1AG0A

Structure of cys 112 asp azurin from pseudomonas aeruginosa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the Active-Site Cysteine of Pseudomonas Aeruginosa Azurin. Crystal Structure Analysis of the Cu(II) Cys112Asp Protein
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 27
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ag0A00
3CDZA 3L45A 4G72B 4GP8B 3OQRA 4BDVB 4F7KA 2PP9A 1NZRA 2DWTA 2AANA 3TA4D 2BO0A 2ZXWB 1NIFA 1IBZA 1AQ8A 4GYBA 3WNJA 1X9RA 2LLNA 3DKHA 3BQVA 1KBVA 1KGYE 3AG1B 2CALA 2EIKB 3UAAA 4E9QA 1SF3A 3GDCA 2FT8A 3DTUB 3NJGA 3ABLB 2DWSA 1XMEB 3EHBB 3FU9A 3IE9A 1L9TA 9PCYA 2CCWA 2XVBA 1PLCA 2XLLA 4GP4B 2H5UA 4BXVA 2XX1A 5PAZA 5I6KA 3T6ZA 1WA2X 1AG6A 2UX6A 2QPEB 4A67A 3QJTB 2DV6A 2EIMB 3G5WA 1YLBB 1GR7A 2CAKA 1ILSA 1AZUA 5B7MA 5TK2A 2VMJA 3ABGA 3TU6A 3ZBMA 4KNSA 2QDVA 2Q5BA 1OE3A 3NJNA 3FQYA 3ZIYA 1A4AA 1MDAA 3IEAA 5I6NA 3ASOB 4P5SA 2J55A 1CUOA 4A66A 4HCIA 4A2FA 4FAAB 1BYPA 3WKPA 2A3TA 4GP5B 4AKOA 2XV0A 1ET8A 6PCYA 1JXGA 1JZHA 2BZCA 4M4RB 2XYBA 4E9YA 3NJIA 4NERA 5AZUA 5AKRA 2XU9A 3NJKA 3AG3B 4AX3A 2GIMA 2PPDA 4CSZA 5B1KA 4Q89A 1IUZA 3PAVA 4GY4A 4DP2X 5B3SB 4YVNA 2IDUA 2DY2A 5IY5B 4HCFA 2HRHA 4YSRA 4BXSV 2FT6A 5PCYA 2UXTA 4K9JA 1RZPA 4YSSA 4M3HA 1PZAA 4YSOA 1JVOA 8PAZA 5A7EA 1NWOA 4DP8X 4F2FA 3NJJA 3FT0A 1F56A 1E65A 1NIBA 3ABKB 3H4FA 3X2QB 3H56A 1AZBA 2I85A 4N8UA 1WS7A 2IDFA 4KO5A 3CG8A 2HX9A 2BZ7A 2OV0A 5D4HA 4DP9X 3CZUB 2YXWA 3BVDB 2YAMA 1V55B 4PCYA 1BEXA 1R1CA 3NP3A 1I53A 3X1FA 2P80A 2W8CA 5B1AB 1BQKA 3S3CB 4CSPA 2VN3A 1ZDSA 3SBRA 4GXFA 5I6LA 2GSMB 3T6XA 4KO7A 1NPJA 2HLEB 4A2EA 1PY0A 1J9RA 1BYOA 3OD3A 1JZIA 1OCZB 5B7EA 1RKRA 3MX0B 2VW6A 1N68A 2IWFA 3TASA 1NPNA 2EILB 4KO9A 3PXLA 2B08A 2JKWA 2HRGA 2GI0A 1L9PA 1ADWA 1CYWA 3FQ1A 1ZDQA 4HHWA 3PAUA 2W88A 3AG4B 4X4KA 3H4HA 1A4BA 4UANA 4DP0X 2IDSA 2HX8A 1BXAA 2WO2B 2AZAA 4G7QB 4W1TA 1AG0A 3NSCA 1JOIA 1W6LA 1OV8A 4AI7A 2MRYA 5I5IA 1J9SA 1M9WA 3QJSB 3QJVB 4RH4A 5ANHA 3FPYA 4DP1X 2PCFA 2BWIA 1L9QA 2FT7A 1GS6X 2XX0A 3IBOA 1HAWA 1NINA 3MBWB 4G71B 3FSWA 5F7AA 3NSDA 3IN0A 4BWUA 1IC0A 5EHFA 1OF0A 1E67A 2EINB 4HALA 1L9OA 2Y1AA 1BAWA 4AKQA 3S3DB 2IWKA 3WIAA 1JZEA 1GS8A 3FSVA 1PZBA 1JERA 2PPEA 4YL4A 2HXAA 2FQFA 1FWXA 2XXGA 1JZFA 3OM3B 1V10A 5D4IA 1T5KA 2I7OA 2XXFA 1NIAA 1ZPUA 2NRDA 4PAZA 3U25A 4WTQA 2CJ3A 1PLAA 1PZCA 3ABMB 1PLBA 2GB2A 4A68A 2R7EA 3CVCA 3AZUA 2TSAA 5F7BA 2IH8A 3N2JA 5B1BB 5I5JA 2BWDA 7PCYA 3FS9A 1CYXA 4YVUA 1AZCA 5I6PA 3WNIA 1QLEB 2UXGA 2PPFA 2MTAA 4TXVB 3FYEB 4JKNA 4JHVA 4YSAA 3SBQA 2YAHA 4AZUA 4DPBX 3SQRA 4EF3A 2GBAA 2VW7A 1OE2A 3V9EA 1V54B 3NT0A 1GSKA 3C75A 4N4YB 1J5CA 4YSDA 3OMIB 1ETJA 4E9XA 1NICA 2FTAA 3OMNB 1RZQA 1SJMA 2AFNA 1MZZA 1OOWA 2H47C 3RYMA 2BP8B 2BW5A 1AZRA 3T6VA 4YSQA 1NIEA 1QNIA 2XUWA 3NJHA 2FQDA 1WS8A 2QPDB 3FSAA 4G7SB 3S8GB 3QPKA 3FU7B 1PMYA 2VW4A 3HB3B 1PNDA 2WSDA 3V9CA 3CVDA 2XV3A 4FA7B 2J56A 1ZV2A 4AKPA 6PAZA 1J9TA 3UADA 3S3BB 1TEFA 3KW7A 4DP4X 1JXDA 3IN2A 3UACA 1AIZA 1FFTB 1KCWA 1AANA 4DPAX 1XB6A 2YAEA 1KYAA 4BWTA 4DPCX 3PLYA 3X1BA 3ZDWA 4E9TA 1AZNA 2N0MA 4YSCA 2IDTA 1MG3C 4YSUA 1OCRB 2VSMB 4WKXA 2XV2A 3FQ2A 4UAHA 2I7SA 4QKTA 2EIJB 3JTBA 1MZYA 3D12B 3OMAB 4KNTA 1SFDA 2FQEA 2HZHA 1NWPA 2X87A 1SHWA 2JXMA 3HEIB 1HFUA 1A3ZA 3AW5A 2CBPA 4KOBA 2FQGA 3PPSA 2BW4A 4HCGA 1BXVA 1EHKB 1ZIAA 2AZUA 2B3IA 3QJQB 1CURA 1GY1A 2XWZA 4E9WA 1E30A 5I28A 1L9SA 4HIPA 1KDJA 2J5WA 1EZLA 3NP4A 1JZJA 1PAZA 1SNRA 1KDIA 3AG2B 1L9RA 3FYIB 1NIDA 2UXFA 4BDVA 4YSEA 5LDUA 2H3XC 3ZX1A 4F2EA 4DP6X 3TBBA 1JVLA 2FJSA 1GS7A 1RCYA 7PAZA 3FPXA 2ZWNA 4ENZA 1ZIBA 2GHZA 2PPCA 1OCCB 2UX7A 2PP8A 4L0PB 3FU8A 4UF7C 1W6WA 5I6MA 1CC3A 2Y69B 2FNWA 1J9QA 4MFHA 2DYSB 5B1JA 4HZ1A 1SDDA 2BP0A 4A2HA 1AR1B 1HAUA 3EH4B 2YXVA 3NJMA 1IBYA 1OCOB 1PNCA 3ERXA 4G70B 2GC4C 1DYZA 1OE1A 2E86A 2QDWA 1ASQA 1NTDA 1QHQA 2OJ1A 2HX7A 3TBCA 4BK5C 1AS6A 4E9VA 4A2DA 1E5ZA 4QLWA 2YAQA 3PAZA 4BWWA 2ZONA 1VLXA 1WA0X 1WAEA 3CVBA 3FSZA 2IAAC 4Q8BA 1SHXA 2RACA 3DIVA 2X88A 2VSKB 3QJRB 4G7RB 3UABA 2WO3B 1IKOP 1ET7A 2IWEA 4KO6A 1N70A 2UXVA 4KOCA 2YARA 1JXFA 1X9UA 1TEGA 3NYKA 3T9WA 3CDZB 2IDQA 1A4CA 2DYRB 3T71A 3WG7B 2YAFA 3AY2A 4NAJA 1B3IA 1ID2A 1BQRA 1A8ZA 4JHUA 3X1NA 4YSTA 2J57A 5D4JA 3T6WA 1KCBA 1ASPA 2QT6A 2TSBA 1GYCA 2CUAA 2VM4A 3NJLA 2PPAA 1AS8A 5I26A 3X1GA 1PF3A 3S8FB 3FU7A 2Q9OA 3UGEA 4DP7X 1PCSA 1SFHA 3NJFA 3SBPA 1DZ0A 1ET5A 5I6OA 3EH3B 5FC9A 2VM3A 2JFCA 3NSFA 1BQ5A 1GW0A 2PCYA 1ILUA 1XB3A 3EH5B 1BXUA 2YAPA 4HAKA 5AFAA 3NSYA 4YSPA 1UATA 1A65A 4ZK8A 1TU2A 1URIA 2FWLB 5B1JC 1AOZA 3WKQA 3ASNB 3KW8A 1GY2A 4KNUA 3X1EA 5I5MA 1ASOA 1JZGA 1AACA 3QQXA 4P5RA 3GYRA 5TK4A 4E9RA 1M57B 1AS7A 3JT2A 1AAJA 3EF4A 2R7EB 2ZOOA 4NB7A 1E5YA 2PLTA 4W9ZA 1M56B 1WA1X 5E9NA 2P80D 2BP0B 3PCYA 2IH9A 1W8EA 1J5DA 2YQBA 3WI9A 2GC7C 2AVFA 1MG2C 3QJUB 4HHGA 1KBWA 4E9SA 5B7FA 1TKWA 3GXUB 2PP7A 2BP8A 1XB8A 3N55A 2YAOA 2OCCB 4DP5X 1FA4A 4A2GA 1KV7A 3UAEA 1SDDB 2BHFA 1SF5A 1NDTA
chains in the Genus database with same CATH superfamily
