1AGCA

Antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyql-7q mutation)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B*0801
publication title Antagonist HIV-1 Gag peptides induce structural changes in HLA B8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility complex
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1997-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1agcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1agcA01
2VUYA 5FYKE 5EORL 4DGVH 5MEQB 2ZJSL 3MRJB 3UXFA 2X4PB 4Z0BH 3X3GH 4OAWB 1KFAL 4M8QA 1KTLA 5E0QA 5E2UL 4IEFB 4TOYL 3NCMA 4M6NL 5K59E 3O41A 5FA3B 5GRZA 5LJYH 1INDH 2L7UA 3JVGC 4UI2A 5F21B 3LSOA 4O2CB 5ESQA 5ICZB 1MAKA 1UG9A 1WCQA 2OTWB 3MV8D 3F58L 3HC4H 1G1CA 4G6AD 4OLUL 1HQRB 5C3TA 4DW2H 5DEGB 2FH6A 5I18L 3VFRB 2FR4B 4YHYC 2R2BB 2CJUL 4Z7NF 3NZ8A 2A77H 5E5RB 1T5WA 1XF2B 5TDPA 3B3IA 4G43A 5IMMA 1DN0B 4KQ3H 4U1MA 3LV3B 1K8DB 2W9EH 1QLEH 5BS0B 3ULVF 2BSSB 3RZWA 3MV7B 3BKYH 4HC1A 1A4KA 3QCUL 3QWRA 2H2SC 4WGVB 5IBLC 1F2XK 1GGCL 3OKKB 5EO9B 4QXGH 2UZXB 1G9ML 2N56A 3SDAD 3SE9L 4EQ3A 2NNAB 3MSPA 4Y0GA 3ET9F 2A9NL 4JPVH 4OF7A 3W0WE 4YBLC 3VXUD 1TTUA 1UB5A 5T3ZL 5KS9B 1H3UA 1KCLA 1DL7H 2EDRA 5A2FA 2I07B 4ALAL 2NXZC 1F5WA 3PG2A 4NN7B 4Z7WB 1SJXA 4KQ4H 1S7TA 5MI0C 4F37K 2F58L 5DJ2A 1FNSL 4FZ8H 3RQ3A 4N0UA 1YEEL 1G6RL 2Q6WB 3O3EA 1DBJL 3JV4B 4HCRH 5FKAA 3LMJL 3WCYA 4ZAKA 1OD7A 3LEYL 1HHIB 4MCZB 3PHSA 5CCKH 4QF1B 1B9ZA 1E4KA 1XEDA 3QJHB 2NX5D 5BQ7B 2R0ZH 4O58H 4JM4L 2BRRL 4I18C 1F2QA 2E6PA 1I4FB 3VFWB 5J12B 1QG3A 4MB5A 2CRYA 1QSEA 5SWZE 1SMOA 3EUUA 3RAJH 1FNLA 3NN8A 1K6QL 4A6YH 3G5ZA 1XGPA 4FXLA 2ADJB 4KAQH 2DD8H 1PG7H 4NQXA 1F6AB 4FNLL 43CAB 4H25B 4QRPD 5MENA 4NHCH 4L9LB 1A9BA 2GTZA 3HE7D 4GBXA 3DMMB 3LD8C 4UB0L 4AM0A 3B8YA 3QIUA 4OKDA 4J7RA 1YYLH 5IF0A 1S5HB 2A0LD 5KTEL 1ND0A 1BD2E 5FOBB 3NFPA 1RU9L 4R8WL 4ZPVB 4PGDB 4APQA 1QFWH 4UNVA 1I7ZB 1GIGL 2P24A 4NO3B 3REWB 2C3HA 3T3ME 4ZMAT 2VLKA 3NGBB 3MLXH 2F74B 2X4UB 5I1KH 2ZUTA 2Z31A 3X17A 2HT4D 5JXEC 3MBEC 5DLML 1CDUA 1CXFA 4JG1H 1RUQL 1NC2A 4QRRB 1MCPL 3ARYA 1X6LA 3ARTA 1SMAA 3GRWA 4AT6B 5E1HB 4N0CC 4PUBH 3RX8A 3BPNC 3VMPA 3I6LD 2W0PA 5EORH 5EDXA 1UACL 1KLUB 4FQHA 4GKZB 4H20L 5IVOA 4NO0D 4PGJA 3WBDA 1KFAH 5E2UH 4DOHB 2PYEB 4N9OB 4TOYH 5ERWB 4OZFH 1ORQB 3IU3B 3D0LA 3S37X 2EIZB 1QFPA 2E9JA 3F58H 4KJPC 2XY2A 5F3BA 2D4FA 3IDYC 3DX8B 1NFDA 4OBSA 3TH4T 4ZOAA 2HJKB 4BKLB 4F15B 3ILPB 1NL0H 3QFJD 5I18H 1N6QH 1WBXA 2J6EA 3VA6A 3VG9C 2CJUH 2DQDL 5E8DL 3U7WL 1Y0LB 3MYZA 3RWIA 5E8EB 3S4SA 3CX5K 3L3IA 4OZIB 5IFHL 3QDME 3S3SA 3QT2A 1PEZA 4NHUE 1VA9A 1Z5LA 3U7YL 3QDGB 3MYJB 1X5JA 3RIFK 1ZWIB 3FQNA 3RL1A 3W11D 1GGCH 2VH5H 1MVUB 1G9MH 4Q9BA 1NFDF 3HPJA 3IETB 4YBQC 4C56A 4YDIL 3GJFK 5T3ZH 3NH7L 5FV1L 3C5ZB 4TULL 4ONFL 4ALAH 1BIIA 1Q9OA 2EXWC 3BKJL 4BSWB 3QISA 5DHVB 1FVDA 4Y19E 4OZGB 4BQ9A 4Y4KA 4EOWH 1MI5A 2F58H 3RFZC 4K94C 2R4SL 1OGTB 3TBYA 1NEZA 2XOTA 1YEEH 4OB5L 1DBJH 1J7VR 1EBAA 1CFSA 3LEYH 5FHBL 4KMTL 4UMGA 4Y1AD 4XHJD 4U1NB 4FQ2L 1XGYL 1E4XH 1QP1A 5K9OA 1T0MA 5IQ9A 1ZLSL 2W0LA 3D25B 3B2VL 2OYPA 5BZWA 4U7KA 4JM4H 2BRRH 3RVVC 4GOSA 2E9BA 5D7SL 2QL1A 3DSFH 3QIBD 1V3LA 3RWFB 4WNQB 4XVSH 4IBLT 4YHLL 2OMBA 1OQXA 1UEYA 3UJJL 4CVXB 4X7SL 5T3ZD 1WFNA 4U6YB 1FL5B 3WIFA 4F7CB 2WZPD 4KKAD 3P3YA 1M7IA 1YY8B 1JNJA 5EO1B 4JFFB 1FG2A 4M1CD 3EO9L 4RAVA 3QRGL 3VWJD 4O4YH 2DBLL 4JAMA 4UB0H 1OLZA 2IPKA 1P4BL 4WU5A 4MNGE 3VFVA 3ARVA 3SGEH 1QKZL 4CNIA 3ARDB 4HWZB 3C60C 5KTEH 2DLGA 2IAMB 3ZKXC 4DWHA 1C8PA 3UC0H 4P5KA 1JGDB 1T5XB 1E4JA 1RU9H 4LNRB 4M3JA 1AD0A 1PVHA 4PRIB 2Z93A 1KJ2A 1L7IL 1R5IA 3SOBL 5A3ID 4FZEL 3TWCL 3VE0B 3L3JA 1P2CB 1GIGH 2X4SB 2NR6C 4HJGA 1P9MC 4P9MH 1FCGA 3KLSA 2EEAA 3CK0L 2PTTB 4ODXB 5DJXB 2DTML 3GHBH 5CGMA 1MRCL 3KLDA 4PBWD 1I7RB 1S7RB 1CLYL 5F6IC 1ZAGA 2VNCA 2HJLA 1DR9A 1NBZA 1OAYL 4RMSA 2VL5B 5TE4L 3QR2A 2ICCA 1N59A 1NGWA 4LMQE 4LEOB 3A6OA 3OL2A 5DLMH 1DSFH 5DO2D 1RUQH 3D39D 1F58L 1MCPH 5IEKA 5EC1B 1DDHB 1JE6A 4NUJA 2ICWA 2WWKO 3CLFL 2ATKB 3EOAB 4KU1A 4B0MM 1UACH 1ED3B 3BPNB 5F7DB 4H20H 4P46B 2DKMA 4TRPL 3Q6FB 4FG6C 1UGNA 2IPUK 2DMBA 2ZSWA 3IDMB 5C0CB 1KB9J 2O5ZL 3C08L 2X10A 3ULVL 4NFBA 5E4EC 3D0VA 1MFCL 8FABA 1OGAA 5JIKA 3VXTB 1LP9B 5E6IA 1U8LA 4WY7L 5DZNA 1TVBA 1CDHA 1M71B 1IE5A 4M1DH 3PABA 4K3DL 1DQDL 1D9KD 2Y1VA 2H1PH 4Y16B 4JFHD 1AGFB 2A83B 3DUSB 2Q8AL 5HDOA 4NNPL 5JHDE 2DQDH 5E8DH 1J0HA 1KCVL 3MXWL 3U7WH 4YZFE 1PD6A 3OF6A 2D7TL 3PWLB 3Q2CA 3UZEA 3U7YH 1I75A 2B1AL 4JB9L 3RX7A 1OQOA 3D2UD 5I1HL 4XI5C 1X5FA 2Q3AA 4G6FB 1T6WA 4PYGA 3QB7C 4WEBL 3GJFA 2OR9H 4JFXB 4X4XA 1NC4B 1JMXA 1XGTB 4OFDA 5IMKA 1FFOB 4DEPC 2HFEA 3CUPA 4FQXD 4YDIH 3VD7A 3HC0A 3NH7H 1CIDA 3OKEA 5DURD 3WJLA 2OJZL 4TULH 3MJ7B 4JE4B 4KKNA 5EZLB 5GGRY 2AV1B 1QEWB 4WI7A 3TEUA 5C08E 3NPSB 3F7VB 2X7LA 2R4SH 4QRPE 5GS0L 4LLMB 5IKCB 4OB5H 4HX1B 4QHKJ 1IARB 3RGVC 2J1KA 1RV6X 5FHBH 4KMTH 4DK6A 3BHBA 2VLRB 4MSWA 2JJSA 4I3RL 1ZLSH 2AJXL 4P4KC 4U33A 1CDYA 1WJ3A 3B2VH 2WWKT 4ZNCD 5HYQB 5FXCH 1IZKA 3F8UB 4BZ2L 5D7SH 3GSNB 2AJ3A 5DD5L 2LFGA 4WO4D 4ZFZB 4X7SH 3VFUA 3ULUE 1J11A 