1AG6A

Plastocyanin from spinach
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
b'VEVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure of spinach plastocyanin at 1.7 A resolution.
pubmed rcsb
source organism Spinacia oleracea
molecule tags Electron transport
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1997-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ag6A00
3X2QB 3OMIB 3FSVA 5PAZA 1SHXA 3NJJA 1JZEA 3FU9A 1OCRB 3WNJA 4P5SA 2XXFA 3T6WA 1BXUA 3MX0B 1AZCA 3CVBA 1AZRA 2FWLB 1KGYE 4F2EA 1A3ZA 1XB6A 2AZUA 1GW0A 1M57B 2VW6A 4E9VA 5I6OA 3S8FB 1TEFA 3ZDWA 4BK5C 3CDZB 3UABA 3NSFA 2FJSA 2PCFA 2PPFA 4WTQA 1MZZA 1NINA 3FSZA 3WNIA 3RYMA 3QJVB 5I6PA 4NERA 3S3DB 8PAZA 3C75A 4A2HA 2EILB 5FC9A 4CSPA 1JZFA 2DYRB 2HX8A 4M3HA 5I5IA 1W8EA 4HIPA 1ASQA 1NTDA 1JZGA 1OOWA 1HFUA 2VN3A 4NB7A 4AKQA 4KNTA 2GBAA 3D12B 1QHQA 4GP8B 4EF3A 3GYRA 4A2FA 2GSMB 2PP7A 2EIMB 3QJQB 4DPAX 2FT7A 4YSSA 1MG3C 3FPXA 2BZCA 3ASOB 1PLBA 1M56B 1OE2A 1AIZA 7PCYA 2FQFA 3UADA 1DZ0A 4PCYA 1V55B 2XX0A 5F7AA 4BWTA 1L9QA 1SFDA 2I7SA 2YAMA 3ZBMA 2XXGA 3JT2A 1BQKA 4KOCA 1PMYA 3SBQA 2UX7A 1BEXA 2CBPA 5I6MA 1BXVA 4KO7A 1BYPA 1EHKB 3CG8A 1JVLA 1SDDB 1GR7A 2QDWA 1XB8A 1CURA 2W88A 2DV6A 4DP5X 1PY0A 2I85A 3QPKA 4UF7C 3N2JA 2CUAA 1L9OA 5B1JA 1RKRA 1GS8A 1ZDQA 4TXVB 2FQEA 2PPAA 1AS8A 1NIDA 2ZONA 4JKNA 3EH5B 1OE3A 4A2GA 2UXVA 3TU6A 1NDTA 4PAZA 1GS6X 3NYKA 2VM4A 4G7QB 1NIAA 1SJMA 1JXFA 1IBZA 3V9EA 1JXGA 2QPEB 1X9RA 3FSAA 3V9CA 4Q89A 5F7BA 4HHWA 3OMNB 1AZUA 1V10A 5B7MA 4F2FA 1L9RA 1IBYA 3H4FA 2B08A 1NIFA 4MFHA 2VSKB 1IUZA 5D4JA 1W6LA 3ASNB 4K9JA 1GSKA 1OV8A 2BW4A 1GYCA 2J55A 3FU7A 3SQRA 4YSPA 2VSMB 2PPCA 2IDFA 2VW7A 3EF4A 2MRYA 1WA1X 2VW4A 2QT6A 2XU9A 2IWFA 2ZOOA 1BXAA 4YSRA 2GIMA 1GY1A 3MBWB 2B3IA 5ANHA 1JZJA 3WKPA 1BQ5A 2FT8A 2WSDA 1ID2A 1WAEA 3ZIYA 2GC4C 1A4BA 4UANA 1NIEA 3AG1B 3PCYA 1ET8A 2QPDB 1PNCA 2BZ7A 4DP9X 3CDZA 1ADWA 2IWKA 2J56A 4YSEA 1WS7A 3FSWA 3NJFA 1CYWA 1N68A 5B7EA 1KBWA 1OF0A 2HRGA 1NWPA 1FWXA 2IWEA 2N0MA 4GP4B 1J9TA 3NJIA 4A68A 4G71B 1J9SA 4FA7B 2TSAA 4YSDA 1UATA 1I53A 2GHZA 2IAAC 5B3SB 1AG6A 2EIKB 4DP6X 5EHFA 3BVDB 3PPSA 1CYXA 2P80A 1AS6A 1SNRA 3KW8A 3PAUA 2IH8A 4P5RA 4DPCX 1JOIA 4YSOA 1PAZA 3FS9A 1E30A 1ZV2A 2IDSA 3AG4B 3NJKA 3UAEA 5I5MA 2XYBA 1HAWA 1ZIAA 3T6XA 4DP8X 3NT0A 1WA0X 4A66A 3H56A 2UXFA 2IDTA 2YQBA 2X87A 2VM3A 1CC3A 1HAUA 4JHVA 5TK4A 2BP0B 1ASOA 1MDAA 2GI0A 4AKPA 3PXLA 3T71A 3IEAA 3UGEA 4E9TA 2XV3A 3IN2A 3WKQA 4E9WA 2HRHA 3GDCA 1OE1A 4QLWA 2Y1AA 1J9RA 2IH9A 1SDDA 1BAWA 4G72B 4YVNA 3UAAA 2OCCB 3NSDA 2I7OA 4FAAB 3FYEB 5I6NA 3TBCA 4HALA 5IY5B 1QLEB 1PLAA 2BP8A 1KBVA 3CZUB 4DP7X 2PP9A 1PLCA 1PCSA 3SBPA 2FT6A 2XV2A 2H47C 1NPJA 2DYSB 2BHFA 4RH4A 3ABMB 3OMAB 3NSCA 2PPDA 2BP8B 1BYOA 3PAZA 4GP5B 1AOZA 3AG3B 5A7EA 2FTAA 2DWTA 4HZ1A 4ZK8A 2PPEA 4HHGA 1KCWA 2BWIA 1ET7A 3AZUA 5I28A 3ERXA 4JHUA 2YAPA 3QJRB 4KNUA 4DP1X 2WO3B 4G7RB 1R1CA 1JZIA 3AG2B 3ABKB 1B3IA 1ZIBA 3IBOA 2AFNA 2AVFA 2FQGA 2XX1A 1ASPA 4KO6A 3WG7B 3OD3A 2XVBA 5D4HA 2YAOA 3OM3B 1XB3A 3T9WA 2RACA 5AZUA 3SBRA 2CJ3A 4ENZA 4DP2X 2E86A 3EH3B 1J9QA 1NICA 5I5JA 3H4HA 5E9NA 1IKOP 1A65A 3HEIB 4KO9A 3GXUB 2IDQA 1DYZA 2DWSA 4HCFA 4W9ZA 1AG0A 2JXMA 4YSUA 9PCYA 4DPBX 2R7EB 3HB3B 3TASA 2WO2B 4G70B 3PLYA 4WKXA 2YXVA 1NWOA 5B7FA 2OV0A 1TKWA 4A67A 1JVOA 1ET5A 2UX6A 1AANA 4N8UA 4BDVB 1WA2X 5LDUA 2BO0A 1ZPUA 2UXGA 4BWUA 4E9YA 3NP4A 3QJTB 2HZHA 1KDJA 1AACA 2VMJA 1AR1B 2P80D 1SF3A 3FYIB 1TEGA 3X1FA 1NPNA 1FFTB 1JERA 4HCIA 3FPYA 4DP0X 1GS7A 1NIBA 2HLEB 3KW7A 3NSYA 1WS8A 3S3BB 2J5WA 4BXSV 2MTAA 1KDIA 3NJNA 2UXTA 3CVDA 3FQYA 3U25A 1TU2A 3AW5A 1CUOA 1ILSA 2BW5A 1SHWA 1OCZB 1X9UA 4E9QA 5B1AB 5I6LA 1E5ZA 4M4RB 4GXFA 2Q9OA 1JZHA 2YAHA 3UACA 2BP0A 3DTUB 1SF5A 4G7SB 1QNIA 1AS7A 1T5KA 2W8CA 1SFHA 1V54B 4YSTA 1KYAA 1ZDSA 3FU8A 6PAZA 3NJGA 2A3TA 1L9PA 5I6KA 1E65A 3G5WA 4NAJA 1L9SA 3DKHA 2TSBA 4E9XA 7PAZA 1MG2C 2FNWA 4KOBA 4Q8BA 2XWZA 3FQ2A 3WIAA 3X1GA 2ZWNA 4YSCA 4N4YB 2HX9A 5AKRA 4F7KA 2HXAA 2H3XC 3JTBA 2BWDA 3WI9A 2OJ1A 2XUWA 5D4IA 1KV7A 4AX3A 3AY2A 3S3CB 3ABGA 1M9WA 1PZCA 3T6ZA 1KCBA 4A2EA 1OCCB 4YSAA 2PP8A 3EH4B 1E5YA 3OQRA 4L0PB 5PCYA 3FQ1A 1AZNA 4E9RA 2YAFA 2IDUA 5B1KA 2CAKA 1AQ8A 2GB2A 3X1BA 1PNDA 2DY2A 3CVCA 1N70A 4HCGA 1JXDA 2LLNA 2GC7C 2JKWA 1A4AA 1E67A 2Q5BA 1PZAA 3X1EA 2EIJB 3L45A 3QJUB 1XMEB 3FT0A 2YAEA 1YLBB 2HX7A 4BWWA 1URIA 4GY4A 3S8GB 2J57A 2FQDA 3IE9A 4KO5A 4X4KA 2XLLA 2QDVA 4YL4A 3T6VA 1BQRA 3NJHA 2X88A 2CALA 3IN0A 3X1NA 4CSZA 2Y69B 5B1BB 3EHBB 1W6WA 4YSQA 3BQVA 2XV0A 1ILUA 2H5UA 2R7EA 3NJMA 1A4CA 5B1JC 4AI7A 4AZUA 3NJLA 2AZAA 4A2DA 2YAQA 2PCYA 4HAKA 4BDVA 1A8ZA 4UAHA 1PF3A 1RCYA 1RZQA 2EINB 3QJSB 3TBBA 2YXWA 3ZX1A 1MZYA 1EZLA 1L9TA 1F56A 2CCWA 3ABLB 2AANA 4YVUA 1ETJA 2YARA 1AAJA 2PLTA 4KNSA 5I26A 1IC0A 1NZRA 2JFCA 1VLXA 4BXVA 1J5CA 4DP4X 1AZBA 1J5DA 4E9SA 1OCOB 1RZPA 4AKOA 3TA4D 1PZBA 3N55A 3PAVA 3DIVA 5TK2A 2NRDA 5AFAA 1GY2A 1FA4A 2ZXWB 4W1TA 3QQXA 4GYBA 3FU7B 3NP3A 4QKTA 6PCYA
chains in the Genus database with same CATH superfamily
