1AG0A

Structure of cys 112 asp azurin from pseudomonas aeruginosa
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFDTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Role of the Active-Site Cysteine of Pseudomonas Aeruginosa Azurin. Crystal Structure Analysis of the Cu(II) Cys112Asp Protein
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 27
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ag0A00
3AZUA 3L45A 1N70A 4GP5B 4MFHA 2UXFA 2XX1A 1ET5A 2IWEA 3N2JA 1E67A 1CC3A 1OCRB 3OMAB 2RACA 3RYMA 4BWUA 2R7EA 2QDWA 1BEXA 5B1AB 4BK5C 1IKOP 1L9QA 1M9WA 1KBVA 4BDVA 1EZLA 1NIDA 3T6XA 2HZHA 2ZWNA 2TSAA 4YL4A 2BP0A 3CVDA 2PPAA 3WKPA 5A7EA 1TEGA 2GIMA 3CVBA 1NICA 2J56A 4JHUA 1EHKB 4KO6A 5I6PA 1XB8A 2NRDA 2XX0A 3OQRA 2YARA 7PAZA 1E30A 1NWOA 3NT0A 3X1NA 2Q9OA 3UADA 3NJHA 1DYZA 4A2FA 3EH5B 5B3SB 1L9OA 1ILUA 3FSWA 1AZCA 4E9VA 2PP9A 2XVBA 1IC0A 1RKRA 4YSUA 2CALA 4E9WA 5I5MA 4PAZA 1QLEB 4BXSV 5F7BA 4KNSA 4HCFA 3IE9A 4DP7X 2P80A 2BW4A 3N55A 5FC9A 4WKXA 2H3XC 2H5UA 2VN3A 4AZUA 3FU7A 4BWTA 5B1JC 1AOZA 1MZYA 4KNUA 3SBPA 3BVDB 4KOCA 1ID2A 2PPEA 1A65A 1FFTB 3CVCA 1SF5A 4DP9X 3AG3B 3SBRA 4JKNA 1AZNA 2QDVA 3FS9A 3QJUB 3OMIB 3NJGA 2H47C 5IY5B 4YSRA 4YSPA 1BAWA 1J9SA 1BYPA 2GSMB 3FT0A 2X88A 4AI7A 4F2FA 4YSDA 5F7AA 1AS7A 1OE1A 3PLYA 1XMEB 1PZCA 3IBOA 5I28A 3PAUA 1L9PA 2Y1AA 5LDUA 1KGYE 4X4KA 3CG8A 3TASA 4A67A 3AG4B 1GY2A 3WG7B 4G72B 2YAMA 4A66A 2OCCB 1KDJA 1ASQA 2QT6A 2OV0A 4EF3A 2FQDA 4AKPA 5I6MA 1T5KA 1AG6A 2EIKB 2VW4A 1UATA 3H4HA 4GP4B 2W8CA 1J9RA 2UXVA 2YAFA 1J5CA 2R7EB 1ET7A 3T6VA 2AVFA 1ZDSA 4DPBX 4W1TA 1AZUA 1PZAA 2VM3A 4YSOA 2XUWA 4DPAX 2N0MA 2UX6A 3NSCA 1E5ZA 2PPFA 1F56A 5B7FA 2B08A 2QPEB 1V55B 3KW8A 4YSAA 4JHVA 2J55A 4HIPA 4DP0X 2I7SA 1NZRA 1TU2A 1SDDA 3H56A 1A3ZA 4YVUA 1X9RA 1FA4A 1L9TA 3HB3B 1MZZA 3FPYA 5D4JA 2XV3A 2BWDA 5I6LA 4KNTA 1HAUA 3AG1B 3FSAA 2VMJA 3IN2A 1A4CA 1KBWA 1R1CA 2ZXWB 1SNRA 2VW6A 2XV2A 4YSTA 2I85A 2DYRB 2XU9A 3X1FA 2CJ3A 1JZFA 3QJVB 1MG3C 3GDCA 1E65A 1JERA 3SQRA 5E9NA 4E9XA 2X87A 3GYRA 1NIAA 4FA7B 4PCYA 1ZV2A 2IDTA 1V10A 4P5RA 3S3BB 3NJJA 1PLBA 2CCWA 1YLBB 2QPDB 2WSDA 2HXAA 4G70B 3UABA 3AG2B 2FT6A 1KCBA 2P80D 2J57A 2WO2B 5I5IA 5B1JA 2FQEA 1A8ZA 1M56B 5TK2A 3FU9A 3EH4B 3QQXA 1X9UA 1OF0A 3FQYA 2IAAC 4DP6X 3NJMA 3S3CB 1FWXA 2BW5A 2HRGA 3S8FB 1PNDA 4ENZA 3SBQA 1GW0A 5TK4A 1IUZA 2EIJB 1ZPUA 2GBAA 5I6KA 4A2GA 3ABGA 4DPCX 1J9TA 1JOIA 2Q5BA 3T6ZA 3AW5A 1NINA 1W6LA 2HX8A 4A2HA 1CURA 2E86A 4UF7C 1ET8A 1NTDA 4M4RB 1WAEA 4NERA 1MDAA 2DYSB 3PCYA 3D12B 2CAKA 2DWTA 2PPCA 2YAQA 3UGEA 3TBCA 3G5WA 2DV6A 3NSYA 5AFAA 2A3TA 1JZGA 3ABMB 1JZHA 1BQKA 1SFDA 3EH3B 4UANA 1ADWA 4GXFA 3CDZB 1SDDB 2GB2A 3V9CA 1CYWA 2XXGA 2YXWA 2BZCA 4AKQA 4F7KA 1W8EA 4GY4A 2VSKB 2FNWA 1TKWA 1ZIBA 3DTUB 1PY0A 1XB3A 2IDFA 3OMNB 3WI9A 2CUAA 1AZBA 1AZRA 1ILSA 4YVNA 1QHQA 4A68A 4UAHA 4KO5A 3NSFA 3ZIYA 1ZIAA 3FSVA 2IWFA 4G7QB 3WKQA 3WIAA 1W6WA 2BHFA 3EHBB 5ANHA 2IH8A 2GC7C 4DP1X 4NB7A 2XYBA 2FTAA 1AAJA 1GS7A 4L0PB 3NP3A 4HHGA 3T71A 1GSKA 1SF3A 4HZ1A 2ZONA 2IDSA 1RZQA 4BDVB 1RCYA 3ERXA 4HALA 5I6NA 1V54B 1JVOA 2BP0B 1PNCA 1GS8A 1PZBA 1NDTA 1ZDQA 2UXGA 1OV8A 4Q89A 1AACA 1AS8A 2IWKA 5I26A 4DP2X 1OCZB 3NJNA 3NJFA 4QKTA 3ZDWA 3HEIB 3PPSA 4HCGA 3UACA 2YAHA 2BP8A 2LLNA 4BWWA 1NPJA 2UX7A 4WTQA 2BWIA 2WO3B 3BQVA 3V9EA 4NAJA 4HCIA 3WNIA 4E9YA 2EINB 2AANA 3ABKB 2PP8A 2IH9A 3FPXA 2VM4A 1AIZA 1OCCB 2FWLB 2XXFA 4TXVB 1CUOA 4N4YB 3QJQB 3FU7B 1BQ5A 2AZUA 1PLAA 3DKHA 3FU8A 5PAZA 1A4AA 3S3DB 1JVLA 3NJIA 3X2QB 3FYIB 1AQ8A 3DIVA 2OJ1A 3FQ1A 1J9QA 1IBZA 1URIA 3CZUB 4P5SA 4RH4A 1KV7A 3FQ2A 2EIMB 2FJSA 1ASPA 2PLTA 1ASOA 4E9QA 3T6WA 1JZJA 5EHFA 1MG2C 2BO0A 1SFHA 3C75A 4GYBA 1WA0X 3UAAA 3ABLB 2HX7A 2JXMA 2DY2A 2JFCA 4G7RB 1CYXA 1M57B 4ZK8A 1NIBA 3PAVA 3NJKA 5PCYA 2YAPA 2VW7A 1ETJA 4DP5X 2FQGA 2Y69B 2J5WA 4E9RA 1GYCA 4KO7A 6PAZA 1OCOB 1OOWA 1NIEA 8PAZA 2GI0A 2EILB 1N68A 5AZUA 1JXFA 7PCYA 4DP4X 4YSSA 6PCYA 1QNIA 3OD3A 5I6OA 1WS8A 3S8GB 1AG0A 1KYAA 4E9SA 1NPNA 3X1EA 1PLCA 1BYOA 1XB6A 1L9RA 3IEAA 3NYKA 2CBPA 3TU6A 1AR1B 2VSMB 3PXLA 3MBWB 2PCYA 2B3IA 3EF4A 2TSBA 4FAAB 4W9ZA 3FYEB 3X1GA 1OE2A 1I53A 2PCFA 2UXTA 1L9SA 1RZPA 5AKRA 1SHXA 3PAZA 3NJLA 4YSCA 3GXUB 3X1BA 2GHZA 2XLLA 4YSEA 2PP7A 4Q8BA 1HAWA 1JZIA 2BP8B 3ZBMA 1OE3A 9PCYA 2IDUA 2HLEB 1PAZA 1WA1X 3AY2A 4G7SB 4M3HA 5I5JA 5D4HA 1DZ0A 5B7EA 1IBYA 2FQFA 1BXAA 3JT2A 1SHWA 4G71B 3OM3B 2AFNA 1JXGA 1PMYA 3MX0B 3U25A 1KCWA 1HFUA 4K9JA 4HHWA 1WS7A 2ZOOA 2XV0A 2FT7A 2YAOA 2PPDA 2HRHA 2GC4C 5D4IA 1B3IA 3NP4A 4CSPA 3TBBA 1WA2X 3QJRB 2XWZA 1A4BA 3WNJA 4CSZA 3KW7A 2FT8A 2I7OA 4KOBA 4E9TA 2DWSA 1PF3A 1E5YA 1JZEA 1NWPA 4GP8B 1GS6X 1AS6A 4AX3A 4BXVA 3FSZA 1SJMA 2MTAA 4F2EA 3T9WA 1VLXA 3TA4D 2AZAA 1TEFA 1GY1A 3ASNB 2YXVA 4DP8X 1PCSA 1JXDA 3ZX1A 2YAEA 2JKWA 3IN0A 5B7MA 2MRYA 1BXVA 1AANA 1BXUA 3CDZA 4AKOA 2BZ7A 3H4FA 2HX9A 1J5DA 4A2EA 4KO9A 3NSDA 2YQBA 1NIFA 5B1KA 3QPKA 3QJSB 4QLWA 5B1BB 3JTBA 1KDIA 4YSQA 3QJTB 1BQRA 3ASOB 4N8UA 3UAEA 4A2DA 2IDQA 1GR7A 4HAKA 2W88A
chains in the Genus database with same CATH superfamily