1N7MH 3U2SA 4RWYL 1JGLL 3UTSD 2OLDA 2AV7A 3O8XC 4U49A 5SX4H 3EO9H 4MHHI 1PLGL 3ARBB 3QQNA 4JZOB 1W72A 3QXAA 4NKDA 3GKZA 1Z2KA 2DBLH 4R2GB 1QD0A 4X6FA 1TJHL 1QKZH 5HD8D 1DUZA 4XAKE 1SY6A 2O61B 2OR7A 5I74B 1HHKB 1YEDB 3SGDH 4HWEL 1L7IH 3MLZL 3SOBH 5DQDH 1JL8A 2CIKA 5CWSB 1RZ7L 3BPOB 3ZKSD 4FZEH 5DD3L 5DD6B 3ARFB 3TWCH 4NDMA 1CFTA 1AGDA 1SJHB 5GSRB 5TH2B 5DFVC 1KLGA 5F93C 2NLJA 2DTMH 4WTZA 4P9HC 1MRCH 5C0BA 2E6JA 4EVNB 1CLYH 4HPOH 2NW2A 5IK3A 3ULSB 1OAYH 4GUPA 3O4OC 5TE4H 5CBEA 3VRJA 3K1KC 3ZLQC 5J6GA 1N4XL 3ZKMC 4LSSL 3QFJE 2HA1A 4XZUA 1F58H 4EXPX 7CGTA 5C0JA 2QQKL 3MRFA 5CHNB 4P4RA 2VQUA 3VFMB 5IMOB 4GKNA 5JORA 4IDJL 1A6TA 4TRPH 4M00A 4XVJL 1DQTA 1RAMA 5DUBA 1YNTB 2EDNA 5F97E 4H8WL 3U9UB 4NC0B 2O5ZH 4UNUA 1MQ8A 5DJCB 3C08H 1YPZB 3ULVH 3EHBC 1ZVYA 1QA9A 4OUOA 2YD8A 3SJVB 5ETUB 5INDB 3VXRA 2ZPKL 3DETC 4PLKC 1K8DA 2YN5A 4H1LB 3FO1A 1S7XB 2BSSA 2FZ3B 4JZNB 4WY7H 3SGKA 4GG8A 3W5NA 1JPGB 2J8HA 1DQDH 4D2NA 4LMQI 3QIWA 1NAMA 1W0YT 4IS6A 1PBYA 4JRXB 2IH3B 5TQ0L 4U1JB 3BRDA 4NNPH 3VGAC 4TVSa 4UT9L 3IAGC 1KCVH 1U92A 3MXWH 3BP4A 2A2QT 1MHEA 2FJHA 3FCTB 2UWEE 2D7TH 4NUGL 1VACB 4UIMB 5I1HH 3D6GA 2NTFA 4YFLF 4WEBH 1NAKL 1XGQB 3CMOL 3PWUB 4YFDB 5ADPL 3EFDH 1XH3A 2DIAA 2VC2L 4HKXB 3ULVD 3CGTA 2D7MA 3T8XA 5I71B 4PV9A 3UBXA 2OJZH 4LLDB 4GW1B 1A7RH 1EEYA 1C5DB 3F6IA 4PD4K 5GS1A 5T3ZE 4QRTB 4L29A 3SKNA 5IFAL 4S2SB 3QRFM 3UTZB 4Z7WF 3CFCL 2YMXL 1GAFL 5GS0H 2OZ4L 3QUYC 4XPAL 5DYOA 1UVQA 2W92A 4R0LC 3VGDA 1JNHB 3HE6B 1JK8B 3FJTA 5FOJA 1KB9K 3TF7A 1YEHL 3HR5B 3TJHD 3ME0A 5D7LB 3NIGF 5D71L 1YQ2A 4WI6A 1QUNA 4OD3H 4I3RH 4NZTH 5GGSY 2AJXH 5H2BB 5FB8B 5IB1A 5E94A 3BN9C 5MERB 1JWMA 1RUKH 4BZ2H 2FJGB 1NJ9B 5T1MA 3EJZD 3SE3C 1SYSB 2G5RA 1T1YA 3VGHA 4P3DB 5MEPB 4WI2A 5DD5H 5EO0A 5D7JD 4LLQA 1FORL 3DWTA 5FOBA 1QR1B 2NPLX 5HHOE 5EZIL 3RVWD 3O3DB 4ZOCA 4R3SB 4RWYH 1JGLH 2QBWA 4EDWL 1PLGH 4G8IA 1I7TA 1SJEA 4ZTPL 3C2SA 5GS0D 4YHKH 1JGUL 1TJHH 4Y2DB 1DJSA 2X70B 1HSBB 2V2TB 4LHUG 5HHMD 1EHXA 4OQTA 4H1LG 4HWEH 1S9WA 3MLZH 5ICXB 3DYOA 3EJJX 5DD3H 4V1DD 5K9QI 1U3HA 1YMHA 4S1DC 3BQUC 1ACYH 3EYFA 5D5MA 1UXSA 3S96B 1Q9KA 1AC0A 1DBKH 3LB6C 3NCEB 1I1AD 4CKVX 4X99B 4S1SL 3T4AA 4WI5A 1A7BA 1P5UA 4NP4L 1MLBA 2PYEA 1YECL 2Y7QA 3IVKB 1N4XH 1F4HA 1K5NB 4LSSH 2B2XL 2XWTB 5JO5B 2EDJA 1T7YA 3GRWH 2QQKH 1N5AA 2OL3A 4J3OC 1CG9A 5ELIA 1MFNA 3TZVB 1KIPA 1BFOB 4IDJH 3U46A 2HT3D 5C0DB 2DMKA 2BVPB 3MLUL 3KPSB 4NKOA 4H8WH 4ODUA 1AH1A 1ZVSB 3ILQC 4PGCA 5GIRB 5KVMC 5ADOL 3VJ6B 1HQ4A 1QFWI 4L8CB 4K8RD 4UTBL 2ZPKH 3V5HA 1I85C 3GO1L 5D6DA 4LPUA 3U48A 4Y4HC 2CLRA 3H0TB 1ZMYA 5GZOC 2FX9L 3TBTA 4YHIA 1AO7B 4NRYA 3VG0L 1UZ6E 3CH1B 4OCRL 4M3KB 3WIHA 1DVFC 4PGEA 5TQ0H 3SDXE 4JPWL 3MV9D 1EEUA 5CIPB 3A0OA 4OGAD 4Z7UE 4UT9H 1C7TA 3QDHA 4ELKA 3OAZH 4EN3D 1OSZA 1T3FA 3BZFB 1BBDL 5E5MA 4JFZL 4NUGH 3U0WL 3W9EB 4F33A 4OZIF 4X4MA 5LAXB 1CDIA 4HWNA 4G3YH 5E8PA 5HHNB 2AXJA 2GAZA 1FZKB 1QRNA 4WV1B 1WFUA 3C8KA 1OY3B 4GRMB 3BEWA 1NAKH 1B0WA 3CMOH 4DN3L 5ADPH 1U8PA 4LKCA 3OKYA 1UJ3A 4IOIA 3PP3H 2PO6B 3KNBB 1D5MA 5BXFA 3VWKA 4E41A 3BP5B 4MAYB 4S0UC 3V52L 2BVTA 2IMMA 1K4DB 2VQTA 3P4MA 5FUZL 4L4VD 3BD3A 1CXKA 5JW4N 4P2RB 1UB6B 3CFCH 4U7SA 5BV7L 4OZGF 5L2KA 2YMXH 2ZKHL 2OZ4H 1YMMD 1EXUA 1FCCA 4J4PA 3B5TA 4WUUA 2WW8A 5HGAA 5TDNA 2GUOA 5E8OB 5D96C 4IRJA 3UTTB 4FQQB 2WBJB 4K7PH 3TCXA 4KKCD 4MDJB 2P8PB 2W38A 2CMRL 3QA3A 4XNYH 1BWWA 4PBVC 3HZYB 3VXMA 3QUKB 3L6FA 4L4TD 2WIMA 4JN1L 4MLIA 2ZP0T 4O00A 3QQ4A 1M05A 2IANE 1QLFB 1FORH 5KSVB 1JGDA 5FGSA 1HXMB 2EECA 4PJ9D 3N9GL 4ENEC 1UENA 3GIVB 3KHQA 1A02N 1AC6A 1UM6L 2DLTA 5E5UB 4ZTPH 5D2NB 1T89C 3I84A 2IADA 4ORZC 1JGUH 5SWQA 2WUBL 5T3XD 4WW1B 1NLBL 3CSBA 1I9JL 3TN0C 3LAFA 2DQUL 1FYTD 3DBXB 3GBMH 5ITFB 2YPKA 1QTYT 4HS3B 1JVKA 3QWQB 4F2MA 3RNQA 1KJ2H 1WBZB 1P5VA 4HS6A 4IIQB 1VADB 5J4MA 1R3JB 1E4XI 4MNHB 1L9NA 4PJ5A 1FH5L 4U6VL 7FABH 5TF0A 2Q86A 5DMKB 1T4KA 2DB8A 1G9NC 3H3PL 3IJSA 5E95B 4Z7OE 5C92A 1U2CA 3HCVB 5DJ8A 3BP7A 5BZDB 1G84A 3OGOE 3PNWA 5HYSA 5D72L 3QUZC 5HTSA 5I1JL 1Z9LA 3IDMA 2GK2A 3F62A 3QULA 4NP4H 2GFBB 1J9CT 5J13C 2Y4SA 1YECH 2AKRB 3QO1B 5H94A 4XPHL 1G7HA 2B2XH 3DX9A 4YFEA 3SQOL 3RWEB 5C0AA 3DROA 2EO1A 2R1WB 3P9MB 3S36X 4GG6A 2XTJB 1E6OL 5F9OL 4KTEL 4M43L 3OGCA 1L9MA 4G42B 3GSVB 3MLTA 2CRMA 2J8OA 4HD9A 3X11A 3FRUA 3KPMB 3GNML 2MJWA 3E8UL 5EWIL 4Y5VC 5C0IA 3JXAA 1IAMA 3MFGB 2NY1B 3RZCB 4F3FB 1X5IA 5D1QA 2V9QA 4JM2B 3ABZA 3ES6B 4NQUA 5ADOH 43C9A 2CDGB 2Z8SA 1BJ1J 4YEFA 3MRMB 1ZVHA 4KKBD 3BMWA 3FFCB 4N8PA 2FX9H 3QZWA 3NVQA 4DZBA 1LP9F 3TA3D 5H8DA 3L3HB 3GSWA 2R1XB 3VG0H 4AIZA 4OCRH 2G9HA 1L7TH 3T0ED 2BJML 5DJZB 3ESVF 4JPWH 3AY4C 4BFGA 4PJAA 2OXHA 4D0DB 2N1KA 3EYVA 1G7MB 3V7AG 1I9IL 4F57H 3R0NA 1OVZA 4JFZH 1A6ZB 1INQB 4ZS7L 2WIIA 2OTUB 3U0WH 1XGUB 4UQ3B 5EBLB 1CFNB 5LXGL 5EBWA 1QHPA 4XNUL 3TPUA 3P77A 3O81A 2WP3O 2XKNA 1KG0B 4YHPA 1YEGL 1U9KA 4DN3H 1UFUA 2ZSVA 3O45B 1NPUA 4XWOD 3FQUB 1VFBB 2I60L 3R8QA 5HGHB 3F12B 4I0PA 3FQTA 4R9HA 4ZUUB 1QR4A 1IC1A 4NQCB 4PLOB 3V52H 2UUDK 3TO2A 2EDHA 4Z76B 1TITA 1HSAA 1NGZB 1YDPB 2GTWB 4PG2C 4MXQD 5HGBB 1CQYA 5BV7H 4RGMB 1MPAL 