4JKPL 1E9OB 4I77L 4FG6D 5K33A 1SHXA 4WUUE 5E6IB 8CGTA 3WNJA 1L9NA 1WIPA 4P5SA 2QADD 3C6LC 3DIFB 4AW4A 5BUGA 3GIZH 4PH8A 3PWNA 1MVUA 5B3NA 5C0RH 4QGYA 3O0LA 3ULVC 1J0ZA 1XXFC 3V0HA 1M57B 3VQLA 4J3OF 2YS4A 1TEFA 1OGAD 5D7JA 1BJ1J 2NUPA 3NSFA 2W0FB 1R3HA 1NFIB 3QSKB 2GJ6D 1YQVL 4XMZA 3RWIB 4BA8A 5I1KH 5ICUA 2DLTA 4MXWH 2Z93A 5C09B 5D7JC 2WWKT 3VH8G 3VNYA 2HJFB 4IBVA 1KMGA 3BQUD 1G6VK 4AKQA 4XX1G 4TL5A 4WDIB 1QRKA 1VIWA 1X7TA 4IQHA 3D4CA 2KS0A 4LLMB 4YK4B 1YSOA 3TYGH 4HOWA 2VITB 4J27A 3MFFB 3ALPA 4MZ3A 5I15H 4UV4L 5AENA 1OF2B 2NY5H 2J6WA 3MU3A 4GSRA 4M29A 3V2AR 5C3LD 2HAZA 2B1HH 2F1BA 4X6CF 3QZWA 4FXTA 1KCSL 1IC1A 4PCTA 5I18L 3SPHA 2FO1A 1OARL 1F4YL 4DZ8B 2NY6C 3EJPA 3HC0A 2J2ZA 4XPAH 4H44C 1BD2B 1UKSA 2I7SA 3A22A 4ZMTA 2ADGA 1I9IL 5ADOH 1T1YB 4P5TC 4B60A 1QRNA 1B6UA 3QDJB 4EN2A 4N8VG 2EVJA 1FG2A 1XEUA 4WJKB 5GPRA 1MIEL 1FYTE 3LDBB 3HB3D 2CHXA 2RQ8A 4MS8C 4LBEA 2CQVA 1GR7A 2DQUL 5FYKD 1YYLL 2O5ZH 4TVPD 3BCFA 4EI6A 3K0YA 4LP8A 2CUAA 1OEZW 5D2NB 5EUOB 3BWZA 3CZFB 4BFFA 4EXPX 4Z7VA 1U8CA 4D3CH 2AXWA 1N8ZB 2VLMD 3RIKA 5JW4M 5E6RB 2D03L 3TCTA 3X3GL 3V55A 2BVQA 1UCTA 4GQ9H 3QUXA 3DSNA 3Q0HA 4G8EA 4KK6C 2VISB 2KQMA 4N1CA 2ED7A 2ZT9C 4Z7WE 4BQBA 4F3FB 1QA9B 3A5VA 1ROCA 1QWHA 1KYFA 1P5VA 3W1ZA 1HEZA 4L2YA 3VQ1C 3QUXC 2EIDA 3MXVL 5CLXA 2KBGA 2F54B 2ZSWB 4TPRH 2BVUA 1TZGH 1J0KA 1CGTA 2K6YA 3LKOB 3QIBA 4FDWA 3OMNB 1JPSL 1D5BB 4F2FA 5CEZD 3VG0L 3FHEA 4HUXA 1PSKL 1QATA 4MLIA 3NFPA 1GMIA 1IILE 3VFNA 3G5YA 2XTJC 1GSKA 2XWEA 5C08D 3QIBC 3ZRFC 3ARUA 3B2UC 3F2LA 1YNLL 3D3VD 1NANI 1OK8A 1PW3A 4QHMA 2A83B 4J6RL 4JZNB 3MROA 1MCRA 5JDJA 2GIMA 4MNQB 3ZLQC 3MA7A 2DLFL 3ZL4L 2IANE 1Z0MA 2R27A 4D0CB 4QHUB 1RSYA 3UYPB 1NM4A 4ZMPA 3CFCL 3BJ91 4ORGB 4EOWH 3HC3L 1G9NC 1LO3H 3BSHA 1MAJA 2VR5A 1MFAH 1CYWA 1BLNA 1JYXA 1G4RA 3RGVB 2MCG1 1PS3A 4TQIA 4E41D 5DHEA 1TKWB 1I75A 3T1FA 4Z7NB 2YD3A 2VQ4A 5EIVA 2MCAA 4P23A 4EBQH 1RPQA 4D8PB 4ZFZB 4H20H 2X1PA 2DIBA 3RJQB 3O2VL 1HXYA 2EH7H 1MIML 4PMEA 3DUHA 4HG4J 3BKJL 4PGDA 3BVDB 3MLVL 4U6HB 4P23C 1PKQE 2IXQA 2BOCA 1A64A 2YOCA 4UQAA 4G6KH 3V5KA 3SKMA 4FQIH 5EF1A 3CJJA 4HFUH 5I30H 4XRCB 1UZ8A 3BHBA 3NRFA 2H1LM 5LGKA 5DK2B 5LXGH 1HAWA 1ZV9A 4XVJL 2RHEA 2UXFA 3WNLA 4H88H 4CW1B 3OJVC 2X6UA 4R83A 3BPLC 1CC3A 4O2FA 4JM2D 4XOBA 3HMXL 5BZZA 2FRGP 3LPOA 4U1IA 5ADPH 1ASOA 1NH6A 4ILDA 2VC2B 3FUHA 4ONFL 4BUGA 2X4NB 4HYTB 1DBKL 2GJZA 4U7SA 3MRJB 4JR9L 2L8AA 1WCQA 3RL2B 1BAWA 5B38B 4G72B 3UAAA 3BDBA 1NCCH 2OTUA 1J1PL 3RG1C 2I7OA 3I6LD 2NW2B 5HHVL 2WZAA 4RQQA 2G3NA 5E1IA 5KVEL 4ODHL 4XC1H 1KBVA 4FQJL 1GYUA 3VSVA 2X2UA 3D8MA 4PJDE 1WBXA 2EECA 3LIZH 4GXUN 1NPJA 1CFVH 1T1ZA 1CLOH 3M46A 4RH4A 4NM8H 4AYID 2NPLX 3VWJC 5E2UH 2F7RA 3NK3A 4I5BB 4AIOA 4EO5A 2DQEL 3HA0A 4KMTL 1O5PA 4GB9A 2C3HA 5LGHL 2V5YA 3AZUA 1ZK9A 3D07A 2I26N 4OZFH 3HUJF 3U0WH 3VD0A 4NT6A 3WIIL 7FABH 3KM2A 3IXTB 5K93A 4QEGA 5IOKA 3ATDA 4GKLA 4AQ8A 4C4KO 2J1ZA 2XX1A 1CF8L 4EEEA 4KO6A 4UAOB 4IRSA 1U30A 4LKXB 2FGWH 5HDRA 1FLTX 4JPKH 4NO0A 3QK0A 4XP9L 3B5GA 4XTRD 1A47A 1U3HA 5FA3B 1J7VR 1EVUA 3HG1A 1KLFB 4LLQA 4ODTL 1G9EA 2WBJB 4AQ8C 4P2QA 4N2MA 4P05A 3FRPB 4GS7C 1R5WB 3FMGH 3GGWB 5IVZA 2HH0H 1YEDB 5T1KD 4PB9H 5SWZD 4Y1AE 3UG4A 2YWZA 4XAKD 1U3HC 3FT4B 1ICTA 5D7LB 2ZX7A 1F13A 1I3RB 3DLQR 2BJMH 1B2WH 3FH7A 3CSBA 2OYLA 4X98B 3M45A 4U1HA 1VZIA 1U93A 2OV0A 3LEVH 1JVOA 2DF3A 2MQ0A 3WJLA 5I1IH 3ZSTA 1OSEA 1U8HA 5JHLL 3E38A 4WV1B 2W07B 1ZPUA 4BWUA 1FJ1B 3NP4A 3V6BR 1SVBA 4KVPA 4OFYD 3RKDD 1EV2E 3QRLA 3MYJA 2L3BA 3BMWA 1MCCA 3ME0B 3WJLC 3EUDA 4JDVB 5C0AE 4N22A 1G6RB 1R6VA 1VEPA 4Y16D 4HDIB 3CXHK 4YHKL 4LEOB 5E5MA 3KW7A 5EZJA 1TZHB 3M1OA 1MRFH 2FNBA 5BXFB 5I0XA 4AUYA 3OJDA 4Z3EA 5DQ9B 5GJSH 8FABB 3UGXA 5B3JF 4MTMA 4R2GD 3CLFL 1A7RH 4N0UE 3TEYA 5HBBA 4QXTA 4AITA 5I71B 2YA0A 3NA4A 3MV8E 5D93B 4IKIA 2ZXDA 4HK0A 3I3DA 1EFXA 3UACA 5CS7A 1T89A 4ZFGH 3NIDE 1XH0A 1T5KA 3DO3A 4LDOB 3IJEA 5D5MB 2CGZA 5C0IB 1Z3GH 1SFHA 2HT3D 4OJDH 4YSTA 3EYQC 5H37H 1EZVX 1Z32X 3FONA 4J3OD 4KXAA 1UTDA 4MWFA 3MUJA 2FATL 5GRJH 4J3XA 3DRQB 1T89C 3V79C 5HHNB 1SMAA 4MQ7B 5IBUB 1KTBA 1WEJL 5HI5C 1N6UA 2TSBA 3DTDA 4FQCL 1BPLB 3RX8A 1RVFL 5D1ZA 5EIIB 4JKMA 4QRRE 2OMNA 1AO7A 4FNLL 3ZE0B 1A7PL 4C58B 4WFED 4XOEA 2I27N 5KYNA 2BWDA 4M1CC 2EIEA 3VNZA 4AX3A 2Y36H 5J89A 1GJIA 3WLWD 5D1ZC 1PZCA 2Y24A 1E3ZA 1FL3B 2AJZA 4JG1L 1D6VL 1L7TH 3GXFA 3VRJB 4CDGC 3KNBA 5DJDB 1KENH 5IK3A 4LSSH 5EA0H 4P48A 4LEXH 2NYYD 4FKHA 5DLML 5IMMB 5EZOH 4OLXL 4RFEB 2VABB 3CN2A 5SWSB 5KSVA 3CX5K 3WSQL 3S4SA 1JZ5A 4PTUA 4JRXE 1NKRA 1CL7L 1RH8A 4MRBA 3MRNA 4F57H 1T20A 1MPAL 4YE0A 4CN1A 3T04D 4KK5C 6TAAA 5J12B 5GGVL 1HS6A 3WNNA 2WUCH 3HRPA 1UYWL 1X5AA 4IBUA 2A6IA 2RBLA 3QXDA 3D87B 2EIJB 5L7XL 2PTVA 3VXSB 5ISZB 4L1LA 1YLBB 3MKKA 4ONGL 3VU2A 3L3DB 4QY8A 1YAIA 5KW9H 2AK4D 2RB8A 4ISVB 5KUKA 2NUTB 2DQGL 4XB8A 3T6VA 4JHBA 3C08H 4JRWA 2CALA 3AQDA 3DGDA 1J87A 3QNZA 1VAHA 2DMBA 3C5SB 1C7TA 4R4FH 5AW2B 2CDFA 2R1YB 1Q72H 1T4WA 2HKHL 4M6OL 4HT1L 3I6GB 5L8JB 1ILUA 4KXZI 4AZ8A 2R7EA 1JHTA 4OD3L 1A4CA 4E5XB 4AZUA 2YEZA 4W9JC 5GS0L 3NJLA 1TLMA 3QIWB 1EQWA 4N5UA 4Z7WA 5EMYA 5HGAA 1G7JB 4N0CC 1A7QH 3V5DA 3F6IA 3NCXA 4Z7QB 