3MA7B 1NFDF 5L88L 1X5LA 4U1KA 3AADB 4WI0A 1JWMA 2BRQA 4WW2B 1DQQB 1U8IA 2WVTA 2B16A 1WH0A 2DWXA 3V5DA 1SN2A 2GJ6E 1E67A 3QNXB 4L8CA 2OSLA 3LMJH 2ITCA 3BMVA 3HI1B 1LEGB 4BWUA 5HGGS 1OWWA 1F2QA 1EXGA 2PW2B 1P5VA 1T03H 1FZKB 4OT1L 2W94A 1B88A 4TNVF 4BSVA 1QSED 3QEGH 4JCLA 1HL8A 3HZMA 1OY3B 5B1CA 1BLNA 3QPXH 2QGBA 1TTAA 3LMJL 4R5TA 5AKTA 4AYID 3KLKA 4IBZA 4K8RC 4DOHB 1SVCP 5LCVA 4BH8A 2V0AA 1NFDB 1MW2A 1T03L 2IIJA 2NYZA 5HYJB 1TVBA 5ISZE 4GEIA 3SDDC 1MFEH 2HCZX 3POCA 3QPXL 1QHOA 3BVVA 4Q2ZA 1HESA 2FHFA 5ABAA 5MEPB 1X5MA 4G8IB 3P69A 2O61B 1QLEB 5B8CC 2JSFA 3STLB 2E0PA 3H3PH 2YGNA 1THCA 3ULAB 2GEQA 1MFEL 3BWAB 5FDWB 3JYBA 4N3TA 5C71A 4ZX6A 5F9JB 3GLZA 5BVPH 4J3OD 1AIFA 1EDHA 2JJUA 3DIDA 4ALAC 3EFOB 5EH1A 3VWJC 1P69B 5E6UB 2EH8L 4ETQA 1URZA 1SHMA 2WLKA 4LZKA 2AERT 2PPEA 4Y2NA 3VRLF 2V9RA 4DP9X 1XCXA 1JK9B 2I9LB 3WIFA 3D07A 3T0EB 4MA3B 4RVBA 4PVMA 5HDOA 3LN4B 4LRIA 5BVPL 3QIUC 2BVYA 1J9SA 3AS3A 5DQ9B 1CI5A 5F7AA 2HJKA 1TQUA 4AV5A 4MS8D 1BD2E 3LSOA 5F1KC 4MHHI 4W68A 2AJVH 4POZC 1WP6A 5I18H 5CZKA 3B9AA 2WKGA 4HKJA 3W56A 4N8CL 4DEPB 3SGDI 1YEDA 3TASA 4A7GF 3PPEA 4LOUD 1MF2H 5E6IB 4IU3B 2EDRA 4MAYB 1V7NL 1U8HA 1CFVH 2VAJA 4ZUSB 4QTFA 1K4CB 2ZG2A 1X4XA 2ESVA 1UATA 3H4HA 4GP4B 5I18L 3GB7A 2JJWA 4Y2DB 2ZX9A 1IGTB 1Q1PA 5GGRB 3FUDA 2P46B 4JFYB 1KJMA 1J0YA 1T2QL 2A9CA 2OTPA 1TR7A 3BKYL 1MF2L 3I9PA 4YSOA 3RX7A 3RA7L 3X13A 5AZEH 4U6XA 3HNSL 3V52L 1CFVL 1YA5A 2QPEB 3KW8A 4ADJA 2QHLA 4P4KB 4PRBB 1M05A 1UH3A 1U93A 3ZHFA 1P9MA 4AVKA 3B2MA 5H4YA 4LU5H 4NKOB 3WS6A 3C12A 2XV3A 3L5IA 4LOEA 1OAUL 5FYJL 3NBNA 1YYMH 3CU1A 5EZOH 3EJRA 4HUXB 5AZEL 2JF1A 4MJHA 4QO1A 3BJ91 3GINA 5FF6A 2XWCA 4NSKA 4QRSB 5D5ME 1FNGA 3UTTD 4FF9A 1MH5A 1LO0H 1I85A 2K70A 4ZTEA 1O7VA 4XAKE 4P57A 4JGMA 5EUKA 4NENB 4LU5L 4NN7C 3VI4A 4PCYA 1I3RB 4ZAKA 1B0GB 3ARDD 3IAQA 1YYML 5EZOL 1JNLH 5DRXA 1KWKA 5LNDA 5C0BB 4NQUA 3U4AA 2J20A 3OL2A 5IQ7H 1J0IA 2OMXA 2XXCB 5I5IA 1THAA 4H0LC 1J12A 4Q97A 5H94A 3L9EA 4KJQC 1FO0H 2WQRA 1NUFA 3DMMC 4HS8L 4ONHB 4GQQA 1JNLL 1G7JA 2CBQA 1E9QA 4GS7B 4JO1H 1WC7A 3S8FB 4NQQA 3F6LA 4HIIB 3DSNA 1H9VA 1YQ2A 2VE6A 3VO0A 1NOAA 3NDYE 5TK4A 2H4EA 3E2HB 1CBJA 2IXQA 2XETA 3GK8H 4U31A 1RIUH 4DCQA 3U4EB 1FO0L 2FHCA 1I85C 1ETZA 4WV1A 2KZKA 3CLWA 2X9WA 2P5WE 1WPCA 4JO1L 1R0AH 3Q1SH 1EEZB 1TDQA 3LKPA 4WFHD 4ZAKC 1JD9A 1L0XA 3DPBA 4U7KA 4HPOL 3LKRB 4JFFB 4RRPA 1E3FA 4FLRA 1WGOA 3EJJX 1QZNA 1RIUL 2OL3A 4CVUA 1UXWA 2A6KB 3SGJA 5KVFH 1WZMA 4RMQA 1AC6A 1OANA 2AJUH 5GZND 5JIHA 3LJ3A 3CK0L 3QUKB 5JUEL 2ZP9A 4UINH 1PKQB 1BW8A 4R3SA 5LAPA 1UHVA 1H5BA 2WW8A 1R3JA 4KV5E 1BQKA 4NN6C 5ICZB 2UZIH 3FQXA 2HT4D 3KHQA 5KVFL 2WZ0A 1SDDB 1TENA 2H3NB 2AJUL 2LU7A 1KBGH 4G9FE 3DGGB 1CFBA 2BZCA 3O11B 4WV1C 3BXNB 1W8EA 5BJTA 4UINL 1KSRA 3KDMB 3U36B 1M71B 3WYRA 2WVVB 4R90L 1E4XH 1A3QA 4NQSA 4YAQB 5DRWB 1GJUA 3KL3A 1JF1A 4HKXA 2ZKHH 4AWJC 4C4KT 1ZHNB 1HE7A 4CKVX 2DMBA 5KOVC 1SGKA 1TMQA 3WIAA 3CFMA 4BFGA 1BVOA 3EHBB 1Z0NA 4TKWA 4GRLB 4UZUA 3LEVH 5JDSA 2XKNA 1E4XL 5CHNA 2VISA 5T3XD 4IJ3B 1C5CH 3FH8A 4KRPB 4B50A 4G6AC 3NZUA 5CEYA 1GSKA 3EYQC 3Q8BA 3WS3A 4FQ2H 2LVEA 1H5BC 4KK8D 2XWEA 1LP9E 4PTUA 1BCIA 3MLTB 3P77A 4JFED 1BOGA 3B83A 3LEVL 4KUCD 1VCBC 1YDPA 5EOTA 2EVGA 4U7MA 5I26A 5C09A 5CZVH 3O8XA 4Z7VE 1MHHA 3QHZL 1R5IA 4JRXB 2VLRE 3MJ7B 1BQUA 1FFRA 2F74B 4X7SH 1XAUA 4XMUA 4AGOA 4LPXA 4HT1H 3BP5B 3CFUA 1N2RB 3UACA 1F8TL 2ZUSA 4EN3C 2QHRL 1SJVA 3ARTA 4PD4K 4MB3A 5D9SB 2BWIA 4WFFE 2VN6A 4OUOA 3KJ6H 3FCTB 5DK3A 4NAJA 2JB6A 1L0PA 1AGDB 5CZVL 1KGWA 4QRPD 4ZX4A 1CTNA 3VTAA 4P3DB 4X7SL 4G42B 3ZL4H 3C2SA 4HT1L 1NCNA 2ENPA 3MNZB 2FWLB 4HJSA 1IQDA 4AQAA 2OSYA 2CJUH 3Q0HA 3QUYA 3OLIA 3R8QA 2A73B 2SODB 2WN2A 5F1NB 5F3HB 5JHDA 3MR9A 3KJ6L 3D1MC 3G9AB 2Y7SA 4YDKH 2Z8VC 3IMUA 1W0VB 4OFYD 1URIA 3CZUB 3N6YA 1WAAA 1KV7A 4AE0A 2EIMB 4N8VA 3S35H 1HCFX 4E9QA 3T6WA 2J8UA 3HPLB 4YNYA 1D5ZB 2NTSP 1MWAA 2CJUL 2XN9E 1BF8A 4FXGA 4Y16C 4QGTA 4X7EC 2Y5TB 5EV7A 4ZFQA 4KJYB 5B39B 5ACMA 1ZXKA 5IM7A 4XPTH 4R7DA 1JFQH 2ZPKH 3KJ4B 4YDKL 2JK5A 3H9SD 4HOMA 3S35L 3VGGA 4N2BA 3TPUB 2Z92A 1ETJA 2Y0SA 3FFDB 5FM8A 1Z3RA 2XWJB 1AO7A 4LEEA 4O51B 1AQDA 2R29L 1RZJH 3EAKA 4HZLA 1JZ5A 3TF4A 8PAZA 4UT6H 1ROWA 4Y4HD 1OSYA 5FFOA 5FB8B 2QGEA 4XPTL 3F6JA 1JXFA 3I3BA 1S7TB 1JFQL 1OTSD 1UH2A 2ZPKL 3JZ7A 2WJ5A 4BFNA 3EOBA 1GHFH 3FU0A 2ZX7A 5CP7A 1FNFA 3F12B 3ARFD 5I8KH 3S8GB 2LV4A 2C9QA 3KMDA 4UT6L 2F0CA 1CGSH 4WI9A 4YHYC 5ADPH 3FT3B 1SN5A 4GW1A 1EDQA 1KTRL 2FYYB 3ZO0A 2OYLA 5EEZA 1GHFL 3EO9H 3DSFH 1N3NB 4QAMB 3PNWA 5KS9F 2KPWA 3D85A 4J8RA 4S10A 2BVPA 1U33A 2BSSB 1OAQH 4KXCA 4ACPA 5IESH 4MJIA 4TSAH 1N8ZB 5ADPL 3F7PC 1IM3D 1EHLH 2GPZA 2J1XA 3DBXA 4JVPA 3HB3C 5KN5A 5KZCB 1I7ZB 1N0LB 1G9ML 1NEZG 1WA1X 4EI5D 3UPRB 2X4PA 4QCIA 2FQFA 1MI5E 5AYTA 3V7AE 4EIUA 1OAQL 3QXDB 5IHZB 4F92B 5IESL 4TSAL 1UZGA 2RHEA 3QB7C 4F27A 5GRZA 3MVSA 1KJ2B 5EWIH 5BO1H 1EHLL 3MLWL 1U3HB 5DVNA 4ZS6D 4RGNB 4HHWA 3DJTA 3K0WA 4LCWE 5KS9B 1FFPB 3JWNH 2YBGA 4IIQA 3CXHJ 4F9LA 3BRDA 3F83A 1FVDA 3X3GH 1TZOA 3FO9B 2CGRH 5DJ0B 3VI3B 2P44B 1PZ5A 4HS3A 2AEWA 1ZE3H 3KWTA 4S2SB 3L3JB 2KI6A 5EWIL 5BO1L 3VFUA 5A3IC 3VYNA 