5J1SC 4MX7B 3FB5B 4HUUA 3GMLB 1A6AA 4N0UE 4J1UA 3F7YA 3DPBA 5B3JF 1P84J 3DJ9A 1XCTB 2MCPL 3RL2A 5GRUH 4JLRB 5DSCB 3JUZA 2X9YA 1CGWA 1K2DB 5EC2B 2F54B 5HHME 3UTQA 1RUML 2CMRH 1JZ4A 4ZSOB 3DVIA 2Z4QA 1IGML 4GAYB 4X8XA 3PL6D 5HJ3B 1TQCB 4KXZH 2C3VB 5LBSL 2NY6C 3IDJB 4HG4J 3B9EA 1YEDA 3QNYB 3N9GH 1KLFA 1NBYB 5D7KE 4RSVA 4RGNE 4PJBB 3SDCB 2AJUL 5FCSH 3BIKA 3CSYB 5GSRA 3R8BB 1JHLL 1UM6H 3D3VB 1W72H 4G9FB 4HV8B 2A6DA 2BSRB 1C5CL 1UA6L 3HNVH 5BRZD 5EN2B 1VCAA 2WUBH 3VFSA 1MY5A 1QNZH 4NM4H 5D1XA 4CGTA 5HYFA 1IGIH 3RPIB 1I1YA 2DQUH 1ZANL 4P57B 4MJID 5HYJA 4OFIA 1UEMA 1YEIL 3GFUA 1CLZL 1PY4A 4U6VH 3EGSB 3V4PL 1TDQA 5AWNL 4L8DB 4XCEB 3O3BA 4WU7A 3BH8A 3JTTB 3H3PH 2AEWA 3NA9L 1U36A 2X5PA 4LEXL 3O9WB 5C70A 4JFPA 2OTPA 2WP3T 5I1JH 1AGEA 4H0HB 1I8MB 3OAYH 5I15H 4XPHH 4CMMB 4P2QA 3SQOH 1RK1A 4N5ED 1EDQA 1R3HA 2A6IB 5D9SB 4UDTB 3RTQC 1Z9MA 3PWNA 3NA4A 4HPYL 1E6OH 2IBZY 4KTEH 4Z95H 5FAAA 3TLRA 1ZGLB 1VGKA 2HN7A 1KN2L 1ZHBA 4M43H 2EH7L 3K8LA 4PJ7B 1QSFA 3GNMH 3CFEB 3C5SA 5EWIH 3L5WB 2JKXA 3OPZL 4NRZB 1REIA 2SEBB 3SGDI 2NY0B 4PJ8B 2KL6A 3LKRB 1MCDA 2FL5B 4UUJB 4LNVA 1YPZF 3KPQA 2H32A 4WFED 3KVQA 2VDPH 2X4QB 4PB0H 5DMGC 4IMKA 4ZNEA 4IRSB 1MFDL 4KJYB 4RDQF 2IGFL 3LN5B 5IOPA 4D9RE 3BWAA 3HG1A 3P73A 1FNFA 1NFDE 2BJMH 4NNYB 3SY0B 5I1AB 3C6LB 3HZVA 2AERT 1YMME 4ZFFA 2F53A 4V2BA 3VFGL 1I9IH 1KTRL 3PHOA 4U1SA 1X3DA 4QY8B 1JNLL 4XX1G 3MNWA 4ZS7H 2K7PA 3MRPB 3TBSB 3EDDA 4JFEB 3E6HB 2OR8A 3RVXC 3B4NA 2X89D 5LXGH 4XNUH 4I5BB 5L2JB 4FTVB 4GS7C 5DRNA 2H2PC 2OSLA 3QEQB 2NY5C 1YEGH 4ELMB 5JW3L 5F7FA 1OL0A 1TJGL 4FA8A 4RAHA 2I60H 5K33A 3FQRA 4WCYL 1HN1A 2V5RA 5D7LA 1JHTA 5BS0D 4MJ5A 3L7FB 3MV7D 3EYOA 4C56E 3TFKA 4HWUA 4HUVB 1A3LL 4PDCE 4QWWD 1N5YL 3KPLA 4M03A 1MPAH 1WGOA 3QAZB 1MI5E 4PG9A 4G7VL 1OTUC 1JZ2A 4UOW1 2EYSB 3H2WA 4KDTC 2MCPH 2D3VA 2OP4L 4RWHA 2Q7NA 1K8IA 1G7JA 5EZJB 2VB5A 2Q7YB 1FYTE 2X4RB 4P5TB 5D4QA 5IROA 3U36A 4L3EB 5J6HB 3QH3A 4TVPE 4YIQB 1RUMH 5AUMB 3P4OA 3ARUA 2YSSB 2EC9U 1IGMH 1S7VB 4JZJA 1VFUA 2OI9A 2MWCA 2VXQL 4Y2DA 5CJ5A 1H15B 4X5XB 2YC1B 1KYOK 3AREA 3CDGB 5KVEL 5LBSH 5TPWH 3VXOA 5TE7L 1RZJC 3GSRA 1WT5C 5MHSD 1T0NB 3CVHB 4M7ZB 4OKVB 5IG7A 2FO1A 1UWGL 4OI9A 4CBPA 4F8TA 5I1DB 4DKAA 2O93L 3LS4H 1FAKT 5ACZB 1EFXB 1C5CH 4HZLB 1H8NA 1F6LL 1AXSA 1VEMA 2VZTA 3MR9B 1N8ZA 1NLDL 2V2XA 4GRLD 4RFEA 1FNGA 3T09A 1ZANH 5ECJE 2FB4L 2C5DC 4IRZH 4UOW0 1WISA 1AGCB 4OQTH 1YEIH 1MFAH 2XZAL 3RDTB 4CN6A 3OKLB 3V4PH 1ZA3B 4XNQB 1WAAF 5AWNH 2R2CA 3DMMD 3O2DL 4WEMB 3B5GA 3BPLB 3NA9H 2EDBA 4LEXH 4R96B 3LKNA 2ZOLA 5I75B 2VLLB 1A6PA 3FZUD 1OM3L 3BAEL 1JF1B 3DXAA 3SDDA 2HVKB 5T5FH 1P84K 4X6BA 4PTUA 1JZ3A 4IOFC 4F9PC 1FGNL 3DTXA 1WSST 2VLMD 4MVBC 3B9KA 4HPYH 5C0ND 5EOCJ 1JUFA 2Y5TA 2HLAB 4M4PA 1CL7H 2EH7H 2A73B 1YY9C 4HK0B 2IQAA 3H7BB 3VFPB 1GSMA 4W4NA 3TIEA 5I1CL 1XIWA 5BVPL 4JDTL 1U8MB 1VENA 3OPZH 1DQQA 4ZUTA 1R3KA 1IGJA 1JPSL 3R06A 1EZVY 5IM7A 2A6JA 4QRRD 5IB2A 1T1ZB 1MCHA 3QJFB 4DUXA 2YPLA 5IFJA 2VXTL 3HA0A 1ZLWK 1OGAE 3GEWB 1A64A 4XP9L 3KXFB 1AR1D 5HHNA 1QO3B 2FH8A 1KIQA 1MFDH 4UBDC 3VFNA 3SCMB 4B7LA 1FZOA 4RQQB 1RZKC 5E8NB 1PZ5A 3FONB 3ZT7A 4NRXB 3M17B 3CX2A 1YN7B 3T0AA 1TVDA 5E1AB 5J89A 3GB7B 4J6RL 4RZCB 1MRFL 3KLAB 3VFGH 4LQFH 4ZXBA 1KEGH 5DHVH 5F6HJ 4LCYA 4KJWC 5HDQL 1ES0A 4OCMC 5F7NC 3ZT5A 5C2BH 3AVEA 2OS7A 4XPFL 4FXKB 2CUHA 3T77B 5JW3H 2M1KA 1O7VA 4WW2B 3G6AB 1MWAB 1NUNB 3P40A 3NCCB 1BD2B 3QI9A 2HP4A 3MQIA 5EOTB 4EUPA 1QOKA 3U4EB 3QDGD 2Z8VC 3K2UL 3OR6A 4JY5L 4JRWA 5EOQH 3MRBB 4BH8B 2R9HD 2E7HA 2F19L 4P2OA 1LEGA 3EO1A 4BA8A 1U8JA 2VZOA 3MLPA 2ICEA 3L3OB 4RISL 4DKDC 5JMRA 1N3NA 4U6XB 3GSNL 2H9GB 4G6AC 5B8CB 3MUZ1 4TNWK 5KVGH 2HRPL 4G7VH 2AEIT 2XA8L 4G5ZL 3TT3H 3C5ZD 5GRWA 1P7QB 4MJIE 3P4LA 3TVMB 3GIVA 4NN6B 3FO9A 3GMPB 2HAZA 5ID0A 1HCFX 4LPVA 3PE9A 4MZ3A 4Y4FA 3WNPA 1IM9A 2I9TB 2WBWB 2ZCHL 2X4OA 5F1OB 3DUHA 2VXQH 4OFPA 1BOGB 1CLCA 1I8KB 3ZHDA 4JFYA 4PS4L 1LO4H 3G6JA 1KCRH 4HUXB 5KVEH 3BZEA 2H8PB 4I77L 5DFWH 5TE7H 3ZE1F 2Q3ZA 4PJGA 2UZYB 3SDAC 1WBZA 4Z5RB 5DUMH 2VOTA 5JOEA 2QLVB 4D3CH 1UWGH 4LPXA 3G6DL 5IR1A 5CAYB 2CLZA 3ZE2E 1VSCA 3AMKA 1DFBL 3S9DB 4AEHL 1DUYA 1KJVB 3TYGH 3CDFA 1LE5B 1C5BL 1A2YA 3JV6A 1NLDH 3CXHJ 5CSBA 1PYWB 1Y6NR 4NM8L 2VE6A 3VFOA 4HULB 2ZUVA 3MRIA 5HVHC 2XZAH 3WD5L 1T83C 2R69L 3MRNB 4PJGF 4H88H 4KHTH 5JPNA 4JFFD 2K3TA 3QDMB 1FNEB 1ULVA 2EDKA 3O2DH 1T2QH 5I1GL 3AB0C 5F9WC 4OLVL 2G5BA 4ZO9A 3S34H 1DLHA 3ARDD 1HOCA 2IAMD 1OM3H 2L4OA 3BAEH 3X13B 4PRID 2PTUA 3P4NA 5C0BE 4ZD3L 1HYRC 2IBBA 2V7NB 1SYVA 4MS8D 3BI9X 4TUJA 3BRGC 4LVHB 2YRZA 3PGDB 1S8DA 2M8XA 1FGNH 3RVUD 5JNYA 4Y19B 2CIIA 2BVOA 4OF3A 2RBLA 3FFCA 2PR4L 3FTGA 5KG9A 3KG5A 3N85L 2AGJL 3HE7C 3QXUA 2AXFB 5BVPH 4LFHG 5I1CH 4JDTH 3I50H 4M93C 1N6VA 3E3QA 1MFBH 4HBQA 1J18A 1I9RL 4LKXA 5ENWB 3RWHB 1FRGL 4U1HB 2NXYB 1CK0L 1WF5A 2Y07L 4UV7H 4JM2F 2GY7B 2VN4A 2VXTH 4XH2A 4WFHE 3V0WL 2E7LA 5HPMB 1J0YA 5EBLA 1WFOA 5BS0E 5CEZE 3IKCB 2CO7B 4P46D 3DRTB 4D9QD 5F1IB 5C0CD 2CPCA 3NCJL 4L8SC 3WUWA 1EUTA 4KY1L 3X12B 4KK9C 4W4OA 4FABL 1A3RL 3CU1A 4XPTL 2ITCB 1UQSB 2P5EA 1MRFH 4ZUUA 4XAWL 5GISL 4EI5B 