1U91A 4EDXB 1UA6H 1A6PA 2DMGA 2HKFH 3VYNA 5T3XL 3RU8H 2NYYC 5KSBB 1MRDL 4JAMA 5I2IB 3IU4H 5I19H 1NC2B 4J3TA 2J6EH 3HAEB 1U0QA 4QF1B 5TFSH 1A6TA 3MA9H 2ATAA 3ATAA 4PRNA 5ABAA 4YHYB 2L7JA 3LZFL 4O02H 5G55A 5D1QC 2C26A 3H6JA 3W0WA 5ABDE 5TE7H 1CLYL 4DUWA 1SN0A 2YD5A 4ODSH 1IC0A 2O26U 2WNGA 4LCUB 4ODVH 4BHUA 4AEHH 2PABA 1MCOL 3P9MA 4Z95H 3IFOA 4X6FA 3FQRA 4HIHB 1UURA 4Y1SA 5C09E 3EADA 4E9SA 2PCPB 4ZZFA 2YRLA 4CADA 3GO1H 2ZUQB 3ARFC 4LOVA 3P11L 2A74C 4K5PA 1S7WB 2DQHL 1S9XA 2E4TA 3BEVA 3QQXA 4E68A 1CN4A 1XCTB 4IU3A 3RB7A 5T3ZD 1EH9A 3O9WB 5FKAA 2Q3ZA 4L8SC 4Q14A 1RK1B 1R3LB 5E2JA 3FU9A 4MJ6B 3OAUH 2XBZA 4TSCH 3EFDH 4PWHA 3B9VA 3QQ3B 4R26L 4WEEA 1KZYA 4PYGA 3C6LB 4OCWL 3GSUA 4Q0XH 1SXNA 3LOWA 4JKKA 4R84A 5EZPA 1LO4H 5FECB 2Z4QB 3X13A 5DHVB 3C09C 3SYAA 1AHWA 3L17A 1RQ5A 1BD2E 1QSFD 4AC2A 1E9PA 3PWNB 1F1GA 1YMHA 1MVUB 3WNIA 4MXVF 3OB8A 3O3AA 3AREC 3V4PH 2PXYA 4IRZH 3K2KA 3E3QE 4M7JL 4PUBH 3RWEA 1AHWC 1PKQA 2GSIA 2NY0D 5C07A 3FOMB 4KZEH 5IESH 2B4CL 1JZGA 2NUPB 5D7JB 2AKRB 4JFDB 1S7VB 2PXYC 4UT9L 2GITB 4XVOA 5D2NE 4DO6A 2ATPA 3KR3H 3H3PL 3O6LH 4URTB 3D06A 3KVQA 2EE3A 3BDYL 5T33H 4YDMA 4JO4L 5JUEH 2KUTA 2ICWB 1JGDA 2WSKA 4Y9BA 3UZEA 2Q86A 3D1MC 3MRFB 1U8NA 3MRRA 5E8DH 4B9FA 2FJGB 4U3HA 1AGCA 2NY6B 1RIVH 1SFDA 3V0FA 5IQ9B 3SCMA 1EDQA 2QPSA 4HIEA 1CIDA 5GS2H 4HAGA 4GW1B 4DW2H 5TGBA 4KDTC 3UZEC 4PY8J 3KWXA 1IVTA 3QZWB 4P5TB 1ZGLP 4F7MA 1BZEA 1RJYA 4RESB 3RWGB 2A9CA 3WJMB 5TDPA 1B4TA 5J57B 4UDUB 3TNMB 1JVLA 1OGAB 4Q2ZB 2J2ZB 2I24N 4KVCL 3ZRCC 3GXDA 1IAII 1Q1JH 2MQ3A 4DN4L 1U21A 4PJDA 4HJGB 4KBPA 3NVQA 3CUPB 4PJCE 2XT1B 3P9LA 3FAXA 2HMIC 2CRIA 1DSYA 3FCTA 2EXYD 3QO1A 5AB1A 2E0PA 3EH5B 1ZLEA 2EDQA 4LBEB 5B4MC 2YPVA 1OAZH 2DN7A 1BZ8A 5AOMA 1JRHL 3IFPA 4KJWD 1E28A 4BQCA 5JYLA 3U4KA 2KI6A 3Q44A 3U6XS 2DQTH 1M1XA 2HFGH 3MBED 3PE9A 5AUMA 4F15C 2QPEB 3DC0A 3FSAA 2BVQB 3ZYOA 4U6XB 1TETL 4HHWA 3DX4A 1T6WA 3CSTA 3O6ML 4Z23A 1R4XA 2G2PA 2QHRL 1L9RA 1P5VB 3O2DH 5C7ZA 2B08A 4PLOB 4DKEH 4CU8A 4TTGA 1X5KA 1NMBL 3SZKC 3NCJL 2XTJB 1HN1A 3VXQB 2VNCA 4K3JH 2IDFA 4QRSA 3U0TA 3UTTD 3VVWA 1SBSH 4G5ZH 2ICWJ 2GW5A 2YK1L 4BQ9A 1L5GA 4HUXB 5D71H 3IF1A 4WI0B 5EULV 3NFPB 1GJWA 3OXRA 2EUZA 3VM7A 4WWKC 4OCLC 2DMKA 1FV1A 5AB0A 1BQ5A 2FYVA 3HJEA 1A3LL 2O5YH 1MNNA 3GJEB 1B0GB 3AG1B 4XPTH 2K4WA 5IHUL 2F53A 5A16A 3HZMA 5INCA 4N68A 1BF2A 3L9RA 1G7MB 1XDTT 5DEZA 3EYOB 3U7YH 4NUPA 3PWLA 2ADIA 2YD8A 1V3MA 3HMXA 4FNQA 4PP2B 1IT9H 1FNEB 3HE7D 1CD1A 4WHTB 4Z77A 3B83A 2DWYA 1QFUH 1E5BA 4P04A 2HB0A 4IS6B 2R9HC 5B3SB 5HI3C 4H1LG 4G8GE 3RP1A 3F7YB 1KB3A 1NCOA 1W0YT 2PTUA 3KW8A 5ICXA 3T1FB 4P5MB 4N0UA 4P23B 4CC0A 1OL0A 3RJOA 5C08B 1ZV2A 2EXWC 3UDWA 1OALA 15C8H 4KVNL 2XVLA 1VESA 5I1DA 2IXQB 4FZ8H 4JPSA 4LCWD 3RGHA 1P7BA 2CNYA 3IETB 3DJZA 3V5KB 5EEYA 3SKMB 4XN8A 4ZYKA 3P3TA 4NQUA 3BPLB 1OSPH 5G2NA 3UDWC 1V3KA 1MDAA 3Q1SH 4ZW7A 4PRBB 3PHAA 4EKXA 3BHBB 4I9WE 2AK1H 2VE6A 1B88A 1J10A 1GPOL 3AVEA 4NJ9L 1JPST 4EJ1C 3VXOB 1RIUH 1IU1A 2FCBA 1H3TA 4E41B 2B20A 4G6ML 5FYLD 5BZXA 5JR1H 3VI4A 3POCA 2GJZB 3QEHA 3BLPX 3EGXA 3WKYA 2NW3A 1XIWA 4EUPA 3QDMD 4D0DB 1KN2H 4MB5A 2WQWA 4MLSA 1DVYA 4PRIA 2DQDL 3TO4C 4QGTA 4AM0Q 2PWEA 1YY9D 2VXUL 3FO0L 4FXLA 2DQMA 4JRXA 4MAYC 1OWRM 2VXQL 3MGOA 4LPUA 3VWJB 1QLEL 2DTMH 3NZSA 2WXGA 2OX5B 2AEOA 3ATFA 4X8XA 5DHYA 5BCAA 4JX0A 1BM3H 1WBXB 1ZJAA 2WZPA 4G1EA 3L3OA 3BSZL 4EQ3A 2BNRD 4MA8H 4NNPL 1OANA 2E59A 4W9HC 3R8QA 2EEAA 1PGRB 1RZKL 4CVXA 4DESA 5JHLA 3BOVA 3EO1A 3D2UA 1NEZB 4I0CC 4X7EC 1FIEA 4ZMZA 5JPMA 3OD3A 3UBFA 5LBSH 1AH1A 1LK3H 2ZF9A 3VB9A 3MV9D 2GBVA 3RWJA 3BC9A 1JWUA 3BWAA 2X6VA 2B8OT 2WM0A 3SBRA 3UERA 5CSZA 3JTTA 4WI6A 4ZUVB 5HPMA 3CZSA 2ICEA 1P5UC 4DGIL 1T0OA 4FQXA 4GG6B 4GS7B 1MREL 4XN4A 4UILL 1YPZB 1U6AH 1A65A 3JV5A 5JXAL 3HG1B 5JPNA 1WFOA 3PY9A 1BGXL 4PJXF 4RIRA 1HXKA 2WO2B 3MLYL 5ELIA 2P5WA 5IVZB 1S9VB 2KQNA 5TDOB 5D5ME 3JTSB 1AXTL 2CJUH 1G5AA 4HCRL 4WJG3 1MOEA 3GMPA 1GCFA 5IHLB 3VM5A 1E2VA 5JPNC 1QFHA 5A2FA 4PY8I 2H1PH 3QJTB 2Y7SA 4FNPA 2C5DC 3ECVA 3SDDA 1ETZA 4DQAA 3QORC 1NCBL 1MLCB 5D2LF 2PF6A 3T4YA 1ZHBA 5J3HC 1QPPA 3OKLB 5F70A 4UQ2A 3CZLA 2CO7B 3I2CH 2F7PA 2H3KA 2XPGA 1DQJA 3PWPE 2CO6A 3FN3A 3QXAA 4P5KA 3A4AA 1TU2A 5KJ7E 4KHTH 5CZKA 5DD6B 1M6OA 1HSBB 4M03A 3TJEH 3V4VH 1N2RA 4B5EA 2X1OA 3D9AL 3L5XH 2WKGA 1C8PA 5DMJB 1CXKA 4ETQA 2P5EE 4QRUA 2CRYA 2FLBT 5AVYB 4GSQA 4LDEB 2VLLA 1GYAA 1I1FA 3Q2CA 5SWZB 2GKIA 3GJFH 3LPGA 2R0ZH 3Q8FA 4HVBA 4N8PA 2QR0A 3OXSB 3PJLA 1EO7A 1N10A 4JO3L 1MG2C 3VXSE 1HNYA 3B6SA 2BXYA 1EEZB 3LKSB 3MR9A 4PI0A 5LWYH 3KPNB 4Q52A 1BWMA 3IDIB 4U6YB 4K55A 2B5IC 2H3XC 3WE6B 4L3CA 1FVCA 3CXDH 3WI9A 1G9MH 2XUWA 4WJ5A 1HHKB 4X4ME 1WAAE 5KVFE 1WFNA 2H0JA 4ZMLA 4NEHB 2MOVA 2ICWI 2EADA 3T6ZA 4YMPA 5IMOA 2P48B 4UU9B 2UY7A 4PRDA 3L1OH 3B9KD 4B3VA 1AO7B 4G8FA 1T1XB 4YAQB 3N9GH 3ULUL 3K4ZA 4Y5XB 1F4WL 4YXLL 4WW2C 3KBPA 3WGUB 2ED8A 2L7UA 2KHAA 3X1BA 4MQXC 4YDLC 2X1XR 4HXBH 3KYNA 4JBSA 3BKYL 1WISA 3MOBH 4GRWE 4X5XA 3L4VA 1A4AA 5KSBE 5EWIH 4HGWA 1YEIL 1AKJA 4GQ9L 4Y4FA 1JE6A 5HGGS 4M8UA 4JFYB 4V11A 5F3BA 5K39A 5GS0C 5IB3B 1MJUH 2AV1B 4JFHD 5D7EA 