1AG6A

Plastocyanin from spinach
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VEVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure of spinach plastocyanin at 1.7 A resolution.
pubmed rcsb
source organism Spinacia oleracea
molecule tags Electron transport
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1997-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ag6A00
3S8GB 1IC0A 4L0PB 2IWEA 3GDCA 1MZYA 5I6NA 3SBQA 2XYBA 5AKRA 5E9NA 4M3HA 2FT6A 1TKWA 3FT0A 3SBPA 3TBBA 2N0MA 3UACA 2BWDA 4YSRA 2XX1A 3ABGA 2PP9A 2EILB 2J55A 2JFCA 2XXFA 1ET7A 2YAEA 1AANA 4YSEA 3EH4B 1XB8A 2AVFA 3AW5A 2P80D 5I5MA 1ID2A 4RH4A 5B1KA 3EF4A 4A2FA 4W9ZA 2AANA 2FNWA 2YXVA 4P5SA 4KO6A 3G5WA 1JXFA 3QJTB 3NYKA 1HAUA 1CURA 3AY2A 4YSTA 2B08A 4E9XA 3N2JA 4DP0X 3T6ZA 1R1CA 1YLBB 3FPXA 3NJKA 1OF0A 1ZDQA 4HCGA 2UX6A 4UF7C 3X1EA 3AZUA 3QQXA 3JTBA 4Q89A 3UAAA 1OCZB 4BDVA 4AX3A 4NB7A 1PNCA 3X2QB 4QLWA 3OMIB 3WG7B 3D12B 2RACA 4A67A 1AQ8A 1PLAA 6PAZA 5I6KA 3V9EA 1SNRA 4DP2X 2HX7A 5A7EA 2BW4A 4KO7A 1KCWA 5B1JC 1BQRA 1AACA 3BVDB 7PCYA 1CYXA 4YSCA 2BP8A 2Q9OA 2YXWA 4MFHA 3PXLA 1ETJA 1BQKA 2H3XC 5B1BB 1AZCA 5I6LA 1J9SA 1BXUA 1ZV2A 2IDSA 3FQ1A 4HAKA 5EHFA 3KW8A 1QNIA 1JOIA 3PAUA 2PP8A 4N4YB 2I7OA 2R7EA 5LDUA 3OQRA 1JZEA 1KBWA 3WKQA 3S3BB 3UGEA 4DP9X 1J9RA 2VN3A 5D4HA 1PLBA 2YAPA 5AFAA 2UXGA 2YAFA 1BYOA 1PZAA 4A2GA 1AIZA 4AZUA 2ZXWB 2UX7A 2HZHA 3NSFA 4A66A 1J5DA 1BXAA 4GP8B 1GS8A 1GS7A 1M9WA 1PAZA 3FSWA 1N68A 1NINA 2VSMB 3QJSB 2CBPA 2B3IA 4EF3A 4DPAX 1NTDA 4BWWA 4BDVB 2OV0A 2GHZA 1ET8A 1GS6X 1VLXA 3IEAA 1GSKA 2XU9A 1TEGA 4KNSA 1NIEA 4E9RA 2EIMB 1L9QA 3CVCA 3DKHA 2BHFA 5I5IA 2GBAA 1XB6A 1JZHA 4UANA 1V10A 1OE1A 1MG2C 1FFTB 3T9WA 2PPCA 1JZJA 1NICA 1W6WA 2FT8A 1GR7A 1WA1X 1ZDSA 3UADA 4PAZA 5ANHA 3GYRA 3NSYA 2HLEB 2WSDA 1PMYA 3EH3B 3WNIA 3QJRB 5B1AB 4A2DA 2NRDA 2BP8B 1PZBA 1NWPA 2DWSA 4GP5B 5I28A 4TXVB 2VM3A 2GB2A 2J56A 3DIVA 2GC4C 4JHUA 4AKQA 3HEIB 2XLLA 1AZRA 1RZQA 1L9TA 1E65A 3QPKA 4KO5A 2DY2A 1BYPA 4E9SA 3MBWB 1ASOA 2I85A 3X1FA 3EH5B 1OOWA 4DP4X 2QDWA 1IBZA 1ADWA 1JXDA 1BAWA 1RZPA 2ZWNA 4DP7X 1OE2A 2R7EB 4WTQA 2UXFA 4ENZA 2JXMA 2BZ7A 1ZPUA 2X87A 3PAZA 1E30A 1GY2A 3NSDA 2DWTA 4KO9A 1A8ZA 2GC7C 1SFDA 2EIKB 3AG1B 2H47C 3ZDWA 1WA2X 1NIBA 4YSPA 4FAAB 1AR1B 1ET5A 1KDJA 3H4FA 4CSPA 9PCYA 2E86A 3OM3B 1ASPA 5B7MA 3CVDA 1AZBA 2QDVA 2IH9A 2W8CA 3QJUB 3T6XA 2FQFA 5D4IA 1TEFA 1AZNA 4P5RA 3S8FB 2MRYA 1NIDA 1E5YA 1BEXA 3NP3A 3T6WA 2BZCA 4A2HA 3FU7A 3ZIYA 1V55B 4NERA 5D4JA 1XMEB 4N8UA 5F7AA 2GI0A 3S3DB 5I6OA 3T71A 3PCYA 2DV6A 2H5UA 4KOBA 2BO0A 4KNTA 2XX0A 3FQ2A 1WA0X 2PCYA 2BWIA 4DP1X 2VW4A 1GYCA 1AS6A 1EHKB 4G71B 1MG3C 5FC9A 3NP4A 3BQVA 4YSDA 1CC3A 3OMAB 1RCYA 1WAEA 1OV8A 2FT7A 3PAVA 4BXVA 4DP8X 3AG3B 4W1TA 2TSAA 1SHXA 4DPBX 1ZIAA 4HCIA 1ILUA 1IBYA 1QHQA 3ASOB 4YVUA 1SJMA 2XV2A 2DYSB 2FWLB 3C75A 4K9JA 4AKPA 4WKXA 4YSSA 1AOZA 1KBVA 1NPJA 1MDAA 3WIAA 2YAQA 3RYMA 1GW0A 5B7FA 4HCFA 2FQGA 4G7QB 1JZFA 4YL4A 5I6PA 2PCFA 3S3CB 1HFUA 5F7BA 1CYWA 2IAAC 5I6MA 2UXTA 5TK4A 1I53A 3ABMB 4ZK8A 5PAZA 3T6VA 3FQYA 1L9SA 4BWTA 1JVLA 2X88A 3NJMA 5IY5B 3NJLA 2W88A 3FU7B 1JVOA 4DPCX 2VW6A 3NJGA 5B3SB 2IH8A 4F2FA 2I7SA 1NIFA 1SFHA 2J57A 3IN2A 4AKOA 2IWKA 1N70A 1OCOB 2PPDA 3FU8A 2YAHA 1AS7A 2PPAA 4G70B 3UAEA 6PCYA 3EHBB 3NSCA 2XXGA 1F56A 2AZUA 1AG6A 4PCYA 1OCRB 2CALA 2PPEA 1FWXA 4KOCA 4E9WA 3OD3A 1SF3A 1V54B 3TBCA 2A3TA 3WKPA 2BP0A 1JXGA 1NWOA 3NJHA 3X1NA 1IKOP 1PLCA 1PCSA 2IDTA 2LLNA 3PLYA 1AAJA 1ILSA 1HAWA 1KV7A 2IDFA 1NDTA 4DP6X 2Y1AA 4HZ1A 1WS8A 2CJ3A 1KYAA 3CG8A 4E9VA 2EIJB 4YSOA 3PPSA 2IWFA 3V9CA 1QLEB 3MX0B 4YSUA 2QT6A 4JKNA 1JERA 3CDZA 4E9TA 4F2EA 2XUWA 2WO2B 3IBOA 1M56B 3OMNB 3N55A 3ABLB 3FSAA 2CCWA 2CAKA 4HALA 2HXAA 2BW5A 3X1GA 1FA4A 2JKWA 4AI7A 2AFNA 1URIA 4NAJA 1PF3A 4YSQA 1E67A 1CUOA 3IN0A 2VMJA 3CZUB 3NJNA 1SF5A 4BXSV 3H56A 2IDUA 4G7SB 4HHGA 1B3IA 2OJ1A 3NJFA 1KGYE 4BK5C 3JT2A 1X9RA 1KCBA 1A4CA 1OCCB 4HIPA 4E9YA 1AG0A 1W6LA 4X4KA 4JHVA 3CVBA 1WS7A 2YARA 1AS8A 3QJVB 4Q8BA 4GXFA 2Q5BA 1L9OA 5I5JA 1UATA 5AZUA 2BP0B 2HRHA 2WO3B 3X1BA 1RKRA 4BWUA 1BXVA 2AZAA 1W8EA 5TK2A 3GXUB 4G7RB 1A4AA 1PZCA 4QKTA 3TA4D 2TSBA 1JZGA 1XB3A 4FA7B 2VM4A 1TU2A 8PAZA 2FQEA 2YAMA 1SDDA 1NPNA 4A2EA 2FQDA 5I26A 3QJQB 1GY1A 7PAZA 3FYEB 3CDZB 1OE3A 2UXVA 2QPDB 3FPYA 3IE9A 1JZIA 3KW7A 2XVBA 2XWZA 3TU6A 3H4HA 1A65A 3L45A 4KNUA 2YAOA 4F7KA 3FU9A 3TASA 5PCYA 3UABA 2HRGA 3FSZA 3NJJA 1L9PA 1PY0A 1EZLA 1NZRA 2VSKB 4DP5X 2EINB 1KDIA 1AZUA 2YQBA 3ASNB 2PLTA 1DZ0A 2MTAA 1X9UA 3NT0A 2XV3A 3AG4B 2IDQA 1PNDA 1J9TA 2GIMA 1L9RA 1M57B 1SHWA 3NJIA 3U25A 3FSVA 3HB3B 2HX8A 2GSMB 1A4BA 3FYIB 5B7EA 4GP4B 5B1JA 4YVNA 1DYZA 3WNJA 2HX9A 3ERXA 2ZOOA 2OCCB 2ZONA 4CSZA 2VW7A 2QPEB 4YSAA 4GYBA 1E5ZA 1T5KA 4UAHA 4HHWA 2CUAA 2Y69B 2FJSA 1A3ZA 4E9QA 1J9QA 4A68A 3WI9A 2PP7A 1NIAA 3ZX1A 1IUZA 1BQ5A 2DYRB 1ZIBA 4GY4A 1SDDB 4G72B 4M4RB 1J5CA 2P80A 1MZZA 2PPFA 3DTUB 2XV0A 2FTAA 2J5WA 3ZBMA 1ASQA 3ABKB 3SBRA 3AG2B 3FS9A 3SQRA
chains in the Genus database with same CATH superfamily
