1AGCA

Antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyql-7q mutation)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antagonist HIV-1 Gag peptides induce structural changes in HLA B8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility complex
molecule keywords B*0801
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1997-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1agcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1agcA01
4OLYL 2VDNL 5DC9B 5FCUL 3VXMA 4ZOBA 5CIPA 7FABH 4PFEA 4LCIL 5D7IE 5F6HI 3WSQH 3QXVA 5JUEH 4NO0A 5KSUB 1Q1JL 2VUYA 4M1CD 1MFEL 4R90H 3LV3B 4GRWE 3LN9A 1PYWB 4F7TA 1NGZB 1HI6B 5HY9A 3LKSA 3IAQA 3IDYC 4H26A 3C5JA 5BW7C 1Z2KA 3RL2B 2FIKA 3RJDA 4CVZA 3ECBB 1RK0A 1JV5B 1E28B 2C3WA 4U0RB 5FO7B 5EORH 5ICZA 4NYLA 4PP2A 3VXSA 5F6IB 2FSEB 2PO6B 1EGJA 2DTML 1HSBB 3ARRA 4HQQL 3SGDH 3UJIL 1AO7A 4YX2H 5I17A 1H8OA 1XGRB 2PF6A 3HMWH 4RGOH 1DVFC 2DB8A 1HKLH 4Y0GA 4Y4FA 4JM2C 3RVWD 4HEPG 2BNQD 1K5NB 3NACL 1IAMA 1MAMH 1FDLL 5DRNB 5GZOC 4OSUH 1FV1B 3DVGA 4RAHA 1DQLL 1OGAD 3C5ZA 2AJSH 3UZQA 4UV7H 4ZAKD 1BFSA 3K4AA 3VGHA 3VXME 4U6XA 4P49A 1CIUA 1QD0A 1NEZG 1OAYL 5HVGB 1RHHA 5IB4A 3S3JA 1EHNA 4F58L 3QWRD 1YEFH 4K3EH 2WBJB 5IB5B 3U30B 3MACL 4ZUWB 1GRWA 4P4KC 4S0SD 5E6IC 1OM3L 2X7LA 2VISB 3WHXA 3KPMB 1KXTB 5GIRB 1V3MA 5KJRL 1F58L 1KPVA 1EA9C 1KJMA 4IHOA 1WBZB 3QXAB 1KGCE 1DVFA 1RURL 2DIBA 2AQ1A 3MLSL 2DQCH 1EAPA 4F80A 1PSKH 4I5BB 4L29B 5IBLD 3HE6C 2I5YH 1KF9B 5E8DL 2X4TB 4J12A 2QADD 1I3RA 4FTVE 4WWKC 4O58L 4PJDE 4RA0C 1Y6KR 3U1SH 4YBHA 4UT6H 4L4TE 2WAHA 3EJZD 4K23H 1VEPA 2DWDA 1FRGL 15C8H 4G6AC 3SOBH 4RQQA 1DTUA 2YC1A 4QTIH 4PP1C 3VXRA 5C0BA 1QFWH 1FFNA 2W0LA 2VXVL 5IW1A 2JELH 2HJLA 1KJ3H 3F8UB 4N0YH 1P9MC 5I9QC 4HWBH 4B50A 5DMJB 2V5SA 2BY1A 3LS4H 3QUXD 1MRFL 4JG0L 1L7IH 1H3UA 4XC3H 2H8PB 2AK4E 1QFOA 1NAMA 3GRWA 4UU9A 