4L4VE 4LPTA 3QDGB 3JQOB 5DZNA 3SJVB 3HE6A 3KPNB 4PRHA 4GMSH 3X3GL 4TQEL 5HHOB 1DBKH 2TRYA 3BUQA 5DFVD 4Y4FB 4XP9H 2J43A 1IZKA 4XMXA 5EDXA 4DP8X 1NGPH 1SBSL 2IPKB 3RIAK 3FF8A 5K9OB 4OCXH 1VESA 2GCYA 4AKOA 3PWPA 1OLZA 4HSAC 3REWA 5JA9A 4Z3IA 4KDVA 5F7KC 1XCQA 1DCLA 2F54A 4GMSL 3JTBA 3Q5YA 1DBKL 4BQCA 3PWVB 4F9LC 5AVVB 3WJJC 1NGPL 4IRSC 3N41F 1XXFC 1QOKA 4OCXL 3KLSA 5IOPA 4FHKA 5DS8B 3LKOA 1WUNT 1FO0A 3AMKA 3OC5A 3QEQA 4N0CD 4ZSOB 3CDGA 3WTSA 4QXUL 2WC7A 3M1BA 3MODL 4N1EA 4AEIH 1UZ8A 3DVGA 1N7MH 2OCFD 2E47A 3K7UA 3OKKB 3OMAB 2XQYK 3E1ZA 3HE6C 1NCBH 2VSDA 1VJSA 2QDWA 4QY8B 3QFDB 4HIHB 5TDNA 5B3JE 2OJEA 1HSBA 5E4AA 3FTXA 4OVUA 2V6HA 2R8SH 1T5XB 5FYLE 4D94A 3TNMA 3PRZA 1XL6A 4X4MA 2BP0A 4AEIL 2VL4A 4F24A 1N7ML 4PJIA 4KH9A 5E5MB 4LKXA 1NCBL 4OUUA 5BZZA 5I1LB 1E30A 4C56A 3H55A 2WQAA 2QSQA 3PUCA 2WQXA 1EFXD 43CAA 1CLZH 1ZHBB 4PJDF 1EAPB 3EH5B 3DLQR 4M1GL 2Q0ZX 5ACZA 2XZZA 1LL1A 5T3ZD 3PJLA 1JHTB 1RPKA 3CWGA 2F7IA 3S97C 3WFCH 1XHHA 1Q9WB 3DUUA 4YL9A 3UYPB 3IXTB 4QRBA 4M03A 1E7UA 1DDHB 1MJJA 4DP7X 1MCLA 1DQTA 1RXLA 3ISRA 1CLZL 1EGJH 4KNQA 4GFXA 1S7VA 4CVXB 3JTTB 1DO5A 5KOMC 2B8OT 4BWTA 4YIQB 4PJCE 4M62H 1QSFE 2W0FB 5G2NA 1AQKL 3SZKC 5FOBA 3WFCL 3PYCA 5DYFA 4KNUA 3U1PA 3LS4L 4A7VA 2ESVD 1ZV5A 2V2TB 1TJGH 3U79A 4OIIH 5BMFH 3OXSB 4EO5A 4PJDB 2VLLA 4JKNA 3C5ZD 4AE1A 4AMKL 5H4ZA 1M1XA 3K6SA 4M62L 4PP1C 3VD4A 4ZXBA 2YC1A 4OIBA 1V7MH 4PS7A 5ANME 3ZTCC 3PNRB 4UU9A 5C07A 3ZE0B 2WIMA 4OIIL 5BMFL 4LPVA 4L37A 2AABH 2YJQA 4LLMA 3RWFA 3HUJE 1D5IL 2EAEA 4A66A 3FOLA 4PJ8A 5EFIA 3EYVA 1LK2A 4CMHC 3F7LA 3BCDA 4HKBB 3FQRA 3P3TA 4IHOB 1A7OH 1K8IA 2GVYA 4TLSA 1V7ML 5EOQH 4XVJH 1WDAA 3QUMB 2VW4A 3TBWB 2OI9B 4I9XA 4LHUB 1HXMA 1T83C 1RUMH 2WM0A 4ZAKD 2AABL 4XMVA 2Y3AA 2QQLL 2ZCLH 1JNHB 1NMCB 1QA9A 4DPAX 1YEEH 3DI3B 5TE4H 1NOLA 1A7OL 2PPFA 3I6KA 5EOQL 4XVJL 3F2LA 3H7LA 1AD9B 4K3HA 3ECUA 1SPDA 5JXEC 5FO9A 5D1XE 4PGBB 1HZHH 1LMIA 4ZXBC 1BFVH 2OXHA 1ZA3B 1G0XA 1XGTA 2ZCLL 3OKOA 2NX5A 1IGFH 2BWDA 3L4UA 4JANB 3VGAB 4MJ5B 3MMEA 4IGBC 5TJWK 3MV01 4F58H 3FSAA 1E8XA 1YEEL 3DX7A 4P2RA 4ZDHA 5I0XA 1DEEA 1YMHB 1ORQB 1KGCE 2XU9A 2GTZA 5J1AB 5DUJA 4I77H 4JL2A 2WXMA 1A4JA 1HZHL 5DWUH 3O4LB 4EE2A 5KWYC 5MHSE 3SQRA 1BFVL 2X87A 1FV1A 2AXGA 2W65B 1IGFL 1OZTG 2AJSL 1AHWA 4WNSA 5FGRA 1YEFH 4NUJA 2DKSA 2CJSA 3FB5B 1GRWA 1H19A 2QKIA 1QFWL 4QRQA 1CB4A 2J57A 2QVTA 3C9NA 4I77L 5DWUL 4AV0A 4P05A 5SWSE 1SYSA 4P9MH 1M56B 5CINH 1E90A 3PAYA 4HF5H 4GNKB 5EU3A 5F96H 1JL8A 1N10A 3MRQA 4L8DB 5I74C 3X12A 1QO3B 3GXTA 3N3EA 2J8HA 4UT6A 5I15H 4QJ4B 2HLAA 1E28A 3RGVB 1P5UA 2XY2A 3S3JA 1CS6A 5F7EH 3SBQA 2OR7A 1K2DB 1UWFA 2NW2A 2VZUA 3TA3B 5BOJA 1TTUA 3RJOA 5EBWB 4FNSA 1QBAA 1Y0LA 1W0WA 4HLZG 3GMRA 5CINL 2OYKA 2C3VB 4HF5L 4MQXD 5F96L 2HH0H 2ARWA 4A2GA 2NLJB 4XP6H 1AY1H 4Z7WF 2R4RH 4XNUL 4PY8J 1VADA 3AW5A 3RI5K 5I15L 2DWEB 1AHWC 3GSQA 1CFSB 2OZ4L 1OLLA 1KLGA 1FFNB 1JWUA 3GTTA 2V9UA 1WAEA 2QKIC 5GHWL 2WYHA 4PLKC 3HPJB 3OVUB 2F61A 2ADFH 1AY1L 4YHIB 4XMKH 2DWTA 3VX0A 2A6IB 2R4RL 2BVQA 1T7ZA 2PPCA 4RMUA 3WFBL 2OTWA 4N2GA 1T22B 2YAQA 3L5WA 2LR4A 2XACC 1CG9A 1FC2D 5AFAA 2NQCA 5EBMB 3UTSE 1BQHB 1UASA 3T4AB 4B7LA 1P5UC 4YHMH 3K46A 3CFKA 1ML0A 3CDZB 2ADFL 4PJGB 4LB8A 2PW1A 4XMKL 4XH2A 2DTMH 5D70H 4ERSH 3GTVA 2H32B 3QO0A 1L6XA 4F7KA 3UO8B 2Y25A 4AEHH 4PJEA 4Z7UF 1W72L 3CXDH 4AENB 1TKWA 5C09D 3O8XD 4M6OL 1CGVA 4YHML 1J1XH 1H8OA 4P07A 4QLRA 4JO4H 3WI9A 1UD3A 5LHDA 5D70L 4DSYA 3MNDA 2DTML 2JJSC 4ERSL 1K85A 4LCYB 3G5YB 4Y0GA 2ADJA 3Q8EA 5GS1A 2I60H 1USZA 1AKPA 1T7VA 1BFOB 1L6PA 2EADA 4AEHL 5B22A 2KQNA 1ED3A 5E7FA 5G4OA 1QFOA 1JG9A 3ZDYE 2H9GA 1J1XL 4JO4L 5BZWA 1UCTA 3BJLA 3MLXL 2DL9A 3HKFA 4P23D 5DVKA 3HZVA 5F2FA 3TFBA 4O5LL 1QR4A 3GSNH 4S1QH 1Z0MA 3QUYD 4R2GB 4AQ1A 4W9KC 2I60L 3SYAA 3LPOA 1JVOA 4MZIA 3O9WD 1KB9K 5JHDD 1T66C 1PNCA 2F68X 3O4OC 4PRPB 3QUXB 3D25B 2XTJD 4WO4A 3GQFA 3DX4A 3BP4A 3RB5A 1AS8A 1GYAA 5IMKB 3SDAC 3CHSA 3MRGB 4PJ9C 3MRIB 2FATH 2JJVA 3JWNC 3OF6A 1AGCB 4JZJB 2WY3B 3HEIB 4KROD 2A99A 1OALA 1BAFH 5LNGA 1IAKB 5C92A 3BQUA 4NQTA 2ZOLA 3TONA 4XVOA 5GS1C 3JV6A 2WP3O 4ZPVA 1ZGLB 1S7QB 1U0QA 1UT2A 3KPTA 3I9GH 2EVIA 3VAEA 2RFXA 2FATL 2FL5B 3V0VA 2PP8A 4J3XA 3FU6A 3MV7B 5D93B 1AO7D 2FO4B 3W0WE 1CUOA 3DKHA 5PAZA 1F1DA 3MGAA 4ZMPA 1NLBH 4U6YA 1NLDH 1QRNE 4XMTA 2HUEA 2XC8A 3FQ1A 4IKJA 2BRRL 4B3EA 1OSPH 4XHJD 2ENSA 3I9GL 3KLAB 1TZHB 3BO8A 5EBLA 5J4MA 3FQ2A 3ILDA 3QRGH 2GI7A 1RPUA 3RWJA 5AB9A 4Z95L 4PLOB 1MG2C 2ITDB 4CJ0A 3IDUA 1NEUA 4PV9A 4Y5XC 4N68A 2QJDA 3S96A 4AMXA 3DX2A 2DJUA 1NLBL 3TYFA 1AQHA 4DZ8A 1TT6A 1OSPL 4ZTPH 3FTVA 3HMWH 3O2VL 3K3QA 3H2PA 3D85D 2VW7A 1LO5A 3CZJA 3D39E 1JK8A 5J11C 4HOZA 6PAZA 5DLLA 4CL7A 1IC4H 4B9CA 5T1MB 2VLJB 1YUHA 4JDEA 4HDIA 4CC4A 2QVMA 1BBDH 1EGJA 2GIYA 4ORGB 4ZTPL 5FKAA 3HMWL 3BH9A 2YPKB 4NPYB 3RHWF 5JMOC 4XI5C 4OZHA 2DM2A 3BSGA 3X1EA 4PREB 4DNLA 1Z9SB 1XTMA 1IC4L 4MD5A 5J6GB 4MJ6B 2EDKA 2VTFA 1XEUA 4Q0XH 2GG1A 4FI7A 1NFKA 4Y88A 3U48A 2ICCA 4M56A 1I1YB 3ML9A 3W81A 3ZLQC 1QUNA 4PHZA 2HN7A 1ESOA 4NN5C 2YEVB 2JKJA 2GSGB 4L1LA 4UV4H 2DIEA 4EDXA 1EFQA 2O4EA 3UYRH 3X1BA 3S7GA 