5E8PA 3M46A 3O6LL 3PQYB 2MQGA 3OC8A 4JO4H 5ECJE 2LR4A 3SGKA 4O9HH 1I9EA 3QEUA 3QT2A 1RV6X 2NW2B 3FQNB 2P5WE 3K6FA 4XNMA 4YH6A 1KCVL 3I9PA 4Y1TA 3QNYA 2CGRL 1SBSL 5AVRB 5TF0A 3UACA 1FJ1A 2Y72A 3D34A 3N9GH 4OVUA 3ABGA 4PW3A 4U6VH 3EADA 3AY4A 1AANA 3BHBA 1DDHB 3QUYA 4Q2ZB 2PCPB 5J3HD 1KBPA 3UJTH 2FD6H 1TFHA 3E1ZA 4LHJB 4Y2DA 3EF4A 3H3KA 3EO1A 5EEZA 3LN5A 5EF3A 5C0CD 2YXVA 2X0VA 1SXSA 2IWGA 3DWTA 2X6AA 5CMAA 3CVIL 4AMWA 4P23D 4APQA 1FO0H 2IAMA 1EEYB 2Z31A 3KLLA 4NC1C 1RY7B 4ES8A 3RWEB 3BPLB 2G9HA 4R26L 2K45A 5IJKA 4Z5RA 5IROC 4NP4L 4Z0BL 4ODUB 3JTBA 4Z8FL 1UWFA 4QRRA 5JXEA 2JCCF 1FZJB 1XGUA 3GMLA 2WLKA 1RZIB 3D12B 3QZOA 4XVTL 1OGAA 2CHNA 5C0IA 4YGVB 4XHJD 3T2PA 2YPKB 4QF1A 3ECVA 5HI4C 5I6KA 3MUJA 1SNRA 1U3HC 2CMRH 3WHE0 4BQCA 4RFOL 4JFVA 3AXIA 4G11A 2B59A 3SDDA 2OL3H 3QUMH 3CQQA 4PJFA 4Z7UB 5B1JC 2JI2A 4WSJA 2AXGB 5E08H 4M1CD 1GGCL 2EVIA 2N56A 4OF6A 4ZUUA 2APVA 3ECWA 2O26U 4QD2E 2P24B 3SCMC 3B1UA 1MI5D 1R17A 2HPTA 5C07B 1J87A 3O6FB 4M1DL 4RZKA 2VN7A 1JIBA 1WFTA 1L9NA 1UOLA 3BEWA 2HUHA 1GJUA 3OKLA 3ESVF 3PAUA 4I77H 1DVFD 2NXZD 4IDJH 1L9MA 4O2EB 1YY8A 3MREB 1OB1B 5FO2A 4POYA 5A2JH 2I7OA 1IGIH 2H1LM 2OZ4H 1PYWA 3D05A 4YHPB 3HLAA 1G9NC 4X6CE 3FNKA 2KUTA 4RBPK 5IQOA 2F08A 1FL6A 2VKXA 4FQPA 5AKSA 3GUTB 2UYLB 3EUDA 1BYOA 1JHTA 1KYDA 1QTPA 5F9AC 5HVGB 3T1FB 1WGVA 1N2RB 5ERWA 5D6DA 2NCMA 1CFQA 3QEGL 1AFVL 4I13B 1E9QB 5EUKA 1NMAL 4O02A 3D1MC 5FA3B 4QHNA 3B2PA 3FHEA 5D1XB 1OAJA 4PRPA 4XP5H 1YN6A 2XVLA 3VJ6B 5F96L 4DF9A 1LP9F 4YLBA 1GS6X 4LAQL 2BJMH 4EZJA 4EIGB 3SSGA 1UD2A 2A6JA 1DTUA 4ODWA 4NBYB 2CUMA 1MCQA 3VD9A 4GPVA 4WCYH 1JFQH 2QR0B 2DQUL 5DJAB 1AR2A 2Q7NA 1W6WA 1DQJB 4CADB 3WTWA 1GOFA 1OOAA 1KZYA 3D52A 1X6LA 3QUXC 4FQCL 4K5PA 1CGWA 5DURD 2AMGA 3IJYA 1T3FA 2X6UA 4AYFA 1BFTA 3MJ9H 5D7IF 4R5TA 4D8PA 3I6LE 1JMXA 1L9TA 1EA9C 3FFCD 2R15A 3GSNL 1T2JA 3UAJA 1NSNH 4EI0A 1OOWA 2DJMA 1HJCA 3P9LB 2ZPKL 4MAYC 2QVIA 4KRPC 3V0WL 2OCJA 3TESA 3IRCA 4L0ZA 3ESNA 1HH9A 3GS4A 2VR8A 3GRWA 1ZPUA 5T3ZH 3AFLA 3BGFC 1AOHA 2V3FA 4PJ5D 3KEHA 1RK1B 2GBTA 5CP3A 3EUUA 5BZDB 3LKRA 2H6PB 3TJHD 4CBZA 1QI5A 3HPJA 2P5EA 4IK6A 4EAEA 1YEKL 1EV2E 2F9BT 3BE1L 2ED6A 1ET5A 3BW9A 3H4FA 2ROXA 2C4FU 5IVNA 3S4SG 9PCYA 2XWTB 5DMGD 35C8L 1BECA 2VRQA 4FQLL 3W82A 4HA1A 2QJDA 5EOCJ 4LCYB 1KOAA 3O3AA 3OKKB 5G5DA 3VFNA 3VXMD 5AG8A 5DRWA 2J8UF 1XGPA 2BXZA 1LM8V 4I18A 3BRGC 3ZW3A 1EZSA 2PETA 3ZIYA 5GSRB 4PJXA 5D4JA 3S3DB 2QTEA 1BZOA 1T0OA 1S4IA 5DEFA 4WJKB 3NJVA 3MRJB 2VM9A 3PCYA 5F6IB 2FGWH 3WU1A 1Q0EA 5ANME 3UTZB 2WLYA 2ZE0A 1MVYA 3CPLB 3QHFH 1MAKA 2OJEB 1ZOXA 1BQLL 3BAJA 3LKOA 4PW4A 1MFBL 3VFOB 3PGDA 5FC9A 1IBGH 2EE6A 2ZKHL 1A7QH 3MUGA 3QDMD 3MNMA 4G7YL 4N6RB 4BINA 5IOPA 3PXHA 2AXFB 2F18A 1JTOA 5DJ6B 3TH2T 2FT7A 1CD8A 4FXKC 3LX9A 3IDXL 3K1KC 3LVEA 3QHTC 3IJ9A 1Z9OA 4HWUA 4FFYL 3K8LA 1A64A 3JWNH 4K7FA 4KPHL 4NSKA 1ILUA 12E8L 4RRPA 3KXFE 1XGRA 3OHXC 4UNVA 4BHUA 3QWQB 3E1F1 5DS8B 2DICA 3FU0A 1AY1H 3MLRL 3I3EA 1ZLWH 1TQCC 1A7NL 4F9LC 4MD5B 2YAQA 3OPUA 4MD4B 4AEIH 4BK5A 1ZA6A 3EOAB 4K5NA 5DWUH 1E8ZA 2ZWSA 1JV5A 5EOCH 2A9CA 2CIIB 2IQ9H 5BRPA 3QXTA 4AG4H 2JJSA 5TK4A 3GIVA 3GF8A 1F0LA 5HY9B 4IBLT 3BPOC 4FFWD 5K33A 1ZA3A 3NJMA 4JKWA 3OXRA 4Z7AA 2PYEE 3L3DA 1YG9A 2W9DH 2A83B 3H9SE 2IBZY 3NJGA 4ZXBC 2WP3O 4PG9A 1UXWA 1YA5A 4FZEL 1E6JH 3UTSE 3WNMA 1K5WA 1G7JB 1AQMA 4WKZB 1FVDA 1NM4A 1VIWA 5JA8B 5JOEA 2AXHA 2JNZA 3V55A 3ARFB 1JCVA 1BOYA 4Z7WF 2CO3A 1JHKL 2PPAA 5A2LH 3S36X 4KITB 2VDNB 4K71B 3QXWA 2CALA 2PPEA 3WIHL 1FRGH 4PJIE 5D1ZD 1UA7A 4Y7MA 4H8PA 4WI3A 5FK9A 1RK7A 3G9VA 1T6WA 3NJHA 1ML0A 2ICEB 2CO4A 4X5LA 1OSPL 1JXJA 2Y5EA 3UPAA 3UP6A 4EOWL 4OSUH 3RPKA 2P5WB 4YHMH 2FWUA 2UWEB 1AIFA 1T5WB 2XICA 2QQLL 4PRNA 4JY4B 1F4XL 3IXTB 4N1CA 1AHMA 1IRAY 2CLZA 4YSOA 3FRUA 4JM2D 3VXSA 3UTTD 3TCTA 1QTSA 1DEEA 2BC4B 1KTDA 5DRZA 1AQHA 2DEXX 1CF1A 2XG5A 2QGDA 3IBOA 5DQDL 1U2CA 1LE5A 2R51A 3CIAA 2CK2A 3ZSTA 3ULUE 1X9LA 2AQRA 3VGDA 4QYOB 2YO3A 2IH3A 3L5XH 3QR2A 3D18A 5CWSA 3O6KH 3P40A 1QI3A 5K9QG 1AHWC 4A7GF 1X5KA 4U0RC 4IRSC 4XXWC 2YBRB 4TVPL 4TLUA 2P48B 3VI4E 3W56A 4RMUA 1ZK5A 1U8CB 1L6ZA 1NAMA 2ZWKA 3QDGD 3R0NA 4HPOL 4PS4L 4F7TA 1S5IH 3QFJD 2OTPA 2QVTA 3ULSA 2IANE 1T1ZB 5EZPA 3RVXD 3II2A 4DEPC 4X9BA 1E42A 5DZJA 1J10A 5SWQA 3GSOB 5KYWB 1KCBA 1A4CA 2GTZB 5L2KA 4GEIA 1T0PB 3TF4A 1WEJL 1Z9SA 3TFKC 3VXUA 4U1NA 4PP1D 3RPIB 1P5VB 3D4CA 4D9RE 5K69A 2MQ0A 1E9OA 2Y6SD 3IJSB 4UV7L 4Y2LA 4ELMB 5AKVA 1BZ9A 5H2BB 3VD5A 1YNTF 4QKTA 1KGUA 3U1SL 4G80A 4M62H 4R4NC 1Z6JT 4U6YB 3U36A 2CK0H 2ZYHA 2IV9A 3DUUB 1RU9H 2ADFH 5DGRA 1E28B 3V52L 1F6LL 2KLRA 2XETA 3GHEL 1BVNT 2XOTA 1ZT4A 2D4DA 1EFXB 1WSST 4P2RA 1PZ5B 2RGSA 4XRCA 4WUUD 5ESVB 5IB1B 3OB0H 4HS3A 3BDYL 1WC7B 4ZG1A 3EG9B 4GKLA 1RURH 2HJLB 3A3YB 1PDKA 4X6CB 3X11B 4EI6A 4PJ8C 1EZLA 5B38A 1EVTC 1KB5H 4JJ5A 1O6TA 3E3QC 4Q0XL 5C7ZA 4ZNEA 3TEYA 4OFDA 1OTTC 3KDMA 3O2DA 1BF8A 5IROA 1K4CB 3MODH 2JJWA 3VRLF 4W9CC 4DNLA 3QW9A 1WFUA 2UUDK 3CTTA 4B9JA 2MHAB 1AO7A 3LAFA 3FQWA 4F15B 1EDQA 3U25A 2YQGA 3ZE1E 3UYPA 3A0OA 4KHXH 4DT2A 1CFMA 5SWSE 1LEIA 1I9IH 2GSMB 4OGQC 5CF3A 1U3HA 2GTQA 2K6YA 4HXBL 5B7EA 3MJ8B 4LMQE 4QRUB 4ES9A 1T1WB 3KPMA 3CK0H 