3CDZA 4B53A 1AHWA 1CI5A 3ZDYE 5HHOB 3IAPA 4FMFA 4LDLB 4H8WC 2MCPL 5GGSY 1R33A 5TQ0H 1NOAA 2ZXWB 4XP6H 5KVEL 5EOCH 1H6FA 2LLNA 5I8OH 1KIPA 2YMXL 1YNLL 2BSBA 3B7TA 1N5AA 3H8NA 3QWNA 4QDGA 2ED6A 5DJAA 5MENB 1KTJA 3DXAB 2HFGL 2CR6A 5KBPA 3DHJA 1TFHA 3MGTA 3PY9A 2P5WB 4LLAA 3TV3L 1UB6A 2JV6A 3HE6D 4PRNB 5F6HI 4M3JA 1TJIL 2VZUA 4PG9A 4JG0H 1EZVY 2YWYA 4JFHD 2JI3A 1PW3A 1KB3A 1PLCA 2R1YA 5TTRA 5C9JB 2X0WA 2QLVB 1RUAL 4IKNA 3MLWL 4N0CD 1G9ML 3HJ0A 1MAJA 2ZCLH 4PB9L 3ZDZE 2Q7YA 4PJDA 4X0KA 4NKMA 4ACPA 1L3NA 2DV6A 3MRJA 5D72L 2FWSA 3BAXA 1SJHB 4TKWA 4CN6A 1ILSA 1PZSA 3ZE2F 3VXSA 3QIBC 1KPUB 3VI4F 2Y7NA 3VGDA 3ATEA 4JBSA 2J25A 3NJNA 1UZ6F 3HZKA 4P2QD 4ZFOA 1KUMA 3WD5H 4N6RB 2GSGB 4KTYA 2HA1A 3F7RA 4C56E 3VD5A 1P1ZA 5LBSH 3DJ9A 5LBSA 1BYPA 3FQTA 4FZ8L 1J5HA 4DK5A 5AAPA 5DD6B 4B27A 4J3VA 1T66D 5AZ2H 4U0RB 4MA3A 1X6NA 2PWGA 2XYBA 5E2WH 2QQQA 4QOKD 4FFYA 1DJSA 1SBSH 1OAZL 1MCPH 4RFEA 1NC4D 5AW1B 1YUHB 2OZ4H 3W57A 4QPEA 4Q89A 3BSZH 2P5PA 2VDOL 4S1RH 5H8DA 2YWZA 5FO9B 1GAFH 1E5BA 4S2SB 4AW4A 4DO5A 3I85A 2B0SH 4XZUB 1HEZA 4U1KA 1B4JH 2AJVH 2JJSA 4P57A 5LNGA 1I7TA 4PJBB 1INDH 3UEZA 4ZMZA 3PL6A 2CQVA 4MZ3A 1W0VB 2EVGA 2BC4B 3QR0A 2DM3A 2BHUA 3L54A 3C8HA 2I85A 3BUDA 5LCVH 3KPPA 1WYJA 1B0GA 1D5XA 4JZNA 1C12B 4M6OH 5DZNA 1QFWL 5FA3A 1XL4A 1WWBX 3QJOA 5DI8A 4OCXL 3G5VB 1UH3A 3ETTA 5E51A 3D85A 4FP8H 2P24B 4FEMA 3FULA 3TN0C 3SGDI 3G5VA 5J6GB 4UYQA 5EU6E 1ZLDA 4F1SA 4HWBA 2GPZA 3VRIA 1BQKA 4N2AA 4KTEH 1N0LA 1UM6H 4WFHD 1JNJA 3ARVA 5DLML 2BNRB 4EZKA 5EO0A 1O6SA 1U3HA 2JF1A 4R8WH 5ANMA 4NGHH 2H6OA 3QUYD 4G42B 3NCFB 2J4WL 4ES8A 1KBGL 2QQLH 1X5JA 4QY8A 4NSKB 3UL4A 3W9DA 2W9DL 3MOBL 1IB5A 1FNGB 3IDXH 2J1ZA 1CZ8H 3SDCA 5EC2A 1HJCA 4GT7A 3ARFC 2JKWA 4Y19B 5T1MA 4EQ2A 4N2GA 1TVDA 5E6IB 3S5LB 1ZDQA 4FA8A 1XCXA 3FRUA 1JRHI 1HZHL 3RKPA 2RCSL 3JYBA 3SGEH 5L6YL 3PWJB 1U8HA 3O6ML 3QG7L 4UBDC 5D6CB 1A8JH 3NDZE 3PPEA 1JYVA 4MA3B 2XC8A 5AVYB 1AG0A 2KPWA 1NAMH 4NOBA 4P2OB 3UTQB 1E2VA 3UBXA 4TV3A 4CN4A 4E41B 3HB3D 3UBFA 4JFWA 1YEFH 4PUBL 1TJXA 1JF5A 4OZGE 5DR5L 1ZHNA 5EEVA 4X98A 4KRPD 1H15A 1U3ZA 4GPVA 4Q6IC 2CXGA 4ACTA 1UWEH 1AQKL 2EINB 3W11C 3CUPA 2Y0SA 4G6AC 1PG7L 1A4JA 3L7FA 3GJFA 5GGVY 2LV4A 5KZCD 4JW3A 5HHOD 5I15L 5GSVA 1XEUA 4PD4K 5I75C 1A64A 4OT1L 4YHLH 3DHPA 3WJJA 2DF3A 4WWOA 2FQFA 2AITA 2JB5H 1MAKA 1HOCB 3UZEA 2PUQT 5D1XC 5F9JA 3VGHA 1CVSC 2E5EA 4RA3A 4N68A 4NN7C 1IIKA 3QI9B 4BSWA 5IFJA 2WANA 1Z9NA 1KWGA 2XPGA 3CFJA 1E2WA 3Q44A 2NW2B 2QTEA 1EGJH 4HWUA 4Y4FC 1YYCA 2BVPB 4LHJB 5JIKA 1HYRC 2G75A 5SWZD 1YEHL 1P9MC 2TRHA 3QC5X 1THAA 4U1HA 4WNQB 4WUUA 1F90H 1W72H 4F7EB 1C08A 3BAWA 5HHXH 1MCKA 1A66A 3VWKD 4AUJA 5C0DA 3QUHA 3RFZB 5AQ0A 5T3ZD 3GGWB 4DUXA 4XPBH 4Z7WA 3M6DA 4PSRA 1Q72H 2FX7L 1S7TA 2GBAA 1OE2A 4ZFFB 2R56H 4W9KC 1EEYB 4E9XA 1IBGH 3OMNB 3PABB 3QFGA 3T3PF 1ZHKB 3ULVD 25C8L 4YXKH 3U0TA 1UG9A 5DC2A 3LIZL 2EYTB 3OHMB 4JM2D 1I3RA 4EXKA 2Q3XA 2DYPB 1MHCA 3HB3C 1BSIA 4W4OC 1SPDA 3OKEA 4HD9A 4MD5A 4S1SL 4Z7OB 5JOPD 3IFPA 4FTVD 4JN2B 2FX7H 4HUUA 2ZG3A 4NENB 2ARJB 1JHLH 2GBTA 1P6AB 2JE8A 3MUGA 3C09C 2IBGA 3PWUB 4LSPL 1JYXA 3RTQC 4OZ4A 5BO1L 4NRZB 3RVXC 1ZT1A 3PP3H 1JNHA 1S9WA 5AYUL 5JQHC 1TLKA 3RY6A 2CKBB 4HJTA 3WAKA 4QD2E 1DP0A 4W9HC 1KV3A 3GSRB 3FTVA 1PVHA 4YSUA 3QCUH 1J87A 3UJJL 2UZYB 4QHNB 5FB8B 5I0DA 1Q38A 2J6EH 1IGJB 3KL5A 3L3IA 4MNHB 3H6AA 3OMAB 3QO1B 4JFXA 1AY1L 1UCBL 3MPCA 4R4ND 2FQEA 3AREB 1SHWA 1T80A 3MNWB 5IG7B 4AEIL 1CICC 4NFCA 2D8KA 1ZE3C 3NAAH 1CCZA 1N2RA 4XPAH 1ROCA 1JK8A 5FYLD 2BW4A 4LSQL 1VRSA 2VN4A 1NGPH 3V8OA 1HILB 1YMMB 3CFNA 1JXKA 1UKTA 4XTRD 4AVJA 2IANA 5A2BA 2X28A 1J0ZA 1CE6A 3WJMB 2OMZA 2FBRA 3VD1A 3U6RB 1JZJA 5LHDA 2FHBA 4FULA 5IT2H 1A1NB 4KKNA 5HYSB 3F7VB 1IE5A 4QXUH 1BIIB 1MCWW 3BPOB 3DRQB 3VWKB 4HK3J 5E5UB 5IMOB 6FABL 3IAQA 3KPLB 3TBBA 3PWLB 4L9LA 2FJSA 1Z32X 1I9EA 1TMCB 3GINA 2GY7B 3MXVH 5IBLC 3ZHKA 1FZOB 3TNNA 2PPCA 5G4NA 4LCCB 3I75A 3VU2A 4ZXBB 4GSDH 4K5LA 2VKXA 5ID1B 1PQZA 1NDGA 1MI5D 1G0XA 2X6CA 4J27A 1CFQA 5KVFL 3QPQD 2HYMA 1L0YA 1UWGH 3MO1B 4K8RH 3ZMRA 2GY5A 4RQQB 3CFTA 2R2BB 5KSUA 2XG5A 3QWOA 2W81C 5DJ8A 1I8MB 1OCOB 4G70B 4Z6AT 2YPKB 3RNQA 1JTTA 4KHXL 1NTDA 3LIZH 5FWQA 4DK3A 4W6YB 4M1CD 1WGOA 2LVCA 2ZCZA 3FB8B 4A2DA 4OCMC 2JB5L 2X4RA 3DVFA 2E0PA 4NRXB 2WBJA 3PAZA 4ZBJA 5FM5M 3PL6C 4M1DL 3E9UA 1Q9LB 1BVKB 2NNXA 1K6QH 5KSVB 5I19H 3AMLA 4U7KA 4FQLH 5A16A 3L6FB 2IPKA 5E7BA 3VM5A 1WFNA 2EZ0C 3T8XB 2J2ZA 3KPSB 2R9HC 4ODBD 4KROC 3GD1C 3VCLB 4A7TA 3DIVA 1LNUB 4UINH 4R90L 2Z1KA 4FZEL 4EIGB 4PJ5B 5DMJB 4JANB 2ALWA 1T83A 2YUXA 3FT2A 3KVPA 4LPUA 2WLLB 3UX9B 5D7JA 4KUCD 2VOTA 1G6RA 3BUPA 1TMQA 4KXCA 5IWLC 2K7QA 4JPKH 1J8HE 1BVNT 2X3BA 2ZT9C 4LLYA 5K93A 1XXDC 3MV01 4PN6A 5FUCE 3X12B 5EG6C 2ICWA 4LMQI 1A47A 4NJAH 5EBLB 2MNUA 1T2JA 3VXUD 3CN1A 3X13B 4FABH 3VQ1C 2WWMD 3NJFA 2QPUA 3DXAD 4KHTL 4P23B 4PD4J 2B1HH 4OD2B 4X80L 4UM9D 5F70A 2AXGA 2EDWA 3FT1A 2XTJD 3QNZB 1MIEL 1MRDL 1N59B 2A6DA 5CJOL 1FNSL 1M2VA 1MWAH 3A21A 1AD0A 4HS8L 2A9CA 3CFKB 1ES0B 3IDGB 4P2AA 2DBJA 2OYLA 1J9CT 4JJOA 5ESVB 2K1MA 2RAMA 3TO2A 5F2FA 5CLYA 2EUVA 2ZP8A 3BZDA 3SDDB 4G9FE 3NQIA 3QZLA 1E5CA 3TEWA 4Z7UB 2A6JA 1FV1A 4JQIL 1JPST 4U1NB 3EF4A 