2ICWI 12E8L 1CFVH 2HT4C 3LS5L 4PGBA 4Z76A 4KMLB 4DCQA 2NZ9D 3IFOA 5F88B 1FL3B 4Y16D 2ZG3A 4NYLB 3MNVA 4XPFH 5GGSB 2R1YB 4MNGB 3GMLA 1XMWA 3X3FL 3HMXL 2Z9TA 2FLRT 1SHMA 3BH9B 3KHOA 2P7TA 5GSVB 1F3DJ 5CFHA 1MCBA 1CVRA 2VERN 5IV2B 3VRLF 2B8OT 3MFFB 1IKNC 3NIGE 5J1AA 5JXAL 1UCBL 5I8OL 4JY5H 3WMSA 1EBPA 2WY3A 2F19H 4Z9KB 3MODL 2FYYB 4BK4A 5MHSE 3IF1B 4NN5B 4HIHA 4G6FD 1RJLB 2GJZB 4LLWA 4RISH 3RWJA 2YEZB 3QUXA 3VFTA 5I6XB 3GSNH 3IDGB 2EE2A 2DQFB 5C0GA 4RBPK 3VXNB 5F7UA 2HRPH 1NC4D 3NOIA 4LCUA 4XXDB 1HDMB 2XA8H 2VAAA 2AQ2A 2CRIA 5I8KL 3DURA 2VSCA 3H9HA 4G5ZH 3BO8A 3SGJA 1XR9A 4RAUA 4PJIA 4ORGB 1JFQL 5C71A 3CSYA 3VXSA 4Z77B 1KIRA 2FEDD 3C09C 2QSTA 4Y2OA 5J7CC 5D70L 4PS4H 3W11C 2C3GA 4I77H 2FIKA 3FRPA 3C2AH 3TCLA 3PQYA 2VLRD 4M5YL 1LE9B 1OF2A 1UKSA 3QHFL 1NDMA 1ZHKA 3ARGB 1UWXK 1DFBH 4I0KA 5C6WH 4AEHH 2OK0L 4MDIB 3G5VA 2R0WL 4Q6IA 4E9LA 1CT8B 2O26U 4GSDL 4PJBF 1JWSB 1C5BH 4BELD 3E2HB 3L3GB 4MHHG 1EVTC 1Y18A 4MQTB 4YHZL 1QFHA 4NM8H 1OW0C 2QKIA 4M8VA 5JHDB 3V6OA 3WD5H 2R69H 4XNZC 4L4JA 1T66D 5IVZB 4KK8D 3NFSL 2RIKA 3ARBD 2VABA 1I9EA 2LTQC 5T1KB 4XHJC 2CXKA 1CD1B 4DZ8B 4OLVH 4R2GD 3SQBA 5IIEB 3WS3A 1A14L 4E5XA 2XRAL 3N1FC 4KXZI 5C0FA 4XP4L 5FA4A 4NQDB 1X5YA 1G9MC 3QIBC 4OSUL 4ZD3H 1LK2B 3FB7A 1BBJA 3SE4A 2P8LA 1NCCL 2PYEE 3ARFD 32C2A 3O6LL 2H26A 2Q8BL 1CN4A 4ZO6A 4KKAC 1CE1H 2PR4H 4YPJA 3N85H 2AGJH 3JTSB 4NKIL 1ZA6A 5C08B 4M1CC 2MSPA 4G59A 1YEJL 4G8FB 1A9EA 4P48A 3VWJC 3PWPA 4ISVB 4PJ7F 5T1LB 5BJTA 4BM7A 1YQVL 1I3VA 3IS1X 1FRGH 3SO3C 1ZGLM 4I1NB 1ZTXL 1YYML 4OI8A 4MCYA 3KPNA 5DRXA 5A3IC 4C54A 3TBSA 3QNXA 1QQDA 3V4VH 5IJVA 2BY3A 1HH9A 4PP1D 4XMPL 3NCJH 4WHDA 4W6WB 2BVUA 4MD0A 1RULL 4KY1H 5DDHB 4FABH 1A3RH 4XPTH 3SJVD 4ZPTA 1CICB 3WLWD 1SEQL 2PXYB 3O0RL 2CH8A 2VLJB 3T2NH 4OF0A 4XAWH 12E8H 3LS5H 1XCQA 1M6OB 3JV0A 5DO2C 1D3CA 5MEOA 1AXTH 1J1PL 1SM3L 3QCTL 4C4KO 1RMFH 4Y5XB 3TESA 4JRXD 3IXAB 4X4ME 2X40A 3BD4A 2BOBA 1QRNE 2R2HB 3X3FH 4BFIA 3HMXH 4PRPA 4ELMF 3Q5OA 1F6FB 1CXIA 4PTTB 4PJEA 1JPFB 1T1WB 1UCBH 5I8OH 5DRWA 5IW6B 5LGJB 2Q7YA 3TO4B 3FT4A 4YFLI 5IJKC 3HI6L 4E41E 2EDDA 3QQ3B 3UTOA 3SBWC 4I48A 2HYMA 1VEPA 1OB1B 3MRHA 5LGHL 2V2WB 1IKFH 4WI8A 2VXVL 5L2KE 1D9KC 1RK0A 5D1ZA 3JWDL 5I8KH 1C12B 1I7UB 1IC5L 3GUTB 3CVHA 3DV6B 1MJ8L 2JCCB 5F89A 1QPPA 1JFQH 2BNUB 5TF1L 4P23B 4TSBL 1O0VA 4G6KL 2HG5A 1FPTL 4FQCL 1VERA 3RNKA 3HE6D 1AKJB 5D70H 5H37H 2Y72A 1U8IB 2ZNWA 4JFDA 5IB5A 4PRBB 4PP8C 2HT2D 3FOLB 3JVGA 4H26B 3FN3A 3CFDA 2OJEA 4FFZH 3KJ4B 3P0YL 4FQXC 4X6EA 1CGUA 2OK0H 5DVOA 2R0WH 1D6EB 1X4ZA 3BVNB 4GSDH 3BYTA 2NMSA 5L8JB 4JR9L 4G8EB 4JQXC 1LEKB 3U6RA 2FD6L 3GJEA 4YHZH 3STZB 4ZOBA 2YD7A 4MNQB 3DRQA 4NQVA 3BXNA 3QG6A 1ACZA 5D6CB 2CK0H 2LVCA 4XRCB 5AEAA 3S35X 1R5WA 2HFTA 5A16B 3NFSH 5I76B 3IRZA 4PJ5E 4C4KT 1ORSB 1MHHA 5K9QG 1J8KA 2B4CL 1E4WH 3IB4A 2XRAH 3DLQR 3C8DA 4XP4H 2APVA 5IB3B 3HLAB 1DANT 1FL6A 1RZFL 4JHBA 4ZFGL 2P8MA 4JKPL 2VR5A 1NCCH 4YJZL 1DEDA 1F11B 1MIEL 4WO4C 3O6LH 5DJAB 2Y36H 1AGBA 2Q8BH 3QEHB 3PDDA 4KZDL 4QT5B 5BVJA 1DZBA 3MLRH 3LH2L 2ATPA 2QSQA 3WFZA 5C0AE 2I26N 2BXYA 4LCCC 3CNKA 3BJLA 3DX7A 4NKIH 2XQBL 4UAOC 3HPLB 3IDIB 1YEJH 3OB8A 4JDZB 2R23B 2V9RA 3FONA 4O2EB 2FATL 4DFIA 5CIPH 5GPRA 2DWDB 1YQVH 4QRUB 4HWBA 2FWOB 4X8JB 5HD8C 1GGUA 2ESVA 3M1BB 1ZTXH 1YYMH 1I1FB 2K9UA 1FIEA 3PV6B 4NOFA 3TZVD 5FM5M 4OCLC 5E24E 4BK5A 4I18A 4WWKC 4QYOB 3KR3H 3KPSD 3NFNB 4XMPH 3ZZ1A 4K9EL 4MA7L 1RULH 2EYTA 2GQHA 2PYFB 4X4YB 1KCSL 4AZ8A 3DYPA 1SEQH 2XWBB 3O0RH 3QFDB 3HAEB 5HHOB 2NW3A 5EU7E 1ADQA 1K4CB 4NNXA 3RY6C 5HHPB 1EHAA 1J1PH 1OP5H 1CL7I 1SM3H 3QCTH 1AO7D 2XZQL 2P5WA 1ERNA 5EU4A 5DQJB 2G2RA 4CW1A 3QDJB 4GT7A 4QOKD 4AJ0A 5DHYA 5KSAB 3K1DA 4OCSL 3PJSA 3TV3H 5FV2A 5B3JE 3QXVA 3RWCB 3X14B 2QQLH 4OZFG 4WW2F 3TPKA 1RY7B 4EUPH 1U91B 2NY4B 1A6WL 2B5IC 5SWSA 3MNZB 4UU9B 4HFWA 1W0WA 4WIQA 2ZCLL 3HI6H 4HLZH 2UV3A 1BQUA 2VLRE 2E27L 4Q9CA 5KVFL 2Z35A 5LGHH 3ZDZF 5IVXA 4JG0L 1P4LB 3FFDA 2PO6D 1BJ1H 4Z7VA 4HK3J 5E2WL 1IC5H 4LHJB 5AG8A 4WI4A 4MAYD 1R5VA 3MBEA 3SKJL 5JXEA 4RMWA 4YNYA 4DGIL 1MJ8H 5AD0B 1U3JA 5FK9B 1HXYB 1XF1A 1M7DA 4KRPB 4P2RD 4Q58C 4HIIB 2CR3A 4TSBH 4N0CA 5CD3A 5FO9B 2R2EA 4G6KH 1FPTH 4AIOA 4MB3A 1KNOA 3N1QC 2QQNH 2JB6B 5JDSB 2GHWB 1T22A 1BX2B 1KPVB 1KGCD 4JKMA 1TZGL 3ALWA 4L3CA 2D7PA 3KJ6H 4OLXL 2IH1B 3UTTD 1JHKL 2WBJD 2DQTL 2XN9A 4JREB 5GJSL 3ULVC 5KOMC 3FT3A 1DE4B 1DEEB 1FNEA 3S5LG 3T65B 3PHQA 3IKKA 5EA0L 3BISA 2FJFA 4QRSA 2FD6H 3IGAB 3SDXB 4LDEB 2BCKA 4Z7UB 2YRLA 4PRAA 3B9DA 5HYJE 2ORBL 4WHTB 4JRYA 5B3NA 3QEUA 5DUPL 1H3PH 1TPXB 3G04A 4RMTA 1FO0A 1X4XA 1FSKB 4RFOH 3BGFB 1EGJL 4KTYA 1IQWL 3HAEG 4NSKA 2ZWLT 4YC2C 1G7IB 4ZFGH 4JKPH 5HHQA 3MO1B 3VA2C 4G6JL 5J06A 1MIEH 4P99A 1S7QB 5D7JC 2P44B 3QEGL 5B21A 4P2QE 3F5WA 3SJVE 2HJFB 5DXWA 3RVWC 2JIXB 1HHJB 2GT9A 1BVKA 5TGBA 5JOPE 3UPRA 1C16B 4QLRA 2FATH 5GS0C 1MIMH 5C07B 2IPTL 4NQEA 1BQHB 1GOHA 3UTPE 3UZVB 3S3JA 2LAGB 1I8LC 4F7TB 1OP3K 1XR8A 2BY0A 2XTJD 3D85B 4QHKI 3RGHA 3VH8B 3RUGB 5E6ZA 3UPAA 2VZUA 2YUVA 4CVZB 1SBSH 1ZT7B 4DUVA 2VJXA 4K9EH 3I02B 3RZCD 2NY1D 4J3TA 4ZUSB 3V0AC 1A7NL 1KCSH 4JM2D 