4ZG1A 5D96C 4KZ0A 1X4ZA 1WD8A 3O6KL 1KCLA 1BFSA 2Y7LA 1O6SA 3T4AB 3WKMH 1BQRA 3G04A 3NJHA 5FF6A 4UBDC 1FQ9C 3MLXH 1ZE3H 2EQDA 2Y69B 5KVDE 4ZFFB 4PJCA 2RFXB 4ZUWA 5FYJL 2ZCZA 4PGCA 3R1GH 5B22A 1AGDB 2A9ML 3NJMA 3WAKA 3HIZA 2LVCA 2W91A 3WV0A 1WTLA 5IJBC 3TYFB 4OTXH 2GCYB 3RUGF 5GRUL 3X14A 5HHME 3BIAX 1ND0A 4FFYH 1A1OB 3DK0A 3P30H 4NKOA 3PHQB 1IM3D 3QPQC 1FG9C 3QH3B 3HMWH 5HGAB 5CXPA 3V5DB 5AYQA 4HJJH 1YDPB 4FA8A 1NAKH 2LQRA 2R2EA 1AD9B 5F1IA 4YEFA 4JFZH 5JOFB 1R46A 3NQKA 5IVXF 5D1QB 1T21B 1KTJA 2CIIA 3J07A 4O58L 2LU4A 4EOWL 1CFTB 1Z3RA 2VR4A 1CTOA 1MFAL 1J5CA 3MNZA 3SKUD 1A6TB 1RZPA 3CBRA 2AERT 1DQLH 3SSGA 2X44D 3WFDL 1P7QB 3VQ2C 3SDCD 5HYSG 4H8HA 3FOLA 3W0WB 1FA4A 3JYBA 4EBQL 3ARFB 5JOPE 2A74B 4G6JH 3VACA 3HZYB 3K2UH 5BOZG 1FH2A 4F5CE 3IFOB 4X6FB 4TTDC 3BVVA 4HIIB 4L8SB 4UT9A 4JZJB 2WXNA 3QQ9D 3ARGA 1BXUA 2O61B 2B4CC 4G6KL 3EDJA 4IIQA 4HFUL 5I30L 2FWLB 1RFDL 4IU3B 4I89A 5DJCA 3VRIA 5K59F 1X5IA 2MCPH 3UOAB 2HKAA 4YGVB 3DX7B 3EOBA 1GIGL 2X6AA 1N3NA 2OSLA 1DLFH 3D6GA 3GLAA 2VLJD 4HUWB 4PJGE 4HLEA 4K7PL 3P73B 1KYOJ 5LXGL 3GKZA 4JRFA 2PCFA 3C09B 3T0ED 4CNIA 5J06A 4IIQC 3QJVB 4UT6A 1HI6A 5CZVL 1OHQA 4LVEA 2BIHA 3VWKD 4LPXA 4D8OA 4G8GA 4HW6A 3AREB 2OTWA 2G5RA 2VMCA 5C97A 3LPFA 3D69B 1OGAE 4KNTA 1OTUD 2JSFA 1FGNH 4GP8B 4PREA 2EJ1A 3OF6D 4PV8A 2GJ6E 3O3AB 5C0DA 4MDRA 2P8MA 1UXMA 2EIMB 2PXYB 3CAFA 2NYKA 3R4DA 3OAZK 3N44F 2GSIB 3ZPDA 1ORQB 3LH2L 1R24B 4P4KC 2FBJH 3FPXA 4YOKA 1YYMH 3O2WL 5E8NA 3VSQA 4PS3A 1UD6A 4NYLA 4DJMA 2WXRA 3ECWA 4LCIL 1DZ0A 2OR9H 2JCCA 3ES6A 3CU7A 2DLGA 4KXCA 2I32A 3NAAH 2X0WA 3K6OA 4IKKA 1CFVL 1R34A 4X5QA 2ZOLA 4NM8L 4LSUH 3VFTA 4UQ3B 3HNVH 3P4NA 1ZVYA 2F58H 3X17A 1TG8A 3DARA 2R2CA 1QBBA 2CBPA 3VXUD 4S0HA 1F11A 1N7MH 1RULH 2IOMA 3BUDA 1IQDB 1U8NB 4M1GH 5HJ3B 1MUJB 2UWEA 4IJ3B 4ZPTA 2VZSA 4I4WB 3MREB 3B3IA 1A1NB 1QO3B 1QVOA 2AEWA 1QSFB 1GVIA 4UF7C 5T5FL 3GQFA 4PGEA 1BEYH 4TXVB 1UKQA 4MGXA 1I1AD 1I4FA 1RZIA 4LHJB 4UYQA 5F7EL 3RVXD 5EOTA 5GRZA 2FGWL 1XSJA 2NY0B 4D9LL 2DJSA 2VT0A 3ZGHA 4WCYL 1EJFA 1T04A 4ACTA 2CBMA 1FLRL 4TVPE 3I3BA 5FYKE 1YN7A 2O4EA 2D3NA 12E8H 3NZHH 1Z9LA 3NGBB 2ZP8A 3OPUA 4AYDC 3AWEA 4NLHA 3FCTB 2DOCA 3OKOA 2VLME 4M56A 5E1GA 3MRQB 3UJIH 4F15B 1NFDE 3Q9PA 1T3FA 5DA0B 5L4MA 4WK2B 4ZUUA 1BMZA 3H4FA 1E28B 1NIFA 2DTSA 1IC4L 3LEVL 1IUZA 2NSQA 4XZUA 5I1IL 1ZA3B 5AUMB 2X70A 2DLHA 4H8VA 4GRMB 2BW4A 4JG0L 2B59A 2FSDA 4KGLA 5CILH 1SXAA 5FO2A 4BM7A 2WB1A 3B34A 2VN6A 3QHFL 3EFOA 3LZRA 2XU9A 5CEZE 5F9DC 4MSWB 3EBAA 3UX9B 3REVA 1ECYA 2EH8L 5BZDA 4MD5A 1E5UI 3L13A 5DZOA 2R0LL 3U4EA 43C9B 5C08E 4Y4HD 2AJUH 4WWKB 2OZ4L 3RZWA 4N0YL 3RVXC 3LB6D 3D3VE 1JGVL 3CTTA 4JLRA 4ZOBA 5K9QI 4OGXH 2ZG3A 4W4OA 2YSSB 4DERA 4WU5B 3H9SD 2FEEI 1GC1H 1B4LA 3T8XA 4ZFGL 1RZ7H 2H41A 1YUHA 3L3GA 3PGCB 3MN8A 2NTSP 1I8LA 2FSEB 3OB0H 4K94L 3HZMB 3MBEB 4LSVL 1U3ZA 1AIFA 1BX2A 3L9RB 4Y2OA 1JV5A 2GHZA 3PWPA 4JCLA 3CPLB 5MEND 4TNVF 4JFWA 1A4KA 1CYXA 1I8AA 3PPSA 5EZIH 4E41E 5IB5A 2X4UA 5IEHA 3PAUA 2C1OA 1AKPA 5HYIA 3FT3A 1Z0NA 5HHOB 1WHOA 3MTRA 4XPHH 4OLWL 3REWA 2JLPA 3DDGA 2P5EA 2Z1KA 2DQ6A 1DBJH 5F21B 3UAEA 4OJCA 2X9YA 3GKWL 1EAJA 3O0RH 2WCGA 3WFHA 5FKPB 4JFFD 4IU2B 3G9VA 1UJTA 4KKCD 1VA9A 2G60H 3Q9QA 4AIZA 5ICZB 1KGIA 32C2A 4LSSL 5EA0L 2VXQA 2Q76B 3T0DA 2EDNA 4GAFB 4WY7L 3TEWA 2AXFA 2XV3A 2Y25A 3CIQA 5H37G 4NZJA 1D5MB 2DMCA 1ZLUH 2DKMA 4LLVA 1ESOA 1GGIH 3FUIA 4OZHE 1Z5LB 4F57L 4ZYKB 3L1GA 3BSZA 4KX7A 4X4MA 1M7IA 5F6IC 1WAAA 1ERNA 2VWEE 4BZ1H 2WUCL 1J8KA 2IOOA 4J28A 3K71A 1NCUA 2F8VA 2HG5B 1R19A 2VE6B 2G5UA 3Q2WA 3F84A 4ORZC 4XB7A 3STZB 1M7XA 2PP9A 3WL9B 2TRHA 4L8CB 3DBXB 1CBVH 1I85A 5FWQA 1OT1A 1FCCA 2CA3A 2CUMA 5GXBB 3CLEH 3L7EA 3I6LE 4YR6B 3TO4B 4F37F 3VI4B 5IW1A 3QEHB 5GSVB 1BYOA 1I85C 3DUUA 2LLGA 1AMXA 3EGXB 1JNLL 4MAYB 1Q72L 4PJFF 4AYFA 2IAMD 4EUPB 2J21A 1O5DT 1I9JL 4XNYH 2HFEB 3GTNA 1CU4L 1NPUA 3OJMB 3IDJB 4LEBA 3SE9L 1URZA 3BFQG 3GNML 1A7QL 1HZHH 2Y6SC 3OJ2C 4LCWB 1KEML 3IBOA 1E42A 2LOEA 3KPRB 1TJHH 2HKFL 3MGOB 4HCRA 4J6IA 4ODWA 4WZ9A 3RVUC 3IDMA 5HGHB 1IO4C 1OM9A 1RHHB 1TFHA 3G5VA 1KUMA 2VN5A 2Y23A 5IB2A 4OB5H 4NWTL 4ZUTA 3ZT5A 4OV5A 3BGMB 4JZOA 1SY6L 2WLLA 2J1WA 3MA9L 5TFSL 3DO7B 3FXIC 4LSRH 3BZFA 1BQLH 2NY2C 3D0LB 4X6DF 5DUBA 4UZSA 2MH4A 1A7OH 3FUFA 2CO2A 2OZNA 1U8IB 2FWSA 4UIMB 5TE7L 4I3SL 4ZSOE 2H2PD 1P5UB 3FTXA 3OR6A 3DHJA 2LAAA 1K4DA 5AVXB 4R96B 3GXUB 3RWJB 4Z0XA 2VUKA 4KQ3L 4DPBX 1M7UA 3LS4H 4N2AA 1OKEA 1DBAH 1CG9A 1FO0H 2XNAA 4N1EA 3U4BH 4P2RD 2DQFB 1KT2A 2CHDA 1NMCC 3ESOA 3KE0A 3N1MC 4OFDA 4OBSA 5SWZE 2JI1A 3GT6A 4XAKE 5F9WC 5LDUA 4KU1A 3OAUL 4XP5H 4IEFB 4MA3B 5JPNB 4P07A 4YLCA 4KQ0A 5FA4A 5MEOA 1MJ8L 1A8JH 1ES0B 1XGUA 1XZ0B 1SF3A 3D85A 1A1MB 1YNTF 3O3UN 1T0MA 3QORB 5B8CA 2WBXA 4GQZA 3VMNA 1OP4A 4LNVA 1MH5B 2HLEB 2BNRB 3TVMD 1KDIA 1MVFA 1NKGA 4HHAA 4YO0A 4KJPD 3QO0A 5B8CC 3WTXA 3T4YB 4F5CA 1K6QL 2V37A 5DMKA 2N0KA 3V4PL 3MV9B 4F7PA 4HWEL 4DHLA 1IRAY 4KZEL 1IEAB 4AL8H 4ZJ9A 4BH8A 1E9QB 3V6ZA 3DOSA 3IE4A 5AL0A 4GEJA 3EYUH 4POZD 3DVNA 4BFNA 1IAOB 4PJGA 2VGLM 4XP1H 1QTPA 1D7BA 3GMNB 1XF4A 4GQRA 3BP5A 3QAZC 3AS2A 4PHXA 