4DOHE 3P4NA 1WBYA 5KG9A 3JBG7 2X1QA 3GWJA 2WO4A 5JHDD 3GK8L 1N3NB 2XXMB 4QCIA 1A6UH 4R0LB 3WI9A 4L18A 2GC7C 4UV7H 4GW4A 3CPUA 1D3CA 4M8UA 5CEYB 4XVOA 1U8LB 4XNUH 3WUWB 2VIRA 3ZYOA 1B2WH 1YYML 1D2OA 3APMA 3QWOB 2NY5L 1DJYA 3DVIA 5DCCA 1MHEB 4OLUL 5AYQA 1FA4A 3C08H 4BJLA 3QAQA 1SF5A 4DZBA 2PTTB 3TT3H 1NDTA 5IB1B 4R7NA 3L45A 5EO9B 5I1EL 1X9QA 3WY4A 1XSIA 1DVZA 2YD3A 3HN5A 4S1RL 4L8SB 2R8SH 4ZXBA 5LBVA 5EU7C 5HD8D 3IWUA 4I1NB 3VFPA 1CXKA 2YZ1A 4ZJ9A 4FI8A 2YUWA 5AG9A 3N43F 5K9QI 2WWMC 4X4YB 2FR4A 2F1BA 4IU2B 3M7OA 3JV4A 2DWSA 1B90A 1LQSR 4H20H 5D2LA 1DVFD 4B5ZA 5I75B 3FW6A 4KTDL 1L9TA 3IPEA 1IAKB 3H9HA 5E4AA 2ZOWA 1I4FA 3U6RA 4OGXH 5K9KA 3UYPB 1FG2B 1FL3B 2JCCB 1YSOA 2XX1A 3F84A 2IANB 4BKLA 4K4KA 2AABH 3BVXA 3VXMA 4EN3C 5KANG 3FL7A 3UTSE 2P47B 2A99A 1QSEE 4XVTL 4MAYD 3WN5A 2OR9L 4D3CL 1PAMA 3FJTA 3WFHB 1MFNA 2IO5A 4PP2A 1UM5H 4XP9L 4WJ5B 4GBXB 4RAVA 4LVNB 3N1FC 5IQ9B 4D0DB 3ZBMA 3GIVA 3FO1A 2I24N 3NCJL 1KB5H 4JFXB 4ODTH 3KLSA 2G9KA 4IYKA 4XNZC 3FTXA 2BK8A 3HMWH 3VXME 2HH0H 3GMPA 3BPNB 5J6SA 1P4IH 1VFBA 1AQDB 3IF1A 3RTQB 3W56A 5JIIA 1DJIA 2GI7A 4M5YH 6PCYA 4ODXA 3TEUA 1JZHA 2MWCA 4YDLC 4ANXA 5IB3B 1D5IH 3SKOA 3JWNE 5DFWH 1P4BH 5FCUH 3M7FB 5JLZA 5ICXB 2P52A 3G5XB 1SJEA 2WUBH 5DHVA 3WSQL 3F85A 1YPZA 4QYAA 5KYWB 3J7HA 4Z7UF 4U6VL 1RSFA 3HI6H 1NGXA 3JWOC 4FG6C 4KRPC 1ZA6B 2WTPA 4R2GC 3VSQA 4ONFH 2P44B 3TWYA 2XWDA 4MCMA 4LHUA 5CUSL 5T5FA 5CWSA 3O0LA 3OKEB 3CLFL 3BOVA 4K9JA 1ZSHA 4OIBA 5D72H 2DYPA 5HVWA 4YSOA 4GRLC 4OLXH 3KCPB 4Y4HA 2DDQL 1QA9A 5EU3B 5KSBB 4AT6B 4E36A 1LWRA 2JQAA 2OP4H 2WP3T 4F2MA 3ECBB 4EI5A 1B2WL 1WZ1L 4WUKL 1QOKA 4HEMA 4R4BA 2F54B 1FYTE 2IDFA 2VSCA 1WD8A 3CG8A 2ED8A 1JYWA 2XSKA 4G5ZL 2ESVB 3CZUB 4R97B 3VFRA 1MCQA 3V6OA 1OZTG 4BV1A 1R1CA 1GL4B 1JUFB 2DQGH 4JQIH 1BWWA 3GRWA 1TCRB 2VXQH 2B16A 4Z78B 3SY6A 1F3JB 2BNRD 4ORGB 1KCRH 4L4VB 1BZQK 4WNQA 4LKXB 4Z77A 1AYRA 5L7XL 4FXKA 4KV5E 2DIEA 1OAZH 3MHZA 3O2VL 4P23D 3GMOA 3WDJA 4PJAB 1F4WH 4BK5A 4YDNA 4JFFD 4P2RE 1IQDB 3MRKB 4KTDH 4X6EB 4J2XA 1HI6A 3ULUL 5A2LH 3ZXAC 2VWEE 4ZMYA 4KH9A 3H0TA 3WGUB 2XRAH 3IJYB 3V4VL 2GJ6B 3T4AB 4IBVA 2DJUA 4Y5YA 3OLEA 2NMSA 3HZVB 3RVTD 4N0FA 5F72S 4HDIB 1ADWA 3EFOB 4XXWC 3RDTB 1OWRM 4ETQB 1FH2A 2VWEC 2ZOKA 2JSFA 2QSCL 2VR8A 5F1OB 5L2KA 2Q76B 5G55A 1EZVX 3QEUA 3BUYA 4FHJA 4DKAA 1WCBA 5I1EH 3C6EA 1TQTA 4KZDH 5KOMC 4RWYH 4Y9FA 5DMIL 3FAWA 5DRZB 3C8KB 3UTQA 1BFTA 2CRZA 4QRAA 1G9MH 4BE6A 2N7BA 4H8HA 3B9KA 5JORA 3HE6C 5L88L 3VXRB 3DGGA 2ZOLB 5KSAA 2ED9A 4I18A 4Z3FA 3KLAB 1FHGA 5HDOA 1FIGH 5KOVC 1QPXA 2QGBA 4FHBD 1JRHH 5GS2D 4PB0L 5AYUH 4AKQA 7FABL 5MI0C 2PYEA 4Z76A 4PG2C 4PM1A 4R4NC 5FYKE 5I73C 1JZEA 2VQ4A 2ZWLT 1L6PA 1UEMA 1XVSA 4N2CA 4XN5A 3CSYB 3VXSD 5IHBA 2O6EA 5LKNA 1PJ9A 3WNPA 1YYLH 1H6TA 1FWXA 3HLAB 4YBLC 3ZO9A 4WI2A 3LEVH 1FNGA 1X7TA 2WLJA 3CVIL 1C5BL 3FN9A 2VQUA 4W9JC 2BY2A 1SN2A 5GGTL 4QYOA 2NXYC 2Y5TB 4QT5B 1XX9C 4HUCA 4WWKC 4CN1A 3K7UA 1OAUL 2CKNA 2UY6A 3KXFE 5GHWH 2ZKHL 4FXGC 3OV6A 4LF3B 5TDPA 1OHZA 4EUPH 4G8EB 3CVCA 2YK1H 3ARSA 4RMWA 4AEEA 5J6GA 4MS8C 5B1BB 3VFSB 1QZNA 1CYXA 1T66C 3JWNC 3WNIA 4TOYH 3P4OB 4G6KH 4UT9H 3MLVH 2XFXB 4AQ8C 2JNZA 3B7YA 4HV8A 1HL4A 5IBLD 1U2YA 4DPBX 1QYGH 5LGJB 5DFVC 2P5WD 1GSKA 1MQKL 2ZXQA 2GJRA 2BSSB 3NQKA 3W5MA 2Z4QB 4JQIA 4O9HL 1NICA 3RGHA 3MA9L 3QDMD 4F7TA 4N2DA 1CK0L 4PRAB 2BP8B 4L4VD 3DX6A 5FGCE 4XNQB 2XUWA 1GA2A 1HEZB 4JRFA 3W0WA 3FSAA 1CFNA 1MY7A 2NDFA 3TCLA 2BHYA 5AUMB 2E74C 2YEZA 5FK9B 3V9CA 3JTSA 2LLGA 1KG0B 2FK9A 3K0YA 3UC2A 2JTDA 2WN2A 3LNDA 2NR6D 4N5EC 5IMLA 5IB5A 3IKKA 2YS4A 3SN6N 4P5TC 3CVHB 3LKNA 1IBHA 1NMAL 3KWVA 1CG9B 3QNYB 3OPZL 2VDQB 3HMXA 3WDIA 4ECNA 3OB8A 4K23L 3ZZSA 1R0AH 1ZA3B 5TF0A 1MXGA 4K5NA 1VZGA 3FQTB 1MG3C 3VDBA 5C0RL 5C92A 4MCZA 1JMZA 4NO5A 3UZEC 1E9OA 2CJUL 5F7EH 4AIZB 4P4KA 2WXGA 1JPSL 2FBOJ 3HZKB 4ZFOB 4YPJA 1E43A 5JPNB 3O45B 4L0ZA 1DDHA 2A6KA 3V5DB 4MJ5A 2VQ1B 4JM4H 2VERN 3H9SE 4OZFA 4JHZA 1HFUA 2X9YA 4FERA 3D33A 2IOMA 3VXSB 1DJZA 2LAAA 1YN7B 2ESVD 5J12B 4X0KB 1EHKB 1LVEA 1W9XA 1ZIAA 3KVDD 3O6FA 3UAJD 5JW3H 2KDGA 4O2CA 4HIPA 2OXGA 2AKRA 5T33H 3EGSB 1SXAA 4H8WL 3L3GA 1EA9C 4G80B 5H35A 3EDDA 3QFJE 3TCTA 1TJMA 5BMFL 3QEQE 2G60H 3VSUA 1NIDA 2ZKHH 4L3CB 2OA9A 1UB6B 4IS6B 2EDDA 4PV9B 4X5WB 4OR1A 5CZXC 4M93C 1T21B 2HLFD 3QDGB 3JQOB 3PGFH 1GS7A 4JHWH 3H85A 2YRPA 4JZJB 1RCYA 1E90A 2ZWNA 1T0NB 5JHAA 2Y9RT 4BCYA 4ENZA 4JFOA 4FG0A 3UZVB 5F6IB 3RAJH 1HE7A 1TVHB 4PJIB 5E7FA 3MN8A 4Y2OA 5HHXL 5E56A 4MXQD 2DWEB 1OVZA 4NC0B 5BZDB 1YAIA 2JVUA 3F65A 4HC1A 4UB0L 3ZR6A 1FI8C 1FL6B 3IFOA 2NX5D 3S3SA 4ZYKB 4CVUA 3IFNH 4NQTA 1K9TA 5LB1A 2XNAA 3MBEA 4HMDA 4YX2L 1XHHA 4FQJL 32C2A 4FQIH 3P30H 3PWPE 2CLZB 3FT9A 4E5XA 3RX8A 1KJ2A 1LXMA 1ZV9A 2DDQH 5E6IC 3VXOB 4OF8A 5J56B 3GBNL 3OXRB 3F8UB 4OF3A 1LO0H 4HGWB 4HJ0C 1K5NA 4MQ7A 4AV5A 3G6AA 2ZUYA 4XMUA 1BMWA 1WBXB 4LSQH 3T8MA 4JX0A 1OZUA 1LEGA 3CVBA 1U8CB 3E2HB 3ETBF 1HDMA 1U58B 5HYJE 1FZMA 2YGQA 5IR1A 3VMOA 5JMRA 4MKMA 3VH8A 2VDPH 2YA2A 3JVFC 3V0IA 1ZWIB 1ET7A 2OMYA 2Z31B 3OKKB 2ENYA 4DN3L 5E2VH 3V0EA 3GI8L 4MHHG 4N22A 2R0LH 4PJHE 2NY4D 1A4CA 