1I1AC 3I6KA 2IANB 5FDWB 2AK4B 5C9JB 4U1KB 4QNPF 4PJCA 4TNVK 1GZPA 4KI5F 2F53E 4AEFA 1A21A 3O4LB 5J1TC 1J0IA 1FZMB 3WDHA 1RVFH 2V5TA 5EU3A 1OP9A 5CZVL 2YEZA 4LSUL 4XCYB 1A1MB 3O6FB 4LSPL 3H7LA 5IHBA 5IHZA 3DNKA 4OV5A 2CDFA 5DD1L 4OCSH 1LILA 3C60A 4FS0A 5EU6B 3BD5A 1KPUA 2HT3C 3OKDB 2JJVA 4K71C 1A6WH 3FB6A 3OMZA 2NZIA 2C1OB 4Q97A 5D7LE 2ZCLH 4RX4A 2DYPA 1KTDB 3ARZA 1J86A 2E27H 3KYNA 1P9MA 2FO4B 2OQJB 5FYKL 5HGGS 4AENA 3FN0L 4GKSA 5KVFH 2CSPA 3AAZB 5DEZA 5IESL 3NMEA 3DGGB 4JG0H 5B38B 5F9DC 4LF3A 4QHUA 5CEXA 1H5BB 4XBPB 3JUYA 5A2LH 4F9LC 5E2WH 1TCRB 4NQCD 3SKJH 3CVHL 1HKLL 3DX6A 4YAQA 2JK5A 4DGIH 3TYFA 5CSGA 4OGAC 4EKXA 1U8NA 4JJ5A 4AMKL 4EN3C 1U8QA 5KSUB 4OFYD 3MJ8A 3L3DA 4WI9A 4ZDHB 4YK4B 4BQCA 1WICA 3KPPA 1UZ8A 3WNNA 1TZGH 2D0GA 3RWGA 2QV2A 3D1MC 4OLXH 4H8WC 4LHUA 2COQA 4M8QB 1JHKH 2DQTH 5IVZA 2F54D 2WWMD 3O41B 3C8HA 4HAFA 3LSOB 5ESQB 5T1KA 4IMLA 4YPGA 4HFUL 5EA0H 2CQVA 2XACC 2IFFL 3MOAH 1PG7X 4L1DA 1PZUB 5E2VL 4NC1C 2MHAA 3BPCA 2EZ0D 5FO8A 1TZIA 5CZXD 1FVEA 2VZ3A 5DFTA 3OWEA 3WN5C 3SDCD 3VH8G 3NZ8B 1T5WB 2ARJA 5GGUA 5DUPH 3B3IB 3D3VD 2KBGA 3OJMB 4G43B 4G9FD 5TDPB 5IMMB 3QCVL 4Q9RL 4PPTA 4U1MB 4N0FA 3SPVA 2D9QB 4PRDA 2VDRH 4ONHA 4LSDA 4KKCC 5CP3A 3OR7A 3FHAA 1A4KB 1PY9A 3EJYD 4N90D 1JYVA 1EGJH 1IQWH 2R8SL 4M7JH 3KPSE 2JB5L 4G6JH 3DXAE 5GRJH 2FHCA 5KSBA 3MRGB 1IAIL 3ARPA 1UB5B 4LVNC 5DJDA 3T2PA 4HUKB 1NUFA 3O9WD 4PJ9C 2Y6SD 5JA9A 4X9BA 2AEQH 4G8GA 2BHYA 3C6SA 4NC2B 4D9LL 1S7TB 3L5XH 4GXVL 4OGYL 3LKPA 3RGVA 1AO7E 2IPTH 3EOBA 4B53A 4RRPG 4N0UB 3CCHA 4U3HA 1XF3A 4U1LA 4ZOEA 2BNRA 5E70A 3O3EB 5FKAB 2VLJA 4ZAKB 2D4DA 2BNQA 5E9DA 3U9PL 1GGBH 3UYPA 4P4KA 5GS3A 4D0CA 2DJ4A 3GIZL 3L95A 2NY0D 1MWAL 4NOBA 4PJ8D 1F3RB 1P1ZA 4NZRL 3WO4B 4BSVA 1QSEB 3NN8B 1JPFA 3G5ZB 1XGPB 2P49B 3ULUF 1O7SA 3O11A 4IRSD 4RGNB 3O8XA 4NQXB 1JF5A 2IALA 4CJ1A 3I6GA 1MLCA 5CZVH 5MENB 3VW3L 4ZTOL 1A9BB 2GTZB 4GBXB 4LARL 4OZHA 3U4AA 5KZCB 4LSPH 1MCWM 3QWOA 3C6LD 4WI3A 1LDPL 3Q5TA 5DD1H 1T7VA 4B5EA 1JGVH 4AM0B 1C12A 3QIUB 4JANA 5IF0B 3M45A 2W07A 4G9DA 2PW2A 1ND0B 2X4TA 1BVLB 1BM3L 1KGCE 1T1XA 4JFED 3NFPB 3FL7A 5EBGA 1FFQA 4M6MH 3UTTE 2VRAA 4FTVD 4XGZA 3W9DA 4APQB 1B2WL 5FYKH 3QEQD 3FN0H 1YJDL 2P24B 3VDAA 5IESH 4KKBC 1JTOA 3V6ZA 1JCKA 2VLKB 3TA3C 4X80L 4EI6A 5DK2A 3AS2A 3IFLL 1UWEH 5IHUL 4U3CA 1BHGA 3WDIA 3T0EC 3CVHH 1RZJL 4JY4A 1HKLH 2Z31B 3IAQA 3QNZA 5DJYA 1QFWM 1U6AL 2Z91A 5ALBL 5HY9A 4AMKH 4MQXD 3MCG1 2JCCF 1FV1A 1NC2B 4I13B 3ARQA 2BHZA 2AAVA 1CGXA 1U8HA 3MLYL 5K9KB 1FC2D 1QLRA 2FIRT 3D9AL 1PSKL 4FQHB 1FG9C 3MLWH 3EDKA 4P5TD 3B6SA 1FAIL 4L3ED 4XWOC 4PJGE 4OGXL 4YBHA 5FM8A 1ZK9A 4LSRL 3D0LB 4X0KA 5EUKA 4HFUH 5FYKD 2IFFH 3B2UD 1AHWC 2F15A 3K80A 4KGJA 5F3BB 2HLFD 3L9RA 2RFXA 3B5HA 4MXQC 1NFDB 5FGCB 3UCRA 4CU6A 3VCLB 4I4WA 4OUUA 1WBXB 5DJAA 1F02I 4KFZC 4D0BA 4QXTA 3RWIB 2DM2A 1EFXD 3NAAL 3QCVH 5ESAA 4Q9RH 2X1OA 3L3IB 3VI3F 2JJTC 4PJHB 4WFFD 3MGAA 2XFXA 4PIRF 1Z5LB 1IGYA 1NCTA 2E5EA 4R97C 4NKMB 3FQNB 5KOVC 3RL1B 4N68A 2R8SH 3RDTD 3PL6C 2JB5H 3ZDYF 3MBXL 2BOCA 3HPJB 1IAIH 4PR5A 5HGDA 4JCLA 1NGYA 3WJLC 4CUCA 1GCFA 4C56B 2VTFA 1JJUA 1ZT4A 2AQ1A 3KPRA 2UZIL 3CFIC 1BIIB 1Q9OB 4TQEL 5JUEL 4U0RC 4LLYA 1H8SA 1FVDB 4D9LH 3FFCE 4Y4KB 4POUB 3QUYA 4GXVH 4OGYH 5BV7C 1MI5B 4R0LA 4LVOC 2AJZA 3V9FA 3TBYB 3SHSA 1NEZB 3LQZA 5L7XL 4KJQD 3E3QE 2JF1A 2GJ6A 4LAQL 3S6CA 1CFSB 2IBGA 3KS0H 2UVEA 3U9PH 4GMTL 3OB0K 3HUJA 5CGYD 2E7LE 4JY6A 5K9OB 1T0MB 5IQ9B 5BZWB 3GIZH 4KROB 3VRIA 4HQQL 2J5LB 3AROA 1MWAH 3ZYIA 2IBZX 5GRYA 3VRLE 4ZS6D 4FXGB 3MNZA 3KXFD 3WIFB 2C26A 4N5EC 3LVEA 1M7IB 3SCMD 4GW4A 3NIFE 3VW3H 4ZTOH 4BYHA 1FG2B 4LARH 4RAVB 3SDYL 2IFGA 5H35A 4RFNB 1WBYA 1LDPH 4UQ2A 4JAMB 4WU5B 2IPKB 3VFVB 2XZZA 2X4NA 4CNIB 3NABL 2AXHA 3T1FA 2D31A 3K7UA 5J9PA 1BM3H 2CDEA 1MOEA 4P5KB 5I1EL 1KJ3L 1AD0B 2Z93B 1KJ2B 1R5IB 5SX5K 1KF9B 2VITA 1ZS8A 3BQUA 2W91A 4M6OL 1B2WH 3L3JB 1YJDH 2F5BL 2F8VA 1BZ9A 2QJDA 4HJGB 3ROOA 3V5KA 3TNMA 2A6KA 4KK6D 1BD2D 1G0DA 4EIGB 3IFLH 2CO6B 1T04A 2DM3A 4NBYB 2ZZUT 4EXKA 2ZUQB 3O3AB 2HJLB 5CS7A 3S4SG 3V4UL 1NBZB 1F8TL 1N59B 1NGWB 2CKNA 3BKCL 5ALBH 1INDL 4OF6A 4PJIE 3OZ9L 3E6FA 1KXQE 5IEKB 1MJJA 4YR6A 4NUJB 3VXSE 3SE8L 5C0RL 3OKNA 3MLYH 5I8CA 4I2XA 2ERJB 3D9AH 1PSKH 1J0JA 4DW2L 2ZSWB 4HKBA 1IC7L 1P7QD 1FAIH 2H6PA 3TVMD 4FQIL 4N90E 3PQYE 4LSRH 1I85A 1UKTA 4PRNA 3D0VB 8FABB 1OGAB 1WWBX 2AK1L 4KQ3L 2R56H 3HNSL 3I75A 4Y4HA 3MV11 1E27A 5E6IB 1U8LB 3WFDL 1FGVL 3UMTA 1TVBB 3MRQA 2J3SA 3GGWA 3TBWA 4QWWC 4IOSD 1DVFA 2A9ML 5I0DA 1UZ6F 1NQBA 2C3XA 1U8KA 1YNKL 5LWYL 4Z7UF 3V6OE 3MREA 3NAAH 5A2IH 4NN7C 1HHGA 3AXLA 1DL7L 1IEAA 1N6UA 1XGRA 4XCCL 1CFQA 5DA4A 4PJ7E 5AZ2L 3VXPB 1VFOA 3GJFB 3K0WA 3MBXH 3QDMD 4X4XB 5J11B 4KRMB 5IMKB 4KWUA 4MAUL 2HFEB 1EIBA 3CUPB 4XB8A 3REVA 5ISZA 3HC0B 3OKEB 2X1PA 4XPGL 1AIFB 2ARJQ 3RUGA 3H9YA 3N0PB 4TQEH 5DZOA 3TC9A 1ZT1A 4CVZA 5JUEH 4F7MA 4OZ4B 4O58L 1MNUL 1ZOXA 5J12C 2X7LB 2UY7A 1TMCA 5GGVH 1EJOL 3STLA 5L7XH 3PWPE 3ULUL 4XVUD 3S36H 4LAQH 4XBEL 3TNNA 4Y19D 1RZ8A 4GMTH 1T7XA 3BHBB 1FZMA 2BK8A 4L9LC 4MSWB 4OBRA 1TJIL 3RUGF 5T5NF 2YXMA 2X1XR 1J05A 1J8HA 