1E90A 1PX4A 1C1EH 4U1JB 3QZNA 4KZ0A 4OJFL 2OMTA 5B1JA 2ZNWA 5AW8B 4E41A 2HX9A 3ERXA 4WEMB 5HDWA 4NQDE 3SCMA 1ACYH 1ZHNB 3EDEA 3DETC 1D5BA 2QSCL 3FTXA 3RZWA 4MCYB 1NCAL 4R7LA 4QTIH 5J57B 2C34A 1CU4L 4EXKA 1KG0A 5FB8B 5HYFA 4K8RL 5DRXB 2O6EA 2Y07H 3BOVA 4NFBA 4P05A 4UM9B 1FL5A 1JBJA 1DVUA 3TIDB 3EF7A 2XWRA 3TPUA 1MZZA 4DERA 1MW3A 4U4BA 3OKDA 3L5JA 4HIHA 2E7LC 4O00A 4NRZB 1KSRA 4N2EA 4OLZH 4UMSA 3BT2L 2H1PH 3TVMC 2QTVA 1A6ZA 5DO8A 3G6JF 4JY5L 3QCUH 3C9NA 4NPJA 2WQAA 3PUUA 4TTDC 4QAMB 3O2WL 3EXJA 1SXBA 5ABZA 2WTRA 1BQUA 2VXQL 1I7TA 3U4KA 2DQIL 4FQQB 5DHVA 1KCUL 4LSVL 3W9DB 1D7CA 3LNDA 4LNRB 4NNXB 3AW5A 3O9WB 4NN6B 4IKIA 4JO1L 5D7EA 3RJQB 4A2FA 4YBLC 5C0DA 3U7WH 1OQOA 4X99A 3QEQE 4Z7OE 1OW0C 4JKPL 4NUPA 1QAWA 4PJGE 2KKQA 4NFDA 4MS8D 2E9JA 3D2TA 3QUXA 1OF0A 3QHZH 5FGBC 4JQVA 4LP8A 3N43B 4UTBL 3NZUA 4M5YL 5FYKD 4PTUA 1QFUH 5ANMB 2WZPA 4UT9H 1ZGLP 2K4AA 2HTLD 1BIHA 1MRDL 2GUOB 3IDMA 5G55A 2CRMA 3ZJAA 4ZMZA 3GJFK 5CJQL 3LNEA 3EFOA 1QO3A 4QNPE 2GHWB 4MAYA 2ZXAA 3LKSA 2FB4H 3M45A 2MWCA 3H42H 3TT3H 1OTUD 2NLJA 1HHHB 4WU7A 3DDGA 5IEHA 5EBLA 2NUTA 3A21A 1I8MB 2VDOL 1TTRA 4L4TA 1PJ9A 4AQEB 4LHUA 1LO4L 3MLSL 4JFDA 2WY3B 1QPXA 1XV8A 3KXFB 5D2NC 5F21B 2JLLA 3FB6B 2FO4A 4HFUH 2BSED 3NACL 4PB0L 3AB0C 4YDKL 5AOZA 2AS5M 5DEGA 5AW6B 1OT4A 5DSCB 1W0WA 4M7LL 4L48A 3AS3A 1CVSC 1XIWD 4UDTB 5E4EC 3V6FA 1HIMH 5C09E 4KQ3L 1IIKA 1JTPA 4AITA 2IH1A 1T20A 3I3DA 2X3BA 1R0AL 4L8CB 4W6YB 1DQKA 1RJCA 4HEPA 2N59A 3LKNA 4D0CB 1OK8A 4FLRA 2UZXA 2R7EA 2AITA 3EBIA 5C0JA 5LXGH 4P2AA 4HJGB 3SE3C 4FG0A 4HQQL 3TX4A 2JKSA 2XACC 4HETA 4Q52A 2FX8L 2AQ1A 5C97A 2X41A 3NIFF 1FNEA 3POCA 1S9YB 3T04D 2KDYA 4N68A 5DJ8A 4QKXB 3ZRCC 2FJUB 3QXDA 4UQ3B 2BS9A 3AS1A 1O7DC 2ZUVA 4TSCL 5FWRA 4YPGB 3V4LA 3MAWA 3HA0A 5FO7B 1DJWA 3MV11 4PP2B 4WLCA 4KXZH 3STZA 5JQ6H 3NA9L 3TO4B 4YMPA 3QNFA 4FXKA 3CVCA 2FLMA 2O5ZH 3FHAA 4GRWE 2Y7LA 5GJSL 5DD3H 5GSVB 1G9ML 5JR1L 3ARWA 4N25A 3I75B 2A74C 1CZ8H 3Q1SL 3L4VA 1FNFA 1M42A 4DGVL 3KHOA 1EGJH 1ULVA 3OHXA 3NUKA 4ZQKA 5IB4B 2WSDA 3UZVA 2ORBH 4OIIH 4GG6E 4YIQB 4F9LA 4ILDA 1A6VL 4ZZFA 2CBOA 3FXIC 5T3ZE 5EU5A 1N26A 1AD9A 5GGRB 4XNZC 3O3UN 5FV2A 4PG2C 1XR8A 4PCSA 3UTOA 2EH8L 1ZS2A 3BP7B 3M8OH 5JXAL 3DURB 1T6VN 1YEDA 4KKLC 1ACXA 3CMGA 2V17H 1FZKB 3DX6A 2NDGA 4YWGL 2KZKA 1Y1UA 1LO3L 1SRDA 1OE2A 3QYMA 1TQBB 4NN5C 5FW8A 2RQEA 2VDQB 3RWJB 4ZXBA 5LGJB 3T0EE 1GC1C 1RLBA 2H0JA 2ID5A 2OMVB 3K80A 3QJXA 2VH5L 4A04A 3RUGA 5JYLA 2H47C 3APDA 3LRMA 3VI4B 2ZD0A 2Q86B 4X9YA 4C8XA 2V5MA 4NKDB 1S9WA 2I27N 5I5RA 2ATPA 1GKEA 2IANB 1MN4A 4ZMTA 1IMHC 5C0BE 2IH9A 3VB8A 4XVUD 1E5UI 3VU1A 1Q9OB 5BQDA 3LKPB 4JFYA 2AABH 3UYRH 3KVDD 3MRBA 5CBEA 5IM7B 1JL8A 2JIXD 4TTGA 2A9AA 4GFXA 3ZDZE 2X3CA 2QKIB 2KI6A 2VQ4A 1A4JB 4V1DA 4BKTC 2NXYB 1XBDA 1N5AA 5FFGA 5F88A 2XPZA 1Z0NA 2Q2EB 4A6YL 5HYQA 3GJEB 4AZ8A 1OIOA 2JCCA 2YMXL 2NYZA 3UBXG 1N19A 3CCHA 4GUQA 4BQ9A 2W9LA 4N8CL 3JWNE 4ORGB 1BQHA 4E42A 2XXMB 3HBGA 2PKDA 1H3VA 4G43B 1KLUB 1BBDL 2XWBA 3JTTA 4MB5A 4XX1E 1VB9A 1MG3C 3L9BA 4M56A 5LBGA 2IGTA 1W0VB 2QZ5A 3ARBB 5KBPA 3GZPA 5HHMD 2OMBA 5D5MB 2W65B 1EXUB 2YZ8A 4GXUN 3VFMB 4F37F 3PAVA 2EP6A 3OZ9H 5I17B 1DE4B 1AHWA 1V3JA 2DYPD 5KSBF 4IRSA 4HCIA 3N41F 4XXWA 5AW1B 1RIUH 5K5YA 1M7XA 4GO9A 4QXUH 2J43A 4E5XB 2CIKA 3ALXA 1NBVH 3PHQA 1K2DB 2DYSB 3C75A 3EYSL 4NKIL 4OTXH 3RX5A 4WKXA 4PBWD 4UDUB 1I9JL 3HG5A 2EICA 3WIAA 4ABQA 1H9DA 4RMQA 4JZOA 3ZE1B 3KPNB 3LHAA 5SWSB 4D0DB 4NWTH 4EUPG 3P4OB 4MXVF 3BT0A 4AL8H 3T0DA 3LJ3A 3T6VA 1ORQB 3L81A 2ALAA 1U93B 2EIZB 2X88A 3LS5H 4Y1AD 5CGYC 3T65A 4ZFOL 5JDSB 1JVOA 1XF4A 4BUHA 2VC2B 2E0PA 4FE9A 3DMMC 4NQDB 5I19H 1TZGL 1LP9A 4YN3A 3O3EB 4B9ZA 1XEUA 1SOKA 4NO2B 1IARB 1MUJB 3U82B 3K5RA 4YXLH 2ZG3A 5T1KD 1A2YB 2D03L 3BAEL 4LQFL 3EHBB 3F6JA 3VH8G 5JTWA 5KN5A 4GRLD 4CKQA 5ID1A 1KN4L 3S35H 1OCRB 3S37X 2LHAA 4AK1A 5BO1H 2G3MA 5TDOB 1QFWH 5FM8A 4G59C 2VDMH 1Q0YL 3QS3A 3WNLA 4HS8L 4KOCA 4PJ8A 3D8MA 4QXGL 2P8LA 4UV4H 2A77H 4HIXH 4IRJB 3H3BC 1DBKH 1NFIA 5CZVH 1EMTH 3X1NA 3WTUA 1IKOP 5D1QD 2EACA 2AK4A 4KKAD 1C5DB 4XCCH 5D7IA 1EJ6A 2IDFA 5F71A 4RDQF 1XAUA 2XVGA 4WWID 2CJSA 4OCXH 4OGYL 2ZT9C 1WF5A 2VLJE 4X6BA 4Y19A 1HK6A 4NQCE 3OJDB 4D9QD 1FO0B 1HXKA 1W15A 1P5UC 2G4EA 2QGEA 4X50A 3TNMA 4HF5H 1DBBL 1RVFL 2BSTA 3EBHA 4YDIH 4DK5A 5IR1B 1GZQB 5LKNA 1X5GA 4LRIC 5MEQA 2CRYA 5CBAA 1OVZA 1Q9LB 3P4NA 3SYAA 3EFDH 4Z7OB 3QEQB 3QJFA 5LBVA 5DJ0B 3FCGA 5KVEH 1FFPA 1E6OL 5AAMC 3EYUL 3WIIH 4PJGB 1JRHH 1BF5A 5HYJE 1S7WB 2A9NL 3SE8H 4JPIA 3RZCC 4M00A 2FEDC 4XAKD 5E9DD 3C8KA 3ESOA 4RX4A 4F8LA 4YSQA 2ESVE 3P02A 5T1DH 2OL3B 4AYID 5HPMA 1E67A 2EDBA 5ISZE 4FNRA 4LCIH 3I9GL 2YEVB 3CSGA 2R29H 1BD2E 3KYOB 1LMKA 3QUZC 1DCLA 3TBSA 4LKXA 4RMSA 4I2XB 1FFNA 2E7LA 2EEAA 1IC4H 1AGEB 3HHRB 3H9HA 4PTTA 1LQBC 4R3SB 3EGDB 4LEEA 3FN0L 3G5XA 4FOMA 5FHAH 1QRNB 3R06B 1DSFH 3ROLA 3TVMA 2Z4QA 4RNRB 2YD8A 1G7PA 2WYIA 1WUZA 4HV8B 4UI2A 1S9VA 3CDFA 3RVVC 1OSZA 4IHBA 4IKJA 5EBGA 4BH8A 2W0FA 4OLUL 2YWYA 3VCLB 4GBXC 3AC0A 1CFSA 1TDQA 3GXUB 3W81A 1PZSA 4P46B 3SKJH 3F05A 1XB3A 3HNSH 3S36L 1H15B 4KV5E 3T77B 2QPSA 4JFXA 4N2FA 