4E5XB 5HYIA 2ZKMX 1P7QB 4NAJA 4U2ZA 1IGYB 4LKCB 3V8CA 3L5XH 3PNWB 1KPVB 2W91A 3MRRA 1J8HD 1AVAA 4V2CB 3QUML 1DQLL 4XBPA 3TS8A 5I0XA 4ODTL 3RL1B 1FNFA 3FU7A 3V4PH 1URLA 2C1PB 4G6FB 4MCYB 4XI5C 2ITDA 2IGTA 1PCSA 2QV2A 4GQ9L 1D5MA 1H3GA 1JCKA 2IAMD 3SBPA 1WC7A 3IDNA 4LVEA 4G9FA 3RE0A 2AI0H 3FQWB 3V10A 5HPMB 1CT8B 4PLKD 5KYXB 3MGAA 1NM4A 3F04A 5IOKA 4MXQC 4WU7B 1ZT7A 2J44A 3FH5A 1IEBB 3EH5B 1BXUA 1UWXK 4WSGA 1KIRA 5L9DH 5J1TC 2P49B 3KWWA 1YMHB 4ZK8A 4ATTA 2P3YA 1EAOA 4J4PC 5SWQA 1ZVNA 4R26H 4K9EC 5BVJB 2C4FU 1KY6A 3SE6A 4M93B 4H1LA 5ICZA 2D7MA 3LRSA 4P5RA 3V9FA 4OLYH 3E80A 3SQBB 1E0OB 4HIEA 3K5RA 1AAJA 1XSOA 2ZOOA 2WGNB 1PX3A 4W9ZA 1NCDH 2O5YL 5EUOE 4HJ0D 2I07A 4YDVA 3DVGA 2FZ3B 5J9PB 1MCOL 4PP1C 4XN2A 1C8PA 3FRPA 4FG6D 5GPRA 4YC2C 4ISVA 1XGRA 2OMUA 1X5XA 3L1FA 4JRYA 3V5DA 2WLZA 3WIHL 1TTUA 4DGVH 1CDIA 1JCVA 4PJDE 1EXHA 1QR4A 5DYOA 1CL7I 3HNVL 4F92B 3KYKH 4PQXA 4KZDL 3FNKA 3CFMA 1IAMA 2EYSA 1T89A 4WI4A 3CFQA 1U8QB 3ZZQA 3CFIC 2N7SA 4PJ6A 1WG3A 1GAFL 1ZA3A 2LTQB 5SX5H 2NLJA 1XMWA 1A1OB 1I9JL 2JELH 4X7SH 4X6DA 3A0OA 4F8OA 4C83A 1IBZA 2K3TA 3BWZA 3HAEG 1KEGH 5JXEC 1JD9A 2YBGA 3MACL 1OAQH 1UZ8B 4G8GD 5L2JA 3VFUB 1ULVA 2Z9TA 1FNEB 3ROLA 2W60B 3FK3A 3GDCA 3ABLB 4LIQL 5ITBL 3EHBB 2WXPA 4DGYL 3LZFH 2YEZB 1N64L 2A77H 2ZP9A 2VAAA 4TPRL 5H2BB 5EZPA 5C09A 3MRNA 5MEOA 3VAEA 1DBBL 3A6CL 5FLVA 1F4YL 1F1GA 4XO5A 1ZLUH 4W93A 2X89D 4LL9A 3F58L 1NCJA 4UYPA 4OZHE 3G5WA 5DO8A 3S2AA 3X3FH 4UTBL 3UTSD 2XKUA 3NABH 5D7IE 1DVTA 2IBZX 4HKXA 3L08A 4MNQA 3OMZA 4GSQA 2SODB 3TU6A 1QRNB 1QHOA 2DL9A 5E1GA 3RVTC 3ZVVA 1UVQA 1J8HA 3FQYA 4HCRL 3B6SB 3FFDB 3GKZA 4ZOBA 3RA7H 3SDYL 2F7OA 4X9HA 2J1WA 2J88H 3L9RA 4GRWF 2HPTA 4H40A 1OAYL 5C08B 1CUOA 2FJFB 4N3UA 4G6FD 4FAAB 3VFGH 1B6DA 1PZ5B 3UPCA 2HKFL 2IQAA 4KXBA 1U8MA 4AGNA 1CS6A 3ESUF 1S7WA 2PXYD 4GKOA 1SYVB 3EO9L 4HK0B 1ETZB 3KL0A 3ZYZA 3A5VA 4HUXA 4Z95H 1RIHH 4ODHH 4ZPVA 1SXZA 3NZHH 5HHNA 1LK3H 3SJVD 3IVKA 4NQCA 4OBRA 4LSSH 3L3HA 4XP5H 2OYPA 4DP2X 5B3SB 2R2HA 1KC5L 3ZYIA 4O5LH 4Z7VE 4IOFC 2VISB 2P28B 2XQBL 3HRPA 2WZ5A 4JRXE 4YSRA 4ZAKA 3LKSA 5IHUH 1VGKB 3ZL1A 1WAAE 2WK2A 4N5UA 3P1VA 1CGYA 3LHPH 3LMJL 5DRNB 1BGXL 4NFDA 2CLVB 5GZOA 2PYEE 2YPLB 2NTFB 2Z0UA 2ZOLA 5KSAB 3VXRA 2W65A 3CU1A 3ZL4H 3UZQA 1OP4A 3AXLB 3FT0A 4NRYA 2H32H 5E03A 3ABKB 5C0BD 2AQRA 5DUBA 5IESH 3BKCL 2DLTA 5CEZD 3GJFH 3ARQA 3BVDB 2FJHB 1EZSA 4X7TB 1L6ZA 3CJJA 3ZPDA 5IJKC 5SV3A 1I1CA 4JR9L 3LV3B 4PJFA 4F15C 2MHAB 2PCPB 3KPSD 1CU4L 1BW8A 2HG5B 4JY4A 3BW9B 5ERWB 2W8CA 4B9CA 4AM0A 5KYUA 4X4ZA 2X6MA 3LS4H 4PI0A 5LN4A 3MLWH 5CSZB 3K8LA 2ADGA 1NPJA 2YD4A 3V5KA 2XWBB 2YZ8A 2E46A 3IXTA 4F33A 4NT6A 4OJAA 4KK6C 3C2SA 3B34A 4M7LL 4RGMC 1QWNA 3HMXL 1QWUA 2MSPA 3DROB 3UAJA 3OKDB 4KO9A 4Z7VB 3WS6C 1CBVH 4R5XA 2ZSVA 2ZX9A 3PQYA 4PIRF 1CYWA 1G7HA 2MEJB 3RPIA 4HW6A 3H54A 4EI6A 4PWJA 4H1LH 4P99A 2COQA 3B2VH 3W0WE 1IC5H 4HMCA 4XPAL 3V0WH 2HJKB 4DN4L 2ITEA 3OJDA 4NQCE 4F7MB 5GS1A 4W9DC 3QH3A 5DGRA 5EUKA 1G9MC 2MIZA 3VFRB 2K4WA 3S88L 4AJ0A 3L3JB 4DW2L 5FAAA 3ILDA 4OUOA 4RSVA 4H25B 5EU6D 2W0KA 1ADQH 1QBLH 3RI5K 4AYID 4MD4A 1AI1H 1M9WA 4RH4A 5E1IA 4Y1TA 2XX0A 4QHMB 4O2EA 3HRZA 2DM7A 3U4AA 5DUJA 4AQZA 3FQRA 2VDRL 1N26A 4PG2A 2Q87A 4HISA 4NNPH 3OLDA 4G6JL 4PTTA 2OLDA 2N56A 1J05A 1JGEA 1CFSB 1LK2B 3HZ3A 3JVGC 3QXWA 4V2BA 5D96B 5SX5K 2OSLA 3EYVA 2HXAA 2DM4A 3BVWA 3CVHH 4IMKA 5DJ6B 5D4IA 2AQ1A 4F8NA 1YC7A 3OBAA 1FL5A 3R4RA 2G2RB 5LGHH 1UWXH 4R2GB 3MLTA 1PZCA 2V37A 3PWVA 3OR6B 4IDJL 3ABMB 2H9GB 5EOQL 4OCWH 3BAYA 3NIFE 5CKGA 4PBWD 3TT1H 5AOMA 4KFZC 2WYTA 3UJIL 4DO4A 2BY3A 5I73B 1OAXL 1CLOL 4WI3A 5E2VL 3N40F 4JFPA 3FZUD 5EZIL 1A6VH 3GMPB 3QH3B 1SJVA 3VRJA 1KLUB 1J12A 3JWOL 2GJZA 4U6YB 4YIQA 2Y06L 3OJDB 4J8QA 2WXOA 5I6XC 2LOEA 3US1A 1R3HB 5JA9A 3OKLB 4D0DA 1CICA 2J3SA 2XZZA 3S5YA 3FQUA 2J6WA 3VI3A 2HLAB 2UUDH 4N4YB 3PQYB 1IBBA 4U6HB 1DFXA 5L8JB 2PO6B 4RMVA 3BVNB 4PJEA 4Z7VA 5DEGA 4CKVX 3ZN6A 3LSOB 1H8SA 1KB5B 2DMHA 1PG7W 1QPKA 3MA9H 4BKLB 4EN2A 4QXWA 4WV1C 3LS5L 4GQPH 4XNAA 5C08D 2Q86B 3F7LA 5K9KB 4M43H 2D7OA 3DVNA 2DW5A 3SDXE 1X3DA 5C07D 5TE7H 4M8VA 3AADB 2ZKYA 3TONA 3P2TA 5AG8A 4NZRL 2EH8L 5D1XE 2Z8RA 2YN5A 3W39A 4LEXH 3MGOA 1J9TA 2MHAA 1A7OL 3LN4A 5E6ID 4UILL 1XH3B 2ZUWA 1KTLB 1RZKL 3DX3A 3M1OA 3FH7A 4Q6IA 2H26B 3BPOC 3VFPB 2OL3A 5LNDA 3LNHA 4OZGA 3ZIMA 4MJ4A 1ZD6A 2G4EA 1OGAA 4AVHA 3L4UA 3MV9B 3UJIH 1EAPA 2WZ6A 2XKNB 4DPCX 5C0AD 1F6FB 3BEVA 3FUFA 2N0MA 3IJHA 2B7DT 2HJLB 3GO1L 3P2BA 4F7PB 3ZRCC 5CJ8A 3FQ2A 4UAHA 3SE3C 4QKTA 1KTBA 2X42A 5L7XH 1EGJA 5JNYA 4RMSA 2X1OA 3DECA 3CX2A 1TZAA 4NPYA 3SO3B 3DETC 4OI9A 3U4KA 1GOFA 1YG9A 3FONB 1NEZA 5DWUL 1AMYA 1OSZA 1EHNA 2F58L 4LCWB 2OJEA 2GFBB 1UJTA 4PLOB 5MENE 4YBQC 3OJVC 1U21A 1FFNB 4KMLB 3JV6B 4LL4A 3RZCD 1IFHL 1IEAB 4X8JB 4LSRL 5E00A 3N0PB 3AABA 1XR8A 3HG0A 4BINA 2F8IA 4CNIA 1KDIA 1BIHA 4RMRA 3FTSA 3MBXL 2VLJE 3KLDA 2ZG2A 4DW2H 2G2PA 2GT9A 4AYBA 3OB0H 3CFBA 5FA4A 4G9DB 3DOSA 3UBXI 1IBFA 1Y18B 4NP4H 5CGYC 5D6DA 5D1QC 1SUHA 1AD0B 1F6LL 4P06A 4G6AD 5EBMB 1HXMA 4ZUSB 1MAMH 4LLMA 1N4XH 2I60H 3WY1A 1BG9A 2WSPA 3CBRA 1CGSL 