1Q9WA 4FTVE 4HQQH 5BW7C 1RHFA 3DECA 3UP1A 1NMAL 4LBEA 1ZLVH 2EDTA 3QEQE 5EU6A 3MA7A 2NXYD 3AS3A 3PWVA 2AJ3B 1FDLL 3FZUC 4X4ZA 5GRXG 1XF4A 4HMEA 2E7MA 3VFUB 3BZ4A 3CX5J 4G7YL 3U2SB 1EZVX 5KW9H 4HKJA 2AV7B 4U0QB 3MPCA 1T89A 5CJOH 5C0NC 3NGBC 3SDYH 1S9VA 1BMGA 1AQDA 3DGGA 5KVDL 1W72B 5DF0A 3QXAB 4NKDB 3OJDA 5B38A 3TN0A 5L9DL 4KI5D 4X6FB 3BEVA 1JN6A 1QACA 4EI5D 1DUZB 3NABH 4B41A 3VXUB 1BAFL 5I1EH 1JZ8A 5DMIL 3GM0A 4PRHA 2CIKB 4M6OH 3NBNA 3G5XA 4NDMB 1CFTB 1AGDB 1QFUH 3U1SH 4Z7OF 1AR1C 4PUBL 1KLGB 3QUZA 3WS6C 2NLJB 4BSJA 3H9SA 5C0BB 1JZ5A 4UINL 4XCFL 3N1GC 4U05A 2NW2B 3WKML 5C09A 5IK3B 5I9QB 3V4UH 4GUPB 1F8TH 4NCC2 4ZO7A 3VRJB 5CBEB 3BKCH 5J6GB 4JHAL 1T21A 3IFPA 1RZGA 3OZ9H 4XZUB 5F9AC 1CLOL 1F4XL 5C0JB 3MRFB 2VAJA 3SE8H 4P4RB 5C0RH 4C57C 3QXDA 4GKNB 5GS2H 4WFFE 5JORB 4F15C 4Y5VA 5AYQA 1A6TB 1S9YA 5DUBB 1NL0L 1IC7H 1KJMA 1N6QL 4JFDE 3L1OL 1LNUA 4FQIH 1AFVL 1F97A 4AQ1B 5E4IA 1QA9B 5EPMA 2AK1H 3VXRB 1FJ1A 3HNSH 4NWTL 3FO1B 3RIAK 4C59B 2R9HC 1FGVH 3WFDH 5LQBL 4GG8B 1D6VL 2A9MH 3LQMA 2JJWA 3QIWB 2VH5L 1NAMB 1NGPL 4IS6B 1MF2L 3AY4A 4K55A 4U3XA 1YNKH 1FE8L 1FIGL 2EDQA 1GPOL 4NO2A 3ZHLA 2APXA 3ARGD 5LWYH 1KXVC 5MP6H 3MRGA 4KDVA 1NMBL 1U92B 3C5ZC 3BP4B 1TQBB 3R1GL 1MHEB 2FJHB 1NGXA 1OHQA 4HKZA 5CP3H 1RHHA 4GAGH 2ITDA 4QGTA 4HIEA 3MRDA 3KYMA 4XCCH 4EOWL 5C0EA 2NTFB 1U2HA 3MGOA 5AZ2H 5JHDD 1JZ6A 2Q1EA 3EDEA 4WHYG 4HIJA 4W70A 1XH3B 5JDJA 2PETA 3G08A 3LKOA 3MJ9L 4MAUH 3T8XB 3P0VL 4HJ0D 4PV9B 3UBXB 4XPGH 2Q76B 3S7GA 1E4XL 1EEYB 3QPQD 4PG2A 2DN7A 5GS1B 1X44A 4GMSL 3KXFE 4L29B 4L8BA 2R39A 4NQDD 1MNUH 4PJFA 3SKNB 1NKOA 3K8KA 4BZYA 1N0XL 3DSFL 3MZTA 1Q0XL 1EJOH 3WUZA 5DYOB 1UVQB 4XVSL 3ULUH 2E9WA 2HFGL 2PNDA 3QO0A 4HMDA 4XBEH 4Z78A 4R7NA 1LD9A 4LK4A 3W81A 5C08D 4AG4L 1TJIH 4S0SD 3NTCL 5T1LD 5IB1B 4P2CG 4WTZG 5E94B 1JWMB 1GZQA 4Q9QL 5T1MB 3GSOB 1JYWA 1NMAH 4O4YL 2P48B 1T1YB 3ARDC 2IAMC 3U4BL 1FDLH 5EO0B 3GMNA 3HZKA 4LLQB 4P49A 3MJ6A 1BVLA 3UC0L 2EDLA 4G7YH 4MS8C 5IEHA 3VXQA 4KUCD 4N1HB 3RVUC 1FYHB 1V8HA 1U0QA 2AEPL 1I1RA 4HH9A 2DQEL 3Q3GA 4G8IB 5I16A 3EIFA 4P9ML 3ZDZE 1I7TB 1BP3B 1SJEB 5A1AA 5KVDH 1CICD 4KK9D 4OQ1A 5L9DH 2PXYD 2BC4B 3GHBL 5CP7A 3ULUD 1MREL 3PXHA 5DRZA 2RAMA 1NEUA 4XP5L 1NCBH 1ROWA 1TETL 1CU4L 1BAFH 5DMIH 1S9WB 1BOYA 1DSFL 3ZDXE 5SWSE 4KKLD 1FN4B 1U3HB 1YMHB 4XXCC 4P9HH 3EYFB 5D5MB 1UXSB 1Q9KB 2VUOA 4XAKD 1Z6JT 5FO7A 4P46C 3BE1L 5I73B 5K9KA 3W0WA 1S7WA 3T4AB 3CDYA 4UINH 4XCFH 1GJIA 1YC8A 1IQDA 1NFIA 3WKMH 3WO3B 3TO4D 1MLBB 4HUWA 4Z7VE 1CE6A 3W82A 2NY3B 4NO5A 5KBNC 2Y7QB 4JHAH 1LWRA 1EX0A 1G1YA 3RTQA 1F3JA 1CLOH 1F4XH 3P11L 2RCSL 1N5AB 2OL3B 4OD2A 3TIDA 1CG9B 1EH9A 2NZ9C 4Y16C 4M1DL 4YDVA 1KIPB 1Z9OA 2H1PL 1ITBB 2Z8RA 3U46B 1JRHH 1Q72L 3L3KA 3VCLA 3L1OH 4NKOB 1AFVH 4ODUB 4LGPB 3MLVH 4P23D 4PGCB 3FMGL 1HQ4B 2XN9E 4K7FA 3V5HB 3F65A 4HBCL 4PJHA 4NWTH 3PDOA 4G6ML 1AKJD 1FVCA 2C9AA 2IMNA 5GGRA 3THMH 5LQBH 1FLTX 2CLRB 1SBBA 1D6VH 5SWZA 3TBTB 4YHIB 4NKMA 3ARRA 2P1YA 2VIRA 1R6VA 4NRYB 2C7UA 1NGPH 1MF2H 4NT6A 1FE8H 1FIGH 4PGEB 1GPOH 5I1LA 2OR9L 3UYRL 2WINA 1OPGL 1NMBH 1OLLA 4ELKB 3R1GH 1NCNA 4Y5YA 1OSZB 1T3FB 2B1HL 3LCYA 5E5MB 4LCWA 4F33B 3NPSC 4PJHF 3U82B 4TSAL 5E8PB 4MNQD 3CPLA 2GAZB 2FEDC 5F96L 1QRNB 2YWZA 5F6HI 3BGMA 3C8KB 2ID5A 3BEWB 4A2LA 1A6UL 2YZ1A 1U8PB 2J8UA 4LKCB 3TGXA 1UJ3B 4IOIB 5BOPA 3MJ9H 3PWJA 3P0VH 3MGTA 2KQMA 1D5MB 4GRWB 1CGSL 3L7EA 4GXUN 5BXFB 3VWKB 4E41B 3P4MB 3JTCA 4QHNA 4F37F 4GMSH 3KYAA 4N0RA 1N0XH 5L2KB 1ONQA 1Q0XH 1MRDH 4QNPE 1EXUB 3HAEH 4NQEE 2HFGH 1F4WL 4WUUB 3AU1A 4FXGA 5HGAB 5TDNB 2GUOB 4PYHA 4KI5E 3L5HA 4RNRA 1P7KA 2E7BA 4IRJB 1T66C 1N7ML 4AG4H 4KK8C 3LRSA 3JZ7A 1ZHNA 3ARBC 3IDUA 3NTCH 3VGEA 2GK0A 4JGMA 3QA3B 1KB5B 2D7QA 4R2GC 3VXMB 4Q9QH 1S5IH 2IEPA 4O5LH 3L6FB 3CFJA 5I74C 3U4BH 2DWEA 1IAII 3N1PC 2ZUWA 1WT5A 3QQ4B 1IM3A 1M05B 4ONOA 2MKLC 1QZ1A 3BPOC 3ARFC 4LP4A 4B50A 2DM4A 5DQDL 4KH2A 1UXWA 5ABDE 2AEPH 4E0RA 2DQEH 4TUKL 4PREA 3D2UB 2IADB 1T03L 5SWQB 1EJ6A 2JELL 4XTRD 2DM7A 1MREH 3OXSA 5HHOD 1O5DT 3O3AA 2MQ3A 1LO5A 4HPOL 4XP5H 4FQ1H 1P69B 1TETH 2YPKB 2Y5EA 1CU4H 4F2MB 3RNQB 4NHUA 5CJ8A 4HS6B 4XCNB 1UKQA 4PJ5B 3BZDA 5D93B 3JSSA 4PD4J 2H41A 3QDJD 2Q86B 1T4KB 2J88L 3IJSB 2FHFA 5KSAD 5LGKA 5DJ8B 1VDGA 3BP7B 3BE1H 5C6PB 2ZG1A 3PNWB 5HYSB 4PP1C 2NY4D 5F8RC 3QUMA 3QULB 4O2FB 3UDWC 5H94B 1G7HB 3WLWC 4F9PA 1JYXA 4MLSA 3DX9B 4XWGH 4MVBA 3M8OL 1CTNA 1F42A 5C0AB 3CZFA 3DROB 3P11H 2RCSH 1H3XA 2PCPA 4GG6B 3O2WL 1B6DA 3LKSA 3OGCB 1EA9C 4PLNC 4LRIC 3MLTB 3X11B 3FRUB 1Q72H 2XWJA 3RY5A 5C0IB 4KRPD 2C4XA 3FT2A 4YDLB 5D1QB 3FMGH 2EYRA 43C9B 4HBCH 2Z92A 4G6MH 2HKFL 1T2JA 3UTSB 1EHNA 3GKWL 4JO1L 4HC1L 3WFBL 3QZWB 2DLIA 4DZBB 3ORJA 3VDCA 4RIRA 1HKFA 5D8JL 3GSWB 4AIZB 5JOFA 4WDIA 1EUUA 2G9HB 3VXPA 4Z0XA 4NQDE 2ENYA 1BFSA 3UYRH 2ADIB 3EFDL 1OPGH 5I71C 3AS1A 1NKRA 4PJAB 3FO2B 3EYVB 2GSIA 5E08L 1AIFA 2B1HH 1W0VA 1A7RL 2FGWL 2WIIB 2QR0A 3JBG7 4TSAH 3RIFF 4OZ4A 4PY7A 5IBUB 5CUSH 5EBWB 5F96H 3TPUB 3P77B 5EULV 2W60A 2G60L 3ERYA 2XKNB 2X9XA 3HE6C 2A74A 4YHPB 5IW1A 1AD9B 1A6UH 2ZSVB 1BLNA 2W9DL 4PJDA 3VMNA 3WE6A 4AL8L 4GO6B 2HT2C 