5CKAA 1L6ZA 3MRIB 3PG2A 5D2NE 5ISZE 4DOHE 1RJLA 5ID0B 3SKNA 3DX9B 5F9AC 1OQOA 5C71A 3S8WA 4MAUH 2YHGA 4H88L 3AC0A 4NQEE 2WANA 3DIFB 3V4PL 4IRJD 1O0VA 1A47A 3EYVA 2MSPA 3VA2C 2D3VA 3UO1L 5B8CB 4E5XA 2D7QA 1KB9K 1T4KB 5C0IA 4WI7A 2JE8A 4X80L 4CVZB 4O9HL 1PG7L 4Z0XA 5C92A 3FO2A 4M93C 3MRFA 1CK0L 1D5BB 4HEME 2HJKB 3KPTA 3MUGB 2VDLH 3MBEC 5TJWK 1Q72H 5IV2B 3GDBA 1RIVL 4HIEA 4XCNB 4UINH 3W9EB 2EDHA 4MSWB 3EBAA 2XA3A 4M02A 4P23B 4PV8A 5IVXA 3L7FB 2C4FT 5I30L 4XPFH 4NQCB 4TYUA 3DRTA 4I48A 5BS0A 4LVOB 3SO5A 5HDLA 1WBYA 2Y36L 2FD6L 1FNFA 5EBMB 3GSOA 2AK4A 1EZVX 1HHHB 4LLUB 2XTJD 3QUZA 4WU5B 4JFFB 4XNZB 3SGKA 3LOWA 5DJDB 3DNKA 1FORH 3LZFL 5DK0A 3TIEB 3EYUH 1U8QA 4V1DA 3U36A 1R5IB 3VD9A 2A77H 2VLKE 3Q0HA 4ODXA 4NNYA 1ORQA 4JRYB 4P5TA 3DMMD 4N5EC 4Y7MA 4I8DA 3O0RH 3HE6B 2E7MA 1M05B 4M1GH 1RZFH 4QHUB 2X1WL 2APBA 5F9OL 1OAKH 1NAML 5F72S 3G04A 4ZODA 1U8OA 4YQXH 3B2UD 4OZIB 4O2FA 1AD9A 1I85C 1MIEH 3O3AB 3RZCD 1FH5L 1HHJA 5E4EB 5KJRH 4DKAA 4MNQE 1MWAL 3MNWA 2BNUB 4P2OB 1REIA 5I1IH 1AD0B 4PJHB 4DCQB 1X5AA 2YMXH 4YXHH 3OKOA 5LJYH 2V9QA 2K9UA 4X0KA 3EHBD 3D2UA 1C1EH 1KCUH 4H1LG 4YGVB 3TJHD 3FO1B 4MXQD 1M7DB 2PYEA 2V9RA 2A9ML 3QWRA 5MERA 4ZYKB 3MA9H 3D0VB 5MEQB 3TPUA 3MROA 5DWUH 3D0VA 1LO3L 4PJ9B 4U6VL 3LQZA 2Q20A 4D0BA 4J7RA 1MFCL 5K9JH 4FQXB 4HGWB 3HUJA 2VLRA 4U6TA 1JWSB 1ZKAA 1CXFA 1CFTB 2AJ3A 4KFZC 4R97B 4DQOH 1I9JL 1MIMH 3MRBA 4G8FA 3VXTB 1NCAL 4NP4L 1N3NA 4V2BA 4R26H 2ZUUA 1VA9A 3A6OA 5GGTA 1AE6H 4TUKL 5T1KA 5JLZA 4LAQH 1U91A 1FGVH 4FOMA 2B1HL 4HJJH 4JKLA 3V5HB 2AJVH 5TPWL 2V7NB 4UT7L 4LF3A 3DVNB 3MBEB 1CLZL 3RIAK 2AKRA 2GCYB 1MVUB 3MXWL 2GCYA 4XB8A 4Z0BH 3IDYB 4LCCC 2EE9A 3ARYA 1WF5A 4GRMB 1IGCL 4PRPD 5ETUA 1NCDL 3BN9D 4WW2C 3GMRB 3FQUA 4WY7L 1D6EA 4S10A 1PQZB 4QXGL 4PJ8B 3LH2L 5MEQA 4LRIC 4U1MB 1AHWC 4CJ0A 2CKBA 2EYSA 4KJQD 3QNYA 4QNPE 3BZEB 4Q97A 1MPAL 3OXRB 