2V7HA 3M1BA 2GCYB 5IJVB 2O5ZH 2MPAL 3B6SA 3FFDA 4HKJA 5DJ2B 1OTTC 3VI4E 5DD1L 5EUOF 4HWEH 4EDXA 4WTXA 1JK9B 5I6MA 1MNUH 3EHBC 1W2KT 3GMLB 3NZ8B 4L1SA 5KSAD 2GT9B 4PTUA 4OVVA 3H9SA 1U3NA 3EJJX 4QXGL 3U0WL 3FKUS 1AFVL 1MAML 3R1GL 4HPHA 3MZGB 1ZT4A 3UBXG 4FZ8H 4PFEA 5IHWA 1JHTB 4PJ7E 5JXAL 1XF5B 3WDHA 4EMZA 1JWMB 5MEOB 1B0RA 1S3KH 2B59B 2R2EB 3HCVB 3ARWA 5SWSD 3GSNH 3ZKND 3WTVA 4NZTL 2DTMH 1KTDB 1UA6H 3CVHL 3VYPA 3ATBA 1DUZA 4F8TA 5IROC 5A2IH 1JTOA 4DCQB 1UYWH 5L2JB 4I85A 4PLJD 4PCTA 2J2ZB 4TUJB 4KJYB 4YO0A 2CA4A 4TNWF 1SHXA 5A16B 1TG8A 2ROXA 4J8RA 3MXWL 5IW3A 1OWWA 2Y1VA 1A1OA 5A3ID 3U9WA 2F7PA 3N1MC 5GGVL 4K71B 2Z0BA 3AACA 1MRFH 4ZO8A 3EUUA 1Q94B 4BUGA 2WQAA 5ACLA 1ZGLB 2DYRB 2WGXA 1KCKA 4W6XB 2EXSA 2YPKA 5DFVD 3L13A 3BP7A 2D4FA 1XH3A 2JKSA 4ONGL 5D4JA 1WFJA 2WNXA 5IMMA 4PR5A 1D9KC 1MCHA 3NFNB 2VNCA 4GAYB 2O61B 2HAZA 3IMSA 3UMNA 4YGVB 4Y9CA 1UASA 5L4IA 1CLYH 1ZS8A 2FATH 3CZSA 5E9DA 4OFIA 1NDGB 4BQ9A 2F18A 5CZRA 1CBVL 3HG4A 3RWEB 4L9LC 4RX4A 3VFOB 2D3NA 3N85H 3A67L 3SQBA 4D0CB 1D5IL 4I8DA 3BC9A 2Z64C 1BQ5A 1TJHH 4ZMOA 5I23A 3GZQA 4N2OA 4TUUA 3UGXA 3BT2H 1HOEA 1DSFL 4N5ED 1WZLA 4HC1H 2NY5H 5FHBL 2QHRL 5FXCH 2CA3A 1YY8B 3FUMA 5J12C 1KJMB 4AQAB 2VLMD 3EYFB 3IGAB 2VDLH 3GSWB 4O4YH 8FABA 2N7AA 1NUGA 2FIKA 2RD0A 3D3VD 4WU7A 3QQXA 5JW5A 3WJMA 1X5HA 3H9SD 3PGDB 4XX1G 5HTSA 3JT2A 2TAAA 4U1SB 1ZLVK 3K6SA 2PR9A 2F5BL 3WKNA 4YZFF 2WLHA 4JFPB 3BH9B 3DHMA 1E5YA 5IHZA 1HESA 1WA1X 5C0CB 5ISZE 1T7YA 1LE5A 1L5GB 3P11H 2ADIB 2K70A 1LEIB 1ZE3H 2AABL 2V4LA 3TBVA 5ES4B 5GS0C 1DBBH 3A6CH 4KDTC 2WLNA 2XN0A 3MV8D 4CVZA 4X5LA 1FL5B 1LJMA 3RIKA 2EXWC 2WTRB 4GNKB 1UTDA 3D48R 1GYVA 3WHE0 3RWDA 2W9EH 3EJCA 5E8PB 3UAEA 2BHFA 4IOIB 4DNLA 1NCCL 3ZTNL 4PJGB 4YMPA 2VDML 2D03L 3HFMH 4LGPB 5T3ZL 4CW1B 1JN6B 5BQ7B 1BFVL 3ME0B 4LOVA 1TYJA 3HKZA 1PG7X 3D25A 1D7FA 3DKHA 1U58A 1FG9C 4PY7A 1B0IA 4O2EB 1B88A 3MV11 2CALA 1JV2B 4Q14A 5HYQA 1JAEA 4KQ3H 4JFDE 3OAYH 3DTUB 4H25A 2VLRE 2ARJA 4I0PB 3AJ7A 4OF7A 1FRGH 1Q1PA 1LEKA 5JDJA 1G6RL 1KJ2B 2V2TA 5KAQG 1KGCE 1OK0A 3APCA 2ZCLL 2CLZA 2O72A 2XVBA 4JDZA 4UT7L 2YN3A 2Y07L 4WHYH 3C6SA 1XCQB 5DK0A 3DPDA 1IGTA 1UM6L 4OCYH 1U8PB 2DMKA 4AGLA 4H88L 1FDLL 3OB0K 3E3QC 1OOAA 1UZGA 2JKXA 2E4FA 2RH0A 1G43A 3TN0D 5BZDA 4H0GA 3M88A 5ALBL 5ENWB 1Z0MA 4Q2ZA 4Q9RH 2MNWA 2VMJA 5L0QC 1N0XL 1J0HA 2EC9T 2DQIL 2QDVA 2R39A 3KYOA 4KX7A 1KELL 2H1PH 3P3SA 3WIIH 3FQXB 2NXZD 4JFYB 2NY1B 1CJYA 4MJJA 3TIEA 1JZ4A 3QUYC 4L48A 5I1LB 1HX0A 1DJHA 1K85A 1N7ML 2LR4A 5JOFA 3RPKA 4TSBL 4NKOB 4AENA 4IS6A 4PV9A 2B4CC 1WFTA 4JCLA 2NW2A 4ODVL 4M4RB 3L3GB 5CHNA 4FA6A 2PR4L 2AAVA 4XVJH 4BSWB 2BRRL 1XL6A 5MEPB 2NY4C 2G0LA 3WJJC 2OXHB 1FORH 2WZ0A 5CINL 2VJXA 3IJ7A 2HMIC 1CXFA 4KK8D 4GEJA 5K9OA 3GZPA 4KRNA 4KBPA 4ZMPA 4NQEE 3VWJA 4FG4A 1T1XA 3KPRB 1FC2D 2C9XA 4IGBA 3D3VA 2ERJC 5I17B 2UXTA 2VQ1A 3GI9L 3DMMD 1QR1A 2YPLA 1QACA 3QXDA 4M3HA 2J8UF 5HGBB 5AB0A 8PAZA 5HDBB 5EPMB 4Z8FL 2GSIB 4RZKA 2X7LA 3EGDA 4GRMB 2PCFB 3NJJA 5L8LB 2VC2H 1E9OB 5FGBA 3CZGA 4M5SA 4X50A 4LLWB 2VISA 3BWAA 5D1ZB 5FYLE 2PCXA 5FLUA 4HSAC 2R27A 1KENH 3DUUB 5JW4R 1BX2A 3C8DA 3THMH 3OSVA 3W1ZA 3RIFK 5D2NA 4AH2A 2K6YA 3NN8B 4J3XA 5C6WH 4POUB 4I77L 3VDCA 5IFHL 4J4PD 5LBGA 3TTYA 3ZK0A 2YPVL 3MOAL 1G7IA 1U8MB 4LASL 3RX9A 2VN3A 1T3FB 1A25A 1JXJA 2C34A 3RURA 5FK9A 1HHGA 3HKFA 1QSEA 1N6VA 4N2FA 5GGSA 4QXTA 1WHOA 3QCUL 2WNGA 2Z91A 4FJ6A 1MJ8H 4IOSA 5B7EA 1DVSA 1R3JB 3Q06A 5DVPA 4DSYA 2L4OA 2PKDA 2IAND 4TLTA 3T4YB 4RFNB 3SE4C 1R3IL 4B7LA 1JPEA 1H0DB 3CFDA 5ANMB 5DFTA 1D6VL 5E08L 3IJEB 1N12A 2PF6A 3IJEA 1L9PA 3F83A 2CMRH 4AL8L 1HHJA 4GUQA 3VD0A 5E8OA 2E7BA 5KVEH 3DV4B 3ECQA 4DKDC 1E6JH 5ANME 5J57B 1KIUA 4UANA 5C09B 4J1UB 4X8CA 4UTBH 4IHBA 1FO0L 4UTCA 2VAAB 2VDOB 3CMOL 3NSCA 5E8EB 4B41A 1EJFA 3IK2A 1IVLA 3DV4A 4FLOA 5E8OB 1UUSA 3B7SA 3K4AA 5GZNC 1J9SA 2BNRE 4HJGB 3NIGF 1AGBA 1GIGH 3VXPA 2EC8A 3BCDA 1H0DA 3G6JA 4YHZL 1AQ8A 1FNSH 3PV7A 2R56L 3ZZ1A 4ZS7H 4ALAH 2K6ZA 1JD7A 2JCCE 5EBWA 4BFOA 3DOIA 4D9LH 1ZCRA 1DQJB 4AVKA 2WTOA 3FN3A 4XPBL 3HLAA 4S2SA 1XCWA 1T20A 3QO0B 1R24B 1WITA 1QSEB 1MJ7L 3FQ4A 4DERA 2PPEA 4Z76B 1JWSB 4GRMA 4IK6A 1VZIA 4PHXA 1G9NH 2E4TA 1OP9A 1BFVH 5HGBA 1U6AL 1V7MH 4JRYB 4JM2A 1DO5A 4ESKA 5FKAA 5T5FL 2YEVB 5EF2A 1MF2L 4BE5A 3IB4A 5F6IC 2J7LA 3MBED 2UVFA 5D2NB 4AH2B 5BO0D 2R4RL 3DUSA 4JZOB 2I07B 4WGWB 5DRWB 3M1CA 1Z7JA 4A68A 4XC3H 3BVUA 2TSAA 5MEPA 4YHLL 1WCBB 4RGOL 1AZCA 3P77A 2F7IA 1G7JB 5I1GL 1QSED 5FECA 4HUVB 2K7PA 2E7CA 1F4XH 2HWZL 4EBQH 3WFEH 5HJ3B 3O3EB 1LO3H 2D0HA 4K71C 3KPRA 3ZKMD 3HZVA 3VWJB 2YD8A 1I75A 3HS9A 3L95B 4J4PA 3EHBD 4RGNB 2AFNA 1ONQB 3DX9B 3MRMB 4YDIL 2D0FA 4I0KA 5EZJA 4H7VA 3T0ED 3T2OA 1IQDA 4OJDH 3NJHA 1I3GL 1WS8A 2ITDB 2BNUA 4CKQA 2AEQH 4PJAA 1CDCA 3MRQB 5FOJA 2IQ9L 4DKFL 3ARFB 4KUZH 4PJEE 2ENSA 5CF3A 4KTGA 4KY1L 1C5CL 1KYUA 4FNQA 3FQXA 4HHAB 4ERSL 3NPSC 1PY9A 5H37H 1WIPA 3ZDXE 1AANA 3TIDB 4P48A 4LCIH 4XPFL 5I1CL 1BF5A 3PLYA 2CO2A 1NANH 4A55A 3ZU8A 5I6XB 2W94A 1JNNH 4UQ2A 4OCRL 3KYMB 3UBGA 2VRQA 3I6LE 1A7PL 3WS3A 5GJTH 5LXGL 3U9PL 2C3WA 3KLQA 2FCBA 3IMRA 3KS0J 4M3KB 