2OX5A 5DD0H 2BNQA 1EO8L 3L17A 5C09B 5A7BA 1F3DJ 5EO0B 5KBMA 5I8OL 3P2TA 1SJXA 2Z31D 1F90H 3LZFL 1KPVB 2CLVB 2QPDB 2VIRB 1ACZA 3RWDB 1OW0A 4TUOB 3GSWA 1YMHA 3MI6A 3HC4H 1BFVH 1IZJA 1VRSA 3DIFA 3E6HA 3M1BB 5MENE 4DAGL 1HKFA 1P2CB 5FGBA 3UO8B 3RNQB 4KDTC 3U4EB 1CLZH 3DUSA 1HXMA 1F8TH 1ZWIA 4DP5X 1KBGL 4O02L 3U9PL 2VXUL 1T66D 1T1XB 3WEXB 3OGCB 2F54A 3NT0A 4J6RH 2DZEA 4MMXA 4XX5A 3VFVA 4L3EE 1F42A 3GXTA 3ZHKA 2IC2A 1PNDA 1RUML 1GVIA 1M57B 1K72A 2X4PB 3KR3L 4MD0B 5MP6H 1NCJA 4GSDL 4WUKL 3NN8B 1HHKA 2UY6A 3FUJA 3G6DL 3O4LD 5I1JL 3L3JA 5KWYC 4JZJB 4HUCA 3QVAA 4OU3A 5GZOC 1RHHA 3OLDA 1KENL 5A2IH 5D2NA 1NC4B 3IFLL 1PQZA 1U92A 1R75A 4UIKL 2FJHB 3C5JB 1VEOA 4JUTA 5TTRA 5IQ9B 3KWWA 4Z7WA 1NCUA 4MA3A 1MPAL 3VXRD 2DLIA 2LU5A 4A68A 4GG6B 3SDXB 3RA7L 1KNOA 4UZSA 1LVEA 4MASA 4ERSL 1J8KA 1O5DT 1F3DH 3QIWC 3L8QA 4IGBB 3BDXA 1MNUH 3VRJB 2YRLA 2P4AB 2RAMA 1PPIA 1MHEA 3SE3A 3JWOL 3P3SA 3GRWL 5EZJA 3FAXA 5HDQL 3BN9D 3B3IB 3V0VB 1UEYA 3NZSA 2HAZA 3D9AH 4YO0B 2GJZA 1VACA 4JFED 4PRPD 4RFNC 1V8HA 4X0NA 3QORB 2HLFC 1A4KB 5GRYA 4R26H 4NP4H 4Z0BH 1I3RB 2VUKA 4NOBA 2HG5A 1BLNB 4U6XB 2PP9A 3MROA 3P77A 3P4MB 4PY7A 3ES6B 3MLZL 5BXFA 3B9KC 4JDVB 4XVTH 4IEFB 4X4XB 2JV6A 1IGJA 2J12B 4IU3B 1CDBA 2BOCB 5C0BB 2H26B 2ATKB 2Q2LA 5F89A 1UOKA 1Y18A 4XNUH 1MQKL 3PS6A 2A74A 5KSUB 3PFQA 3ZKMD 3NFPA 1F86A 4Z3FA 2D7NA 2AXWA 1CGSH 1HAUA 2EXYC 4KQ4L 3ZDZB 5FUOH 1GGCH 4JLRB 4HGWA 4L1TA 1L3NA 1HHJA 4AJWA 3LD8C 5I15L 2ED7A 1TTCA 5TFSL 4M1DH 3AZUA 4AMKL 3GTTA 5MEOA 3ZZQA 2V2TB 3IFNH 5AUMB 4PG2A 4ODXA 5C08E 1DDTA 4G6AC 4NB7A 5C0GB 5FOBB 1S3KL 5EOTA 2RACA 3BVVA 3FRPA 3HLKA 1RUQH 4HX1B 4JN1L 5IV2A 5ESAB 1PLAA 4PRBA 3V9EA 4PRDB 2P5ED 4XC3L 1AGBB 2N7SA 2HT3D 2DLGA 1HJBC 5C0RL 1BM3H 4NFCA 1NOAA 3UEZA 1MSPA 1VEPA 5L6YH 2CNZA 3BZ4B 4HJTA 1KXTB 4G8EA 3QIBB 4JO2L 4Z7VE 2ZSVB 3MRLA 3QH3A 2JE8A 5IBLD 1JF5A 1ETJA 4DCQB 4XNXL 4F7CB 4OQTH 4BCZA 3ZQWA 3JYCA 3QBTB 3CZJA 1QEWA 3HFFA 4UBDC 4HC1L 4RESB 5B39B 5DK2A 4C56B 5DMYA 5D7HA 3IGFA 4GI9A 1I8KB 3D0VA 2VQTA 2PP8A 7FABH 1WH0A 2BFGA 2CU9A 4J2XA 2NR6D 4HUUB 5J12B 4ADIA 2JMRA 2XTJD 3PABB 5JA9A 1RZFL 4ODTH 4X6EB 1UEMA 4V2CB 5D72L 5K93A 1E4WL 5E99L 4RA0C 4WI0A 4FQCH 1ZLUH 4GAFB 2D31B 4ZFZB 3MUUA 2B9AA 5KVGH 2EDWA 5BV7H 3BUDA 2O5YL 2MQ3A 2MOQA 4H88L 3H9ZA 3CSYA 1GH7A 1SGKA 3K6DA 3D2UA 1WAPA 3PV6B 1CLYH 5DUPL 5I0YA 5I1HL 2NY1C 1QFWM 2FBJH 2EIMB 4E9RA 3B1TA 3RY4A 3DYPA 1RLWA 4BGLA 1XB6A 3VG9C 1MEXL 3D85B 4LBAA 1UB6A 3EGSA 1BMGA 1GR7A 1J1OL 2FX9L 2X9XA 1FLRL 1E8YA 2ZAIA 5BOZG 4P57A 1C12A 5SX4I 3FN3A 3WNPA 1A8JH 1YEKH 3BE1H 4JHAH 3QPXH 1L0YA 4DKFL 2BXYA 3P73A 4KHTL 5A2AA 1AMYA 5EZOH 3VFUB 5I1IL 1ZSDB 8FABB 4FD0A 4MGXA 3QPQD 2AVGA 2KC0A 3K8KA 4MHHI 2VR3A 1A6TB 1I75A 2YMOA 3I6GB 4GIPD 3RB5A 1WV7T 1MCOH 3GKWH 1ZHLB 3MBWB 4D9LH 2IBGA 3WTVA 2D2CC 4X0KA 1AE6H 4PV9B 2ZWNA 1SEBA 4LESA 1HOCA 3O81A 4U3SB 3D25A 2Z1PA 5FGCE 2WBJD 2X87A 5AL8A 1GY2A 3TF7C 1NAML 3DMMA 5ITFA 3RTQC 3UG5A 3VFRB 1WA2X 2XFGB 1VCBC 3QR1A 2NTFB 4QY8B 4BZ2H 4FAAB 2ESVB 4UM8B 5CEZL 1MFBH 5ISZB 2IOIA 5EU6B 2G4GA 2F1EA 1U8OB 3JV6A 3RWIA 2ZKHH 2XYCA 3GBNL 4MA7L 3QFDA 2W8CA 4ALAL 1XR9B 1BBJB 1F58H 1XVSA 4ZS7L 2VN4A 4DTGH 4YL9A 2ZUTA 2V7NB 3KGTA 2EKSB 4LQ1A 3CFJA 4KXCA 4ZO7A 5C7XL 5HVHC 4XTRC 3VXSD 1V55B 2JLPA 4FLSA 12E8H 3QWRA 1WG3A 2ZJSL 4EN2A 5A3ID 3FCUB 3SJVE 3Q5YA 3TYGL 1GGUA 2FRGP 4M6NL 1UKSA 3I50L 4XCEA 3MLRH 5G4OA 4X7TB 1DJGA 3BQUC 5GS0D 2J71A 2CA3A 1A7NH 3FQ2A 5CHNB 4BYHA 3U79A 2BWIA 2YD0A 5L4IA 4YDNA 1KB5B 3L3GA 2FSEB 2N1KA 3JZYA 4PREA 3GRBA 3HE7D 3MRDB 1SJVA 4QLRA 4NWUL 3CQPA 4F7EA 4LRIA 2L8AA 5EU4A 2CHXA 4KVNH 3RGBA 1F00I 5HYEA 5FYKU 3GRGA 4LEOB 2UY7B 4ZFFB 5HGDA 3NPSC 5DJXB 3O41A 4LLUA 2X2UA 3GXNA 5D2LF 4DN4L 1IEAB 4RIRA 5MENB 4OZFA 4KKZA 2OXHA 3RZCA 2UZIL 3F8UB 4UNUA 2ODIA 3FT9A 1QA9B 2DWEB 2W91A 3GPEA 4O5LH 3NDYE 5E8NA 1MCPL 4J3OD 4G5AA 3T8XB 3LIZA 2F6AA 4X6DF 2XN9D 4HWEL 3QUZA 4F57L 4CW1A 4L3EB 4JM4L 3A4DA 4FERA 3AM8C 4EXPX 3PU7A 2F7PA 2CHWA 2AEPL 2WLLB 1UKQA 1CR9L 1YMME 3WIHH 3O4OB 4XVSL 4PGDA 3GXMA 3R7RA 2XRAH 2QVFB 5I6MA 2UXTA 1NFDB 2EADA 1M2VA 3F7YB 3LIUA 4MWFB 3X3FH 1MHHA 4OCMC 3HAEA 4NT6B 3CFCL 4PGZA 5EUOA 1JPTL 2W88A 1AYOA 1NJ9B 4GBXA 4ZRGA 2XTLA 1FL3B 1PFCA 1RUAH 4MSWA 4ZI8A 1Z66A 2XWJA 3QQDA 2QQLH 5CILH 5FM4A 1F4XH 3S2CA 1FBIL 1MCNA 5EC2A 4WWPA 2DMCA 1CICC 1KJVB 2J57A 3NCCB 4P2RD 4OM1L 4TUJB 2WINA 3CGTA 4FP8H 5CEXA 4RMTA 1UWGH 3MQIA 1ZCRA 1M6OB 3MNZA 5TE7L 4RBPH 1HYSD 1G9NL 1SYSA 6PCYA 2A73B 5IJCC 2FR4A 4NZ8A 2FBRA 2MKLC 5HHVL 2CLRB 4KK6C 3IK2A 4FG2A 4O51B 1MCDA 4YR6A 3B9VA 4HOMA 5DZAA 2KQNA 4HXAL 4PWEA 2WNGA 3TA3C 3GMNA 4KDTA 2ENPA 4L4VB 1A5FH 1M53A 3QC6X 4NQSA 2NZIA 5GGTA 1M71B 4ABVA 3RQ3A 3BESR 4TVPH 1PLCA 2YPVL 3RBGA 5HI4D 3HE6B 4PS4H 4XCYB 1T22A 1E9PB 1U3HD 1FFOA 1TTGA 1UCBH 3S7GA 3TN0B 4F2ME 3C6SA 1G7QB 4Z0XB 5KVEE 4D3CL 2HVJA 1A0QH 1XGTA 2X5PA 4N6QA 3VTMA 4E41D 3B7SA 4PJ9C 4PJEE 4ZMOA 1HCVA 1H3XA 2BINA 4UZGA 1SLVA 5T5FA 1JERA 4L23A 4E9TA 3VI3E 5C0NC 5AB0A 4DQAA 2X4TA 2AQNA 3O45B 3SCMD 4G9FA 4PJCE 1WT5C 5EDXA 4Y9GA 5HXMA 2WXNA 2QQNH 5GZOA 3F01A 3IT8D 5CSBA 