2PP7A 1TNMA 3IMSA 3OKDA 4LCUA 3S48A 5JXAH 3ZBMA 1JZIA 3OZ9H 4Z18A 4N1CA 5HYSG 3HE6D 4OF7A 4UQ2B 1EQWA 1PAZA 3WTYA 3AY2A 2BFVH 4UNUA 2DLGA 4XZUB 2CZNA 4G71B 2DF3A 4OJAA 2FH6A 4HK3J 5C6WH 5IWLA 3NACH 3FQTA 4PI2A 3WV0A 2BY2A 2GSIB 3NJXA 3EGSA 3TBTB 1WFTA 2PYFA 3PWPD 3A6OA 4N0FA 1NGYB 3CFDA 5DZVA 3T09A 4MRCA 4K5PA 4ODUB 3OZ9L 4XNXH 3ZKMD 1G9EA 2F54D 2GJ6A 2KDGA 2BFVL 3FUFA 3TO4A 1YNTF 4JQIA 5HHNA 1A4BA 3NACL 4N6RB 2GQHA 3VGDA 2B9BA 1RI8A 1KCVL 3OB8A 2HJFB 4NZ8A 1NGZA 3IRCA 3ARBA 5CGMA 5DR5L 4E9TA 3QEQD 1JZEA 4YDNA 1A2YA 4WI5A 4XNXL 1KN2H 4GP8B 1GSMA 1AS6A 3V6FB 5KYXA 2BJMH 1T04A 4F37K 3SQOH 2BOBA 2YA1A 3T9WA 3LNHA 3AAZA 2EEFA 3ZXAC 3LV3B 4LSSH 4AUUA 2O5ZH 5CBAA 2DN7A 2NR6A 2OMYA 2NSXA 1MVUA 4IRZH 3VFGH 4XVUC 2VC2H 4S0SD 1B4LA 2WB1A 4FZ8H 4JM0A 4WWPA 5ISZA 1KN2L 1NMBH 4BEIA 2NYYD 2Q87A 1YNTB 3GD1C 1YSOA 3P02A 4CNIA 5ID0A 4LSSL 5KANG 3QZWA 2YMOA 2D3NA 4W6XB 5IB3A 4IRZL 5BRZE 2VC2L 1K6QH 2AITA 4A2DA 2LHAA 1JGUH 2H7WA 2D31B 1QI3A 4X6CE 4ZUTB 3ENEA 4YFLI 2WLLA 2ZXCA 3PHQB 5EO9A 1AP2B 3ARBC 4TQ8A 3PWNB 3DHMA 4NJ9H 3F65A 3SODB 4NM4H 4ZFFB 2WXPA 4G8FB 3NZHL 1RLBA 3QI9A 1U3ZA 4OFQA 4JFWA 4I13B 5CD3B 1IE5A 2ED7A 2ZOUA 4MXVE 1K6QL 4C83B 2WKOF 3CFEA 3DX9B 2NR6C 4OKVB 1CF1A 1FZMB 4DT2A 1RUPH 4NJ9L 4WSGA 3CVDA 1CXIA 5C8JA 1CFQA 3ZY7A 3CN2A 2CCVA 1BD2A 1DVFB 4R84A 4XN4A 3QH3A 4GKSA 1LE9B 1KCRL 4LSVH 3RFZA 5DYOB 4OH2A 5GQBA 3ZPDA 3ZE2E 5T5NG 5AL0A 4E2OA 3L3DA 1CIUA 1IAII 1CT8B 3EYOA 2Z93B 1UB6A 1IC0A 5DT1H 2WQVA 3IDNB 5AKVA 5I1CH 3FO1B 3QI9C 3LH9A 4KNSA 4HCFA 4LLWB 3AREB 2D2CC 2E9WA 5HI4C 3B7SA 3RPKA 4PJ8D 2H5UA 4LOVA 1P7KB 4GKZA 3VFOB 3TH3T 2P8MA 1YCSA 2NY2B 5DT1L 3QNFA 3ZSTA 5E2WH 5A2CA 1A65A 3U0PA 3FTZA 1J48A 3LH8A 3KPOB 4YDJA 1XGQB 4FLHA 3IGUA 4E41E 4FFZH 4D9LH 2WSKA 2H47C 4D2NA 4XCEB 1F00I 5D5MA 3FT0A 4PJ7F 2K1MA 3ZJAA 1L3WA 1GCYA 2FJFB 2PWHA 2AXFA 5F89A 3B8SA 2Y1YA 5IVXF 2EUWA 1JFHA 5E2WL 2VXQL 3QIBA 3P9WB 1PZCA 5DI8A 3RX9A 2NX5D 4ABQA 2DKUA 3PAUA 4FFZL 3DYPA 5HD8D 1A9EB 4D9LL 3HS0B 2IBZY 1GZPB 3GSNA 4P2RD 3T2PA 3ARRA 3GM8A 4V2BA 1U3JA 4XN9A 2VKXA 5I6MA 4M6NL 3OZLA 4DO5A 4PWIA 5JHMA 5CN1A 1GGUA 5KYNA 2GITA 1XF5B 1DVYA 3IAPA 1KEML 4M93C 1KPRB 4XAWH 1RVFH 1ZK5A 5IEHA 1KV3A 4AIXA 3ARXA 3NCEB 1J5CA 1I8MA 2CR0A 1F4YL 3BRGC 4HUVB 2DBJA 4TSBH 3I6SA 4UQ3A 3FTWA 4PJ7B 3KXFE 2C9AA 4HJGA 1E5ZA 4H25A 1AGBA 3Q9PA 2HTKD 3RU8H 5JIPA 2HUHA 3WLBA 1GIGH 3ROOB 4XAWL 1FA4A 5FYLH 4DN4H 2DLHA 1NQBA 3UG5A 2P5WA 3CHOA 2NY1C 2Z35B 5I6LA 1GKEA 3L4CA 4H1LG 4GSQA 3QG6A 4PJFF 3RI5F 3V4PB 1CTOA 1IBBA 4KRLB 1RUKH 2QLYA 3RL1A 2BSTA 4NAMA 1T1ZA 5FYKH 4QHKJ 3X1FA 1SVZA 1J0ZA 1GIGL 3FN9A 4PJ5B 1BBJA 4HMCA 3D09A 5FYLL 3EO0B 4DN4L 4N1HB 4Y9EA 2DEWX 3SB3A 2EIZA 2ICWA 4P2OA 4ENEC 1UUSA 3CU7A 4HS6A 3II1A 4WHDA 1RUKL 5H35A 2GTWB 1RFDH 5HYQA 2YWZA 5FYKL 3BEVB 3GHEH 4EBQH 4OLZH 2V17H 1MCRA 3L3GB 4Q7DA 3GIZH 3R0NA 1U3NA 4HA1A 1EJ6A 4R7LA 4A7SA 2A7BA 3SCMB 4F7TA 1ACYH 2BIOA 5TK2A 1R5WB 3TC9A 5FEBA 1F4XH 4PJFB 1WBYB 4DP6X 2CR3A 4A04A 4BQ9A 2BX5A 2XA3A 5L0QC 2OMZA 1RFDL 5JHLL 2JCCB 3MV8B 3GHEL 4EBQL 4MWFA 2F7QA 4NQVA 1UWXH 5EUOE 35C8H 1U8LB 1AHKA 2GJPA 2X70B 3GIZL 1CBVL 3A21A 1ACYL 1N5AA 3QXAA 4JFOA 1WBZB 4O2CB 4DETA 1F4XL 5C0CE 3FOMB 5M94B 2PR9A 3H3KA 1N6VA 1MFCH 4AXWB 2ERJB 3BN9C 4NI6A 1UADC 4Z77A 3L13A 35C8L 2A4CA 1CL7I 4N24A 1CR9H 5DHVB 1FRGL 3O3EA 5I17A 4F7PA 2EXYD 1G7LA 3VTMA 1AKJA 1R9FA 4NZUH 5CCHE 1WIOA 2PF6A 1LP9A 2FECL 3Q6GH 2CAKA 3QP3A 3HMXL 3BGFB 1MFCL 2XQBH 3RY6A 3U6XS 3TBCA 4XPFH 1XH0A 1DSYA 2P8LA 1CR9L 3OHXB 5H2BA 4Z7VA 2VJXA 4TLKA 1BOYA 2VLRA 1OGAE 3LVEA 4UB0H 4WUUD 1RMFH 5FCSH 3Q6GL 4HH9A 4YS4A 4ZFOL 4A6YH 2WPGA 2YXWA 1WZ1H 4AKQA 4LXFA 1U6AH 2YRPA 4WO4D 4LO9A 5IQLA 2HSIA 5IREA 3RILA 2WANA 4HMDA 3MV9B 5ERWA 3D2UA 3UERA 1V27A 4KI5F 3OF6D 4I2XE 3LRSA 1ILSA 2AW2A 2L7JA 3I3EA 4YVNA 5GRVK 3JVGC 3PF2A 5DHXB 2NY4C 3BQUD 2FJHB 3T3MB 1KWGA 1U6AL 1G7PB 3QUGA 2IG2H 4PI0A 3RY6C 3Q5OA 2X4SA 4Y8DC 2YOAA 4XMLL 4P46B 4D9RD 1HHHA 3VQLA 4PR5A 2PCPB 2XN9A 1KGIA 4G2AA 4BINA 1RP8A 3K80A 5FR3A 2XIBA 4IRZA 1EMTH 4QT5A 5E8EA 4BDVB 4ZFZB 5I6NA 4IKNA 4UOQA 1EEQA 5JW4R 3FCGA 2IG2L 5IG7B 3P9MA 1G7QB 3RVWD 2C1PB 2NUPA 4Z5RB 2G4GA 3BT0A 3QYMA 1U8NB 5E9DB 1TYJA 3SDXF 3SBWA 4FG0A 3NJFA 1KIUA 5KG9B 3BLPX 5DMKA 1EMTL 5BOZG 4J3VA 5J3HC 2NYKA 4NM8H 4FLOA 2WJ7A 2EYRA 5C9JA 1VACB 1NPJA 2UX7A 1FCCA 3QO1B 4GKNB 3WNKA 5HI5C 5JZ7D 1GGIH 1DO6A 1JMZA 3SKMA 1B3JA 3O6KH 3ILPB 3B5TA 3SKNB 3FL7A 4QXGH 4F7EB 3CHXA 1BMGA 1U8PB 2VLMD 3PWJB 1OP5K 4HFUH 2XXFA 4NM8L 3V5HA 1KTDA 1QLEL 1QSEB 4RNRA 2V9QA 4KXZH 2XWRA 1GGIL 2V7NB 4DQAA 1JVLA 2BSBA 3GMMB 3FYIB 2YPLE 2VDQB 2OJ1A 3IMVA 4PWHA 3ELAT 3SGEI 3MUJA 3SDXB 4J3OF 2VDRB 4FQHA 4MNGB 1LVEA 1F3DJ 3FT1A 1FHGA 2C26A 2BO0A 2BSRB 2F6AA 4D7BA 4GAAA 1OSEA 4N25A 5E24E 5HVWA 5TF0A 1FCGA 4LGSB 4AOFA 3TWCH 1XF4A 4YXHH 3PDOA 1HHGA 1U8JA 2V8LA 1JIBA 1M57B 1NIBA 1PQZB 1T6BX 3WXVH 1MI5A 3L4TA 4GBXA 1NJ9A 1ZLWK 1E8YA 3RJDA 3WUZA 1J5IA 1PKOA 1BV8A 2BOCB 2R0WL 2Q20A 1D6EB 3TWCL 3QZNA 4X98A 4LCWA 2A5UA 3IJHB 1GKOA 2VR6A 3OR6A 3L4ZA 3WXVL 3OD3A 4A7TA 4ZUUB 1Q9LB 3OKEA 1BVKA 2VZ3A 2Y4SA 