3MBEC 4Z0BL 3G6AB 1XCQA 1EVUA 4KVNL 1JWUB 3MFFA 5AVQB 3HI5L 4IKJA 5FIEA 2ENJA 4Q9BA 1DBAL 3QRFM 1ODAA 3MCYA 3MXWH 4KK6D 4Z0XB 4CW1A 2EZ0D 2GITB 4A39A 1ZV5A 3SDDD 1BZ7B 1I9IH 1D9KD 1JPGA 2CM5A 4PJGE 5D7LA 3MNZB 2AC0A 1DO6A 3EYSL 4L8BA 2HWZH 5KVGE 1F4HA 3AB0C 1X5IA 3RLSA 2AZUA 4PGDB 2JCCF 2WTRA 2HRPL 1KENL 1Z9OA 2FH8A 3BP5A 4M8QB 1GY1A 3HC3H 3BAJA 4GXUM 3QIWD 5HDBE 5IZ7A 5IKCB 5E08H 1CGVA 5CCKL 1NFDB 2DTML 3E8VA 4JFEA 2R23A 3SKOB 1CBJA 2D4DA 4K73A 5CCJA 2QMJA 4RWYL 5C0BB 5E6UB 1C5DB 2G3NA 2B0SL 3GFUA 3FU5A 4EN3B 1T03H 3K6SB 1I1FB 3KPRD 3KL3A 4ZUTA 2LVEA 3ARUA 4H2CA 2VUKA 1ERNA 3KGTA 5CEZL 2P45B 1CIDA 1AGCB 3FO1B 2C9VA 3WNOA 3FU8A 4XMKH 2W80C 5IQ9A 1CC3A 2VLJA 2FNWA 4YFEA 4WJ5A 1J88A 4HWEL 4FFYL 2R2CA 2VLKE 2X4NB 3CHSA 4ZMLA 4C56D 2HCZX 5DZVA 5I0VA 1RZJH 4GSUA 2Y7QB 2WCPA 3EGSA 2YGPA 2AKRB 1QX1A 4OZGF 3V6FA 2LU4A 4JKKA 3VWJC 4F9PC 2BSEA 3UTPE 4ZTOH 1F4WL 1DYZA 2GC4C 3HBPA 3D08A 4PUBH 5JHDE 1RUML 5K1JA 5AAMC 4RETB 2ZKWA 1I4FB 1ASQA 1BD2A 1MFAL 1T0MA 2HX7A 3P0VH 4AM0Q 4ZX6A 2Y24A 1ECZA 4D0BA 4ZTEA 5B22A 4BWWA 5TPWL 2DS4A 2FSEA 3RUGE 3SKJH 4MJ5B 5IFAH 3Q7JA 1DDHB 4GI9A 3MV8A 1RD6A 2MTPA 2P5EE 3N50A 4DKFH 4WW2B 3QUXA 5KTEH 3MYJB 2VDRH 5TE7L 4JKPH 4JCWA 1BQHG 2XETA 3DWTA 4X6CE 3HE7D 5DZPA 2XBTA 4PRHE 3QFJB 3K8KA 2VL5B 2YARA 5FV2A 1DBKH 1SZNA 1RSYA 4LPVA 3NYKA 2Q6WB 3T9WA 2WWOA 3QIWC 3I9AA 3AY4C 4Z7WF 4P5KB 3QUKB 5DMIH 2EUXA 1OTSD 4PR5B 3KPNB 3KBFA 4JHUA 4RFOH 1LO3L 2G5BB 4GOSA 2F5AH 3QIWA 5DEFA 2BVUA 2AQSA 2J88L 5I26A 1INQB 3GPEA 5CXPA 5C70A 1KMGA 4UOZA 3IBEA 3QQ4A 5IQOA 4WEEA 3OKOA 4NPKA 4OT1H 4P2RD 1A6VL 3HUJA 3S36H 5HHVH 4QRRD 1MFCL 5GS0H 2EH8H 3JWDC 4LQFL 5C8JA 3WKMH 4R7LA 3F58H 1YEEH 1T4WA 1OL0A 4PTUB 3QARA 4NBXB 1FJ1B 2B5IC 3NZ8A 3LDBB 1AOZA 3IDGA 4FTVA 3AQXA 3QCVL 4ZQKB 2P26A 4UT6A 4BH7A 3KNBB 1NAML 4JG5A 4JFQA 1E4KC 1VKXB 4OZHB 1AS7A 4B60A 1ZT4B 4GXUN 4MDIB 1HXMB 4M62H 4WI5A 4ZUSA 2WIMA 4XNBA 1M56B 2P80D 3MACH 4G9DA 2VMCA 4FQCH 4JAMB 1E27A 4JFHE 1KYOK 5GRWA 2EVFA 3DETD 3MLVL 2JKNA 2UY7B 5IJBC 1CPUA 1PX8A 1TEYA 4QTFA 3QEQB 2AK4A 4M48H 3DRTA 4LSTH 3T5WA 4KZEL 2FYYB 3RBGA 5EORL 2PR4H 4EDWH 4OZHA 3HUJF 1VKXA 2GCYA 2OULB 3MLZH 3KYKL 4F7CA 1EFXA 3MU3A 3ZKQD 1IT9H 3I6SA 3KGUA 4LCWA 5SWZA 2V2XA 4P07A 1IM9B 3VSVA 4NGHL 5DURD 1LHZA 4PJHB 1YZZA 3G5ZA 5EN2B 1RLBA 4U0RC 2K9UA 5GXBB 3U1PA 3L5WB 4LZKA 4L29A 5DQDH 4XP1H 1GYAA 4M5ZH 2MOQA 1XR8B 3ZE2E 1FLRH 5C8JB 2YA1A 2NDGA 1ND0B 4X8JA 1TZHB 1FYTA 3B9KB 1KGYE 3EUDA 3UAAA 1SF3A 4MMXC 1PZ2A 3BWUF 1P69B 3BEVB 4M6MH 1PYWA 2FHCA 1IT9L 2XWTB 3LZRA 1XMEB 3QQ4B 4L4TD 2E3VA 3B5HA 4I9WD 4Q97A 3PDGA 3BT0A 1URZA 2ENPA 1F41A 3TTSA 1U9KA 2XI9A 4MMZA 4PRDA 3RNQB 1QW9A 1A7QL 1T5WA 3D4GA 2FWUA 1AYOA 4NO0B 5I0YA 1KTLA 5DJ8B 2BS9A 3T0DA 1EX0A 4HOMA 5JNYB 1ZTMA 5ELIA 3QK0A 5ITFA 2FJGA 3QHTC 3O4LA 2VLRA 5KJ7E 5AD0A 4HDIA 3VFWB 3U7WL 4L05A 1IARB 4X4MA 1NGYB 3HAEB 3QQDB 3QDME 5B7MA 4R7XA 3ZKNC 3IJYA 5BCAA 1OGAB 1QZ1A 1HI6B 3O4OB 3ZIYA 1K4DB 3O9WA 5CILH 3QI9C 3RWCA 4NHCH 4PJ5D 3MKGA 4XOEA 5IOPB 1QG3A 3MRCA 3ILPA 4YHOH 2WKGA 1PDKB 4HF5H 5DRXB 4XOBA 2FLMA 3MJ9H 4XMVA 3UCRA 1GYUA 2J5LB 2IG2L 2YJLA 4GP5B 1DANU 4OGQC 2XZCH 4KKZA 4QNPE 3MLZL 3WNMA 1S7QB 1D9KB 5FYJH 2B1HL 2Q86A 3VNZA 1WTGT 2IAMC 4FE9A 4NHCL 2GTQA 2PPDA 5AWNH 4QRPB 2WAHA 5CINH 1MCLA 2EO7A 1YNTB 2F54A 3GSOB 4FMKA 4ONHB 4S0TD 4S1DC 5E9AA 5B39G 3W11D 2ZNWA 1I82A 3DIFB 4HT1H 4NJ9L 5LDSA 3S8WA 2BSDA 3LB6D 3FHQA 2A9BA 5T3XD 3SPGA 3ECBA 1YDPA 1GXEA 1O9VA 2QPSA 3QHZL 3OKLA 2AQTA 4DAGH 2K3HA 1RJYA 2AJSL 3JUZA 1R3KB 4HLZH 4NO3A 1E4HA 3DTDA 3HE7B 1AE6H 4EOWL 2JB6A 5ABZA 2GUYA 1KCSL 2HKHL 4DUVA 1OO2A 2J21A 4X7EC 3LEYL 2AK1L 4QRRA 1RUQL 2K78A 3WKML 1RK7A 1S9WB 3OR6A 3PWVB 5JQIB 4N86A 2VLLB 5CUSH 3WE1A 2O6CA 4WGKA 1RY7B 4LQ1A 4IRZH 3MLUH 4S11A 4F9LA 4FKKA 2G2RA 3B5TA 4ODXB 4YLQT 3P9LB 4NDMA 3T0WA 5B3JE 5DJ6A 2J8OA 4GIAA 4FNRA 3WXVL 4CSPA 2CH8A 1VFBB 4HAGA 4QHKJ 3LRMA 3SBRA 3W9EB 4JPVL 1PKQB 3AU0A 4HFWB 5C0AA 1KB9K 1CFSA 3SCMB 3BAEL 4P5MA 4ZX5A 1NC4A 3B9KD 3POCA 3TP4A 2GEEA 1TUPA 1WVZA 2VW6A 2ZXEB 5HHOE 2OR7A 1EDHA 4BFIB 1WWCA 4F37F 1R17A 5IBUG 1WTLA 4O58L 3FCTA 4YNYA 4APQA 3T0EC 3P0GB 2EXWD 2ZSVB 4Y4FB 4LT7A 3FT3B 2YXMA 1DN0A 1SDAB 1YNTA 4ONHA 4Y1AD 2FGWH 43C9B 2PMZA 3LH8A 3TIDA 3EH1A 1SVZA 3FT4A 1KN4L 2F58H 2D03H 4LCUA 4UUJA 1IGMH 1G1OA 4S1DD 5I82A 2AZAA 5J1SC 4W1TA 1QO3A 1UOVA 1JOIA 4WO4C 3ARFA 3Q9QA 3EG9A 3OL2A 4PJ7F 1ZLWK 5IEHA 1OP3H 3MRDA 1ZOXA 3MRQA 2DLIA 4IKIA 3RFRA 2VM9A 4QIRA 5DRXA 3DLQR 4KWUA 1L9QA 2BNUB 1GS6X 5GRJL 5IFJB 1NINA 5H94B 3WV0A 3FFCE 4QRPD 3LTVA 3TC9A 2PW1A 2L3BA 2ADJB 5C0EA 3TF7C 3HAEA 4U7MA 4A7UA 5DO2D 3I9GL 4R7NB 4RGOH 4P5TD 5I1GH 5AD0B 4ODUB 2VLRB 4I89A 1CICD 2H32A 1MFEH 1AR1C 2PXYA 1TLMA 3O3EA 1FAIL 4GMSH 5F9OH 2FJGB 4HWBL 2ADFL 3OM3B 4FNUA 4G2AA 5MP6L 3OC5A 3TBSA 4A2LA 2R15A 1GYWA 4QEGA 3US9A 1UADC 5CLWA 1T5WB 1X7SA 2ALAA 2X2HA 2ZKXA 5F88B 3HR6A 2YRLA 5IROD 3MRFA 1UWGL 1Z5LB 2H1XA 2LHAA 2KDYA 1PYWB 3NIDF 3P4NB 3OZLA 1LILA 1NBYA 5FO8B 3O6FD 1CWVA 1T2QH 2JH2A 3N2JA 3GXFA 2IALA 4RAUA 5HHNB 2BWDA 3VG0L 3IVKB 2NPLX 2QADD 5LGKA 