1UD4A 4EDXB 3PWUA 4OFIA 2K9FB 2IPUG 3BH8B 4GS7C 4UV7H 5EWIL 4RGOL 4HKZB 4JE0A 4F8OA 5JW4N 5IW1B 1HVXA 4B97A 5C86A 2B1HL 3M6DA 4Y4HD 3ZTCC 4L3CB 3R1GH 3AAZA 3BVUA 4K5LA 2CGYA 3EYVB 3H56A 3QIWA 3PDOA 3AREB 2PYEA 3GHEH 2B1AL 1JWUB 3C08L 5EA0L 3H9SA 3NMEA 1EXGA 4M4PA 4OCLC 5EFIA 5EORL 1VESA 1X9RA 3GB7A 5KANG 1OCCB 2YC1A 4FX5A 4ZTOH 5JHLH 3BDYH 3U0TA 2A9ML 3SDAC 4UOZA 1WS7A 5KTEL 3TT1H 5LNEA 3UTSA 2BP3A 2EDFA 2Q5BA 4LF3B 3PUCA 4Q0XH 3FUHA 4QRTA 2WO3B 4PIRF 3S34L 4L8DB 5D7LA 5KYUA 5JOPD 2Q8AH 4S1DC 4FJYA 4Z7VB 5C0CE 2K9UA 4W70A 3TA4D 2BSSB 2R1WB 3K8MA 4PJIA 3B9KA 5EB9A 3MRCB 3S37L 1BJMA 4ZW8A 1FSKC 1RZJC 4HXBH 4NDMA 2ZOKB 1TOXA 3GS7A 5AYTA 1N5YH 2EYSB 1D5ZB 2DH2A 3MXWH 2I9TB 4WEBL 5KSBA 4JRLA 1KWGA 4OJFH 1UCTA 3EOYG 4F7KA 1JDAA 4XB8A 5AZ2L 2FYVA 3MBEC 3BCFA 4PJDB 1PX8A 2VSKB 4DH2A 1UZ8B 2JB5L 2CKBA 2Z64C 2XY2A 3B7TA 3CLFL 3DJZA 5AVSB 1NCAH 2YQBA 3S8WA 5DFTA 4QXTB 4KRPD 1DZ0A 2Y2YA 3QUKB 4YZWA 1CU4H 1TVHB 4K8RH 1Q9KA 1QZ1A 1IAKB 1A1NA 3KPPB 5FYKH 5FHBH 1J9TA 3IJEB 4J3WA 4YZFE 1EAPB 1V3MA 3ATFA 4LHUD 2ZXGA 5EG6C 1HDMB 3WXVH 1MI5E 3P3YA 4K5MA 1EO7A 1S9XA 4QXVA 5BJTB 1BZEA 1DYZA 3WNJA 4U4IA 3VFSB 4JY5H 1QMUA 2E7BA 1RZKH 4EUPH 2X1XR 3L4XA 2EIEA 1ND0A 4A2LA 1B0GB 3L08A 1GW6A 4J3OG 4XOCA 2DQIH 1UM4H 4JZNB 4HLZG 4N0YH 2EUWA 4JQXC 2CO7B 4HP5A 3ZX1A 6TAAA 2F0CA 4YHLH 3PL6B 4GG8B 3SBWC 4Z7UF 1GSMA 3CVHA 2I9LB 3DTUB 3AMLA 4KTEL 1JGEA 1UGNA 2FTAA 2WTOA 4JCWA 2J5WA 3AVEA 1IVLA 2EZ0C 4JKPH 3V5DB 3K4DA 2LABA 4C83A 3VXPB 3IKCB 3BZEB 3WNOA 2F74B 4LLDA 2YQ2A 4KRMB 5HI5C 2FGZA 3DK0A 5FGCB 1T03H 1TPXB 2M83A 4M5TA 4NUJB 4PI0A 1Z32X 2D4FA 2JJUA 2A4CA 2XG4B 1MFCL 5DZVA 3CFBA 5KYYB 3EH1A 5I1KL 5IW3A 2B77A 3HI1B 5L7XL 1UQSA 1I1CA 1F11A 1T4KB 1FVEB 3PDGA 4PGCB 1F6AA 3BSZL 1DVTA 5JIHA 4RAUA 1JTTA 1HQRB 4HSQA 4PRAB 3EYOB 4LBEB 4RZCA 5GS3A 1ODAA 3IDJA 1XF1A 3W57A 5FGRA 1DLFL 5DR5L 2K6ZA 2VDOH 3WFEL 1MHPH 1IVTA 5D70L 2W60A 3CZFA 3N50A 1YEWA 2E7DA 3STLA 3ZDXE 1N6QH 4PLOB 4DP0X 4XO4A 2GSGB 4N0CD 4PB0H 4YHNA 3SJVB 1F4HA 4M7LH 5KSAB 4NLHA 1R0AH 1WBXB 3A5VA 2GITA 2G0KA 2ZUQB 1NOFA 5TDNB 3ARQA 1GGTA 4ZXBD 4PJ5E 2YUVA 2C3WA 4BSWA 3ZE0E 3K6NA 1AQ8A 4NUMA 2B5IC 1CFTA 3QEHA 4X8JB 3EBGA 4Z76B 1B4JL 2FX8H 4P8QA 3SOBL 1UACL 3ZL1A 3HI6L 3QB7C 2J1WA 4AIZB 1FYTA 1BQRA 4HHAA 4I85A 2ZUYA 3RTQA 4AXWA 3WNNA 1ONQB 5BOPA 3FB8A 3HPLB 2Q9OA 2EH7H 4D94A 2V9QA 1L4IA 2IFFL 4JJHA 3TNNA 4GSXA 3UO1L 3VXME 1R33A 1UZGA 2A6KA 2R2EA 1CE6B 1XAKA 4QWWC 3ZYIA 4M1GL 1KEML 1EIBA 2B7DT 3TBVB 4V1DD 2WWMD 3NA9H 2C4FT 2G5BB 3LKQA 5KVGE 3FT2B 5CP7A 1MH5A 1UJ3B 4Y4KD 5GJSH 3B7YA 3NCFB 1CT8B 3Q1SH 2ADIA 4ZAKC 1WISA 4PBVC 5IG7A 5KVMC 2H32A 4BKLA 5HSFA 5AFAA 2DQTH 3QUGA 3MO1A 4KZEH 4F58L 4H20L 4V11A 4UB0L 3BQUA 3QDME 5GGQL 2BS8A 2VDMB 3V5HB 1JE6A 4ONOA 1ZVSB 1UG9A 1IAII 4GXVH 1GS7A 2I26N 4JRFA 3QJSB 3P0YL 1JGVH 5FWQA 2DIEA 5EIIB 3C5ZB 4IRSD 1Z9PA 2E8YA 3PV7A 1L7TL 4KDVA 1R3KA 2NDFA 4QIRA 4QPEA 5JXAH 1TEGA 4PR5A 1JYXA 1NIEA 2AV1B 1HESA 2C3VB 3BYYA 4YWGH 5FDWA 1NDMB 1U21A 3FO0L 3QDJA 1NGQH 3W3BA 3MNWA 4UUJA 1KIUB 3G5YA 3Q44A 4OD1H 3SPIA 2A2QT 1UT1A 32C2B 2UUDH 5ANHA 1HE8A 4HKXB 4N0UE 1E2ZA 3VSQA 1E40A 3C6LD 1U2HA 1AR1D 5DZOA 4K94L 3TFKD 1BGXL 1FDLL 3JWDC 2XDHA 3OB8A 3GXDA 3AM8A 4AKQA 2PYFA 5E4OA 3IJHA 5C9JB 4PRHD 4LHUG 4FA8A 3GO1H 1FN4B 1D6VL 1RPQA 3GSQA 4KMTL 1XH3A 3VI3B 4CL7A 1K8DA 5GZND 5HYIA 3TM6A 3ROOA 2DQ6A 4R4ND 4KJPD 4IBWA 3FB5A 1PKQB 1ID5I 2W9EL 4A6YH 4FFZL 4P5MA 4H25B 1MFDL 3RI5K 4G3YL 2NY5H 1WYJA 4HEPG 2J6EH 5I8EA 4JRXA 2C8NA 3DPBB 1PS3A 1CICA 4PJAB 4G82A 1E4XI 1G5GA 4A7UA 4DUVA 3LNFA 1NIBA 2X89A 1DJIA 3CDGB 4P5TB 1ZHBA 2E86A 3VSVA 2M8XA 4K3DL 3K3QA 2F53A 2GJ6B 4EN3C 5LBSA 1QLEH 3BP5B 1OTTD 2DBJA 2F1AA 3HG0A 2FQFA 4DSYA 5IMLA 5KUMA 1AP2A 3HR6A 3VD4A 4ZPVB 1F4WL 2COVD 1KPRB 3JV0A 4AEFA 1JJUA 1KIQA 2Z9TA 3PNWB 4FFVC 5EOQH 1EDHA 2HPOA 3H6JA 1AKJA 1CD0A 1KLFB 4POZC 3TA3A 3MLWL 4Y19D 4Z23A 1ESOA 3SDCC 5FGSA 1JPEA 3UTTE 1HCFX 3QYNA 3NGBB 4CILA 4WVRA 4MCMA 4G8FA 5I1DA 4NKIH 4DQOL 2UZYA 2BO0A 1DL7H 1FGNL 4MZRA 4OV6F 2XX0A 5F1IB 1XZ0A 3CN3A 4KGJA 2Q6WA 2QKSA 2VYRE 4PJ9A 5C0CB 4DJMA 5FO9B 5EEXA 1U8HB 1JXKA 4X98B 3QIUA 4KI5F 3LZNA 4QRQB 3KGSA 3JTSB 3U30B 3TZVD 1L6PA 5FA4A 4P2QA 3AJ7A 3CH8A 3DETD 4P23B 1WT5A 1N3NB 2ZXBA 3BPLC 4ELKB 5I9QB 3MRGB 3WO4C 2VCOA 3QP3A 3QDGE 3QRBA 5HVFB 3QFJE 4LEXL 5IFJB 4L1SA 3MRNA 1OL0A 2UWEF 1G6RH 3DV4A 4M7JL 1T0MA 2VRAA 4AEHH 4B7IA 4QEGA 4EJ1C 1P84K 1U8PB 2QSVA 4R2GD 5EULV 2XV2A 2XQ0A 3ENEA 3WY3A 3G6AA 1UXSA 2VISA 3ESUF 1LXMA 3P3UA 3TVMD 4H5SB 2D03H 3BAEH 4X80L 1K5NA 1OT1A 1TVDA 1SOQA 1JUFB 3L1EA 3BUPA 2WKGA 3S3CB 1UB5B 2IAAC 3T2QA 4HG4K 4F7PA 1CTNA 5J6HB 1HWGB 2Y2WA 1JVLA 2WANA 2IPKB 1MXGA 1VZGA 3EO9L 3H6AA 1AQKL 4PCKA 2XA3A 2L4OA 3OXSB 2Q8BL 3QA3A 5ESQB 2J8HA 3UTQB 5BS0A 2NXZB 3PWPA 1SFHA 3A22A 4WUUE 5CD3B 4XNYL 3TEXA 5C8JA 1CPUA 4C4KT 3T4YB 4AYGA 1CG9B 1DLHB 4Y4FC 3WKML 1H3TA 2H3NB 5A6IA 4G70B 2F8OA 3NSCA 2BVOA 3V6OE 1AG6A 1ZE3H 1JZDC 3MA9L 4NPYA 4H1LA 5INCB 5DJYA 5JW3L 2ZOWA 2F54D 3VRIA 4ELMF 5EF1A 3MBEA 1FWXA 2YEZB 1N8OE 3DXAB 1GGBL 3EYUH 2A6DA 4HCRA 1P4BL 2A9NH 1MFEL 