4O51B 3SQOH 4CMHC 4G42A 2W0KA 4HIIB 1OF2A 1BQHB 1MCDA 1ZSDB 3OKOB 4TOYL 1S3KH 4JDVB 5J1TC 3ZKND 3NFPB 1YYML 2UZYB 4EDXA 2EEDA 4NM4H 3P9WB 4WTZG 1JPST 3GO1H 4UOJA 3RVVC 3SKMB 3VRIB 1U93B 3MROB 4WUKL 4RGMC 3HG1A 2JJSA 3UTSD 1U8NA 3HAEA 4P3DB 1JBJA 4D9RD 3MRRB 1AXSA 5EOTA 4EKXA 2CIIA 3X13A 4B0MM 1A1OB 2YD6A 1CE6B 4MB5A 1IGIL 4HXBH 4BH7A 3WD5H 3HZKA 4FQJL 1MUJB 2GUOA 4Q6IB 5D1QC 3KG5A 3TFKC 5GS2H 2GT9B 4XCFL 4NJ9H 1BZ9B 2M26A 1UWXH 4OCNC 4WW2B 3GI8L 4M5ZH 1VKXB 2R23A 5CP3A 2PW1B 3E6HB 4Q9RH 5IUSA 1G0DA 3TJHA 1UWXK 4Z95H 1OLZA 2YN5A 4ZFOA 1MELA 5B39A 3TBYA 4UTAL 2IALB 3QJFB 2A6DA 1HOCB 4ZNEA 1W2KT 4F7PB 1EXUB 5FYKE 4EXPX 1LO2H 4PJCF 3LMJL 3U30C 5DD6A 2XWJA 4IS6B 1DVFB 4CUCA 1UM4L 5SV4A 2ED7A 4H25A 2XOTA 3JV4B 5FB8A 2W92A 3OXSB 4CU7A 1WCBB 4YHML 4OD3H 1YPZA 4XC1H 4GRLD 3TWCH 1F6LL 3WDJA 2B20A 5DVLA 1SMAA 2HTKC 5FAAA 2NLJA 3HZVA 3RUGB 3SBWC 5M7QA 5FUOL 4DGIL 2YUXA 4YHOL 4FFEX 3GMPB 1ZTXL 4PLKC 5C2UB 4XNQB 4R7NA 4LNVA 1YYLH 3SE9H 3U0PA 4L3CB 4PJ8A 3ZSSA 3DXAD 4WFEE 1GC1C 2NW2A 3GJFH 2VDQH 3NTCH 1SVCP 3OTTA 2BXYA 1LWRA 4OCRH 1S9WA 3IRZA 2Q86A 4QRPE 3QWOA 3MOQA 3DOSA 2PYFB 3S35L 2OMBA 2AK1L 2P4AB 1JGDB 1DFBL 3FB6B 4Y4HB 2QR0B 2VLLB 3HI5H 4PTUA 1IZKA 1UC6A 5E4EC 3VU2A 4DKEH 2LVCA 4LPWA 1NJ9B 4UV4L 1YPZE 4HJ0D 5GGQL 1BBJA 2Z92A 1XGQA 2Z91B 4XHJD 1T04A 2VDOH 2AEQL 3HLAA 4FQXA 4ZUSB 4YC2C 1OQXA 3HB3D 1A6ZB 3ZDYF 8CGTA 1MJJA 5E08L 3TT1L 5IT2H 4JZOA 4DFIA 3GSRB 4JQIL 1E4XH 1D5IH 4JO1H 3CXDH 4XNZC 2AEWA 1J87A 1INDH 1VB9A 4U7MA 5L2KD 2Q8BL 5TGBA 5SWZB 5BZDA 5BMFL 1KJMB 5EBWB 1KCSL 1HH9B 4YX2L 1W72H 4X4MA 4GS7B 2Z8WC 4MA8L 4L5FL 4PLJC 2NW3A 1EFXD 3AUVA 3B8SA 1BZ7B 3WFCH 5K9QG 4OGAD 2VDKH 1YZZA 3O3EB 2WNGA 4L29A 5ALBL 4L3ED 3QUYD 4M7LH 4QY8B 4QHNA 3UEZA 3IDNA 1WAAE 4TUOA 2YD3A 3GBLA 3SO3B 5L8KB 1L6XA 3LN5B 2AJSL 1WBZA 3QXAA 5IHBA 2GAZA 1UZ8B 1RIHL 5DD3L 2JJUA 5DMIL 