4JM2B 4BA8A 3MDJA 3SDDA 2PPFA 1MVUA 3FO9A 3WEBA 1BFOA 3QEGH 1S7WB 3L1GA 3MXVL 3UAJC 3TO2B 1IKFL 1TCMA 2HN7A 3KM2A 4PJHA 4XR8C 3VVWA 3V9EA 3VYOA 1Z3GL 3C75A 1XCTA 2L7JA 4PS4H 2MCG1 3OMIB 3ATAA 4ZX4A 3AB0B 4UNTA 4D7BA 3NIDB 3ARTA 5EC2B 1RZQA 3KBHE 3QB7C 2X40A 5LUMA 1V8HA 2KYIA 2QGCA 4NQCB 1GCYA 3U2IA 5EBWB 3EADA 2EE0A 2BW5A 2HLFC 3ARBA 4U4IA 1QRNA 5DUPH 1EANA 1JNNL 1L7IH 3BD3A 4MDRA 4TNFA 3X13A 3SPIA 5I1DB 4HSQA 1E27B 4WTWA 4FA7B 4R4FL 3MUZ1 5GZOD 1PZ5A 1AC6A 1ZV2A 3MLSL 5E8EA 3SSGA 1RIVH 1F8TH 3MV7A 2HFTA 4N6QA 3ARRA 2F8OA 4JDEB 1Q90A 4PWHA 4BFBD 4QRFA 3KDMB 2WB7A 4ODSH 3KYNB 4FNLL 5F7WC 3VB8A 4AIEA 2QBWA 4Y1AB 4NXKA 2CR3A 4Y5VC 4UZSA 3T2PA 1W91A 1M7XA 4E9TA 1HHJB 2APWA 1DANT 4LRIC 3ZW3A 5GRXG 1H9VA 1T04A 1INEL 2BC4A 1SM3H 1JE6A 4GW1A 2AS5M 2EIJB 3KPSA 2R29H 5IJDC 1HZLA 4JO3H 5ISZA 5HP5A 1RJZA 3L3OC 3HUJB 4UQCA 4X6DB 1MJUL 2Z91B 1OTSC 4XZUA 3O8XD 5K39A 4XMPH 1V3JA 2CO7A 1CDBA 1RK1B 2HSIA 4Q4IA 2NXYB 4OF5A 2VZSA 1KEML 3AQYA 5HHPB 1I7RB 5DEZA 2XN9D 5LO7A 1CMOA 4GUCA 4KDWA 3MV7D 1XF3A 3ROLB 3GQFA 4EI5C 1CURA 3GBNH 4X7FC 3ZHDA 4FFVD 4JPQA 1XF2A 1PKOA 3BPCB 4S0HA 1Q1JH 4FI6A 4RQQA 3OHXB 1UCBH 5KSUB 3L1EA 2CZNA 3WFCL 1KBPA 1U8OA 2EE6A 2LFEA 4NWUH 2HB0A 2R4RH 3FYIB 1OF2A 4GS7B 4OLVL 3ULUH 1A6WL 1BX2B 5BV7L 3DUUA 4DF9A 1EDYA 4NN6C 1I8AA 1FO0H 1BEYH 2WSKA 5I71C 4NZUH 4DO6A 4PWGA 4BA0A 3E6HB 5JA8B 4IRSA 5GZND 5KVDH 5KVFH 1XT5A 3FB6B 3U48A 4XPHL 1I3VA 4UF7C 1TDQA 4N9GA 2WQXA 2UZIH 1XGRB 3NUKA 2CHXA 1F18A 4FQPA 4DH2A 4K7PL 1HHHA 5J9PA 1F02I 4K3GA 5DZLA 4YDVB 2Q7YB 2QQLL 2CE6A 1GW6A 3E1ZA 1SY6L 1T89C 3RDTC 3UPRA 2WXHA 1ROWA 3A23A 3COOA 4NUJB 4F8QA 4C4UA 1I31A 3QORC 3PRZA 2CDGA 4PG9B 3RHWF 4BZYA 4LLDA 5GISL 4OLXL 1CO1A 4AENB 4LSUH 2NXZC 1CQYA 3WL9B 1VLXA 1WBZA 3MGTB 5I15H 4BCXA 4NKDB 1XIWC 5BV7B 2G3XA 9CGTA 3DXAA 4IRJD 4LKCA 1IGYA 4EE2A 1FGVH 3FSZA 2CHNA 1KIPB 1RUQH 4JFZL 5JZ7D 3JWNH 3D0VA 1EXGA 3HA0A 3SB3A 3T1WA 1C5DA 5GJSL 4IBQA 4DVRH 4LCWE 2Z31A 2XCMC 3Q2NA 4U3XA 4K0OA 1AHWB 3CDZB 3CCHB 2X41A 1EAQA 1B4LA 3GXTA 4XBPB 3TFKD 3V0AC 4KJQD 3AY2A 3I02B 1JFHA 2X3AA 2XBZA 2AJVL 1B3IA 3PS6A 5IKCA 3PJLA 4MSWA 3A22A 4LIQH 5ITBH 1EAJA 3T6WA 4MD0B 2B77A 1DCEA 2ZYHA 4IIQA 3OPZH 3QYMA 1AS8A 2CGZA 4HUUB 1GGCH 1NJ9A 1BD2E 3HS0C 4TOYL 5CP7A 4KY2A 4IIQB 32C2B 3RBSA 1GPOH 1FGNH 1VEPA 1A0QH 1FH5L 4PV8A 1OQXA 1F4AA 3WHXB 3PABA 2PABA 3HNVH 2YSTA 1E8XA 1JV5A 3NCMA 2Y72A 5BJTB 5E6RB 3ZSSA 1TU2A 2MH4A 2FWLB 1K4CB 4PJGA 5D7LE 4ELDA 4OJYA 4V1DE 1AKJD 3DBXB 3LEVL 3N1QC 4MZIA 5DS2A 2CM6A 4CC4A 1Y6MR 3LZFL 1M71A 1TVBB 3BAKA 4BHUA 1PLGL 1M57B 1NCDL 3GJFK 3B5GA 5A6LA 1O9WA 4GKZA 4YR6A 2PLTA 3PDOB 3APFA 1G4RA 2KH2B 3IFOB 1XIWD 4NUGL 3WNLA 4B96A 4PS3A 3C12A 4LLDB 4N24A 2APSA 5F1SA 5E5RB 4HBQA 3QJUB 1OY3B 1CVRA 4R2GD 5AZEH 4E9SA 1OQOA 2D2OA 3MLYH 2BRRH 3GXUB 5CGYD 2EIEA 5EZJB 4XCCL 5CBAA 4XNZB 2Q2LA 2PXYC 3O6FB 1ONQA 2IADA 2ZICA 1EJOL 2J72A 4G43B 4JPWH 5D4QA 1F58H 1WV7T 3EW3B 1MLBB 3IGAA 1QLEL 3EYFA 4MLIA 3DJTA 3RZCA 3U7YL 4GP8B 4X5WA 5CEXA 5HI5D 5GGTH 1SOQA 4HT1L 3T3MB 1EPFA 1BZ9A 3CUPB 4AYFA 4UV7L 5KSAC 3FB6A 2XWCA 3CSPA 1EEQA 1G7JA 2PWHA 3P77B 4HJIA 4QRSA 3D0AA 1L0PA 4UIMB 1ZLUK 3WFBL 4BZ1A 2I9LB 2WP3O 3RWEA 1PG7H 2DIJA 5BZZA 3OKNA 1SLVA 3CXHJ 2QPFA 4MNQE 3DJRA 1NOLA 1YN7A 2QSVA 2VDQH 3MJ8B 5F1IB 3TYGL 1DHKA 1GH7A 1RZFH 2EXYC 2FO8A 2A6KB 1NQBA 4BKTC 5PAZA 4ICXA 5I6KA 4QXVA 3ROOA 3UG3A 4TRPH 5FGBC 2XICA 5E0FA 4E41D 4J3OD 3UTTD 3ARBC 1BOYA 1IGML 1U4EA 1WSST 1WE5A 4AYEC 1A1MA 1LO0L 5DUMH 2H2SD 5BUAA 4L8CA 5F7UA 5C0AE 1TSHA 4QY8B 4KDTA 3W9DB 4PRAA 4DGIL 2CO6A 3BRGC 4I0PC 3O6LL 5I6NA 2WC7A 4P5SA 2XA8H 4CSTA 1K2DA 1JGLH 1O6SB 1P0SE 1U3HB 2Q7AA 2BSSA 4GEIA 4HCIA 1O9ZA 4DCQA 4QNPF 5BRPA 4KKCD 1UGKA 2V2WB 4JPKL 2X12A 3EOAA 4MJIB 1ET8A 2BVYA 1JXGA 1KBGH 4HV8B 5AW5B 5C6PB 5AUMA 1ZTXH 2BZCA 4LQFH 2CK0L 3CFCL 1MKFA 2BJML 2P24A 3KPOB 4XNQA 5IVXF 1BM3L 2ZNXA 5F89A 1KIUB 1U8NA 4FXTA 4C4KO 4DT2A 3WXVH 5HI5C 2DBLH 3PAYA 3I3EA 3TJHC 5HSFA 2Z4QA 4RDQG 2MCPH 4NZ8A 3VXTB 3CFDB 3OKMB 1NDMB 4YS4A 3NJVA 2GABA 3U2SA 5FYKU 3M07A 4JQVC 2DLEA 2H0FA 4NZFA 1G1KA 3ESOA 2OPCA 1I7TB 2LQRA 1HEJC 2RGSA 1A14H 3GF8A 3RWGB 5A7EA 2OS7A 4NQUA 4FNSA 5I9QC 2CLRB 1NWOA 5IBTH 4XCCH 1EQWA 5J13C 5HVHB 4YX2H 3H4FA 4L5FE 3X2QB 3HZYA 5I74B 5BRQA 4AE0A 1S7RA 4RRPA 2NY3C 5FHBH 3UC0L 5JW3L 4P4RA 1N8ZA 5CJXC 4DP9X 2OV0A 4ZSOA 4EIZC 4K3EL 1V55B 1NCOA 1MVUB 3KHQA 1DDTA 4WDIB 3DUHA 3DURA 4LRNL 1P2CB 3BZEB 1W8NA 2P80A 1UJ3A 3S3CB 1V05A 1HCFX 5DD6A 5FPIA 5E6YA 5IVXE 1E4XH 3GSNL 2AEWA 1TTBA 4I0PD 1HN1A 1KXQA 5AB1A 5T1DH 1IVTA 3GO1H 1J9RA 1OCZB 3MV9D 3FTWA 1E9PA 5DVKA 3L1OH 3RWJA 5AOIA 4LOFA 1KIQA 3TASA 1UD6A 3RWIA 4ZMXA 4IGBB 3FU3A 2GI0A 3GS7A 1USZA 5ILTL 4AGPA 4YFDB 5C0EB 4Y2NA 2ZX5A 1S5IH 3FBQA 2A9MH 4YFLF 4MA7L 5FHAL 3CXDH 3T04D 1FPTH 3KXFD 4U6TA 4WO4A 5ISZD 2IFFL 2CPCA 2HVBA 3UTTB 3GM0A 3U7WH 1ZLSL 5L2KB 4JJHA 3MGOB 3ARGC 4GFXA 2CUHA 4LKXA 4Z77B 4AI7A 4JO3L 4UU9B 2QL1A 1DCLA 5JO5B 4IKKA 4O9HH 4XMXA 1ZSDA 3UH8A 2CCVA 4NQEA 2AXWA 3VQ2C 2QHRH 3TIEB 4EZJA 5F7AA 4J23A 1JUFA 4AC2A 4R96A 2V3FA 1I9RH 1HNGA 5J06A 