2R1YB 4LLMA 3VGGA 1W91A 3RGVC 4FG6D 4BM7A 2DAVA 3V8CA 4CKVX 3TFBA 3Q48A 3WE6A 3Q1EA 3HZMB 4RMBA 5IBUB 4ZO6A 2WJ5A 3KM2A 2LOEA 1Y07A 4MNGE 1ZTXL 5INDA 1INQB 3BZDA 1TNMA 1NCTA 2H2SD 1IO4C 1NEZB 4JO5A 4X6CF 1CL7L 2YD6A 2WYTA 4PWGA 2FJGA 3FONB 3ZT5A 2DI7A 5E8OB 3SEPA 1Q1JH 1W9XA 4HKBB 5CN1A 4LKCA 4XN7A 3WNKA 3ABLB 3A23A 4AIOA 4K9EC 1P6WA 4GMTL 3VG0L 1JWMB 1E7VA 1HE7A 1XCTA 3QQ3B 2HXAA 4OLUH 3V4PH 2YRBA 1KPUA 3GBML 5A6LA 2AI0H 3G04A 3U0PB 3MCKB 3ZDXB 5L0QB 4ODSL 1XFPA 1UD5A 2AFNA 3GM8A 1TVBB 3HZKB 4MJ5A 3QQ4A 3CFKA 5EZIH 4JQXA 4JG0L 1EO8H 4JUSA 4KUCF 4WWKB 2DW5A 4O2CA 4FL4B 3SBWA 2NZ9D 3BYTA 4LXFA 1AQDB 2OJ1A 4RETB 5DHEA 4P4KB 4XPFH 4B27A 1DUYB 2A1WL 1EXHA 1DANT 1AXIB 1O6SB 4ZS6D 3TJPA 1OAZL 1U3YA 5SX5H 1X5FA 3FC8A 4GAYA 2E6QA 3EDKA 4DAGH 4Q8BA 4Y16B 4LCWB 2C9AA 1BREA 2H4EA 4HLJA 4C4BA 4Q9QL 2LV4A 3GBLA 4O02H 3NZ8B 1ES0A 1RI8A 5BRQA 4EI5C 2BVPA 3KJ4B 4NEHB 1RKRA 2AEOA 2O5XL 4LASL 4G7RB 2B16A 3EYFB 2EC9T 1RUMH 3WHXB 1SDDA 1D2PA 1MRFL 4AC4A 3CHQA 1NC2A 4G6FD 4M61B 5F6IC 4YHIA 5ADOL 1S7RB 5BV7B 3MRPA 2XVBA 3MUHL 1EHLH 2FWOB 1R3HA 2E46A 5FYKE 5TD4A 4WEUD 1I3UA 3CBRA 1CVRA 5IHLB 2VLJA 4QRSA 3W1ZA 3GSNB 4NQCA 4HUNB 3HC3H 2XXCB 3AXHA 4PRIA 1M7IA 3ZDYE 4AYDC 2IJ0C 5HD8D 2APTA 3NFSL 2XNAB 3ALPA 3QDMB 4MX7B 4LGPB 2APBA 3RA7H 4N2BA 4LSUH 4ERSH 4Z78A 3FTGA 1R3JB 3K81A 4N2IA 2Z91B 3S5LB 3ORJA 2Z65C 3FU3A 2R2CA 4MJ6B 5F9OH 3GRWH 1JGDB 3D4GA 5HDQH 1TSHA 1Z5HA 2WXIA 4NC0B 4LOUC 3V7AG 3N43F 2R0ZL 3RIAF 5CP3H 3D5OF 2AXJA 2HT2D 3DGDA 3IAGC 2WBWB 1Z5LA 3WUWG 3BGMA 4KAQL 4HWZB 3DJ9A 4NKMA 4AQ1B 3NCMA 1BD2A 3GI8H 4QHPA 3DHPA 3VXNA 3RFZC 1Y1DA 3LQMA 1UFGA 3F5WB 4N0UB 3IDIA 4Y0GA 2Y69B 1KGIA 4JPKH 4KBPA 5MERB 2BMKA 3VE0A 2BOBB 3CHSA 1CFVL 2DBLH 3RAJH 1F3JA 3ZMNA 1IKNC 1D5XA 2EO9A 1IU1A 4HK0A 2WAHA 2C9SA 1UC6A 4M7KL 2GI7A 1MJ7L 2R2BA 3WDJA 4APXA 1RZGB 4CVZA 2FUQA 4PLJC 2B4CC 1EK3A 1T0NB 4X4ME 1I8UA 4WI6A 5GGVL 4ZAKA 4XXCC 2OZNA 3SOTA 3POHA 3CUPA 4A39A 2I07B 3ARFC 4CMMA 3C2AL 4IBZA 4OIBA 5HGBA 5CZXC 3HCVA 5F3BA 4OAWB 5FR3A 5I15H 1A6WL 1CDYA 4NZTL 5HHQA 3MV9D 5TFSH 3FT0A 1MFNA 1TKWA 3PAYA 5JLZB 4AMKH 2BIPA 1IGFL 2GSIB 4GKSB 2JVUA 4RGMB 1JYVA 4X42A 2VLRD 3KS0J 2EILB 5D1ZB 2EYTA 1S3KH 2YAEA 2X3AA 3UMNA 1T7VA 2B20A 2MSPA 5D93C 5BQ7A 4KVCL 4GEJA 2KPWA 1JF1A 4JN1H 4XT1C 1A9BB 4G6JH 4HJEA 3WIFA 1G1KA 3WKNA 1RMFL 1FNGA 1VADA 4TVSa 4IS6A 2AJUL 3UZEC 1OY3B 3CNKA 4JAMA 3SKNB 4PJBA 4JN2A 3INOA 3N40F 3HR5A 4MDIA 5LG6A 4FYTA 3CXDH 1QUNA 3AY2A 4FNTA 3VYOA 1YEEH 3D69A 4OV5A 1CD1B 2R9HC 1IILE 4UT6L 2X4SB 1ZT7A 2QSQA 4HCGA 3HRZB 5KSVA 4CMHB 3LQZB 2X4RB 4XP9L 3WLBA 8CGTA 5IW6B 1R5VA 4LVOB 4O2FA 5DK0A 3SE9L 4Q9CA 1WBZB 5ITBL 1F41A 3BP6A 4ZW6A 4UNIA 2NQ3A 5GGVY 4IKLA 3ZQXA 3MRKA 4WGVB 3DO4A 3FH5A 5TGBA 2O6FA 3IU3A 1RZFH 3C09B 2J5LB 3MUY1 3QDGB 3T5WA 1JV2A 2GAZA 4N5EC 3F7PC 1OD9A 3BUQA 5H37A 5J06A 2EECA 1IC1A 3BVNA 2LTQC 4R4FH 2L7EA 5T1LD 2C3XA 2G2RB 3MUZ1 3T0XA 4FABH 3KLHD 5EN3A 1I9RH 3LIZL 1OCWL 1ZS8B 5K39A 1V3KA 4OCYH 4IBQA 3TV3L 1BQSA 1G7MA 4HGKC 4Z18A 4F3FB 3KS0H 1B2WL 4EN3A 5FECB 5F9DC 3FQNA 4OF7A 3D39A 1U8MB 4IM8A 3QWRD 3SGDI 1CIUA 2DTML 1J48A 1NUFA 2IXQB 4FKEA 3MLTB 3LH2L 5J3HC 2ICWB 4NCC1 1MEXH 1P4LA 4NUQA 4Q2ZA 3MA7A 3SDCA 4S10A 2XFXB 3VI4F 4XN4A 3U0WL 5LAXA 4U6HA 2UXGA 2AQSA 3VNYA 3LNHA 1PZAA 2A5UA 5IKCB 5E8DL 1FGVH 5ILTL 4HFWB 3WJJC 1B3JA 3UC0L 5HHME 4DKFH 4WEEA 4KHTH 1CLOH 2KZBA 2JWYA 5GS0H 4DPAX 2DMKA 2FL5A 3Q3GB 4OUOA 3IFPA 1NGWA 4CC0A 3OQ3B 3RZCD 2FEDD 5BRZD 1UM5H 3IMUA 3P1VA 4ZX4A 2WXRA 5DQ9A 2XKUA 1SUJA 4Z77B 4I0CC 2AQTA 1PY9A 2GBAA 3IPEA 4XVJH 4CN4A 2XBTA 2Z93B 3KDPB 3QUZD 1MWAA 1NAMH 2E8ZA 5KYNA 1LMIA 1WA1X 2DWYA 3IPBA 4YGVA 3L6FB 5DJ2B 3FRPG 5C08A 4JFOA 2CO6A 4FQ2L 3MLUL 4I0PC 2OXGB 2WV3A 1I7ZB 1PZBA 1A1MB 3KPSD 3PY9A 5ICZB 4Z7UA 2EE9A 4CC4C 5D5MF 1AGDB 4MNGB 4NGHL 3F83A 1P1ZB 2RJMA 3HUJB 3OR7B 4MA7H 1NGPL 4NO0B 3RVVD 4AM0B 4N8VB 2R0KH 4Y1AE 4HKJB 3LPFA 1WTGT 4LDLB 1BSIA 4GW5A 5HYSA 4GBXD 4HLZH 5C2BH 4CGUB 4TKWA 1DVFC 3VFWA 3BKML 2EE2A 4OZ4B 5DD6A 5EF2A 1GAFL 2BM3A 3W0WE 2ZJSH 4KWUA 4R7VA 3FOLB 3WFHB 3TYGH 1XF3B 2NY7L 4QO1A 1U95B 3AS2A 4X5WB 3ZE1F 1YPZB 2QPUA 3FJTA 3FF8A 1QPKA 4J4PD 4M8RA 3B7RL 1IM9B 4Y4FA 3SKMB 3T1FA 1BJ1H 3BD5A 5F1NB 4ECNA 1EBPA 2Z92B 1NPUA 4XMUA 2BIMA 1AZBA 4FQIL 1OWWA 1DFBL 4X7SL 4HUWB 1YYML 2FATL 2ZOLA 1P7QB 5EV7A 4XPGL 1QWNA 3O2DH 4HEME 4LPXA 3BC9A 4D9QE 3QNXA 2ZTBA 5DCCA 3RGVA 4JKKA 3R4DA 2LGNA 3BUIA 3O9WC 4XMPL 1JGIA 2VXSH 3PWJB 2P43B 1MCPH 4G9FD 5IT2H 2OPCA 3Q8AA 4HUMB 1I1YA 5DJAA 3FBKA 1GYAA 5GHWL 4OZGE 4F57H 2Y2TA 4UILH 4JM4H 5E8EA 4CADA 5GZOD 2AEPH 1D7BA 4ZOBA 4KQ0A 3LS4L 2X7LA 2ARWA 4JKMA 4ZNCD 3CFQA 2B2XH 1FV1A 4URTB 4XAKE 1U8IB 3BIAX 1BIIB 3BWUC 4JQIA 5E9DE 3SYQA 4R7DB 3QRFM 1KYOK 4IBYA 3AG3B 4MNQA 3CFCH 1P7BA 2CKBL 1NBYA 5DWPA 4DPBX 2OMYB 3QIWD 4Z1PA 2WLZA 4BSVB 1IBYA 1FBIH 1D7DA 3ZDYB 3ULUL 4JFFA 3FUDA 4KROD 4PY8I 1GXEA 3N1MC 3TJHC 4N2GA 1HKLH 4N26A 4EUPB 1G9NH 1RK1A 1SMAA 3KBHE 4XCNA 1DQLL 1JZFA 2ZP0T 1XDTT 5CCGE 3SGEI 5HHVH 4FJ6A 1VFUA 4PJGF 1T83C 4X2UA 3EYQD 4MNHB 3U6RA 2HYMA 4JANB 3RBSA 2ZUXA 1I53A 3P0VH 