4I0PB 3FQTB 5KSBE 3DO7A 1CGSH 3WKNA 4OD3L 4NZTL 2RGSA 3TO2B 4BUGA 4YEEA 3MV8A 3CD4A 1HSAB 1IGFL 1RUKL 4G8GE 1WCBA 4JFOA 1NMCB 1MCNA 3IJHA 5DVLA 4HUUB 5EU5A 4QXUL 1A6AB 1UJTA 1VGEL 3MUGA 2QQQA 1F4WH 1T6VN 4J1UB 2CUMA 3F7YB 5JTWA 3KLHD 2BNRE 3FO0L 2JIXD 3RL2B 4OTXL 5CZKA 2VLJE 1H9VA 1WK0A 2BNQE 5KN5A 1GH7A 1GOGA 5DJ6A 4L1HA 3ZKND 3UTQB 5HYSG 3O3UN 1KBGL 5C07D 1S7SA 3LDBB 2Z4QB 4Y2DC 3P2TA 1CF8L 4Q7DA 4YHKL 3PV7A 3SDAA 2W0FA 1T80A 4YQXL 3D85D 1A5FL 1RI8A 1K85A 4IHOA 3VXUA 1K3ZA 1OAKH 4JKKA 3ZE2F 4WWKD 1U42A 4GAFB 3BIKB 4DVBA 1ACYL 4TUKH 2MCG1 5DTFA 3BGAA 2A6DB 2W65A 3QSKB 2C4FT 2IAND 1DBKL 2AK4D 5BOZG 1T03H 2JELH 2YOCA 3VFSB 5D1XB 1X9QA 2YR3A 1I1YB 5HYJB 3OXRA 1T83A 1IC4L 3O4LD 4JJHA 1SVZA 1NCAL 1G9NH 1BREA 1JV5A 3EW3B 1R3LA 2JCCE 1C08A 2QADB 3O6FD 1C1EL 1E6JH 4CJ0A 3O3BB 4Q2ZA 3BH8B 4WU7B 2J88H 4GJTB 3GRWL 1B0RA 5F9JB 1PEWA 2NX5A 1T20A 4MXVF 3TZVC 4MQ7A 4U1GB 3EYQD 4CAGA 4JFPB 3WLBA 4NPYA 1S7UA 3N06B 4MWFA 1AGEB 3HS0A 3ZT6A 1RJZA 1RZIA 5GRVL 4KRNA 4P2QB 1RK1B 2YBRA 3M8OH 1R3HB 3I9GL 4UIKL 2EKSA 4QRPA 3ZTJH 3PWNB 3HE7A 1U93A 3O2WH 4NCC1 1VGKB 2HN7B 2IG2L 1ZHBB 1A0QL 1QSFB 1Z0NA 3OKOA 2MFNA 2QEJA 4JVPA 3C5SB 2J6EL 3IJYA 4HCRA 4MNQE 5DS8A 4Y8AA 1KCGC 2CKBA 3ARXA 1I3GH 4MJ6A 1Q0YL 2Y23A 3T08A 3WFEL 2DI7A 3VI3E 3KPQB 2H32B 2HKFH 4LU5L 2VKWA 2ZNXA 3GKWH 3O6KH 2IF7A 4JO1H 4HC1H 4WV1C 4G3YL 3Q1SH 3WFBH 4YHOL 3STBA 4L8SA 1Z3GH 5D8JH 2GW5A 5CD5D 5IOPB 3BWAB 3ZDYE 3HG1B 3P73B 2PO6C 4YHML 4A6YA 3HZVB 1TVHA 4OF5A 4ZXBC 4MAYC 4ZFFB 2F53B 8CGTA 3PHOB 4U1SB 5E08H 2Q76A 4N8VA 3SEPA 5I17B 1IAOA 3MNWB 2DIJA 2FGWH 1MCSA 4JFQB 4BUHA 1OAUL 5DRNB 1U95A 2OSLB 2G60H 3CVIL 1PFCA 4NO0A 2W9DH 3UO1H 3C5JA 1IKNA 2Y25A 3FQRB 4XBGA 3CFBA 1PX3A 4DTGH 4PY8J 3BOVA 4AL8H 1TCMA 4TVPL 1JHTB 4MJ5B 2WBJC 4AK1A 5D7IA 3EYOB 4LP5A 4K7PL 1V5JA 2WAHA 3QWRD 4LOUD 1IGTA 4XNYL 4LGRB 4DGYH 1IGFH 5CLWA 4RMQA 4Y89A 3KPLB 3GSOA 3CDCA 4PG9B 3C9NA 5FHAL 4QXUH 1VGEH 3JWDC 3QFJA 3OHXB 5GGTA 3FO0H 3QG7L 4OTXH 5K93A 1K8IB 4J8RA 2GJ6E 1G7JB 3DVNA 1PJ9A 1X5LA 2LU4A 3QHTC 5FGBA 3U36B 2N7AA 3QH3B 4ZFOB 4HZAA 4U31A 4YUEL 3P4OB 5D2NC 3RVTD 4BH7A 1KBGH 2XZCL 1CF8H 3PF2A 4JZJB 2OI9B 1SQ2N 3QDJE 2BC4A 2VO5A 4ZAKD 3AREB 5IWLC 4YQXH 4IIQC 3GBML 1A5FH 2BY2A 3VXOB 3MV9B 3GSRB 1KJ2L 3MRCA 1G7QA 5IG7B 7FABL 1FN4A 4RDQG 1WWAX 1MQKH 4ZUVB 4RGOH 4YH6A 2XG5A 3HN3A 3QP3A 1AXSB 4K23L 1QSED 1OW0A 1N8ZB 4DAGL 1JYNA 2V2XB 3CSPA 4RFEB 1FNGB 1VESA 3MC0A 1FNAA 3D48R 2UWEA 1IC4H 5D7KD 3HC3L 1QFOA 2GSGA 4RGND 2ZCKL 1NCAH 5D2LA 5DT1L 5MEND 4Y1AA 4GBXD 4H5SA 2FX7L 1U58A 1C1EH 2XTJC 4GLRH 1KXTB 2YK1L 4L4VB 3RA7L 4MMXC 3FB8A 5J8OA 4OIAA 2APWA 2B4CC 4NWUL 4WJ5A 2DL9A 1JBJA 4GXUM 6CGTA 3QIUD 5D5MF 3LKNB 2ZOLB 5E7FA 3QIBA 3A6CL 3RZCC 2NY1C 1V7ML 4YDJA 4AEIL 4JM2C 3DXAB 3SDDB 3DOSA 4X6BB 4IJ3B 4APQD 4S1RL 4PTUB 3S5LA 3I9GH 4UIKH 5DI8A 3ETBF 3DTXB 5D2LF 3B9KB 2VLKD 1XZ0A 1CIUA 2ZOKA 1JUFB 2Y5TB 3FKUS 2IG2H 5JW4R 5DC0A 1L0XA 1A0QH 1VEOA 2IQAB 5GGQL 3VWJA 1T2XA 3WNMA 3P30L 3TIEB 1XIWB 4ODWA 5CINL 1G6RA 2J6EH 1L7TL 2Z31D 1DQQB 4I2XE 5CEYA 4ZUTB 1R3KB 2AP2A 5TDOA 1KPRA 1DQJA 1IGJB 4UT6L 3R06B 3GSQA 5IM7B 1NC2D 1Q0YH 2A6JB 5IB2B 1V3MA 3LKQA 3V0VA 1D5BA 2D0HA 3WFEH 2YPLB 4F57L 4LLUA 5IFJB 4LU5H 4X6CB 3HZMA 2GCYA 2X1WL 3DO3A 4YHOH 1KIQB 1YEFL 3MA9L 3VFNB 1FZJA 4K9EC 2ARWA 1FZOB 2NY2B 4E42A 5F3HA 1PZ5B 4YHMH 4AY0A 5DC4B 4MD4B 2BZDA 4DUWA 3U0PA 2YA0A 4QCIA 5HI5D 4ZXBB 3D39A 3EYUL 2FECL 2B7DT 3KYOA 4LCYB 5JPMA 5IP4A 1F45A 1ES0B 1OAUH 1EMTL 4D9RD 4RGMC 3V5DA 5IUSA 4R4FL 1JRHI 5H37G 4YXLL 3CVIH 1M1SA 5C07E 1MCOL 3G5YA 3JWOL 5DC9B 4JVWA 3QI9B 1JZ7A 3NZHL 5GRUL 1X5KA 4W68A 4TVPH 4EUPB 1HHHA 5IJKA 2WWMC 4FFWD 3OR6B 3GM8A 3I85A 5ISZE 4GRWF 3SBWA 3MX0A 1WZ1H 2N4IA 4P2OB 1LEGB 3RUGE 3EO1B 1U8JB 1QBAA 3GMRA 2ICEB 1KB5A 3WIIL 1JWUA 5IB4B 4LPWA 1N3NB 1MHCA 1TQCC 1D9KA 3LIZL 3T0VA 5FHAH 4KRLB 1GOFA 1VB9A 1AI1H 3DV4A 3GBNH 3SGJC 4C56D 2AK4E 2HVJA 3MMEA 2EZ0C 2BDNL 3QG7H 1DTUA 5CZXC 4F7PA 3BT2L 4M4RA 3SDCC 2X2YA 3T0BA 1Q1JL 1ZEAL 3D18A 4KUZH 4Y4KD 4XX1E 3FO9B 3O4LE 1MI5D 4YUEH 1URLA 5ID0B 4WEUD 2FLBT 3VD4A 1W72L 4Y4FB 1IM9B 2XZCH 3PIQA 3D2UA 3HNVL 2X4OB 1TENA 4TPRL 1ZHLA 4JFYB 1QNZL 4NM4L 1SY6L 2V7HA 3KDMA 3DUUA 2DBJA 1IGIL 3EJYC 3G6JB 1MCLA 3LQAL 3BZEB 3EO0B 2EDOA 5EU6E 3D69A 4PJGB 4TVPD 3FN9A 1YN6A 4XCNA 4M7KL 4FQXA 4XNMA 4OCWL 4N1EA 4ODHH 5IR1B 2CLZB 4KROD 1X7QA 4X6DA 3G9VA 1DUYB 3O9WC 2Y6SC 4JQXA 1A2YB 4K23H 4U7MA 3A67H 3JV6B 1R24A 1Q9LA 3V8CA 5A2JH 4DAGH 4QRQA 3VFOB 2VE6B 3H3BC 3V6OC 4O2FA 5I19L 3MRIB 3HC3H 4KK5D 2ZCKH 5I15L 1BPVA 5DT1H 5JPNB 2FX7H 2KZWA 5E56A 1PKQA 4PRHE 3ECBA 2YK1H 1MCFA 3RA7H 4HS8L 2G5BB 4NWUH 4Z95L 1ETZA 1LEIA 2VR4A 2P42B 1DLHB 1HOCB 3MACH 4LLVA 4ERSH 3A6CH 3VGBA 3H9SE 1JPST 1TIUA 4OJFL 1V7MH 1CCZA 3OX8A 4AEIH 2NY0C 3P4NB 4PJ8C 4WO4A 3WXVL 1SYVB 4S1RH 5C09E 4TUJB 5ALCH 2VDNH 1S8DB 5CEZL 4LCCA 3KPOA 3DIFA 4X5WA 4W6YB 5JNYB 3IXTA 3UTSA 1UCTA 4IRSC 4WFGD 4UZGA 2CIIB 2BVOB 2VDPL 5KG9B 4PB0L 3FTGB 3B43A 5GGQH 4GG6F 1NAML 3P30H 3KGRA 5CINH 3C6LC 1KYOJ 4FFEX 2FCBA 5JR1L 2DJUA 2ADIA 4EUPG 4HAGA 4YGVA 4LKXB 4UT6H 