2APWA 4ETQB 5T33L 1L9PA 3ULUC 2FDBP 1J8HD 4TNVK 4FYTA 4JRYD 2VDML 3X1GA 4P3CL 2R1XB 5DJZB 2VDLH 1H6UA 2K0RA 2W59A 3QJHA 4WEMB 4Z78A 1U4EA 4GEIA 2B5IB 3ZVVA 4CSTA 1YO4A 4LO9A 2UVFA 2GJ6A 5BOPA 5C7XH 3QS3A 4F1SA 5DRZA 1MHCB 2DJUA 2QSCL 2ROYA 4HC1H 5AW8B 5EDSA 4NC1C 4NI6A 4OF5A 2BSED 2A77H 3OLIA 4WEBH 3BQUA 4XBGB 4WFEE 5T3ZL 4WJ5B 3EXLA 2A2QT 3H55A 1E4XI 4WW2B 3ZMNA 3T6QC 4NAMA 1KF9B 3HLAB 4YDLB 1FZMA 2OKMA 3V0WH 4PRDB 1BA9A 3BESR 4G8FB 1JPGA 3N91A 4WFFD 1FGVH 2GK0A 4XR8C 2ZXAA 3P3SA 4A6YH 5L2JB 4GUQA 2LTQC 2XIIA 1GTNA 3O6FA 1JXJA 5JXED 1GOFA 1OAZL 4XX1E 2VDNB 1W72H 1RIHH 4OLVH 5DSCA 2VTFA 4H13C 4LKCA 5IBLC 3UTSB 5KJRH 4ZXBD 4PIBA 5D96B 4BKSC 1QBMH 2J71A 1HKLL 4ZBJA 3IN0A 3O6FC 4K3DL 2G75B 2FIKA 2FH6A 3B9EA 5DR5H 5F3BB 4F37K 3O2DL 5GJTH 4FMVA 4DKEL 2FUTA 5EOQH 3TF7C 1Q9KB 2XA3A 1N6QH 2AK4E 3O4LB 3NESA 4L3ED 4M4PA 3MACH 3LXBA 5FF6B 3LZPA 4JDEA 5E9DB 1DQVA 4L4JA 1Q9WB 1OIOA 4OJAA 3ROOA 4XWGL 3RRQA 3SOTA 1XGPA 1JZDC 1BMWA 4JHAL 3MNWB 1SBSL 4WF7A 5F1OB 1DQTA 5D71L 1DJYA 1UB6A 2IBZX 4BUHA 4OFQA 4ZX3A 1JBJA 1KLUA 1TZIA 1FNFA 3WXWH 4GNKB 1F58H 3HN3A 4FABH 1CK0L 2LLLA 5F7KC 4IOIA 4M8QA 5I76A 5A2JH 3X14B 2FB4H 2AQ1A 4IDJL 2C9XA 1QWNA 4LFHG 1AR1C 5D55A 2I07B 3WXVH 2HT2C 3CCHB 4OQTH 2W65B 5FDWB 1J0IA 4LLDA 2K70A 2A99A 3FTGB 1S78D 2VXTL 5DJ0B 4DO5A 4XCNA 1PZBA 3DIVA 1ZSHA 1IT9L 2R2EB 2E76C 3D2TA 5E99H 1PAMA 4ZXBC 3TEXA 3UEZA 1KJ2B 3FQ4A 2ZCLH 4HF5L 3LN4B 3MUUA 1XF3B 5HY9A 3HCVA 3MNZB 1A6VH 4L8DA 4KKAD 3P54A 5GGTH 4EZLA 3UO1H 5J5EA 1BJMA 1XTLA 3H3BC 1KB5B 2WLJA 4L23A 4RGOH 4AQEB 4TSBH 2GFBB 2J1KA 3WY1A 2XHNA 3L5WA 3VXMD 2AZUA 5T3ZE 4F7EA 4TMPA 2JKSA 1EEYA 4DCQA 1NBZA 3VA6A 1GZQA 5JQ6L 4PGJA 4XPBH 2WXQA 4GAGH 4IIQB 3V0IA 4RAUA 1MFBH 3O11A 3PGFH 3DX6B 1OSPL 5FC9A 5AVRB 1P4LB 1CFQB 1ZLWK 1KJMB 2VDRH 1I3UA 2YJQA 1J1XL 3BP4A 4MKTA 5FUCE 5KBPA 1F4XL 2I9TA 2CR6A 4LHQB 3MLRH 4YJZL 1QSFE 3C87A 5L88L 5ITBH 1X3DA 5T5FA 4U1MB 3NIFF 4YXKH 2XACC 1KJVA 4P4KB 1ZGLA 3CDGB 4LSDA 5J8OA 4CU6A 2NQDA 2OL3H 1CZ8H 3BH4A 2NX5A 2H6PA 3QFJD 3UJJL 3WTUA 3CPUA 3ARBD 2EP6A 3F04A 4W70A 4DZBB 1CFMA 1YJDL 4MNHA 3SDXA 4EIBA 2KYIA 4JM2A 5CSBA 1YEKH 4NYLB 4ZX6A 2VLRB 4QHNA 3WEBA 4NZUH 2D7TH 1NL0H 4XVTH 3CG8A 4CBPA 4MA8L 3F7VA 4NENA 3PNWA 3U0PA 1EA9C 3TFKD 1K5NB 3BYYA 3P4NB 3WTTA 3OSKA 1GS8A 4NRXB 2FQEA 3IGAA 1JNNH 2VJXA 3VJ6B 5KBKA 4RMSA 4BBWA 1LK3L 3UMNA 1F11B 1JTOA 4UM9A 3QG7H 2UWEB 4ZPTB 3GI9H 4A2GA 1OAJA 2L7EA 4GFXA 4JB9H 4N6QA 5H35A 4LESA 4X6CE 4IMLB 5J13C 5AB9A 1RZIB 1A6ZB 5FCUH 1WLHA 3M17A 1U6AL 1J05A 2OZ4A 5FDYA 3VSTA 5MEQB 4XCYA 3JWNG 3VFUB 2CNZA 4H1LB 2XVGA 4LL1A 4QI3A 5AVQB 5I66B 1H3XA 4Z8FH 1YN7B 4J4PA 4R7LA 4LEEA 3VI3A 4H0GA 4X50A 4BSVA 2X4QA 3CZKA 5D4JA 3MUY1 1RZFH 4FQPA 1KY6A 3FUDA 4KKBD 5I74C 3ZHFA 1Q0XL 3OKOB 4PG9A 2Z0BA 5AOJA 1A22B 4LSPH 4J4PC 4RRPG 3HNTH 4ZSOA 5FYLL 2VMDA 1L6XA 2HA1A 1IQWL 5EOCH 5JW3L 3FRUA 2VR3A 3IS1X 4FFVD 3MRMB 4HV8B 4XZUB 2X70B 4YSRA 3ZKND 3I2CL 4BKTC 1IZJA 5DJ2B 4K94C 1VKXB 4YHOL 1T4KB 1AQKL 3UAJA 3NACH 1HC1A 1QZNA 1X7QA 2B59B 1OP3H 5ILTH 1FN4A 1G7HB 3B2VL 1CB4A 4Z0BH 1M7DA 1T5XA 3UTTE 1E40A 1SMDA 1JWSA 1DTUA 1DVUA 5BZDB 4MD5B 3O8XA 5I16B 1C16B 1BVKB 3UAJC 5CINH 4PJ9C 1NWPA 2ADFL 3PXHA 1XSIA 2O30A 2N0MA 1LP9B 5AKTA 5BMFH 1DJSA 5ANMB 4NKMB 3NDYE 3AU0A 3O8XC 2PW1A 1CLCA 3WTYA 3I9PA 3L95B 3LRSB 5KSAC 4WI8A 2EIKB 1LILA 3I75A 4DP6X 1GXEA 4MZIA 3PGDA 4M7ZC 1GYVA 1LDPH 3L3IA 3T8XB 5L4IA 4GFTB 3OWEA 5IEKA 1Q0YH 2O72A 1BZQK 3L3GB 4MA1C 4PLNC 1DVFD 2WWMD 1TTCA 1E2ZA 4Y16A 1Y0LB 1AIFB 2A4ZA 3ZKMC 1X5GA 4KZCA 4X9HA 3CXDL 3CH1A 2JWYA 1QSEA 1A4KB 1NAML 4JFED 4PJ7F 3CDYA 5F89A 5EU4A 2BOLA 1IL1A 4WSGA 3C5XA 5B3JE 1I3GH 1KTLA 4FCHA 2J8UB 3AB0C 3AUVA 3FT3B 2X87A 4PJEF 3L1OL 4UM8A 1NCHA 1EAOA 3MO1B 1A7NH 2E4FA 2OW7A 5SV4A 3N9GL 3PL6D 3NH7L 1CL7I 1F3JB 1S8DA 2C8NA 3FUMA 3MJ7A 4N2BA 2HRHA 3E9TA 3RIFK 4HXBL 3WFHB 5I0DA 4LCWE 2ESVB 5FM4A 3SKOB 4DKFH 5BZWA 2N01B 3NA9H 2NZ9C 1JHLL 2YPKB 3TBSB 3ARXA 1J1OH 4APQD 5F6IB 1KEGH 4H40A 1JL8A 1QLEB 2UY6B 1A4JB 4OKDA 3KBFA 1HHIB 2XRAH 5FB8B 2XN9D 1SY6A 2IBGA 4N85A 3UTPD 4XC3L 1LTXA 4H25A 3KDMA 3PQYA 4RAVB 3NJVA 3SJVB 4NI3A 4XMPL 2H8PB 1KB9J 3K71B 3NRQA 4M00A 4PLJC 5FYLE 4DSYA 5DGRA 4FXGA 4JO5A 1QFWI 5A43C 1S7SB 3IU3A 2CIKA 3BAEH 2IC2A 2QELA 2DWTA 3QDME 3ESPA 5D7IF 2R59A 2XZQL 1GA2A 1C5CH 1DQQA 3SIKA 3QUYD 1H8NA 4X6CA 5F7DB 1BZOA 3MCKA 5IW1B 3DUUB 2FQGA 5D1XC 1WRFA 3K5RA 3QUGA 4IRJA 4NNYA 1LXMA 3FB7A 4ZW5A 3P30L 1TVBB 2PO6C 3HW7A 5I1JL 1AGBA 2F7QA 3SY0B 1DQKA 1E8YA 4HZLB 2BNRE 4XHJC 1H8SA 4IRJC 5FM8A 2NY2B 4ODWB 2CKBL 5FW6A 4DP2X 3FO9A 1DEEB 1S7UA 1TNMA 2B1AH 2WB7A 3PUUA 1BIHA 3FB5A 5ACLA 2N3JA 3BLBA 4OUUA 3RA7L 3RPKA 4Z5RB 1DYZA 1ZSDA 2WLLB 3MV9E 1Y18A 1ZANH 1ZT7A 1O9WA 1AD0A 2V9UA 1XF1A 3NTCL 4U31A 4YGAB 1RZ8A 1UFGA 2DQCH 4W6WB 2L0DA 1TZ8A 4N8VA 3BUYB 4A67A 1C8QA 1T7YA 2VO5A 3OR6B 4OLZL 1V7NH 4NHUB 3FFCA 2EE9A 1KYUA 3TNNB 2V7NA 5JIMA 2YO3A 3S35H 1IGIL 5F9WB 3ZL1A 5I1LA 5CJOL 5ES4B 1I9RL 2V7HB 2IAMB 3LRLA 1R17A 4GI9A 2XNAB 5DI8B 1TEGA 5BQDA 3O3DA 1HJBC 3Q5YA 1S7TA 1GS7A 4I0PD 2W94A 4V1DA 4G6AC 3OGCA 3FBQA 2WW8A 