3RWJB 2XZCL 4NKDB 1S7VA 1XR8A 4U31A 4Q9RL 1RZ8B 4EVNA 3IRPX 4G42B 4LGPB 3RVTC 3PHQB 1KN2L 2XXCB 4V1DB 5I15L 5I66B 1MWAB 4HGKC 3T0AA 4P5KA 1AH1A 3VRJB 4BSVB 5CEZL 4OAWB 3VRJA 4Y5YC 1G7IA 3VFVB 3ARDA 4D0CA 2D31B 4BELD 3I6LE 3KYOB 2FSEA 1SY6L 1Q9WB 3P73A 4JPWH 3U46A 2CQVA 4KDTA 5FM5M 4PJIA 1UXSA 4QXTB 1ONQA 1K5NA 4HFWB 5FO8B 1SJVA 3O2WL 5JOEA 1CE6A 4NN7B 2YD7A 4CW1B 3O2VL 5BZWB 5EU4B 2BSSA 4DAGH 1J8HD 2BSSB 2VH5H 2CLZB 5DLML 3OKKA 3VFWA 3IVKA 4PR5B 1NMBH 3FT4A 5TE6H 1I8IA 3RPIA 1LNUB 2WLYA 4XCCL 4BYHA 3WLWD 1KCRH 1FFRA 4KMLB 3PABA 3VXQA 1CD9B 3DX7B 3JTTB 1MJUL 4IOFC 4QHKI 4NO3A 2B5IB 2BVUA 1CF8H 1J1OL 4X4YB 4JKKA 1DFBH 3B4NA 3QDME 4IDLA 4OZFH 1MCBA 5EC2A 2OP4L 3P4MB 2H32H 2HN7A 1H15A 2DQIL 2F54D 3HAEH 3RRQA 4MJ4A 4MLIA 4JHAL 2HT3C 5EN2A 1A9BA 1A02N 1G7PB 1P7QD 5JORB 1NBVL 4R4NC 1DBML 1JYWA 2A74A 3UAJD 1M1SA 1MRFH 1KCVH 4JG0H 4QOKE 1NGXB 1FL5B 5DUBB 2EKJA 4PJIE 4YZFE 3P3YA 5D96B 4PGCB 1DEEA 5KSBE 4U1JB 4UIKL 4OLZL 4K94C 3I6GB 3HC3H 2AQ2A 3CFCH 3LSOB 1P7HL 1P6AB 2AP2A 2W9LA 3O3DA 5KOMC 4FQXD 2AXFA 1RZKL 1OTSC 1T20B 1OGTB 4L9LA 4N8VG 4LSPH 5FV1L 4PJ9D 5D7IB 4U1GC 1IGYA 2GY7B 3S3PA 1MWAA 1BAFH 2F19L 4YWGL 1OAQL 2FX7L 3NCFB 5HVFB 2G9HB 1JZ4A 4LCWD 5EH1A 1S5HA 2BC4B 5EZIL 1OSPL 3DO7B 4NT6B 1LO4H 2JIXB 3BZFB 3IU4H 2D0FA 2R2BB 3GM0A 3X12A 3GK8L 3PWVB 3I50H 7CGTA 1MNUH 3VG9B 3MO1A 1P2CA 5E7FA 3WS6A 4AJ0A 4YFLI 3GHBH 4Y16D 2GFBB 3H3BC 1F4WH 2E9BA 2UZIH 1U8PB 3MX0A 3C60B 1FORL 5FUZH 5IK3A 2WIIA 3S34L 3QEHB 4JRYD 4F2MB 3ILQC 1A1NA 3TZVC 2H45A 4Y2DC 5GISH 3D9AL 1FV1A 2EDLA 3B5GA 1CL7H 3KLAA 3KR3L 3HZMB 5HGHA 1RUPL 1NBZA 4GRLA 5I19H 4HD9A 3T4AA 4BUHA 1S8DA 1U42A 3CDGB 5JOFA 4ZSOE 3GHEH 4Q58C 2RB8A 1EHLH 1LMKA 3L1OH 3RZCA 4LCCA 2OK0H 4UAOC 2WY3A 3BW9B 3TA3A 2PYFA 4M61B 3TYGH 1IC1A 2VXUH 3RTQA 4OLUH 1AQDA 3IFPA 2EC9U 4YDVA 2F8OA 2A9MH 5EUOF 4P23D 3MA9L 3LKQB 4HPOL 