2X3CA 4ZYKB 1ZLVH 4E9SA 5DTFA 4P4RA 1DZBA 5F9WB 3NYKA 2RBLA 3D48R 4L4VA 3ZDZF 3RWHB 3QDJE 2G3NA 1YN7A 3LY6A 7CGTA 1UB5B 1KGXA 2WXKA 5IR1B 2GJ6D 5I2IB 2V7HA 3TO4D 1HZKA 1NBQA 1SXZA 2EICA 4FAAB 4JQVC 4BGDA 1UKSA 1UD4A 4LAJH 4WFGE 1UXSA 4GBXC 3WHXB 2UWEE 3D18B 3WOVA 1YNKH 1SLWA 4P2YA 2Y6SC 3B7YA 2XWTA 4DO6A 4NNXB 4ZMOA 5J9PB 2C1OA 1X44A 5EC2B 2X0WA 3QARA 4OTXH 4DHLA 3CVIH 5BS0B 5KUKA 1HAWA 5DHYB 3SO3C 1JPTL 2HLEB 2M8XA 2PABA 4IS6A 5A6MA 2NR6D 5F9WC 1BXAA 1D5BA 1N6UA 4I0PA 1VFBB 2J73A 3B43A 3BIBX 5DD1H 1YNKL 5K9QI 2QGCA 1H15B 3N9GH 1VFMA 1XMWA 2PXYB 1J05B 5ISZD 3PHSA 5LG6A 2X28A 1JRHI 1AVAA 1E9OB 3EFFA 3FTGB 2GABA 3IJYA 4YDLB 4I8DA 1EEUA 1EBPA 2PPDA 4LHJB 2MOVA 1U21A 3EXJA 4M1CD 3DHPA 1VKXA 2B7DT 3Q6FB 1BF5A 5DD1L 1IAOA 3N9GL 2CXGA 4M48H 3BP6A 2CM5A 3KW7A 3ME0A 2YD3A 3P9LB 4IKKA 2I7OA 5T1DL 5I71C 1NWPA 3GO1H 3FSZA 3VXQA 1SJEA 3UTTB 1DLFH 4WNQB 2BMKA 2IH1B 4KMTH 5SWZB 2PO6D 1RUQL 4PG2A 5SWQA 2CO6B 3QJFB 3OJDB 1IU1A 5C0AB 2XCMC 4I0PC 3ARDB 1LM8V 4OFDA 1BXVA 4EVNA 1DANU 1H6TA 3GO1L 3AVEA 5CLWA 1DLFL 5L9DH 4JDVA 2DMHA 1A6WL 3CGTA 1KTCA 3NFNA 3N04A 4KMTL 3VTTA 3JV0A 5CJQH 4IW4C 4JO8A 2XG4A 3NCWA 3TPKA 1HHIA 2AQQA 3K4ZA 2V4LA 4P2CG 1WFIA 2DYPA 5KEZA 3MRDB 4OI7A 3BSZH 3L45A 1N70A 2XPGA 4M7LH 4GP5B 4PJCA 1C8PA 1QSFA 2DICA 5I1GH 4M8VA 5D2LF 5CJQL 5AOLA 2CO3A 4K73A 1CC3A 3QXWA 3J7HA 3SKUD 3NA9H 2VITA 1BPLB 3ALWA 5DJZB 4J3BA 3H7BB 3GS0A 1KYUA 2DQCH 2X4UA 3BT2H 4M00A 3AXLB 1R75A 4CILA 1QACA 2OMTA 3MRNB 1RZ8B 4V11A 5CEXB 1RK1A 1MOEA 3CH1B 1J11A 2EZ0C 5I1GL 4YFEA 3LQAL 3ZRSA 3AQXA 3D0LB 3NA9L 5A2AA 5A7EA 5MERA 2DQCL 4KO6A 5MI0C 1H3WM 1EO5A 2ZT9C 1NWOA 2IBBA 3HUJA 2NNAA 3M46A 1O9WA 3IGAB 3T4YA 5ITBH 4WF7A 4IDJH 1UOWA 2ED6A 5D2LB 1ZA6B 1OT4A 4Y4KA 1S9VA 3DV6A 4XAKD 3G04B 5CLXA 3U83A 5DA4A 1P4IH 3QIBD 4WK0B 4QYOA 4QIRA 4F8OA 4XTRC 2DI7A 1JUFB 1J8HE 3NPZB 3QG7H 3OKMB 4I3RH 4JE4B 2BY3A 4ONGH 1MFBH 5ITBL 5HDQH 4ZMWA 1FG2B 4PJAF 1EXHA 4A6YA 4PG9B 5J6HA 4NUGH 4RDBA 4KUCF 1BWWA 1HL9A 2MHAA 2APWA 4JKWA 4NWTH 3PS6A 5D1XA 1YJDH 3BWUF 2PWFA 5L7XH 2O93L 3IKKA 1XGYH 4PLJD 3DETC 1QD0A 2MCPH 3K2MC 4I3RL 1U8MA 3TF7C 2IAMB 3FS9A 1MFBL 4ONGL 4MX7B 5HDQL 1Z66A 1FE8L 1CDUA 1QZ1A 2EXTA 4NUGL 4OZIE 4K3JH 3FXIC 3OHMB 4ZO7A 2Q7YA 2EIBA 4JY4A 5GGQL 3UPAA 4YSDA 3WFHA 2YLKA 1YJDL 1FQ9C 3Q13A 1VFOA 2X2IA 1A3LH 2WV3A 4PM1A 5L7XL 2FO8A 4PU2A 1F0LA 4CSTA 1XGYL 4HJJH 2MCPL 2ATAA 4PJAB 4E5XG 5IKCA 5LWYH 3NIFF 4L4TE 5AD0A 1KCSH 3INUH 2QSVA 4K3JL 1FNEA 1ERNA 1TPXC 2CBTA 2DJMA 3IDYC 3O0RH 4NEHB 1A9BA 1A3LL 3HG5A 5SWSA 3V4VH 2DMKA 3VCLA 3P0YH 5IUSA 2XWBB 3KYOB 4OCNC 1S9YB 1Q9OB 4HJJL 4NUQA 5HPMA 1S78D 3BN9D 4P9HL 4P2OD 1HILA 1TQTA 4YFLF 1KCSL 4NRXA 1YEHH 4ZD3H 3C60A 3O6FA 5A40E 2MCG1 2AS5M 2N0MA 1UOVA 3O0RL 5FWRA 4AUJA 4HK0A 3V4VL 4HIPA 3P0YL 4APXA 5F0PB 2EDYA 3TP4A 5DJ8A 5TE6L 1FPTH 3T1WA 3NIFB 2ZX6A 3AABA 4UDUA 2BXZA 4OJFH 4ZD3L 4NO3B 1YEHL 3HC0A 2R2EA 3BZ4A 5HJ3A 3MRCA 4GG8B 1HAUA 4Z7QF 2AK1H 1YEKL 1MSPA 1Z5LA 4FGMA 1KACB 1II4E 3NMEA 1HXYB 4MMYA 1KTLB 1W0YT 3MRPB 3HW7A 1PPIA 3ZZLA 3CPLA 4YJZL 1JERA 1FNSH 1I9JH 1WZKA 4YLQT 4AEFA 4OJFL 2FO1A 5D6CA 1JNJA 3D51A 4ZOAA 1G94A 4NQEB 1K5WA 4OY9A 2AK1L 3GJFK 3H9SB 4X5WB 5E8PB 4H8VA 3UTSA 3PP4H 2YGOA 3AS2A 4AYSA 1AKJD 2NY4D 4PRIE 1FNSL 4LEOB 1I9JL 2FJGA 2A9AA 4NZDA 4TVUA 4Y4HB 3AWEA 3U4BH 3G6AA 1OAYH 2UYLA 3WFEL 4Z7QB 4WU5B 2IGLA 5KSAA 4X7DC 1Y18A 1OGPA 3MO1B 3ZGIA 2JKLA 5HHQB 4HFWA 3PP4L 5D2NE 3ARFB 2A4EA 5DGQA 2VLRD 2EUZA 3WHE0 2VXSL 5AW0B 3UTOA 4U3CA 5JOPE 1YNLH 1IGYA 5IHLB 3B37A 3U4BL 4NP9A 1OAYL 5F1IB 1F4WL 4WFFD 5FX3A 5D1QE 2A9NH 4LGRB 1PLGH 3AU1A 5F6IC 1W6LA 2E7BA 3F7VB 3MLVL 3DI2B 1HHKB 3T0BA 5ADOL 3D2UD 1YNLL 4OQ1A 4RBPK 4NAQA 3SY0A 3N44F 1ZLSH 4E68A 5J0BA 1P1ZA 4DEPC 2AV1B 1IM3B 5D7LD 2A9NL 4DERA 2OZNA 2X4OA 1PLGL 2DQEH 3E80A 4EI5B 3Q06A 2FGWH 4MAYC 1FZJB 5JHAA 1P2CB 3Q01A 5KSAC 1IGCH 3KR3H 1BZDA 3LKSA 4AJ0A 2DQHL 4FABH 4PVBA 1F58H 2VDNH 1MELA 1E8ZA 2WZPD 1SFDA 2XN9D 3FO2A 2EKSB 2VLKE 4RAVA 3MCG1 2DQEL 2YD8A 1U58B 2FGWL 3G5ZA 5AWNH 3B6SB 1F45A 2D7NA 1IGCL 3RZCA 4OZGF 5FFGA 4FABL 2VCOA 1MCSA 2VDNL 1F58L 2DEXX 5A2IH 3N44B 1XV8A 2TAAA 2WLJA 3IT8D 3OMNB 3HJEA 5AVRB 3KD4A 2Z1KA 3W0WA 4U1KB 3J07A 4H8WH 4KO5A 4OM1L 5F7YC 4WI0B 1JWMB 5DRZA 4P04A 3FSVA 1QRNA 5IVXE 1U8IB 1TSRA 2YS4A 3LNFA 5AWNL 5B8CB 2OSLB 1HL4A 1NCDH 2ITCB 5DJYA 1Q8MA 3C6LA 3QCUL 1P5VB 3DX8A 4ZZKA 1DR9A 1RUAH 1MEXH 1W2KT 1PD6A 4ZMNA 4BSVB 2DWYA 4GSDH 3HZMB 2F9BT 5CR1A 1BLNB 4I1NB 4WEUD 2CLVA 4GLRH 4QEGA 3GTNA 1NCDL 4MSWA 4BH8B 1WRFA 4NRZB 1ZT1A 2IADA 3D39A 2OP4H 3GGWA 1B4TA 1RUAL 4BQ8A 1G43A 2ALAA 1TVBB 1OTTC 3R06A 4GSDL 5F7LB 1DEDA 1MCWW 2YAHA 3ARPA 1MY7A 4Q2ZB 1J10A 2DTSA 3PDDA 4R97C 5ALCH 3BSZA 4GW5B 2XHNA 4H13C 2VXUH 2OKMA 4Q9QH 1MI5D 4GBXD 4G7YH 3TEXA 1IMHC 3HOGA 2OP4L 2VZ1A 2EINB 3EF7A 3K1DA 1Z3GL 4HUKB 2PTVA 4HV8A 3ZDXE 4GUPB 1RURH 2YUWA 5BPPA 5DJXA 4TXVB 4RZCB 2V5YA 2W0PA 1M1SA 3CFTA 5ALCL 3FULA 3MU3A 4HEPA 2ZKXA 1AIFB 2VXUL 3HHMA 4N85A 1FL6B 3N50A 4G7YL 1RHFA 2E4TA 3VSQA 5GS2H 4WWOA 1EEYA 1AZZC 5AOKA 1CN4A 1KCKA 1E6JH 3WIFB 1NCAH 1SFHA 3D0AA 4L4VD 1XH1A 