3PJNA 4IEFA 5TFSL 4U1IA 3GHPA 5AKTA 2ATKB 4LARL 4PRBA 3DPBB 1FFOA 1GGIH 3ISYA 1Q9WB 5HHOA 4B9GA 5I18H 3C5SB 1HKLH 4KPHL 4LSPH 4RAHA 3SYQA 3FCTB 4YNYB 2W07B 1XZ0A 1JZFA 2B15A 1T1ZB 1QA9B 5EU3A 3SOBH 2WN3A 1MCRA 1ZPUA 3WY2A 2GJZB 4U6YA 4ZXBD 3GDBA 2CJ3A 1KLUA 2APFA 4IIQC 2NUPA 3B7UX 3U4BL 2BP5M 4HFWA 1AGEB 1HQ4B 1MHPL 2YEQA 3HHRB 1ZA6A 3GZKA 1UWYA 1O7DC 1G1YA 5CJQH 3NSJA 1S8DA 2WCGA 4WKZB 3D51A 2Q2EB 3N42B 5KSBE 2V9QA 5ICXA 4PY7B 3KDPB 4F2MB 2Q20A 4WU5B 4DKEH 3LJ3A 4BKSC 4JKNA 3G5YB 3TEYA 5T3XE 2UUDK 1XF4A 3ZLQC 2H1LM 2BIPA 2F74A 5C1MB 4M4PA 3RGVA 1A6WH 2C4XA 4L4TB 1MZZA 3MKKA 5CJQL 4QRTA 1IGFH 1D5BA 4NBYB 4HIHB 3RJOA 3OGCA 2YD0A 3ECUA 1AZRA 5DHVB 3T6VA 3AXIA 3CWGA 1KN2H 2ZPKL 2DQFB 4R3SB 5DHYB 2FQDA 5FM4A 3O3UN 5CJOH 1KULA 5IV2A 3CAFA 4DTGL 5AVTB 4DN4H 2NNCA 3MODL 5HJBA 3U0WH 1AH1A 3KMDA 1FGVL 5DXWA 5GS2H 1DQDL 1RPQA 2BNQD 3ALXA 4AKPA 2YQ2A 4CSSA 3QNFA 1TT6A 5ILTH 5GS1B 3UTSB 2VABA 3QUXD 3VFMB 2CG9X 2GEQA 3ARDD 2CWRA 5E2UH 3B37A 5F6HJ 1XV8A 2VLKB 3SPVB 5KBLA 1RZ8A 3GSXB 2CO4A 4PGEA 4JO8A 2I69A 2JLLA 2L8AA 4XAKE 2E6PA 3REWB 4O51A 2VT0A 3H3PH 1AZNA 2EDMA 4MNGB 2B4CH 2VB5A 3ARFD 4HIJA 4KAQH 5MI0B 4TQ8A 4ZXBC 4WNJA 5FYJD 3GIZH 4O2FB 3B9DA 3TO4B 3RWCB 2LTQC 5D5MB 1MW2A 4XX5A 4OTXL 4YDZA 1JGDB 3RPBA 4F57H 3ULVF 1PU0A 1E7UA 2YC1A 3LYRA 5J11B 4UDTB 4MAUH 4CMMA 3KEHA 1CD9B 3PWNA 3T0EE 1RUPL 2X9ZA 2YSSB 3WCYA 3H9HB 1ZS2A 3A6OA 1ZS8B 3TYFB 4JE0A 1OIOA 1TPXC 4XN8A 3WS6A 4AM0B 4GAYA 4AQ1C 3B3IB 5A3IC 1VEOA 4LBAA 3QJQB 1QLFB 2DLGA 1LO2L 3BP7B 4XI5D 1ZVHA 4GKSA 2R1WB 3ASWA 5EU4A 5L2KE 5EZIH 1WZ1H 1PAZA 3FUJA 1GVIA 3IDXL 3DGCR 3P4LA 1HH6A 1NLBL 3QZNA 2FJHA 4NCC2 3GMNB 2XWTA 3WFDH 5KG9B 4ZUUA 3LPOA 5T5NG 4PGJA 4YSEA 1LYQA 5DC0A 3DO7A 2NX5B 4YLBA 4X5RA 2VYRE 3L3OB 3AXLA 1JVLA 4QJ5B 3HS8A 1CFMA 4WENB 3WFEL 1QKZH 1UM4L 3H3KA 1FVDB 2NTFA 4UAOC 2KZWA 1EO8H 3N5AA 4Y16A 4WWID 2O5XH 4FFWD 5ESVA 1I1AD 5HHMD 5I18L 1ES0A 1JFQH 2OKMA 3KJ6L 3BIKB 3MRPB 4K55A 5FYLH 2X1WL 2R2HB 3QIUA 5DQJA 4LSVL 1CL7H 3KPTA 1IC1A 3D30A 3HJEA 2EAEA 1JHTA 2YXVA 5KVFE 2A6JB 3H3PL 3SDAA 4Z7UA 1OE1A 2FLRT 3HMWL 4XBGB 4XNDA 1MCWM 5MP6H 3KJ4C 2UY7A 1JZDC 5FFOA 3RB5A 2YAQA 4U1LA 1ZLSH 3SYOA 4HLZG 4LU5L 4PY8J 2FJFA 2JJVA 4N3TA 4XWOC 4CAGA 4LHUG 4BH7B 1J8HB 4KDVA 4WJKB 5JHDA 2GIXA 3HVDA 4CBPA 4OD2A 5D7JB 3H2QA 2BZDA 5C2BL 4G7RB 4Z7AA 3I50H 1H8LA 4XHQA 3E1F1 5DR5H 2IWEA 3X3GH 3WENA 5JXED 2VITB 2CU9A 2W0FA 1FJ1A 4I2XA 1X9UA 3ZQ9A 5KS9A 2XFGB 3S0PA 5IQLA 2NXZB 4KNQA 5SX4I 4CNIB 4CL7A 4A7GF 3RL2B 5EOQH 2HVJA 1A4KA 1IU1A 5ADOH 4YLCA 3D34A 3NTCL 5IW1B 5T5FH 1FP5A 2IPUG 3SKNB 4A2MA 1KCBA 1S7VA 5T1DL 3ZUNC 5A6IA 5INCB 2D3VA 5IVXA 4FJZA 3WFBH 2OJEB 3QZPA 4YHOL 1LO5B 3MRPA 4OM1H 4PCKA 4DGIH 1CGTA 3EOTL 2ZXDA 2Q9OA 3A4AA 5G2NA 3FFOA 3UGEA 3VRLE 1MWAB 1NEZB 1HIMH 1BECA 1EZUA 1I8MA 4P46B 3K80A 1AO7A 1ET5A 3DSNB 4FFWC 5FC9A 2VM3A 5EU7E 3LH2H 1S6NA 1BQHA 1NSNH 4IMLB 3T8XA 3GB7A 2JKLA 3ZDYF 3MO1A 5FO7A 4LVOC 2IH1A 3BKML 2KL6A 1CFQB 1JSYA 1YYMH 4HUWB 4XCNA 4KQ4H 2XKNA 4WFGE 4N0UA 1AXTL 3DI3B 3WKQA 2QJDA 3EZJB 5EOCJ 3DHUA 1XEDA 3FB8A 5DHDA 1A6UL 4TNVF 2DEXX 3BH8B 2ENQA 5TK4A 3O3DA 3CLFH 3KPLA 4WFFD 3LKPA 4QF1A 3MV8B 3V6ZB 5IMOA 5HI3C 1CD1B 4HWZA 4PJ7A 3X3FL 2RA1A 4HIXH 3AC0A 3THML 4D0BB 3CH8A 5CN3A 5HYSA 4ZX3A 1DJWA 1KCSH 2HKHH 4HHGA 3REVA 1AXTH 5KN5A 4GAJH 4CMMB 1PQZB 1HCYA 5TJWK 5LN8A 4UT7H 1MPAL 1WHPA 4GUOA 5CGBA 1MWAL 2CK0H 2YAOA 3UROR 2YMOA 3VG9C 4NCC1 4OGYL 1IV8A 3V6FB 1HILA 4EI5D 4HKBA 1X44A 4HIJB 4YE0A 3F62A 4TQEH 5BXFA 1LTXA 2W95A 1FH5H 4EJ1C 5SWQB 2DRUA 1HIML 4KK8C 3CN4A 5I76A 2ZUQB 4OGAC 1KIRB 1CDGA 2DIBA 5C07B 3O2WL 1IEBA 5E94A 4HLEA 1AXIB 3K6IA 4OM1L 1I1FA 3V4UH 4WAFA 3VFMA 1RZIB 3V5HB 3VWJD 1LLAA 2UZYA 1XDTT 4QHNA 1H3XA 1WC7B 2MKWA 1MRCH 4P2QB 2GJPA 2OI9B 2C1PA 1U2CA 4PVLA 1ZXQA 2H9GA 3FO2A 4M1CC 5EUOA 5BRZB 2ZUXA 3P69A 3WEOA 3TN0B 1GIGL 4HS6A 5IG7A 4GIPD 4J6RH 1VEMA 4FZEH 1TQCB 3W37A 2RHEA 3Q2CA 2YD9A 4Z8FH 3CMOH 1WD9A 2OM5A 3L9YA 3KPQB 1FC1A 5KBDA 3EYVB 1NBZB 2HTLD 1JGEB 4GRWB 4C58B 3HE7C 1ZWIA 2JK5B 2IOOA 2PYED 4UNVA 5D71L 5F7DB 1KJ2L 4HEPG 4NRZA 1NCGA 1A4AA 4JL2A 1F86A 3SY0B 2H3NB 3FAXA 3N04A 1ZHKA 3ASOB 4K94H 5DJDB 1KXVA 4JO4H 5FDYA 1KY7A 5C3TA 2V8MA 2KZKA 2IDCA 2ZE0A 4XRCA 4ODVH 1YQVL 4FKEA 3BKMH 4UQBA 2XQ0A 1F58L 1FZJB 3V0HA 1IAOA 3K72B 2DOCA 2ZCKL 4R8WL 3F6JA 1LP9E 1JJUA 1EFQA 1OTUD 3TFKC 1H6EA 3V4PL 3CSGA 3WIIL 1X7QB 5HGDA 3VD3A 1P7HL 2IDUA 3AM8C 3LN9A 1SBSL 3PGFL 1RHHB 4JHWL 1E8YA 4YHKL 5LNEA 2FEEL 2DQMA 2XPGB 2CJSA 2QVTA 3BIAX 1AQHA 1WK0A 2EQDA 3OF6A 1Z1WA 4EZMA 3N1GC 1IJNA 1PZAA 4IEFB 3NSXA 4PJ8D 1TO4A 4LCYB 4ZPTB 4K8RD 3D85D 2ZG1A 4TNWK 3OKYA 3GRGA 4R26L 3GS0A 2IGLA 3IXTB 4F33B 1MFBL 4KGLA 2ADGB 1XD1A 3L4XA 4WI7A 3WE6B 2D7QA 5T1KA 4L3CA 2BZ7A 4BGLA 1T22B 2YAMA 4JRYE 1NSNL 2Y5EA 4FS0A 4MMZC 3HW7A 3CFJB 5ECGA 3SJVE 4HJSA 4Z3JA 5DUML 4YEFA 1RFDH 4WO4B 2RB8A 3QR1A 4NLHA 3QI9A 1A02N 4TVSa 5D2NC 3MLXH 4GMTL 1KACB 2DQUH 5CSGA 2KZ1B 2XPZA 2XT1B 4XVTH 4GSDL 4WGVB 4N8VB 2WAQA 4N90D 3LNGA 4E41A 1T7VA 4FX5A 2GSMB 4QRRE 5T3ZH 1LWHA 1R3LA 4NQDD 1A4JB 3L7FB 4P46D 4HC1L 5FW7A