4JR9H 4WU5A 3ABMB 4CA4A 3MJ7A 2OP4H 3DNKA 3OJVC 3SB3A 4AT6B 4QOKA 1XIWB 1BZ7B 5LGKA 4EI5A 3FF7A 4MHHG 5DHVH 4P5KB 4MMZC 1MFAL 4F2FA 4XPBL 4D3CH 3SKOB 1NIFA 1X5HA 1FG2B 2EXYD 3OLIA 3VXTA 1GCYA 1IT9H 2EIDA 1T5XA 4PS7A 3MRJA 4P04A 4QRRE 1VFMA 3CVHL 4V33A 3HBQA 4YHYB 1X4XA 1EJ8A 5J9PB 2R56L 1VA9A 3UAEA 4BRJA 1ORSB 5I1AB 2AZUA 2OTUB 3OPZH 1WFIA 3ZE2F 2JKIS 3K6SB 5E1AB 4TPRL 5ENWA 2DD8H 3DSNA 5BVPL 2R39A 3G08B 3PWLB 1KB9J 1RJZA 2WYHA 3Q9QA 4PJFE 4GI8A 3MFGB 2BP0A 2P8MA 1MJ8L 6CGTA 1CF8H 4YLQT 1N7ML 3KCWA 5CXPA 3TLRA 2EDNA 3U1QA 4ZFGH 5FCSH 3FFDB 2VDOB 3A6CL 5IUSA 2A0LC 2DL2A 5JW5A 4WW2B 3GNML 4JK0D 2MNUA 3NAAL 4CVWA 1D6EB 4TL5A 4OZFG 3DV6B 1J18A 1OF2A 5EA0H 2H1XA 4YK4B 3SZKC 2CE6A 4GRMA 4KXDA 5IHZA 1OALA 2Y7QA 1OSEA 1TZ8A 3RWFA 1O9ZA 2CR0A 2A9MH 2V2WA 3OAYK 4RRPM 5JIQA 3VXRE 3FN9A 2X2YA 4U7SA 4MD4A 1MHCB 2FEEL 3AROA 2VERA 4OJEH 3GMQA 4KI1A 1ODUA 3RFZA 1QOKA 4X4YA 2Y3NA 3N44B 2XKNB 3GGWA 1HINL 4TOYL 3ZL2A 4JM0A 4OQ1A 3I9AA 4IHOB 4F9PC 4OIAA 1IKNA 1CN4A 3S37H 3HAEG 2FX7L 3E2HB 2GFBA 3SDYH 4JFEE 3O11A 4HD9A 4PRPE 4AGMA 2IDUA 4LDCA 1I7RB 3T2OA 4WFHE 4DN3H 1X5XA 4L9LC 4JO4L 2FJFA 4XXCA 3RURA 4WKZA 3U46A 1AG0A 2HFGH 2SEBA 3KPOB 3ARFA 1OO2A 3MSPA 1HWWA 1NLBH 4LGSB 2IDCA 2NNAB 4IMLB 5FX3A 4GG6F 4L9DA 2V4LA 2J1XA 3CSFA 5I5JA 3SDXF 2NY1D 1N64H 5AZUA 1XF2B 3N1PC 5IFHL 5E5RB 3HZVB 4X5QA 2CBTA 1KYUA 2FD6L 3IMRA 3L5WA 4XPHH 2JIXB 4MDJB 2VWEC 1TCRB 4ZO8A 5KBKA 3NCJH 4JB9H 1QLRA 3ULVF 5C70A 3JZ7A 3S3PA 1JVKA 4OW6A 3G5VB 3UZEA 5I73B 5I1LA 5HHPB 5C1MB 1FO0L 3WXWH 4KNUA 1JPGA 2DM7A 2QQQA 4WFFD 1BXXA 5F9WB 1KT2B 3ZTJG 5JNYA 1J0YA 1DQQA 3AITA 2YGNA 3HS0B 1TQUA 3OSVA 3RL1A 4KJYB 4PJEA 1NZRA 1KCKA 3GHPA 3KLKA 3CIQA 3EZ8A 4GQQA 5HHMB 2P5EE 5DTFB 3MV7B 5KW9L 2VERN 3PGCA 2CMRL 4EKXA 1L9RA 1FYTD 2DYPB 3ZDZF 3RDTD 3BRDA 3BIKB 3FZUD 1UWXK 1U8CA 3S4SA 1DHKA 2OL3L 3CFEB 3QUML 1LTXA 5E08L 4MQ7B 1XSIA 1NCNA 4PM1A 1WAAA 2J2ZA 1BG9A 2NUPB 5DVPA 1ZVHA 4IOIB 2ZOOA 3F2LA 5JORA 3IAQA 4PJXE 4N3UA 1Z0MA 2X70B 1T5KA 1TJGH 4UAHA 4NKQB 2CUAA 1MFCH 3IXAA 1QKZL 1Y7VA 5JO5A 2Y6SC 3ATDA 2BSRA 4U1GC 4LCCC 5HHNA 4A6YB 4I77L 5L7XH 4IDJL 5LN8A 1AXSA 3MU3A 1JPFB 2G3NA 3PWVA 4FMFA 4UQ2B 4FNLL 4CSSA 3BISA 3RVWC 3US0A 1WHOA 3ECBA 1LYQA 3BQUD 4MZ3A 2IVFC 3SO3C 4AGNA 3IM1A 3L3HA 3QXUA 3LY6A 2DEYX 1XCQA 5D70H 3W9EA 4MJ4A 4EQ2A 4UQEA 3W0WB 4YHKH 1E28A 1BP3B 2Y7MA 1KYFA 4G9DB 4JG9A 3VFTB 3WJJA 1UWEH 2VITB 3DVIA 2PTTA 3GMPB 2B1OA 4LU5H 5EN2B 5GRXG 5BVJB 5M95B 5T1KB 1VKXA 1UXLA 1XSJA 2OA9A 3DTXB 4PVBA 1A3QA 4GRLB 2BJML 3V6OC 1QFPA 1PZ2A 4WJ5A 5LBSL 3MC0A 4KTGA 3QDJD 2WW8A 5IHHA 3BO8A 2HH0H 4P9HC 2BLFA 2VDRH 3H9YA 4ETYA 1G1CA 2GY5A 1QNZH 5AD0A 4G42A 3DX9B 4LDOB 2GBUA 3RTLA 3A6BL 3MOBH 3VTAA 1MW0A 2VN6A 2FNWA 2MHAA 3GSXA 1C9SA 4S2SA 5EU7E 4AENA 4M3JA 2OKMA 1OM9A 1EWHA 2KBGA 3QZWB 1D9KD 4FC3E 4OZHB 4NO3A 4I0PA 4UNTA 3WUZA 5IMMA 1ZMYA 5JPNB 1TETH 1CGTA 3ZVVA 2YA0A 5C71A 3RRQA 3WE1A 1K8IB 1MY5A 4CC4A 4I3RH 2VUYA 1G6RB 4ZFOB 1KEMH 3MRIA 4TMPA 4OZGB 1NSNL 3UAAA 3VGEA 4Y8AA 4AX3A 2QV4A 4QHKI 1PNCA 2OSLB 2A6IA 1MCFA 4YEEA 2DQMA 5A16A 1YECL 1QLFB 3GJFB 3C6EA 4JRXD 2NT1A 2X6MA 4X9HA 3BD4A 1CICD 1DVFA 4BA0A 3ARXA 2Y36L 5E6ZA 1DJYA 1XD1A 2X89D 5DRXA 5E9DB 2V2XB 1P69B 5SWZB 1YCSA 4TNWF 2J1YA 4TQPA 1CDUA 2WHVA 5E8PB 2F53D 7PCYA 4NQQA 5GGQH 1G1OA 3V4UL 3WEOA 1AMXA 1B90A 2YXWA 5HBBA 3QEUB 4KK6D 3PXJA 4H0HB 4XNMB 3T0WA 1TQWA 3P0YH 3SE4C 3QNYB 1BQKA 2H6OA 3TA3D 1FJ1B 2Q76A 1L7TH 1OGSA 4OLYH 3VXSE 1BMWA 1ZJBA 4H13C 4KTDL 4UAOC 4YDMA 5FKAA 3BHBB 3QUYB 1YYLH 1RIVL 1WDAA 2QQKH 3KW8A 5C0FA 3CHRA 4RGNB 1RQ5A 4Y2DB 4P46C 1YEGH 1U42A 3VM5A 1WBYA 3BDBA 2WSPA 5LDUA 3EO1B 1W16A 2H0PA 4PJ9D 3S3BB 3O9WA 3QIUD 5D4HA 5C0ND 4P9MH 2DH3A 5CMAB 2IMNA 1XO8A 3CLEH 3OF6D 1SXZA 2ZQKA 1SXAA 4PQXA 5G4MA 4PEEA 4APQB 4NRYA 1BGXH 2DQJH 2IAMB 4AZUA 3AU1A 3UCQA 2Z31B 1A9EA 3N1GC 2J4WH 4MS8C 1ACCA 1RZJL 3GIZH 3T0BA 1IBGL 1A7QL 1SY6A 4Z5RB 4BK4A 3QG7L 1NCIA 3BVTA 2AP2A 4WFED 3LPWA 4Z7QB 1D6VH 4QRRB 2WLIA 1VLXA 3DVNA 1SJHA 4LPVA 3IDNA 1GSKA 3FFCA 1XGUB 2YN3A 3GMLB 4LDEB 3V0GA 2X2JA 4HBCL 4NIKB 4RLDA 4X7CC 1HEZA 3UGXA 3KMDA 1KTLA 1OGAB 5C0IB 3DKHA 5L2KE 1MLBA 4QF1B 3SPGA 1NCOA 3VXUE 1UTDA 1PSKL 2XN9E 3CAFA 2B59B 3SDDB 4FEIA 1NMCB 3IBEA 1OTUC 1AY1L 3JVFC 4PJFB 4Y8DC 4YDLC 5IHBA 2H9GA 3NPZB 1H5BC 3LMJH 1Q94A 2HLEB 4PJ5A 1TXKA 4ZDHA 2ZYSA 3L3IA 4BZ1A 3WNIA 5B1AB 2RH0A 4ZUUB 5GGSA 1EX0A 3SODB 1BEYL 2J7LA 4JZJC 3EGXA 5LUMA 2IQ9L 2PABA 4OD2A 2HMIC 3DYOA 1MNNA 1X7QA 1T83A 5BS0D 4Y5XC 3V4VA 2BVYA 1CGYA 3OKLB 4RWHA 2W9DL 3W5MA 3PWPD 1YY8B 4P2RE 1PYWB 1IC5L 1OK0A 1Q4NX 3HLAB 3KPRA 4PGJA 4NBZB 1E6JL 4DQOH 3ILEA 1UM6L 4IGBC 1FL6B 1J11A 2LE9A 1CQKA 4MMZA 2DI8A 2FH8A 4ZNEE 2ITDA 4KO9A 5DZNA 1JHTB 2K4WA 4HJGA 3F7KA 3JV4A 5ERWB 4EBQH 3ULVC 1CFQB 1BFSA 25C8L 1NFDF 3L4UA 5EUKB 3VDAA 4O02B 2AEIT 1S9YA 3QCVH 1ASPA 4QHNB 1AO7E 1NGYA 2BWQA 3O6MH 4PRPB 3ARDC 4ZMXA 1YN6B 2QADC 3DBXA 5IP4A 3OHMB 5TE4H 2HN7A 4HMCA 1I85C 1C7TA 4W9JC 2WOYA 2A6JB 4ODWB 4AW7A 5EU3A 2HKHL 3LNIA 3R8BB 4IIZA 2JK5A 4LSQH 3RPBA 4YHML 3BJLA 4E41E 3WLWD 3FU7A 4HK3N 4U1SA 1XZWA 1IBHA 