2W0LA 2QMKA 4GMTH 4HVBA 4O4YH 5DGRA 1DN0A 1HVXA 1AJ7H 2HJKB 2AMGA 3LSOB 1J8RA 4JLRA 4G1EA 3AWFA 3MJWA 3ZRCC 5M7QA 4DP5X 2FQGA 2Y69B 4RESB 1E6JL 3VFWA 1NCAL 4HKJB 3PHOA 1NA8A 3VG0L 1YEDB 3LQAC 1NIEA 4GXUN 4FI6A 5KYUA 4GMTL 3OLDA 2HKFH 1AJ7L 5D7EA 1MXGA 2K8MA 5GIRA 5IHBA 2FBOJ 2OA9A 4P5MA 3IS1X 4I0PD 2ESVB 4LIQE 2WYTA 4GIOA 2B1HH 2MNUA 3GB7B 1F42A 4X4ZA 1X4ZA 3OX8A 2X9XA 2ZXBA 3I9AA 1BG1A 3VI4F 4LSPH 1KJMB 1R5VA 3IEAA 3COOA 3M17B 4LLVA 5JORA 3TU6A 2HKFL 4U6XB 4U3SA 1CXEA 4B3VA 4L0YA 4OGAD 4GT7A 4FEIA 5HBBA 3TZVA 4IJ3C 3O3AA 2FD6L 1M05B 5DHEA 3DMMB 1U93B 3TYGL 3PGFH 3WN5A 2A77H 1PTZA 5C7ZA 1TO4A 5SX4I 2YQ2A 1L9SA 2R0ZH 5K5YA 5AKRA 4M5SA 3P40A 4QO1B 1OAZL 1JGEA 5FF6B 2RMNA 4NSKB 4AH2A 5EN2A 1I1RA 3MNVA 1Q90A 2IDUA 2Z65C 3MQIA 3PGFL 2A77L 4P57B 3IFOB 2YEQA 5BRZA 5EUKB 3MRLA 1A1NA 1HHJA 3VI4B 4QOKD 5IMLA 2NY0D 4ZAKB 3GI9L 4EIGB 4X6CA 4B53A 5DRXB 3QUZA 4FA8A 1WHPA 2LOEA 4P48A 3V4LA 1YJDC 1IZJA 1KXHA 1JJUA 1REIA 2OMXB 1WWAX 2V5TA 1W80A 2X4RB 3KM1A 3CPUA 5KUMA 3VXNA 4PUBH 5H94B 2CKBB 2XBDA 3D52A 3GLEA 3BZDA 4U1GB 3TZVC 2DYPD 4NX0A 2AJZA 3WN5C 1I75A 4M4RA 4XGZA 2PUQT 5LNEA 4NT6B 3RWGB 1E9QB 4CJ1A 3QIWD 1WC7B 3DXAB 2E8YA 3MROA 3D4YA 2FX8L 4NN6B 3T0XA 3DSNB 4AX3A 2OMUA 5IJCC 2VE6B 4PUBL 2JQMA 4ANUA 1VLXA 2IXQB 2XICA 4P9HC 2H45A 5DZAA 3ASNB 3VVVA 1H0DA 1ETZB 1IFRA 4WV1B 3WTVA 3UIYA 4AVJA 4F20A 3MLZH 5EDSA 4RAHA 3LKPB 3SE3A 1FHNA 4ABUA 3ZKQD 2IQAB 4HXAH 2ZF9A 3O2WH 5K1NA 3QUZC 5HVHB 3DPBB 4RRPM 2BIPA 1JPST 1XSOA 4DOHE 1CLVA 5L6YH 4ZQTA 2OL3B 2X5PA 3PXJA 3HNVH 4PYHA 1JGDA 4PP2A 3ASOB 5LAXA 4Q6IA 4MDJA 3MLZL 4XCNA 2E9JA 4HJ0D 2YZ8A 2BINA 3KGUA 4APQD 2EO9A 3O2WL 3QXTA 3KGSA 4LEBA 4OSUH 4R3SB 1WBXA 1XSJA 5KSBE 4Y4KD 1JMXA 1PD1A 1H5BB 1ET5A 1EZVY 2VMDA 4KTDH 1R3JB 5L6YL 4OLVL 1GMEA 3FQXB 4GXVH 1DN2A 3GZKA 3K5RA 1RZIA 1KELL 2PCFB 4E41A 3QQNA 3K72A 2W92A 3BUYA 5EEWA 4OCSH 4OSUL 2ZWNA 1OP9A 4BUGA 4EI6B 4NQSB 3MXVH 4XWGH 4HKXB 4GXVL 2CIKA 5D1XD 3CVBA 2DAVA 4EN3B 4V2CB 5FO7A 5T1JA 1G7HB 5I6PA 3BHBA 3MOAL 5INDA 1IEAA 1MQ8A 3T0EE 1U8CB 2ZUXA 3QNZA 5GZOD 5C0JA 1SN0A 5MENE 2ZICA 4ELME 1LDSA 4KKAC 5ITFA 5CHNB 4N5ED 3DNKA 3MXVL 3FSWA 1KGCD 5CEYB 2Q8AH 3WS3B 5MHSD 1KFAH 3HBQA 1P6WA 4Z0BH 4AYMC 3QXUA 5DJDA 3SE9H 3CHRA 1WUZA 4MNQE 4NDMB 5LGKA 4PTUB 1MCCA 1UM4H 4JPVL 1ORSA 2BW4A 3P77B 1U3HC 3GSWA 1BOGB 4RGNC 1NUDA 3DRQA 5EEYA 3KXFA 1YDPB 4H7VA 4OCWH 5EOTB 1ADQH 3OXRA 2W95A 4FG6C 4U1HA 1JTOA 5KSVB 1MHHB 2R69H 3JV4A 1R5IB 3BGMA 5FO7B 1WAAF 4FQXA 4Y8AA 1KFAL 4UT9L 4Z0BL 1X5FA 2B59A 5SWSD 3ZDZE 4G43B 1XGPB 4L29A 1RIHL 2DIAA 3SE9L 4F7MA 2J8UF 3WIHA 2QTVA 3EJCA 3WXWH 1UM4L 5I66A 3SYPA 2RCSH 1KXVA 1OAJA 3ETBF 4ICWA 1Z5HA 5IJVA 2AQTA 2CDGA 3C60D 3CSFA 3NZSA 4KJWD 1AR1D 1ADQL 1MFDH 3O6FD 4OCWL 4JY5H 3K81A 3UP6A 4LPCA 1N0XH 1N64H 2X88A 4F2FA 1MCQA 1SDAB 3OSVA 4Y4FC 4WTZA 3U2IA 1IQDB 1ZSHA 5I0YA 2X38A 3GZOA 2RCSL 3RTQA 1UWEH 3K0YA 5JHDB 2MPAL 4LPWA 3SKOA 1GY2A 1MFDL 2XTJB 2QBWA 4JY5L 3B2VH 4J6IA 4MB5A 2GKIA 4IHBA 4M6MH 5EU7C 1N64L 4HWEH 4N8VB 3U7WH 2ED9A 2HPTA 4OVVA 4MZ3A 2EXWD 4AKPA 1QTYT 2J8UB 4XC3H 5CSGA 5AUMA 4YHYB 4YNYB 1HJBC 4MYPA 2J25A 5KVMC 1XXDC 1KTKE 4FXGB 4GOSA 4OD3L 1UWEL 1FUNA 5IM7B 4TUOA 1ET7A 3CZSA 2AVFA 4R7DB 3ARVA 1SXAA 4EQ3A 5C0BE 3B2VL 3BUDA 1NCCH 1KXVC 3HRZA 5EUOA 2Z92B 3HFFA 1F56A 1T7WA 3L6FB 4XC3L 4YSAA 3UZEC 4ESKA 5C97A 1TU2A 1AQDB 4HU2A 4HZLB 4PEEA 5C0CA 3HB3B 4GKLA 1CZ8H 2YKKA 2CHZA 3FPYA 3F8UB 2CUHA 4XZ4A 2A2QT 4KFMA 1LEIB 1NCCL 3EOBB 5T5FH 1N5YH 5CP7B 5I30L 2Y1VA 4OBSA 4FERA 1I3GH 2Y5QA 3BYYA 2D0GA 1JZFA 3VXOA 2ITFA 1EIBA 4LLQA 3EOYG 1E65A 1CZ8L 2G5BA 2L04A 4NUMA 2Z64C 4WFHE 5ESQA 2ZNXA 3MLRH 1ZV2A 4GW1B 2R56L 2FSDA 2VMCA 2EYSA 2AEPH 3L3IA 5T5FL 5DEFA 3WE6A 1N5YL 1NBZA 2ZSWA 3PNWB 4G70B 3FZUD 3D85B 4J8RB 2BVPB 1KCBA 4JFFE 3UMTA 1OGAA 5BQDA 4H5SA 1MHCA 4K5NA 3B34A 4MJIB 1GGCL 1HL5A 5GSRA 1OGTA 3MLRL 2OS7A 3KPSE 2FLBT 3VM7A 3DBXB 5AZ2H 1P84K 2X4PB 3WKNA 2HRGA 2W81C 5HDBF 1JGIA 4Z3GA 1ZHLA 5FAAA 4K4KA 5MEOA 1WHOA 3S35X 1D7CA 4JDTH 4I2XA 5DK2A 3RVVC 5FV2A 3A47A 3KPPA 3GMNA 4TRPH 1URLA 5SV3A 3SDCA 2ICEA 4RMBA 5AZ2L 4IIQB 1KEGH 1WT5C 1NINA 3QQ9D 4IRSB 4MA7H 2WWKT 4ZW8A 5L8LB 1FVDB 3RZCD 2VR9A 2Y2WA 3NCMA 1PZ5B 5E9AA 2ZUQC 1ET8A 3W0WD 4LSRH 3VFUB 4ES8A 4MS6A 4TRPL 4RGOH 4HP5A 3UG4A 5C0RL 3LPFA 2PYEB 1QRND 3HAEH 4OAWA 4QI3A 2LVCA 5HDBB 4JREC 5C0GA 2YQ3A 3UDWC 5DK0A 3HE6B 4PRHB 5EIIG 1KEGL 2ZP8A 1NPUA 3ROLA 5JLZA 3ABMB 4KJPC 3TM6A 4P8QA 2EEDA 2WK2A 2N0KA 3C6LD 3EO1A 3GZPA 1JS4A 2OI9C 1QI5A 4LSRL 4YWGH 3U2SA 4JFEE 4RGOL 1EUTA 3CMOH 2GCYB 4Y5YA 3PWPB 5C6TL 2C3WA 3REWB 2NT0A 4U05A 3AM8C 1NMCC 3WFZA 1XCQB 5A7BA 1S7XA 2Y22A 2F54B 4MQSB 2EE3A 2ICEC 4AT6A 1OP3K 4TOYH 1X4YA 1MY5A 4PJIF 1ZIBA 2AKRA 4JRXE 4JJOA 3V4UH 4NRYB 2GUOA 3U0WH 4A7QA 3LKOB 1FO0B 4G9DA 3QEQB 4GKOA 3CDGB 2C4FT 2J6EL 1UD6A 2ICWI 4GAGH 3ZIYA 2RGSA 4WTXA 3M1BB 2YPLA 4OKDA 3C09B 1UZ8B 3DVGB 1W6WA 4QRPE 1RU9L 4TOYL 2ZUTA 3AWGA 2GC7C 4DP1X 3U1SH 3V4UL 2Q3XA 3ET9F 2ILLA 2OJEB 1AXTH 1HSBB 3U0WL 2AXJA 4NLAA 2V3FA 2VL5B 3DOSA 1WO2A 3EUDA 3VRIB 3TNMB 1WWCA 2BP0B 5CCGE 3FK3A 1QQDA 1NDTA 