4TVPD 2E6JA 2YZ1A 1HWGB 4K3GA 3PHSA 1NL0H 1A1OA 1E0OB 5I74C 5D9SB 5IEKA 1C1EL 3ARFA 1XFPA 3GFUA 5I1HH 1FZOA 2X9YA 1NAKH 1AY1L 3KDMB 1U8NB 2IANB 3HAEB 2Z31B 3O9WA 2VL4A 4XVSL 1NC4D 3QO1B 1C5DB 3ULVL 3F62A 1Z5LA 1FGNL 4I9WE 5IHLB 4R26L 5H8DA 2APWA 4G8IA 2AJZB 1OCWH 4NIKB 1KBGH 4RMWA 1JE6A 5E5MB 1FZJB 2X4RB 1TCRB 2FBJH 4OM1H 4F7PA 2FJGA 1OD7A 4QXUH 3REWA 5BQ7B 1P7QA 1SJEA 3UZVB 3AMKA 4BSJA 1B4RA 4JGMA 1YJDC 1RK1B 5BJTB 3JV6A 1N8ZB 3FB8B 4GW1B 3STZB 3QCTL 4GLRI 3QXUA 4JVPA 1MJ7L 1J1PH 2Q1EA 3NA9H 3C6SA 3BT2L 2CK2A 4K94L 3RAJL 4OF0A 1DEEB 4F37F 1J11A 3VJ6A 3VE0A 3ARPA 5FOBB 5FOBA 2DJUA 4IJ3C 5ACLA 5L9DL 3QHFH 5SWSE 3HZMA 3NFNA 5HGHB 4HXAL 3W0WD 5T1KB 5JLZB 1FNAA 1XF2B 3KPQA 1EPFA 4I1NB 3GO1L 2FEEL 4NZRL 5DR5H 3AU1A 1C08B 3DPBA 2LABA 3O4LA 1LD9A 5EOCL 5INCB 2GFBA 4KI1A 1ZLUK 5GRUH 5KSVB 1MIML 3BO8A 1A6WL 2R1WB 1IGFL 4LRNH 3KPNB 1F97A 4WTZA 4TUKH 3ROLA 2ZG3A 1RUKL 1RFDH 4MMXC 3V0VB 4CW1A 5FEBA 4R4FH 4G8GB 3GSXB 1H8SA 1RULH 1UA6L 3D2UB 5T1DL 4X99A 1KPVB 5GS0H 2X4OA 3KPRB 3QO1A 3HE7B 3GBMH 3B3IB 1IC5H 3ARBB 1CE1L 4UTAH 1JGVH 2R0LL 4LDEB 5DQDH 1AI1H 4HKBB 1CGWA 2AS5M 1EHLL 4YE4H 4MDIB 3L7EB 4PGEB 4Y89A 3CSYB 2QQNL 1N5YH 3ILPA 1UH3A 3GSUB 2EO9A 5EO0B 3U4EB 3WIFA 3FRPG 5K9KB 1I1FB 4RCAA 3MRBB 4G8FB 2CIKB 4I18B 4WFGD 2RAMA 1F6AB 5C1MB 5CD5C 5GXBB 3M8OH 4PRHD 2XG4A 3SCMB 2BMKB 1N4XL 3INUL 1I1CA 5CILL 5DURD 4JFZH 4MAYD 4MD5A 3IAGC 1S7WA 2DQFB 3HMXL 3K1DA 4P2QE 5F3BB 5C6TH 5CJQH 1GSMA 4XBEH 1H3WM 1IGJB 4PJCB 4MNGE 4MNGA 5ICXA 2DLFH 1EHXA 1A14L 2WUBL 3OGOE 1XMWA 4CADB 5DYOA 4HDIA 4MB4A 2NYYC 4KROD 2MNUA 4G6JL 1HXMB 3G5ZB 4NO3B 2FYYB 3O6MH 4OD2A 4KHXL 5A2KH 1YYLL 3SKJH 3WNLA 3QUMB 3QAZC 4RNRA 3WD5L 1HH9A 4AMKL 4CU8A 1N7ML 3CK0H 3S36L 5GZNC 3LVEA 3W9EA 4HUUA 4MJ6A 3QUKB 3S7GA 2ZPKL 1QLEL 2VLJD 3F7VA 2IQAB 3AVEA 1A3LL 1FYHB 2C3XA 4P5MA 2PTVA 3TC9A 2AK1H 2FHFA 3MRNA 