1BV8A 4KDWA 1JYWA 4PJIB 5F7FA 4B3EA 5FA4B 3TIDA 5MEOB 2CPUA 3D85B 2Q1EA 2EDKA 4G6FB 4XI5D 4LFHD 2E9IA 2J4WH 5JNYB 1PX8A 5B8CB 2FJHB 3TO2A 3WUWG 4ZMQA 4IOFC 4JFPB 4UQIM 3W11D 4C83A 3CFMA 2ZOUA 3RDTA 1QR1A 2CLVB 4PFEA 1YEEH 4HHAB 4IYKA 1FGNL 3W81A 1BBJA 1MF2L 4IGBD 1NDMB 1TR7A 4N9GA 3RUGB 5CBAA 4LZKA 4O2EB 1MQKL 3RDTC 1TQCC 1MNUL 1NC4A 3NJGA 2D31A 1BSIA 1NFAA 1YCSA 2FBJL 3QAZB 4AEEA 3V6ZB 5CJXA 5KZCD 4M5ZL 7PAZA 3SKNA 5DMYA 1NBVH 1NCDH 1SM3L 2HTLD 3K74B 3K46A 1Q9LA 4LMQI 5HDBB 5ID0A 4NZFA 1IAMA 2YKLL 3BZ4B 2OR9L 4QHLB 1JK8B 4I13B 4NQED 3JTBA 3WAJA 3NAAL 1XF4B 3VD4A 3BP5B 2Y06L 2ZICA 1AGFA 4LSUL 4A7UA 4IKNA 4FP8H 4MXVE 3UBXG 2VZOA 2XETA 3T0AA 4YSAA 2M83A 3JV6A 2FL5A 3P3YA 1EERB 3EBGA 5EU6D 1PEWA 1UWGH 3O2DA 4Q4IA 7CGTA 4XI5C 1FSKC 2ATKB 1DUZA 2D3VA 5AKSA 4J7RA 5DRZB 1BEYL 1TTAA 2DL2A 2AQNA 2LLNA 4Z7UF 2ZYHA 1MHEB 3WIHA 5EPMA 2HTKD 1Z5HA 5IFJA 4LIQL 5CJ5A 5GGSY 1PZAA 4NUJA 4UOZA 4GW5A 3L45A 4QRTB 2XQYK 3ZE1B 2QSTA 2LTQB 1FZMB 12E8L 5E5LA 2FQDA 3A3YB 1MW1A 1YN6A 2R69H 4ESKA 1JPGB 2QKSA 2GK0B 4TUUA 3WFBL 3SPCA 3VQMA 3I3EA 3O6FB 5EO0A 4JRYB 4RFNC 3VDBA 4JFHE 5DSCB 4U05A 4XMXA 3UH8A 4ABWA 3CE1A 1MFEH 1S9YA 1HH6B 3IMWA 5CR8A 5AVVB 1RURH 4A2DA 4WTZA 2FIKB 4HAKA 3QGVA 2XYCA 5INDA 1AXSB 5DC0A 3WMQA 2FO4B 5J0BA 3AU1A 4M1DL 5E23A 4E42A 1RPKA 3ZX1A 4YDJB 4HS6A 1MZYA 4LAQL 3MXWH 5IROA 3A6BL 3ZMRA 1CWVA 4OF3A 3NPSC 1AAJA 4JDEB 2AJUL 3ROOB 1GGUA 1PYWB 3T2PA 2XG4A 3HUJA 2MPAH 3WS6A 1BM7A 3CQPA 4GQPH 3QWQB 5IROC 1RUMH 1YMMD 3N43F 5SWQB 5SX4I 1W0WB 2B0SH 4UCFA 1TZIB 1OCOB 3EGSB 4ONOA 1GC1L 1QG3A 3PAVA 3WGVB 2E5EA 4IOIB 3WY4A 1L0YA 4ABUA 4I3GA 4ZXBB 3WLBB 1JZ7A 4KK9D 5CD3A 1T22A 3G6DH 2WP3T 2BS9A 3F8UB 2QZQA 4LMQE 3CMGA 2YC1A 1ZKAA 4K9EH 4L0ZA 3WHXA 4HD9A 2AMUA 2VUOA 3UTTA 1BPVA 3H2PA 4Y2LA 3WIFA 5AVZB 5GIRA 1BDYA 4D7PA 4BEIA 5IB1B 3QDGA 2DYPB 5I73C 1JZ8A 3ZY7A 1DSFH 1AZRA 3UPCA 3X12B 3C8DA 2PYFB 3OAWA 3UC0L 3BIBX 1DBJL 3LNFA 4JO2H 3A23A 4BK5C 4ZNCD 4HWZA 3VMPA 1TITA 5BW7C 3MRHA 4S2SB 2P43B 1PVHA 3MLZL 4FJZA 3C6SA 2CGRH 2VRKA 2E7MA 2VDPL 4X7SH 5DC2A 5BVPL 1UJ3A 4PJ8A 2H6OA 1TZAA 1IAKA 2VLJE 2CDEA 3T2NH 3T0EE 1H3VA 3HR6A 1BZ7A 1HSAA 5KBNC 4ZD3H 1YJDC 2DIEA 1CFBA 1UJ3C 4PJ8C 3S37X 1U8KA 2YWYA 3NUKA 1CD0A 2JTYA 3ZOAA 3H7BA 2R8SL 3UG5A 2I9TB 5IB4A 4NQDA 1PLBA 4OZFB 2XXMB 2ZJSH 3BW9A 3BO8B 5GRVK 2VMFA 3ULSB 4KROC 3ULVH 2ZX6A 2XWBB 2NQCA 4OLYL 1N0XH 2FLRT 2OMBA 2QQLL 1NGYA 1N59A 1S7XB 2XXGA 3JT2A 5TQ2H 3QEQB 1XF5B 4OD2A 3IM1A 1ZGLB 2R2HB 3CDFA 3UJTH 3SBQA 1SJEA 3GS4A 3C5ZD 4XNYL 4MQSB 2QSQA 4OZGA 5IJVA 1JK9B 3ZZLA 1S9WB 1REIA 1A6AB 2NX5B 3GHPA 4RZKA 1NOFA 2Q87A 2WGNB 5CEXA 1CT8A 1XB8A 2W88A 1V3JA 1GZPB 1HZHL 1O9ZA 1PY0A 1XFPA 4C8XA 3U7WL 1TJHL 4WU7A 1LO5B 4FLQA 2APBA 5A2AA 4MJ4A 4JL2A 1DZBA 1NIDA 4JN2B 3VXUE 4NKIL 5DCCA 4PJAB 1OE3A 2PWDA 2VB5A 3OKDB 4FULA 3W39B 4NENB 4OZIF 4HSCX 4NM4H 5E1AB 5IQNA 2LVEA 4OD1H 1PX4A 4BJLA 1KFAL 2HT4C 5CP3H 4MMZC 4UUJB 3IGAB 4I85A 5J13B 3V9EA 4M6NL 4UM9B 3Q8EA 2CXGA 1BVZA 1EHXA 3M1CA 2QQKH 5ICYA 3LS4L 1IGMH 1VFMA 5FPIA 2WD0A 1DVQA 3NZUA 1DBAL 2A0LD 3U4BL 2OMVA 2QPUA 2P7TA 2E9GA 3VRLF 5E56A 2JF1A 2BMKB 3M17B 5ANME 3BGFC 1A3RL 1DUYA 3ARBB 4XP5L 3SQRA 1HILA 4JG5A 2OQJA 4WIQA 1NGZB 4J3BA 4OJFL 4L5FH 4JM4L 2RALA 1BIIA 1HL5A 4PRPA 3VXTB 2VW4A 5A7EA 4C4BA 4BSVB 2X4QB 5B39G 4LCCB 3TA3C 5C0BD 4R9HA 2WJ7A 3IFNH 3DSFL 3S5LG 3NN8B 1DEDA 4XP6H 5AVWB 5D9SA 5JOEA 3D51A 1OB1A 1PD6A 4Y0GA 2BZ7A 2JXMB 4RGNC 3KYMA 3VAEA 3VFSA 1NAMA 1INQA 2D3JA 3ABZA 4F80A 1N68A 1A5FH 4XAWL 4PJFB 4LU5H 3D39D 4PJXE 4GW4B 1L3NA 4PJ9B 4HJEA 1WZAA 1FC2D 5F9OH 1G9MC 2IPTH 1EBPA 1M7DB 2WTRB 3E8VA 1J9SA 1T5XB 1XX9C 4FA7B 1JWSB 4E0RB 2CKNA 1UATA 4LRIA 3O8XB 4YHPB 3AWFA 3H85A 3PABA 5KSAB 2ADJB 3H9SE 2EZ0D 4YHZL 3FCBA 3PUCA 3ZR5A 4GMTH 4M7ZB 1TZOA 5D2LE 4AOFA 4PRHA 2O5XH 3U2SB 2FJFB 1JOIA 4LRIC 3I02B 4X6DB 3L9BA 4YHIA 5LJYH 1EX0A 5F1SA 1AGEA 2AJ3B 4PP1D 4KTGA 3MRCA 3I75B 3WO4C 4HUVA 4B9CA 4M61A 5MENE 2XYBA 4PJ5D 4ELMA 1U2CA 1W8NA 3EYFA 3AGVA 4D7BA 3QCTH 1XD0A 3CSYA 4XNMA 3N0AA 3AB0B 1WBYB 2EIZA 5KYYB 1G9NH 5FXCH 3UGEA 4GSDL 1KC5L 1AI1H 2G9HA 4MCZA 3IJHA 3SDAD 5T1MA 4U1NA 5A3ID 1U8MA 4JFFE 1SDDA 4WGVB 3G3LA 3V0WL 4WO4D 3CU1A 3GBDA 4KK8D 2VH5L 3BZEA 3NCYP 3AXLA 5SX5K 2DWDB 2WXMA 1SHMA 3DTXA 3GMLB 4KTEH 5CEYA 5I8CA 4HALA 3TH3T 3CD4A 4N90D 1YNTB 1HOCA 2BY3A 3LSOA 3PRZA 1W72L 4GMSH 1DBML 2RCSH 1R3KB 5BZWB 1ZJBA 5LGJA 1OWWA 1PD1A 1FE8L 2CKBA 2BHFA 2ITDA 1JHKH 5DR5L 4BSWA 1T1WA 5EORH 5AWNL 4HKXB 3RWFA 3L4TA 1AOZA 3B9KA 3OR7A 3SGJA 5FHBL 1KCWA 1N6QL 1B0RA 4O02B 3PQYB 3LQAH 2F7OA 1K8IB 2GJRA 4JFEB 3MACL 4KY2A 4AG4H 1C12A 2EYRA 1HCVA 1B3IA 3KZ8A 3SGJC 5H2BB 1OAXH 3IU3B 4DTGL 5D1XB 3WG7B 2XKUA 3PV6A 5FHAL 2YAOA 4N28A 1QEXA 2BFVH 3SKJL 5A3IC 2PO6B 2H2SD 3MCKB 4LOUD 2BNUB 1NLBH 5I6XC 4YZWA 2QZ5A 3NCBB 1FC1A 4PR5B 2E86A 3F01A 3GBLA 4IRJB 3GZQA 1L3WA 3UPRB 1OB0A 3RY5A 4W9DC 3SODB 3MV01 1AGBB 1AG0A 3B5HA 3VD5A 4YDVB 3RVVD 2K3HA 5JTWA 1UUNA 3TASA 4NSKA 5E99L 1B90A 5BUAA 2GSGB 5DD1H 2ZCLL 3KXFD 3HHSA 4AGNA 1CFNA 1U9KA 4R0LB 4Y4KD 5ACZA 1B4JL 1KCVH 1JPTH 2FWOA 2OCFD 4B95C 