3CV5A 1T80A 4UM8A 3U1SL 4LKXB 3Q2LA 1WEJH 4OUUB 1AXTL 4C56B 3P73A 3HI5H 3ZDWA 1ZT4A 43CAB 5KANI 5BNXD 1A7QH 2W9DH 3SE6A 5ACZB 4WDIA 2X40A 3QDAA 2WXGA 5I23A 3DTXA 1WEJL 3TJHD 4Y9CA 1HEJC 1AC0A 3DUUB 3WNIA 2FWUA 3N42B 4MMXA 5I82A 4G8GE 3HI5L 1MJJB 5HY9A 4CMHB 4WHYH 4IJTA 1A7QL 3QDJA 3MCLL 3IYLW 2EJ1A 4HBCH 5IF0A 4Y9GA 5DFWH 4PGCB 1A4AA 1U41A 3ISYA 5FOBB 3E8VA 4M8QA 4GAJH 3OC8A 4Y7OC 3MRFB 3RFRA 1E42A 4MNHA 2WQSA 2UWEA 1J1OH 1OT2A 2ZOKA 2OJZH 2BNQB 3LNEA 4U1MB 2JVUA 2RQEA 3T77A 2UZYA 2H26A 3R19A 2BIQA 4GYBA 3TEUA 3BVUA 4M6AA 4HBCL 5IT2L 3K6SB 5T1KA 2DY2A 5IROA 1OT1A 4MRBA 3FHAA 1YMME 4GAJL 4ZK8A 4ZXBB 2YC1B 1AI1H 4CSSA 1CDHA 3EBGA 4UU9B 4WCYL 2OX5A 1JPFA 5C07B 2I26N 1J1OL 3CN1A 4L37B 4E9RA 2OYPA 4JKKA 3HHSB 3NCJL 3RWFB 4MMXC 5HGAB 3RBGA 5EFIB 5CZXC 3EYVB 1LK2B 1WSST 5IW6A 1IKFL 1X6NA 7PCYA 3FQRB 3BLBA 1UA6H 4MD0A 2WXLA 1FVEB 4JKMA 5BRZD 1PIGA 5I6OA 1UH4A 3Q48A 1JWSA 4N2IA 2R69A 2R1XA 3NIDF 2J4WH 4GUCA 4HUMB 1ONQA 4Q56A 3E0GA 3TFKC 3H8NA 4Z6AT 4MAUH 1QA9B 4M7KH 4YK4B 3G6DL 3PG2A 4AJWA 3HZKA 1UA6L 5IBUG 1HKLL 3I6KB 2VSMB 4YR6A 5HHME 1PD0A 5BUAA 3UBFA 1G0DA 2OM5A 3EF4A 5FO9B 3CZLA 3VI3E 5C0IA 4OM0H 3C5JA 4Q6YA 2J4WL 3OPZL 1XGTB 1F86A 2NX5B 1RZPA 3VFMA 5AQ0A 3UL4A 4YXKH 2P26A 3DX7B 4L4JA 4P2RB 4ZDHB 4L9DA 1DEEB 2EDOA 5A2FA 3QUXC 4Q8BA 4AK1A 1OE3A 2P28B 3NCYP 1BDYA 2JQZA 4G7SB 3NIDB 5HHOE 1A4JB 3OPUA 3V4PL 2Z31D 1FV1B 2AXGB 2LLGA 3WL9A 4QYAA 5F21B 4YPJA 3VGEA 1T1XA 1AHWB 2WB7A 3H54A 4NUJB 4QXTA 4D3CH 4OZGE 3NQIA 2WTRA 5HVFB 2ROXA 4JHAH 2W80C 1HFUA 1XZWA 1OB0A 2QKIB 3BPNC 4QRQB 4U1NA 3C9NB 1PW3A 3IDGA 1CGUA 1U4FA 5E99H 5D93C 1NGQH 5EU3B 5EIIA 1LE5A 3OZKA 4KRNA 2F8XC 4D3CL 1I8LA 2W1NA 3IWVA 3HA0A 1JSYA 2DWSA 2HLAB 5AW6B 4QHLA 3WJLC 4E42A 1P5UB 2QVKA 3OGOE 3U9WA 1GS6X 2Z7YA 2QV4A 2NW2B 2PTTA 3DUSA 3T6QC 3C2AH 3DYMA 1Y0LB 4WO0A 1W0WB 1ZTXL 3GMRB 3TA4D 5E99L 1TEFA 4P2QB 3K2UH 1OSZA 3IN0A 3NK3A 3KLQA 4B9PA 4E41D 1NDGA 1VADB 2EDMA 4FG6D 2E75C 4GG6F 3GSQB 4Z3FA 1JVKA 5E00A 1H9DA 3RQ3A 1KLGB 1JWUB 5EBGA 1NIFA 4TF4A 1ZSDA 1DJIA 2YD0A 2CNZA 5DZOA 2XNAB 3MBEA 3P30H 1N12A 3K2UL 1OM3L 5FA4A 1FSKB 2BVQB 1J8HA 4Z7AA 1E50A 1BJ1H 2CRMA 2OTWB 4MVBC 4P5TC 2OK0L 2M83A 3QZLA 1CG9B 5DZJA 3T1FB 4LIQH 2JJTC 4WWKD 5AENA 5C0NC 1NAMA 3N2JA 4Q9RH 1M7XA 3CFKB 3P30L 2G2NA 3QCTH 4XH2B 5MP6L 2PW1B 3I6LE 5DCCA 4X6DB 1S7SA 3BAKA 3AY4A 1Z7JA 3QO0B 4AIEA 3U7YL 1R46A 3JWDH 3CN0A 5I1AB 1WD9A 2CJTA 3HC4H 3KXFD 4PJEB 1EZLA 4OZIA 3IAGC 1TKWB 4JUSA 3VD2A 2ENYA 4G6ML 2X1OA 1A0QH 4FQXD 1SMOA 4Q9RL 2GIMA 5DU7A 1IEHA 2ADIA 4R4BA 1I4FA 3MUUA 2A83B 4HIEB 2ZJSH 5GS1B 2YXMA 3JWDL 3MBEC 5IMMA 3HC4L 4L4TA 4FJZA 4UQCA 5CO1A 1C12A 1ED3B 1DBJH 2H1XA 2ZKYA 3HAEA 2H9GB 1A0QL 5BZWB 1AZCA 1TZIA 1F90L 4PS4L 2BLFA 3HZVB 3OR7A 4PJXF 3TN0C 4AQ1B 2WUCH 4TUUA 2ZJSL 1F97A 3P11H 2ITEA 4XNBA 3IE9A 3RTQD 1G7MA 2CMRL 4XPHH 5FUOH 4WO4B 2XQYA 5I73B 2BSCA 3VB9A 1DBJL 2A9MH 2LLLA 3EXLA 1HNGA 1AOZA 5AYUH 2QR0A 1FH2A 4R4NC 1TTGA 2WUCL 1FL5A 3BVDB 3P11L 3SGKC 4XPHL 1G84A 5FUOL 1EJ8A 1UEMA 1X9LA 2ZOLB 1QBLL 3JV6B 1FLRL 4ZPVB 3ARGA 4PJHE 3ZMNA 3FH5A 2RFXB 4NQCE 3V0VB 2XZQH 4JS7A 5DS2A 3BFOA 2PNDA 5C0CD 4QJ5B 5LXVA 5EZLA 4KZDH 1KYDA 3QWNA 1GA2A 3MKGA 3IFPA 2H2SD 1U92A 4A67A 3GRBA 3QQDA 3S5LA 3TV8A 1C5DA 2C5DC 5DF0A 4GT0A 3BO8B 2EYTA 4PB0H 5AEAA 2EVJA 4PBDA 1V3LA 3RWJB 4LNVA 4PRIA 2VDQL 3NRPA 4OZHF 5IHUH 1CQKA 4PV9B 5AVSB 4KZDL 3S96B 4HGMA 1WCQA 3TYFB 2ETWA 1T4KA 4V1DD 3WUWG 2CNYA 4KTEH 1PY4A 2FLRT 4NN5B 3KBFA 5D2NA 3HG0A 1LO5B 4O58H 2B08A 2FVNA 1TQCC 1JK8B 3O6MH 4PPTA 2Y07H 2MMXA 4JHVA 3UO1L 3VXRE 3VD7A 2I7SA 1NZRA 4AZ8B 5IHUL 5K33A 1L9TA 5JNYA 8FABA 3IETA 5D1QA 5GRJH 3N0PB 4HDIB 2EDDA 4K23H 3T08A 3H42H 1BQSA 5FKAB 3CFJA 2VQ4A 2GUYA 4KJPD 4C8XA 3BH9B 2IEPA 1QHPA 4O58L 2EABA 1DVFC 1NFIA 5KJ7E 4DUWA 3QDME 3JTSA 5CBEA 4ZMVA 1BZ7A 3QJZA 4MD5B 4HEME 5IQ9B 5E9NA 5GRJL 3KM2A 3SDCD 3NSJA 4K23L 1IBGH 3UCRA 1V10A 2O5XL 5B4MD 3S3BB 1CGYA 1XF2A 5CP3A 3SDYH 2Q8BH 1QUNB 2HN7B 2FT6A 2Y36H 3ZE1E 4A2LA 2WO2B 1LO4L 4NFBA 4KBPA 2HLFD 1J1PH 3K6DA 1I7RA 1A4KA 2FQEA 1S7UA 3PXHA 2VLKA 2HFFA 1FAIH 3PWLA 5DEGA 3WNPA 3OKDB 2J71A 4LCUB 3MRKA 1KJ3H 5EIQA 3TT3H 5CGTA 1FORH 3SDYL 2P1YA 3MAWA 4IRJA 5MEQB 3Q2WA 5JW4Q 4ZFGH 4G6JH 1J1PL 3FQTB 4ZBJA 3RKDD 4AGMA 4U1JA 1FAIL 2GBAA 4PJGE 4N0FB 3CFDB 5LGHH 4X9GA 2H6PB 1KJ3L 4DPCX 5F3FA 4JM2A 1J9TA 4JVWA 1BVNP 2GJ6B 4HUUA 2GK0A 3TO4B 1AE6H 5GGSA 1TYEB 3FUHA 5I1EH 1NGWA 4G6JL 3CQFA 2G3MA 5HHNB 2Q6WA 1ZS8A 4UQ9A 5DRNA 1NGZB 4BCZA 3ARBB 5C1MB 5GS0D 2XT1B 5LGHL 1E3XA 3ESNA 1A2YB 5FUZL 1GH7A 2R51A 5C7XH 5KYXB 4JM4H 1T04B 2YPLD 3QCVL 2HMID 4D9QE 1D5MA 1AE6L 3AAZB 3KE0A 1EO7A 2XPZA 1XF1A 2A3TA 3PWUA 2OMYB 4L1SA 1QFWM 1MJ7H 2ZXDA 4IRJC 4LRNH 5FFLA 1XR9B 5ISZB 3Q2CA 2GB2A 1NSNL 3D05A 4JM4L 1XH2A 1WAAE 3L7EA 4J3TA 3MBXH 5ID0B 3QZWB 3ZQWA 5JO5A 5IB3B 4KXZI 1MJ7L 4LPYA 3O3DA 3DRTA 4BCXA 3ULUE 4LRNL 1J88A 3WEMA 4RA0C 4ODXA 4WRLA 3A22A 5F8RC 2WLLB 5EO9B 2BFGA 3LEXA 3CJJA 4UILH 1IKNA 1TZ8A 3LQMA 3MBXL 4TVPE 2VABA 1DJHA 3QI9B 1KB5H 2IH8A 3VU2A 1XVSA 4ZI8A 1L9MA 4YGVB 5LVEA 2I07A 1IGMH 4PVNA 4Q9CA 2IDSA 4UILL 