5IOKA 4N8UA 3FU5A 4XE0A 5FFOA 2HJFA 2R2HA 2DI9A 4S1SH 4WDIA 2OSWA 2WBKA 5HHOD 4EZLA 4B9FA 1MVFA 3WAJA 2PCYA 3SPCA 2VW4A 1FUNA 3V0EA 3IJYB 1T3FB 4AYFB 4G71B 2VJ0A 2R4RH 4D8PB 3L5XL 2NYYD 4YSDA 3O6KL 2DF3A 4M7LT 3PJSA 1S6NA 2PO6B 4MJ2A 4H26A 2FHFA 2CJTA 3APNA 4I9WE 3HOGA 4LT7A 1AQKH 4R90H 2TSAA 1HH9B 2GKIA 2B15A 3B2XA 1Y0LA 3FSOA 4JDZA 1UUSA 3MRHA 4JG1H 1QHQA 4NN7B 4AE0A 4F9PA 2EZ0D 4XNYH 4UMGA 3LKRB 3BH4A 3HPJB 2P5EB 3GSUA 3QWOA 3WKMH 1H3GA 5LCVA 3BW9B 1IGTA 1NEPA 1GW0A 3GMRA 4A7SA 2FQGA 1MDTA 1NL0L 4L9LA 4P2CG 4OJDH 4FKHA 2Q86A 4PMFA 3WN5C 5JW3H 5J11C 2BVQB 5JOPE 5IB2B 3O3AB 5G5DB 3VFNB 5DRWB 4PJ7E 5GIRA 1XGPB 5FYJD 1HWHB 5IY5B 4I18B 2CDGA 1BFOA 2P8PB 1M1XA 4WI5A 1NC2D 3PF2A 4PJXB 5I8KL 2VW6A 1S7QB 1WTLA 5DEFB 2HLAA 4TQHA 2OMUA 2CK0L 4GFTB 1RU9L 5AW5B 4I89A 2V5SA 4C55A 2N0KA 4YQXH 2KT6A 1CL7H 2NW3B 2BCKA 3UTTA 3K4AA 4L29A 4U7KA 5GS1B 4PRID 1OEZW 3LXBA 3LKOB 5DJCA 4N9GA 3PGDB 5F7FA 3RVTD 4OH2A 3MUGB 5A43C 1MJJA 1TFPA 3MRMA 5IOPB 2EVFA 3MODL 1I8AA 5LG1A 5I76A 4FI7A 3GBMH 4Z7VF 4LMQI 2NY3C 4D0BA 5JHDD 2PWFA 4HPHA 4OKDA 3ILQD 4L4TE 4K7FB 3F7RA 4NSKB 1AAJA 1F1DA 3M88A 3TWCL 5I17A 1CLCA 2D3VA 4JREC 1WS8A 1XGRB 2XI9A 3LNGA 1I9IL 2GPZA 3PJNA 3D30A 3MNVA 4M6ML 4U31A 3CK0L 2WUBH 4WY7H 4JKLA 1RERA 4PJDF 1ZA6B 2XUWA 4JHZA 2MMXA 1LO0L 4LIQH 1GC1H 4WI2A 1JV5B 3ILPA 3I6KA 1GL4B 5C6TL 1OAUL 4HZLA 2CCWA 3GIVB 1WITA 4Q9QH 4ETQA 2CAKA 4HALA 2CHDA 1ZA3B 2NY5C 5KJRH 2O5XH 4A63A 3JWDL 5AW3B 3OXRB 3VFPA 4JFZL 2YD9A 3WFBH 4OZIA 4FEMA 2OYKA 4PG9B 1JDDA 1UXWB 4OLWH 4ZAKD 5AVYB 5DZ9A 5J1TC 3V5KA 4YXKL 4PD4K 1CI3M 3NJNA 4ZUWA 4I3GA 4GQRA 1HHGB 1FVDB 2WZAA 4G7SB 2Z7ZA 4OLZL 3MNDA 1P84J 5L4MA 4LL4A 1SBBA 4PJHE 5LNGA 1LWHA 3EXLA 5BMFH 3QJVB 3UJJL 4GXFA 2BK8A 2QSTA 5FK9B 1H8SA 1JSYA 4LSPL 3PWNA 3NFSH 5HJBA 2HRHA 5FYLL 5TDOA 5IEKA 2GT9A 1BXVA 3Q2WA 1W8EA 3V6OA 1CGXA 5TK2A 5D1QC 2GQHA 4EIUA 4J1UA 4HG4J 4MS6A 4G7VH 3ZMEA 1AIFB 1KY7A 1TZOA 2V8LA 4PRNB 2OW6A 2OM5A 3U7WL 3ELAT 2CLZB 1P6AB 1NPNA 1GGYA 1UENA 2DQCH 3VXSB 7PAZA 4ZMAT 1N8ZA 5B3JE 4M93C 1DEEB 2YD3A 1KTDB 5DRZB 3DGGA 4TNGA 3RHWF 3SYCA 4WF7A 4QJ3B 3OJDA 2ARJA 2CCLA 2XG5B 3M1CA 1LE5B 4HIIA 1SN0A 3UPRA 3QHZL 2IG2H 2P7TA 2AJXL 1JN6A 3HFML 1QFUL 2IH3B 2PW1A 3IWUA 3DDFA 3D18B 1PX3A 5CWSB 2YHGA 1KDIA 2DB8A 3MLYL 4UT9L 2QLYA 1PIFA 2RR3A 3GI9H 3RUGE 4AMXA 3FL7A 2IEPA 4F7TB 1NAMB 4NNPL 5IVOA 2R69A 4FNPA 4JX0A 4LZKA 4AVHA 2FB4L 3H42L 1FE8H 1MJ7H 1RK0A 1KFGA 2GIMA 3HZ3A 3ULSB 3NJIA 4H0GA 3AXLA 4G6KL 2AJVH 2QHRL 4HPYH 1TZIA 5FF6A 3DROB 1MWAL 3HHSA 4ODHL 5L2KB 3C2AH 1HX0A 1HHIB 1Z9SB 3IVKA 3VXUB 2YJQA 1A6WH 1PZDA 4U1NB 4V1DE 3D39D 2K6WA 3ARUA 4CSZA 3O4OC 3PREA 5GJTH 1IGFH 3GUFA 1QRNA 2W07A 2E9GA 3OGOE 3SE4A 4RAVB 1E9OB 5DEJA 2JCCE 4POZD 1JZ2A 1INDL 4AYSA 2ZCLH 3QARA 1J9QA 1BZ9B 3SDCD 4KVCH 3CXHK 2DOCA 1R47A 5J1AA 3LQAC 3UBXA 1BQ5A 1ZY9A 2IADA 3LXCA 4G80B 4QHKJ 3V0JA 5LXGL 3VM7A 1C7SA 3EDJA 3HB3C 3U36B 1OTSC 2LW3A 4P46A 2AJUH 3RX9A 1KCRH 3Q8FA 4XNQB 1IL1A 4XBPA 2NY2C 3MDJA 2XCMC 5F7NC 4XMZA 4XRCB 4HS3B 4B0MM 5ACLA 3BKCH 1XTMA 1KPVA 2ENJA 2VIRA 3AQYA 1PDKB 4WW1A 4EI6B 2FT6A 1IX2A 3LRSA 4CRPA 4JJ5B 3ZT7A 5B38B 4GJTB 3OJ2C 4IOSA 4XP9H 3KDMB 1JZ3A 3AGWA 3MV8A 3CN2A 5JQ6L 2WXMA 4B96A 5ITBH 3L2LA 5DD3L 2C7UA 1AO7B 2WXJA 3R18A 1A22B 3HE6C 3CFMA 1JWSA 1CZ8L 5DJZA 5TF1H 1VZHA 4L1BA 4OZFH 1LEIB 2A38A 1EGJL 1U3HB 4M8UA 3OLEA 1X5YA 4PI2A 3KPMB 3MLPA 1EJOL 4YHZL 2C9PA 4Q6YA 2ORBL 4OIIL 2AGJH 5LGHL 2B08A 1H5BA 4PRHE 2Y25A 1WFMA 3FT3A 3LIZH 1OZTG 1KGXA 4H4NA 3VMPA 4B9CA 5C07D 2WVSA 3TV3H 1CQYA 3SCMB 2PW2A 4JZJA 3FT1A 1D5BB 1LP9E 1VFOA 2BSEA 4W9LC 5DMKA 2FSDA 2V17L 2BNUA 4PFEA 1KG0B 3OMIB 2VE6A 4Y5XA 2HKFH 3LH2H 4YHOL 4ONGH 3OJMB 3HAEH 4OJAA 3TPUB 3LEXA 5CGTA 5IMOA 3DX8A 4TQIA 3OKDB 2W81C 4HIHB 2WVVA 2DTSA 4Y4FD 5GISH 4IGBA 2ITFA 3AREC 1B4LA 3E3QE 5F9JA 2Z34A 2J20A 5GS2D 1A6ZB 2DKUA 4MFHA 5D7IE 3C9NB 3MCLH 4L3AA 4XNAA 4OFYA 2RFXA 1AZCA 2WTRB 4Y19E 3UYRL 4NENB 1I7TB 1YJDC 5AWNH 3ARDA 4UINL 4XMTA 5DHVB 2AK1H 3CDYA 5EHFA 1I85A 5CJBA 3T3PE 1SUHA 3VGAC 4MA1C 1P7KA 2L04A 2VLMD 1KLGA 5GGTH 5FKPA 3HN3A 2X9ZA 2D3NA 1RXLA 3QO1A 4PJAF 5DI8A 1PIGA 2KQMA 5C0DB 1BYNA 4X99B 2BOCA 2FDBP 2XJLA 3UGEA 3BZFA 5DC2A 2YJLA 3ZKMC 3MLUH 4IYKA 5DVMA 3OL2A 3VD0A 3ZTJH 4PWKA 5DUML 5MHSD 1SMOA 5DUJA 3GSRA 4PV1C 1WFOA 2UX7A 1BA9A 2WXKA 3QUXB 5T5FH 1J5DA 4Q9RH 1EAOA 3O0LA 3ZUNC 5JHAA 2VSMB 2OMWA 4MNQD 2DLEA 4HS6B 4PTUB 4AGPA 4DZBA 3FO1A 3V7AE 2WPGA 3W2DL 1WD8A 2BIIA 3LSOA 4JVWA 4XOBA 3OZ9L 4NHCH 3NFNA 5JZ7C 3IDMB 4KNSA 5CJ5A 3BKMH 3L4CA 3EFOB 1QO3B 4JFFD 1RIUL 4NC2B 2BS71 1PKOA 3LKSB 4MAYB 2VLKA 4MVBC 4AGQA 1NBVL 2YD4A 4E9LA 4K15A 4OTXL 2VO5A 2NLJB 4CU8A 4PAZA 4WU7B 3BGFB 4NZDA 5IEHB 1NFAA 5EBLB 1PG7X 2NUTB 3BLPX 3V7MA 4Y89A 1N9PA 2DIJA 4L4TB 1MVUA 3V2AR 1E2WA 4LHUB 3QQNA 4JFDB 3B9AA 3MYJA 2GB2A 3WD5H 1HI6A 4NWTL 5CCKH 5DEGB 5IBLC 3BZ4A 4X7SH 4AL8L 4QOKD 1PLGL 1YYMH 2FATH 1GGIH 4TLKA 3WN5A 4TNVF 1NQBA 4KO5A 3FCTA 5IJVA 2IH1B 1T20B 3ALWA 3V95A 3TCLA 5JHBA 3HI5H 3NIDF 3QRGH 1DN0A 3LKNB 1ZAGA 1IBZA 1JXDA 1JGUH 1INEL 4DP7X 2R7EB 2WGNB 2NR6C 4XMPH 1MCWM 1J86A