3RUGE 4N3UA 3L54A 4ENED 1JFQL 4F9PA 1AD0B 2HZHA 5BOJA 4GXUM 3V4PB 1ZTXH 3OKNA 1RZ8B 2P80D 4G9FB 4WK0B 1CI5A 1DE4B 4XN7A 4HEMA 4P2RE 4TSBL 2F8XC 1IM3A 2VQ1B 3FPYA 1CR9H 2XC8A 4NQVB 3HVDA 3FFCB 5DJ6A 5EO1B 5FUOH 4F9PC 2WLNA 2A1WL 3HPLA 1S5IH 2V7NB 3BEWA 1S5HA 4OKVA 5IVXE 3U25A 2OR7A 4QT5A 4QOKD 5EEVA 3HG3A 1PL3A 2BS8A 1SHWA 2WWOA 3KPLA 1MFBL 1XGTA 4G7VL 5B1AB 2SEBB 5I6LA 5A1AA 3TS8A 5JHDA 3QAQA 4V1DB 3OGCB 5FFOA 1T7WA 2DQIL 5KBLA 1TO5A 3PP3K 2E9WA 4ALAL 2BSBA 4ZNEE 5AW3B 1JGEB 4P2OC 4IHBA 4NQSB 3AXIA 4K8RH 2ZP9A 1FZOA 3CHSA 4S1DD 4ZO7A 2APSA 1OTTC 4MHHI 4YXKL 5M95B 4NAJA 4HPHA 3RDTB 3ZKSD 3KGUA 1BZ9B 2GTQA 1LJMA 3K8LA 4BGLA 1SLVA 4GBXC 5DYOA 1SEBA 2GAZA 4N9GB 1CZ8L 1SUHA 1BOGA 2F19H 4ZUSA 5JIKA 1MFVA 2VLJA 3EJRA 2OJ1A 3RX5A 1MI5D 4N8CL 1ML0A 2XG5A 4ETYA 3T0EA 1ITBB 2A9AA 2Y1ZA 4GRLA 1J8HE 3SKNB 1YEKL 4JRYE 4X5PA 3VWKA 2XPYA 1DR9A 1Q9LB 4HJ0C 1R0AH 3BAWA 2OS7A 4AQAA 2D7TL 3H0TB 2J88L 5CJQL 2ZWSA 1YQ2A 1GSMA 1VFBA 43CAA 2VDQH 4GRLC 3PJSB 3T77A 3LMJH 1ZT1A 2MHAB 1FSKB 4HCGA 2QJDA 4P57B 4HH9A 1SJXA 3QARA 3TTSA 2WLMA 5L4JA 4JB9L 4BE5A 1RK0B 3PNRB 1NCAL 4BWWA 2EDHA 5CJ8A 4L4VB 4I18B 5CO1A 5FCUL 3IE9A 4S1DC 5E4IA 5J1TC 1T03L 1EXUA 4JY6B 2J12B 4RMUA 3MBXH 2EDFA 1N64L 1EAPA 4XCCL 1ZA6B 4GUCA 4NUJB 4GW5B 1IBGH 4OAWA 2EDEA 4N2CA 4Z8FL 1W6WA 1NGXB 5CGYD 2XV0A 5GQBA 5HD8D 3VXUA 4O4YL 3TONA 1KTDA 3N1PC 3L4UA 2W9DL 3M07A 3T08A 3MLSH 4YXHH 3GINA 3R7RA 2NY1D 3MCLH 3HNTL 1BF8A 2ZXQA 2YJLA 5EO0B 1I1AA 5FOBA 4LNRA 2PW2A 1GC1C 4UAHA 3QUZA 5EOCL 4S1SH 3LHPL 2Z8WC 2R0WL 1UWXK 4QRPD 5EU6B 1F90H 3PWJB 3GMOA 1S9YB 4L3EE 3L3KB 3V7AG 3QQ4A 3RQ3A 3DX9A 2OXGA 3JT0A 3PFUA 3NPSB 2ITEA 3QUZC 2WQSA 1Q94A 3LKQB 3OHXB 1FZJA 4E42B 2WKOF 2UZYA 2YGNA 4N87A 2MNWA 3ECBA 1INDH 4HS6B 4AXWA 5CINL 3FZUD 2WN3A 1MCIA 3TA4D 1P1ZA 3V6OE 2HRPH 5TK2A 3BVWA 1LEIA 3C2AL 1DP0A 2E27L 4FHKA 2IGFL 4FS0A 3NP3A 4Y19A 4FADA 1WICA 1NCWL 1F3DH 3FSVA 5PAZA 4PGBA 2P8PA 5D6CB 5ID1B 1LDPL 2GT9B 1Q0YL 4XO9A 4NQCA 2FYYA 5DUPH 4POYA 3MX0B 5LUMA 2A73B 2A9DA 5EUKB 3BH9B 1NGPL 5E03A 5I73B 2YPLA 1T22B 4Y4HA 1ZLDA 5C6WH 3HRZC 1U8JA 3U9UA 3HC2A 1OK0A 1Q9OA 2ZKMX 3FU6A 1WIOA 5EBLA 4EKJA 4F93B 4JKPH 3KMDA 1I3GL 5EUOF 5FAAA 4JEGB 5CKGA 5I6PA 2N7SA 1IGYA 1A14H 1KGUA 1QUNB 4PD4K 3X11B 8PAZA 4Z18A 3H9SA 4AT6B 5IHHA 4CSPA 3VXME 5DZLA 2IFGA 5DVKA 4XE0A 2A6JA 2YUVA 1JUFB 5DWUL 2CLRB 3BT0A 4KI1A 4HWZB 2JJTA 4F24A 2EKSA 3UO8B 2BVTA 2XFXA 3QZMA 4DPRA 3UYRL 5BV7L 4QKXB 4YIQB 1YMMB 3AAZA 2GSMB 1ZPLA 1F6FB 5MENA 1J1OL 2DS4A 1Z9SA 1UJ3B 4HS3A 1YQVH 4PJ8B 1LEKA 3L7FB 3E6FA 1IAKB 2JJTC 2OMWB 2XRAL 1D3CA 5CLYA 2AV7A 4HETA 2E7HA 1BZ7B 4XN5A 1JWMA 1HYSD 1H6TA 3C9NA 4PCYA 2JKNA 3ZQXA 3N5AA 2G30A 2X4OA 1U8KB 1L9QA 4JFFA 2YAMA 5HGBB 5IB4B 3JXAA 4NQDB 3GHBH 1R3JB 3O3EA 4UV4H 3BAEL 4FD0A 5TPWL 3FT2A 1E4HA 3ZRSA 4GUPB 4H8UA 4TULL 1BXVA 4WSJA 4OF7A 2A9BA 2BSCA 3QFJE 2EC9U 2QDWA 1NGYB 1KCSH 5DQJB 1H15A 4XXCA 4YZFF 5I18H 1F4YH 1TFPA 4OD2B 1IBBA 3Q48A 4X9IA 5M94B 4XGZA 2WQRA 4A39A 4PY7A 4OZGB 5KSUB 1USQA 3OG6B 4JPQA 4XXCC 5FO8A 3DJTA 1FFOB 4Z7NF 3T65A 5F0LB 4TQEH 2NXYD 1MIEH 5E6UB 5CHNB 1MLBB 1V7ML 1YYCA 2WQAA 5E8PB 3WY2A 2B1AL 2DQUH 1NJ9A 1KGXA 4PSRA 4HU8A 3HI5H 1IBZA 3LKPB 4MMZB 1W2KT 2PYEB 3QA3A 4PJ7B 4PJHA 3VTTA 1XGRA 2WLIB 4ONHA 1JAEA 4QLRA 3FKUS 4L4TA 1ZANL 1CXFA 2F61A 4PJFE 4QTHA 5CMAB 4KH2A 3QWRA 2D03H 2DQCL 3RGBA 2JIXB 4XVUC 4QCIB 5EEUA 1HWWA 2VSKB 5A2IH 1XR9A 4PJBB 2JJUA 1B0IA 4LVHC 3WY3A 5K9KB 3QJFA 5E94B 1SYSA 1IZKA 2J55A 5B38G 2JV6A 1TDQA 4YSPA 3S35L 5DDHA 3VXNA 5ICYB 5IT2L 4LLYA 4NPYA 3V4VB 1JF1B 4O51B 4AL8C 1WA1X 3BVUA 3KBHE 4J3SA 1E6OH 4Q6KA 2IWFA 2NLJA 3B8YA 1JPSH 2XZZA 1F2XK 5AW9B 3V95A 1HHGA 4X6DE 1SDAB 4E36A 3TA3B 2Z31D 1ID2A 1PSKH 4HQQH 3GJFB 4X7CC 5J6SA 1BIIB 4YBQD 3T3MB 4X99B 5FO9B 1U8LB 3OKEB 2XQBL 1YNLH 1L4IA 4BQ6A 4CRPA 4HULB 3NJFA 1IE4A 4HAFA 1UT1A 2HRGA 1LLAA 5JQIB 3N6YA 3OLDA 4J6RH 3L5IA 4XNBA 5DD0L 2YPVH 2C7FA 3I84A 2VKWA 2X4SB 1YEEL 2HWZH 1QTYT 2X89D 3AS0A 2DLFH 5FYJU 3ZL4H 6FABL 3VFSB 3G08B 4NIKB 4FHJA 3QHZL 5LNEA 5C92A 3K1KC 1X5HA 5AALA 5IVXA 1UASA 1DQIA 3CFCH 4WGWB 3HC3H 3L48A 3ZZ1A 3QHTC 3GIVA 5E8OB 2NTFB 1I7UA 1NCDL 4NX0A 4U6VL 1CDCA 3EZ8A 1GAFL 3TVMA 1CICD 1AHMA 3ARDD 2DI7A 3NJKA 4FMKA 3O2VH 4DK6A 4IBQA 3WO4B 1NBCA 5KYWB 3H56A 5C0ND 4PRHB 3EYVA 1TT6A 2ZAGA 3BKJH 3MLUL 3MLVH 3ZO9A 1G7QA 2BP0B 3QW9A 3A67H 2B14A 3CIAA 4JHZA 4HG4K 4PTTB 1UWGL 1D9KD 5E95B 1P7HL 1U58A 4ELMB 5HYJD 1D7FA 4JFEE 1LVEA 1LDSA 1T0PB 2BCKB 1CGVA 3WN5A 1KPVB 2NNXA 1G7PA 1MFDL 3C60C 2EIZB 4XVJH 1DJXA 4FAAB 4GPVA 3D39B 4MXQD 2W80C 4I2XB 1NBYA 3HMXH 2KT6A 4TKWA 4DP7X 1HDMA 2D4FA 1U8MB 3KS0H 4L37A 1X5XA 4WW1A 4ONFH 1DBKH 1IFRA 2FT6A 4C4KT 3MTXA 3AXLB 4CU7A 4JR9H 5DHMC 1B6DA 3KGRA 2XWRA 5D7KD 3ABMB 3OMAB 1P84J 3B2MA 2UZIH 1FVEA 1J1PH 3P1VA 2G3MA 3CLWA 1MCKA 1QLRA 1UVQA 2XN9E 3APDA 5HHVH 2XBTA 5J1AA 4LF3A 5BRQA 3US9A 2BSEA 1O9VA 1F4AA 5KVEH 4ELKB 4ODHH 3UTPE 5FM5O 1RZJH 3QJRB 4KNUA 1ORSA 4HWUA 4FQJH 4NO3B 4PJ5B 3DXAA 4MCYB 4P59H 4XNUH 1T1WB 1RSFA 5LO7A 5HHQB 1NMAL 3IDNA 3OMZA 4LCYB 4HOMA 1TCRA 3CFNA 4UOW0 3VFRA 3VE0A 