3QQ4A 3QDJD 3N91A 2BS9A 1WZLA 1QW8A 4XBPA 3GSOA 5C8JB 4YX2H 4M7JL 2OXGA 2Y23A 5E94A 1CICA 4Z3HA 1KB5L 2CIIB 5CGYD 2L8AA 1MCIA 4FQCH 1BD2B 5FO8A 3QH3B 5HHPA 3L9RB 5F1OB 1OB1A 2H6UA 4LSQH 4WFGD 3RFZB 2JKXA 3SCMC 4ANVA 3ZT6A 1OCZB 3OQ3B 2RTTA 4N2AA 1IGML 1A6UL 3MI6A 4HCGA 3AMLA 4K3EH 1J5OH 2WSPA 2YBRA 3E1F1 5KVDE 5T1KD 4XBEH 4M5ZH 1F6LL 3L3DB 4YX2L 5IROD 4HJUA 1BIHA 3EYOB 4FULA 1IKNC 5EORH 4R7VA 4M9PA 5D5MF 5D6DA 5DFTA 4XPGL 1DVSA 1I1CA 2WINA 3AACA 3A4FA 4LSQL 3WFDH 4HH8A 1WTGT 4L3EE 4Z0XA 3C87A 3FPXA 4K3EL 4AIOA 1DBAL 4OJYA 4HKZA 4XBEL 4M5ZL 2B15A 5EOCH 2CUIA 4GKZB 2BZDA 1BQ5A 5CGBA 2AZUA 3RNQA 1T1WA 1HQRB 4XRCA 5EORL 1AQ8A 1J9QA 1P7QD 4PY7A 3L5HA 1S46A 1PZDA 2FX7H 4P5SA 5DD5H 3T5WA 3ULSA 2UVFA 4UM9A 3U0PB 2DLIA 1XZ0A 5T3XH 4YDJB 4B97A 4KK9C 3QA3A 3W11C 2MCMA 5EOCL 1WISA 1NL0H 1Z5YD 2X89A 3B3BA 5D5MB 4N0UE 3RWEA 5KYWB 3ML8A 2YRZA 3QZBA 4K15A 1I3VA 3NTCH 2DQIH 5DJCB 5F89B 2WTOA 3IS0X 4X6EA 5DD5L 3TIEA 3QIBB 2NY1B 3S37X 5EA0L 5T3XL 1I7UA 3ZYOA 1I1AC 2X4QA 5AVYB 1LJMA 1HOCA 1V3JA 3GSNB 5DDHA 3LZFH 3SHSA 3W9EA 1DJXA 4BRVA 3MRMA 2DQIL 5AVUB 4MD4A 3JWDC 3FFCE 2GITB 1QTPA 3SE8H 3TCXA 2WQUA 4IQHA 1DFXA 2EIEA 4A39A 5IEHB 4RMVA 4ANKA 1IL1A 2D03L 2R0LL 1I8MB 3FTSA 1G1OA 3LZFL 1CDGA 1F11A 1CDYA 1X7QB 4JFDD 4UQ3B 4S0TD 4X7CC 4C55A 4GSUA 4HJGB 5ABZA 4H25B 3QNXA 1AGBB 3PXLA 5IQNA 1LGVA 1LEGA 5HDRA 3VX1A 4LARH 3VA2C 3KVDD 2DM4A 2P5WB 5L0QB 2PW2A 4Y2OA 4OZFH 4WWNA 3KNBA 1MHPL 3QG6B 3NJLA 1P53A 3STZA 4PB9H 4YDIH 3RL1B 2BSTB 1E4HA 2ALWA 1T1ZB 4NUPA 3HZ3A 4KI5C 3VXPA 1RJLA 4DKEH 4RSVA 4QWWC 4LARL 4UNVA 1G7IB 1BVLA 1BBJB 1IBYA 1XBDA 1U91A 2PN5A 4NBZB 4WENB 4HUNB 2MKLC 4KMQA 4UI2A 5IBTH 2EIZB 5CN2A 2ICWB 1O5DT 3IK2A 5HYJA 4HS6B 4X9BA 5H35B 3L54A 4M3JA 3HG2A 3V0GA 5HYQB 2DI8A 5KSBA 1YAIA 2EE2A 3KWUA 3GSVA 3BAYA 2XV0A 4DKEL 2AJ3B 1E4WH 4G80B 1HKFA 1JYWA 5E0QA 4F7TB 4ZUVB 4XB7A 1CGXA 4G9FB 5IBTL 4S1DD 4PMFA 4WGVB 4KQ4H 3PU7A 3DX1A 1LP9F 1NM9A 3BWAA 3HHRB 2OMZB 2OTUB 2P5EE 4QMEA 2JXMB 4NQVB 4PGJA 1E4WL 5BQ7A 1Q0YH 3EFOA 3T2QA 4Z7VF 2LQRA 1N5AB 3QXAB 1IAIH 3ZTJH 1IC7H 3S8WA 4OBRA 1QYGH 3F64A 3T0EA 5ESVA 1P1VA 5CNHA 1AANA 5MENA 5D7IE 3LN4A 4ELMA 4HAGA 5F3BA 4Z77B 1VB9A 1J5DA 2NOYA 3ORJA 4YBLC 5DQ9A 1HCYA 3UBXA 1Q0YL 4F8PA 3O3EB 4F7PB 3LS5H 5T5NF 1IAIL 1QR1B 1AKJB 2NY4B 1IC7L 4B9ZA 1A02N 1BQRA 2XRAH 4MNQA 1LP9B 3C08H 4F57H 4NKDB 4JZOA 4KKLC 4L4TD 3AZUA 5AAPA 5E6IA 3TL5A 4J3OC 2AGJH 2P8LB 2IC2A 2XX1A 4Z7VB 5H2BB 4CU8A 2RAMA 2VLRB 3AB0B 3ZGHA 4PJ6A 1F3RB 3LPPA 4TTDD 5FECA 4H20L 4OZFG 3C08L 4F57L 2VO5A 4ZPTA 4C4KO 1U3YA 1H3VA 4PBXA 1F02I 1HCVA 2QMJA 3MYJA 1A3RH 2FEJA 2JCWA 3LXBA 1BHGA 4OFPA 1D9KD 3U4KA 3LRHA 2HZHA 4S1SH 5TTRA 3KAAA 5ERWB 3D2UB 2PPAA 4HIJA 4MS8C 5B39G 3WKPA 3DV4A 4PRBA 1TEGA 2WHVA 5HJGA 3LRSB 5IK3B 3BKMH 2ZP0T 2J56A 3K74B 5D8JH 5FM4A 4LMQI 2E7MA 2X2JA 1NUGA 4NKOA 4TUJA 2W60A 1A3RL 3TJEH 1J0KA 4FCHA 3VDCA 4K9EL 2QLVB 4LOUC 3L95A 3QORA 4OCRH 3US9A 2P8PB 5F7NC 2QKSA 4DVBA 4GW4B 3ULVD 2MOQA 3RKPA 1JXKA 1IFHH 3KPLA 3ARGD 5B3SB 1T0NA 2X4SB 3ZZ1A 2E7LC 1NDMB 1HHHB 3MFFA 4PR5B 5JIDA 2XVBA 5KVGH 4YSUA 1GJIA 2XN9B 2WYZA 4NENA 4QT5B 4KY2A 3TWYA 2P4AB 5E8EB 2V33A 2W9EH 2JTDA 1MFAH 4ZW6A 5IB4B 4OI8A 2R9HC 1NKRA 1B6DA 3P9MB 2H1LM 1DJWA 5C0BA 3GLAA 4GSRA 4I0KA 1IFHL 3NVQA 2NUPB 1A25A 2UY7A 1AQMA 1OW0A 4W6WB 1NEPA 5KVGL 2X6VA 4XMPL 4F8NA 3QNYA 5CU9A 4RIRA 4PRID 5DMKB 4M9OA 1MFAL 4WW1B 5LCVL 1FNAA 2EYRB 5C9JB 3LKQA 3ILQD 1NFAA 3ZR6A 4LBEA 1NAKH 2FEDC 2XG5A 3NN8B 2X0UA 1D3CA 2GFBB 4ONFH 3GI8H 3L4WA 1BYPA 2C4XA 3LRGA 5JOPD 1CFTA 1KB5A 3OJMB 4E9LA 4RZKA 3VSTA 3V0EA 5I5RA 3ARDC 1ZLWH 4M29A 1KTDB 1MREL 1ULVA 5D1QD 4JKLA 4RNRB 1WF5A 4DKAA 5F9AC 3AG4B 1Z2KA 2YAMA 3K8LA 4QRAA 4ONFL 5I1DA 4OI9A 5I75C 3GI8L 4FQHB 4PSRA 1Z1WA 4JFFA 3BOVA 4FQJL 5CR8A 5BUGA 3FHQA 2FEEI 4O00A 2A6KA 1UWGL 2BPBA 5IW3A 4DW2H 1X5IA 2WWOA 4H2AA 3KPSA 1XF4B 3ZHDA 3PDOB 4LCVA 2R7EB 2MCAA 1U8JB 4FXLA 4WK2B 2IAND 4DPBX 3UBHA 5FIEA 1MI5B 4GBXB 1NJ9B 4MCYA 2I27N 2YEZA 4AJVA 2XQ0A 4KKCD 5KJRH 3BZFA 4DW2L 5ICZA 3BW9A 4NWUL 3HJ0A 5T3ZL 3P54A 1SDDA 2VLKD 1B4RA 1X9RA 1RK0B 3UJTH 1L5GA 2Y1ZA 3SO3B 4X98B 3RB7A 4LCWB 3MUGB 5I1IL 4I9WD 3AT9A 3OR6B 1L9NA 3BXNA 5KVEE 3V0JA 1LQBC 5H37H 3AG1B 5K69A 1R17A 4CUCA 1A64A 3F84A 4IRJD 5KJRL 3FQUA 1KZQA 1XSIA 5DRWA 2ADGB 1BVKB 2NDGA 3ARUA 2WWMD 3SN6N 3S34H 2BY0A 5FUCE 4GG6E 1CL7L 2LFGA 3T0AA 3MZTA 4LCIH 4P4RB 5GZNC 3B9KA 4L4VB 3N85H 3TV3H 1X5JA 4UV7H 2NY7L 2D9CA 4JM2D 4Y19E 3NFSH 2BWQA 3EH1A 4DGIH 4R0LA 4GRLA 3CLEH 2V7HB 4OF8A 1PLBA 3RY5A 1YLBB 1PJ9A 3QULB 4CC1A 2Z7ZA 4TPRH 2J88H 3SOBH 3WBDA 3VW3L 4AYBA 2P80D 2QV2A 1UXSB 3EZ8A 2Y2YA 4JFTA 1XGUA 1RD6A 4EIZC 5B1JA 2XWTB 3BAXA 4JFEA 3N85L 5B3JF 3WDIA 3TV3L 3FU9A 4UV7L 3GBDA 2C1OB 1KT2A 3NFSL 2F8IA 3K91A 1N18A 1TETH 4JRYB 4UTAH 3L5XH 1QX1A 4IS6B 3TTYA 4HU8A 3BPCA 4WUUE 4TPRL 1IQWH 1D5BB 1PNDA 4I0PB 5HHVH 3SOBL 4JRXA 3MJ7A 2F74A 1T89A 4XVSH 5ESAA 3QYNA 4XP4H 3S0PA 1XFPA 3BP5A 3WKMH 3BD4A 4XNZB 3C5XA 2YA0A 5GJSH 1SEBA 3ZU8A 1TETL 3ABGA 1T5WA 3EFFB 3F00A 3CFNA 4FTVE 3IJYB 3L5XL 4UTAL 3HI6H 4ISVB 1AGDA 5HHVL 4JY6A 4MXWL