4LDLB 3FO2A 1MH5B 2RB8A 2CRZA 3RWDA 4HLZG 4XH2B 1VFAA 4MA8H 5HBBA 2HMID 3GMQA 3H42H 3MCKA 3FQWA 1SEBB 5HDLA 3MA9H 1YEFH 2ICWJ 5DEFA 3GJFH 3IT8D 1AD9A 4CADA 3WUWB 3K4ZA 3UPCA 5L0QB 1OGAD 2B0SH 2P5EB 1CXLA 4N1CA 5FYJE 4L3AA 5E6ID 5HHXL 3BIBX 3EYUH 4PGBB 1P4IL 4PJAF 2KQNA 4MQXC 4HDIA 1MCEA 1EMTH 4DCQB 3WSQL 3IFOB 1I3RA 1WWWX 4ETYA 3QAZC 5DQ9A 5JW5A 1CGVA 4R4FH 2GITA 2I9LA 3MNVB 4YXLH 1KCKA 1TTFA 5EIIA 1MCRA 3ROLA 1MCOH 5ID1A 3LN9A 3HRZA 3JWOH 5EBMA 2P7TB 4BQBA 3OF6D 2DQHL 2X9WA 1H3WM 1G6VK 3NZHH 3PGCA 4P5TC 1I8IA 5J1AB 4UDUA 1I3UA 4TTGA 4YDKL 3GMOA 1LHZA 4HIHB 5KAQF 3B2UC 1Q94A 4LLWB 3RWJB 3WIIH 1DANU 3CJJA 4POZD 3QUXB 3VFTB 3LIZH 5C0GB 4HH8A 5TQ2L 2HLFC 4LCUB 3AM8C 5I1IL 2VAAB 4WHYH 3DURB 3H9HB 2BDNH 4M7ZC 4NGHL 5DK0A 5EIVA 3FOMA 1QSEE 4JEGB 3BO8B 5TPWL 3BT2H 1XR9B 4RAUB 3G9AB 4PJIB 1Q1JH 1ZEAH 4ODSL 2FSEB 3VXSB 3OG4B 3LS4L 2BVQA 1KIRB 5MENE 4XC1L 4TPRH 4KMQA 4N9GA 3T4YA 1SY6H 4D94A 1QBML 4CU7A 1RFDL 3LQAH 2J12B 2FIKB 4IRZL 3RDTC 4OQTL 3TCLB 3PQYB 1MFAL 1KEMH 2A38A 2GJJA 1OF2B 2D0FA 4M7KH 4OD1L 5TFSH 5I66A 5HVWA 4OCWH 3BPLC 1NDMB 5GRVK 1ZHKB 5F9JA 4Q6IB 3G5VB 3AMLA 3TM6A 3CSGA 9CGTA 1MUJA 5I75C 5M7QA 3OKMA 3QXTA 1WC7A 1Y18B 3MRLA 3UJIL 2VLKE 2DDQH 5I19H 2QKIB 3NCBB 1EAPA 5T5FL 5HVFB 1FC1A 3ALXA 4KJQC 3TJHA 4RCAA 2AVGA 2OL3L 2VABB 4HS8H 3OAZK 5C1MB 5CGYC 5C7XL 5GZND 2VDLH 1CL7L 3WS3B 3WUWG 3BUTA 4E5XB 5C0FB 4OJFH 5FA4B 4C83A 4TUOA 3WXVH 1B4JL 5D7JA 1AP2A 3FB7B 5AAWA 1BBJB 3LEXA 2P8LB 32C2B 5M95B 4ZS6C 2H26B 3PP3K 5CEZH 3L5JA 2XPGA 5HDBE 3U30B 3SCMC 2X05A 2YHGA 2KPNA 4L9DA 5C0BD 3V6FA 2P4AB 1ZA6B 1NAMH 4HGWA 3WIHL 1ZGLP 1A9EB 3MRKA 1N64L 3PWPB 5BJTB 1S78D 4JGJA 2CKBH 5JR1H 5FGCE 1I8LA 4JPIA 1S9XA 2BSTA 4K3JL 5HHMA 4ZYKA 4LQFL 5F7YC 2BERA 5I17A 1DLFH 4MCYB 3KPNB 1KEGL 4V1DA 5B39A 4JFQA 5DRXB 4PJHE 3QNXB 1QQDB 5C2BL 5IJVB 4JO2L 2DTSA 2JTDA 1HH9B 1MJ7L 4WW2C 1I1AA 3UX9B 1J1OL 4MD0B 4GRLB 4KK6C 4WFHD 4ZPTB 1OCWL 3VXRD 2YS4A 2NTSP 5CEZD 4PP2A 4YO0A 1RIVL 4WRLA 5HHXH 4XP1L 1BEYL 1XCQB 1P4IH 2WBKA 5EOQL 5MEOB 3WSQH 4I0CC 4LRNL 1FFNA 3QIWD 4FOMA 3U83A 4LCWE 5B8CC 2DICA 2XQYG 5DVKA 5FF6A 1TNMA 2BOBB 5KVGL 3FRPG 5EUOA 4BFIB 1IVLA 4EBQL 2ADFL 2CUIA 3HI1A 3OHXA 4P5MA 5DD0L 4PRPB 2DQHH 2J8UE 2VKXA 3S98A 2VISA 4MXWL 3TT3L 1B3JA 3RX5A 4YE4L 2VQ1A 4NN6C 4PJEB 5CGTA 3TVMC 1A4JA 25C8L 5DRWB 3FT4B 4YDKH 3RKDC 4ZFOA 1KB5L 1MAML 1A22B 2OCFD 5L8KB 1YJDC 4I48B 3DVGA 3MRHB 3Q48A 4HHAA 5TQ2H 2H3NA 4F9LA 5I1IH 1RK0B 5GGTH 1LO4L 1KCRL 5D1ZB 3O6ML 4GW5A 3EFFA 4NGHH 1CWVA 5EUOF 3MV9A 5DUML 1D5ZA 4Q0XL 4EN3A 5F89B 4H0GA 4D3CL 4ODSH 3IFNH 5F1NA 4MD5A 1AQKL 4RMRA 4ZUVA 3IYLW 4XC1H 2HG5B 3TYGL 3FAWA 2ZJSH 3VI4F 3RNKB 4FFVC 3ISWA 4CDHA 1CD9B 5ANMA 1QBMH 4KV5E 1RFDH 3WHXA 15C8L 4M6NH 4M61A 4JFDB 5IB5B 2J4WL 4O9HL 5FYLE 5BO1L 4OD1H 4NQSA 1WTGT 4DKFL 4U1IA 3CFDB 2OJEB 4H88L 1EO8L 2OMNA 4KHTL 4PLJD 1OTSD 4X6EB 4YHNA 4L4VA 1T2QL 3RP1A 4OLUH 3BSZL 5CSZA 1FBIL 5DR5L 3S34L 1WEJL 4F8QA 3U6RB 3GJEB 3UJIH 1AJ7L 1YMMA 4QKXB 4WFGE 1F4YL 5JW4M 4MA3A 3DRQB 4NQVB 3BXNB 3QG6B 3WN5A 4YHYB 1MAJA 4LVHC 4XVUC 5L6YL 5C6TL 2F8OA 2EIDA 1QVOA 1R5WB 2OL3H 5C8JA 5HYIA 2LE9A 3QCUH 4XMKL 1MHHB 2HFFA 5C7XH 1NFKA 5AYUL 3CC5A 2LU7A 4GH7B 1BF8A 3WFHA 2XV6B 3B83A 3LN4A 4NZDA 4L4TA 3SE9H 2A9NH 1JFMA 3I50L 2BMKA 1MFBL 2O5YL 3HMWL 1NBQA 1B4JH 4WTWA 3TH3T 1FL6B 2NXYC 4YBLB 5KJRL 2P8MB 2CLVA 3EZJB 1XAUA 1U3HD 1AGBB 4PJ9A 4CDGC 4UV7L 5BVJB 4X6CA 3TP4A 1MCKA 2NXZB 1PQZA 1H0DA 1WIUA 2ATPB 3HHRB 4R7DA 1N2RA 1FNSH 5MI0B 1L8JA 3SKMA 3DX7B 4FQJL 4WVRA 2OZ4A 4ZQKA 1G6RH 3WIHH 1MCWW 2PYED 4ZUWA 3LMJH 1N64H 4JN2A 1A7PL 1HH6A 2NY3D 1BECA 1HEZB 4KI5C 1FYTA 2NQCA 4MD4A 3DHJA 4PV8A 4EI5C 4K3JH 2ESVB 1V3JA 1PG7W 3QYCA 2GI7A 4GLRI 1L6ZA 2KUTA 4QHLA 4FRWA 4R4BA 1CFVL 1F00I 1P53A 1KN4L 2UYLA 4X6CF 5E03A 3GK8L 4I18B 4JO2H 4TSCL 5BCAA 5FECA 1CDCA 1MJ7H 3GSXA 2WANA 1J1OH 1K6QH 2EYTB 2RHEA 2RR3A 4J3UA 1OCWH 5E00A 2ZUSA 3KWWA 5AAMA 1OD9A 4GRWH 4NZJA 3AC0A 4FNLH 3RPKA 1GVIA 2FBOJ 5I8EA 4J12A 5C3LD 1RIVH 1D5XA 4XP1H 2NW3B 1EHLL 1BEYH 1HYSC 4NNXB 3B9VA 4NN5C 1Y6MR 4R6UA 5FFLA 4LRNH 3BUYA 5I6XC 2P5WB 3QQ9C 3LD8B 5IB4A 1KIUA 5EU4B 2G2RB 1EO7A 4CW1B 5DHYB 4EBQH 1EFQA 3BKML 2ADFH 5ESVA 5DD0H 3PJSB 1ZE3C 2C1PA 4R8WH 3Q6GL 4MXWH 4PJDE 1BJMA 4YE4H 3U0TA 2XTLA 25C8H 2ADGA 2PKDA 5SWSB 4HFWB 4EDXA 1W0WB 1QRND 1KB5H 2YUZA 1MAMH 5EFIB 3ZL4L 2R4RL 3IDNA 1NUGA 3TA3A 2Z35B 3MV8E 2X6MA 4CL7A 1BZ7A 5IVXB 3FFDB 3T0EA 3O6MH 3EO0A 1U3YA 1N0LA 4Z7VB 3VWKD 3C2AL 4E41D 1R5VB 3MBEB 4YNYB 3ARGC 3NCFB 4Q0XH 5IW3A 3GDBA 4ETQB 3OAYK 2WNGA 1M7DB 1AQKH 1GXEA 5IMLA 2R0LL 3E2HC 1DN2A 5L2KD 1YUHA 2F9BT 5CD3B 2R2EB 1KNOB 1EK3A 2VXSL 4J4PD 1T22B 5EB9A 4WUUD 5DJ0A 1EEZA 15C8H 4PJXA 5TE6L 5CMAA 1A1NA 4DQOL 4L3CB 4OT1L 3MROA 2J4WH 4O9HH 4R90L 1NDGA 4IRJD 5BO1H 3G6JF 2XNAA 4DKFH 2BY1A 2XN9B 3FQXA 1EO8H 3VXUE 3LHPL 3FT3B 1AHWA 1A1OA 3INUL 4HJ0C 3BIAX 3CFKA 5T1DL 3VXMD 3PHQB 4MXVE 3BSZH 2FJFB 3QPQC 1FBIH 5DR5H 1WEJH 3IDYB 3LEVL 4MXQA 1FFPA 4QRSB 4EEEA 1AJ7H 5I2IA 1IGCL 1F4YH 1XF5A 4UILL 3GMMA 3QBTB 4K07A 3VG9B 2BCKB 4PJXF 1BQSA 4PRAB 5IFHH 5L6YH 5C6TH