3VTMA 1IBFA 5E6ID 3SHSA 4ABQA 4BK4A 5IBUG 4PWGA 2DQJL 1GGCL 2E6JA 3MXWL 4RVBA 1FRGH 2NXZC 4HBCL 4JKWA 2ORBH 4WHYH 3T9WA 3SDAB 3VMOA 2DQEH 4KMTH 2CJ3A 4WKZB 5JXEA 5LGHH 5CJBA 3FO1B 4BZYA 2CG9X 3WIIH 2LFGA 5I6XB 2Q3AA 2ZKHL 1NICA 2K4AA 1ZVNA 3PV6B 4R3SA 5I5JA 1RUML 3BP7B 5E4EC 2B0SL 2X7LB 5IR1B 2R4SH 1D6EB 4KKLC 4YSUA 2H32H 4TL4A 1CF8H 5DO2C 2YEVB 5TE6L 4F27A 3KPPB 3CFEA 1I82A 1Z6JT 3S96B 5EU7C 5EDXA 3RVWC 4EUPH 2ZG2A 5D6DA 4IBWA 4ODTH 3ZE0F 5DU7A 5EBMB 3STLB 4L3EA 3GUTA 1A9BB 4N8UA 1JZ4A 4G42A 3MLWH 3AS3A 3UYOD 2UXGA 4K9EL 3L2NA 4Z7UB 1AACA 2YGOA 5D6DC 1M05A 4KUZL 3D50A 2GK2A 1KIPA 3DURA 2D9CA 4BE6A 1DVTA 5ACZB 5ERWB 3V6OA 1MCFA 2FWOB 3GS0A 4JPWH 4K23H 3V0EA 1CQYA 2XCMC 4NP9A 3II3A 3O45B 3OKNB 3CN4A 1P53A 3BAXA 1A25A 3KYKH 3MGAA 4UQEA 1M3JA 2FECI 5FK9B 3AM8A 4G43B 2XPZA 1EVTC 4M4RB 2Q9OA 4D0BB 3KPSD 3HPLB 3QDJD 4OY9A 2YKKA 1S5HB 3KBEA 4E5XG 5I17A 4XN9A 5E00A 1HIMH 2JB5L 3IJSA 4ZO6A 1HXMA 4KRLB 2ILLA 2JI3A 3AM8C 1C5BL 4ZD3L 3QQDB 4ZMNA 1XGTB 1KIQB 4KZDL 4N3TA 4P2OB 5JHDB 4S0SD 1KXQA 2LGNA 1MJJB 3CLFH 3LN5A 3HS0A 3HAEG 3WIAA 4ZPVA 1T0NA 3VXMA 1JIBA 3D4GA 4YSCA 3RX9A 4FL4C 4GBXB 5B21A 2WINA 3WD5L 5DFVC 4F7KA 1G94A 1N0XL 1U8QB 1KV7A 5CD5D 4BGDA 4Z7QF 4UTBL 2N1KA 3Q3GA 3N43B 2ITFA 5KSBF 1OCCB 4KKZA 2PP8A 4F7TB 3UJTL 3QYNA 2F54D 5CCJA 3A4FA 5DYOB 1SEBB 2GAZB 4XNQA 4FQCH 3FQ1A 3G6JB 4ZUSB 5AZEL 1JNHA 3MRLA 4NQEE 3TBVA 3M7OA 3T0XA 1KIRA 3LZOA 2XG5B 3EYSL 4FNLH 2IPKA 5EN2B 1A7PH 1BFOB 5C0GA 5EF3A 2D0FA 1JXDA 1VACA 4OZ4B 5E24E 4XNZB 5CWSB 2QVIA 5BQ7A 5KBMA 5E2WH 3S34L 3P0YL 4JG1H 5ESAA 3NIFE 2Q5BA 2PN5A 4BCXA 5EU6E 4XXDA 1VFBB 5ALCH 3X1EA 3B1UA 1WUZA 1ZHNB 4NM4L 4OLXH 3ET9F 1AQMA 1TPXC 3FUEA 4MNQD 3CGTA 1DBBL 3UGUA 4KRPC 3VG9C 5DRNB 3VFPA 3GSNL 2IH3B 5IMLA 1MPAH 2AAVA 2QQKL 4ANVA 1IGML 2WXFA 5I82A 2NNCA 4X9BA 2WUBH 5GGVH 3BQVA 2VJ0A 1A6WL 1UYWH 3RGVD 2LAGB 5L7XH 4PJ6A 2KLTA 1FORH 3ULVF 4XH2A 4ONGH 1EAPB 4JK0D 5AW5B 5FR3A 3EZJB 4NQXB 5FGCB 4MD4B 3MRKB 1PF3A 3MV11 3M6DA 4L05A 1MCDA 4XBPB 4RWHA 4CJ1A 4HUUB 1J88A 1EZLA 4HT1H 4AQ1C 3LNIA 1ETJA 4XP6L 2PLTA 4OD3H 3KPQA 3L4WA 3QXTA 3U36B 4WWPA 3ZUCA 5GS0H 2AXJA 3AABA 1XSKA 5F3HA 5GGUB 4AEIL 3DX2A 1X5ZA 5T3XH 1IFHH 3QZWG 1DDHB 2VIRA 3QQ4B 4FLOA 4LU5L 3RWCB 4F8NA 2Z92B 2NRDA 2VSCA 1R5VA 3V52L 2QHLA 5F9OL 2R23A 2IPTL 3IMVA 4M8VA 4J8RA 5EU5A 4K7FB 5EC2B 5E5UB 3LZFH 3VXRD 2ID5A 4XMUA 4AK1A 3MRIB 1MCSA 4Y9GA 1YMME 5ESVA 1CLYH 2BC4A 2P9RA 3S3PA 5ESQB 3JWNE 4GMTL 3UZVA 5JW4R 1AZZC 1MCOH 2OMYA 2GY5A 3MRDA 5IM7B 5DMGC 3HZKA 5BV7C 5GZOD 3P11H 4TVSa 4DVBA 4RSYA 4OUOA 2DQHH 5AW0B 4BRJA 4RX4D 5LXVA 2WXLA 3HRZB 2Z9TA 4X4XA 3RYMA 2IG2L 1UZ6F 4JM0A 4R26H 3EGDA 4HX1A 2YPLB 5H94B 4OCWH 1E4WL 5TDNB 5LAXB 1U8JB 2QPFA 1AI1L 2VN3A 1OOWA 1E4KC 1HFUA 3WO3B 3ALXA 4CSSA 1O7DC 3BD5A 2MWCA 4FTVA 4ZDHA 2YHGA 4DPAX 4KTEL 2YIHA 2VAAA 3ROLB 3PFQA 2HN7A 2YZ8A 1X5FA 5IKCB 3V0AC 4ES8A 2BVPA 3OTTA 4WNQA 3BRFA 1DSWA 5JZ7D 1CD9B 3DGCR 4A7VA 3P4MB 2B4CH 2XA8L 3AAZB 2EE0A 1A9EA 3KPOA 2WBJD 3DIDA 2E9BA 3E6HA 4HUCA 4XO5A 5EEZA 2O5NA 4PJ7E 1G43A 1Z9SB 3IXAB 4BWTA 3MJ8A 4HS3B 1FL5A 4UT9H 1JD9A 1LEKB 2VDKH 3NABL 4NN6C 5EORL 5C6TL 1AP2A 1PMYA 2F9BT 2NY4C 3AY4C 3H3PH 4PJEE 4PRAB 2OYPA 4GKSA 5D7LD 2P24A 3GSWB 3BJLA 5B39B 3PL6A 4OJEH 3C9NB 3LQAL 4IJTA 2CBOA 5DVMA 1FPTL 2JNZA 4YFDB 3QPKA 2I85A 1FZKB 4EI5A 3B2PA 1OAXL 4UT6H 1YEHL 3PREA 2AGJH 4N86A 4WI2A 4WQOA 2PTTA 2C34A 1FHNA 3UZQB 2BIMA 2J43A 2ZONA 2BFVL 4EI5C 1KG0A 5DS8A 2H4EA 1FO0B 3TU6A 1JN6B 2WLZA 1P7KA 3MV7A 1K2DB 4L2LA 5HVHC 3E9UA 2MJWA 2EVGA 4R5VA 4B0MM 2H9GA 3VGAC 4JY4B 1H0DB 1IGJB 3LS5L 1CFSA 4KVCH 4AJVA 4PY7B 3N42F 3LTVA 4BH7A 5KVGE 2DWEB 3QDHA 5FO8B 2CBTA 2VM9A 4XPGH 1S7QB 3US1A 5GRVL 4J39A 4TNGA 1VCAA 3GMRB 1GOHA 4MJIA 5B7MA 1FCGA 3V0VB 2J8HA 1EHLL 1ED3A 5D7IE 1NJ9B 3CFIC 1W6LA 3L6FA 3QA3B 4PJHB 3QUYA 3KPMA 2WVUA 1JRHH 1LQBC 1T5WA 5T1LB 4Y5VA 1JCKA 4L4TB 4V2BA 4ZZKA 5AW6B 5BS0A 3DV4B 4N0FA 4QTHB 1ZTXL 4GXVH 1OGTA 3I74A 3E7JA 1XSOA 3KEHA 4LSTL 2VQTA 1AY1L 1TETH 2J1YA 1F18A 2UYLB 3QUML 2E6PA 1BXAA 2E9JA 3MAWA 3ZDXF 4LSQL 1CR9L 2QHRH 1P9MC 4BYHA 2IALA 1G1OA 4RZCB 2X9WA 1BVLA 2VL5B 3QNYA 2GC4C 3EH2A 3UBXI 5A6IA 4R97C 2H26B 3LZQA 1ZT4B 1NMBH 2WJ5A 4KDVA 4NOFA 5A2CA 4G9DA 2V2XA 2CLZB 2X4TA 3NCJH 3TN0C 4R7NB 3HPJA 2NLJB 4HBQA 3SZ6A 3K1DA 1GKOA 1C7SA 2X38A 3UBHA 5C0BE 1W0VA 2YK1H 1LHZA 2NXYB 5DZ9A 3WS3B 2FAUA 5EN3A 1YY8B 2VDLB 3IJ7A 5IHZA 2APVA 1ZWIB 2HP4A 1DO5A 1MCPL 2ENQA 4G71B 5HYQA 2K7QA 4C59B 3EO0B 5SWSD 1A3LH 4EN3D 1TMCB 3D7PA 3UTOA 5BO0D 4OIBA 2ALAA 5C0CA 1NEZG 1JI2A 5IHUH 5C3TA 2Y07L 3GPSA 5C0FB 1TTGA 2V8MA 3CNKA 3D39E 4R5XA 1AS6A 4AVKA 4HWBL 2E8YA 5L8KB 1OTSC 3CFDA 5CZXD 3PS6A 4HMCA 5JORB 1E30A 1F3RB 2W38A 3FQXA 4I0PA 3ZQWA 2YN3A 3FFDA 2AXGB 5ISZD 2DEXX 3VXSD 4DGYL 3QUKA 1LNUA 4F9LA 4OLUH 5KG9A 3Q8BA 4C56A 3KCPA 4A66A 2Q2EB 2HFFA 1FFRA 1P4BL 4A6YB 2OYKA 4QAMB 5F1KC 2OI9C 3NOIA 5K1JA 1USZA 5J56B 1Z7JA 2D7NA 2AF2A 4EZJA 2Z31B 5TTRA 1W72B 3IN2A 5ALBL 4E9WA 2Y1AA 4PJ5E 1PZ3A 5AOIA 2G2RB 2IJ0C 2YBRB 3C5JA 4IGBA 4G11A 2NNFA 2ZIDA 3LMJL 4GG6F 1DN0B 4RNRB 4X5WB 1TJIL 1YPZF 3B56A