3LQAL 2WP3T 5FECA 4BH8A 1F4XH 1XR9A 2AI0H 4I9WD 1Q9OB 1KPRB 2HWZL 4UNUA 1EO8H 4Z8FL 3FQNA 2H6PA 4NQEB 4YNYA 2BSRA 2GJ6A 5BV7H 2DQDL 5D2NB 2V5YA 2VAAA 4AM0A 5DMGD 3DYPA 4KUZL 4P46B 5L9DH 4C83B 5F89B 1JZ8A 4WI2A 1NFIB 3CXDL 4CBPA 1QBLH 2OM5A 1AXTL 2Q8BH 4NO0D 2VXTH 3LSOA 5I18L 1YQVL 5DJ8A 3BE1H 4HUWA 4OTXH 3V8CA 1WIOA 2A6JA 1I1YB 4NNXA 1EUUA 5DJ6B 3ULSB 2EH8L 1SYSB 3N1GC 3RWFB 2MFNA 3OL2A 3KHQA 1HILB 5E9DB 1XZ0B 1U2HA 2J8OA 1E4XL 1T1WA 1UWEH 5SWQA 1F6FB 1DCLA 3RKDC 5DVKA 1F3DH 1KCSH 1JZ6A 1QLRB 5DMKA 4PJDB 4QRUB 4X9IA 2APVA 1QRNB 2HN7B 1RFDL 5CKGA 1QOKA 2I07A 3PWPE 4ZO8A 4N0UE 4BK5A 2VABB 3EOBB 2DM3A 4TNVF 3TYFA 5FF6A 5JO5B 4C58B 3DRTB 1A2YA 4ELMB 5FA4A 1TPXB 1HQ4A 5HHQA 4ODHL 4LVNC 2HT4D 3HCVB 3UBXA 3CX2A 3U7WH 5BRZD 1CLOL 1CT8B 5DD6B 4ZAKA 5I0ZA 4UBDC 3WDIA 4ODWB 3C60C 4BSWB 1KIRA 1CS6A 4X6DB 3ARFB 3ULVE 5HHMB 4W4OA 3PGDA 5B4MD 4NHCL 1HDMB 1H0DA 1ES0B 4OFVA 4Y4FD 3SDCD 4OCMC 2Y7QB 3QFJD 3T0BA 3LKQA 2CO7B 4YHYC 4WW2A 3FKUS 3P73B 2P5WD 4JFZL 1CWVA 4YUEH 3EYVB 4HZAA 1X5YA 4NN6C 4Y5VA 2YPKB 2Q6WB 2BNRA 4HIJA 1J86A 1FIEA 3GIZL 4PRNA 4PTUB 3G6DL 4NZUL 2YPVL 5EO1A 3MV9E 1HCVA 1T66D 4OZFB 5LWYH 3VFTA 3SE3C 2N7AA 1IC4L 3DETD 5MENA 5KAQF 4JJHA 1YEJL 4HIXL 4PRIB 5EZLA 1FL6A 4MGXA 5CMAA 1UCTA 3VXRB 1N7MH 4OV5A 1T5WA 5I1DB 3LS5H 5DRZB 4G8EB 2G60H 4KK9C 4NOBA 2YUVA 5KBNC 1NBVH 5AAMA 2A6KB 3QCVL 1INQA 4H26B 4HUXB 5D96C 2OX5A 4HUXA 4JDTH 5E56A 4C54A 1IZJA 3SKOA 1KB5A 2B2XL 1S78C 2DQIH 2RFXA 4F57L 3QDGD 1GZQA 4TNVK 3HHRB 5J13C 5ITFB 2GJZA 2IAMB 4Y4KD 5DEZA 2VXQL 2VKXA 2ZOKA 3SCMA 4UDTA 3U9PL 4FA8A 1J05B 4WIQA 2D03H 4RDQG 5JMRA 5IFJA 2BOBB 2F54A 3GSNA 2DMBA 5FGRA 4MA7L 2UUDH 1FNSL 4QRSA 3MUY1 3VXNB 4F9LC 4FTVA 5JA9A 1BP3B 3IU3B 3B9AA 3HLAB 3DROB 5IB4B 4URTB 1OARH 3ARGB 3EO9L 3NZ8B 4POZD 5D7LD 1LE5A 1NKOA 3T0EB 3D85D 5JXEC 3OQ3B 5DJZA 4DZBB 3HE7A 1C7TA 2Y7QA 1XIWD 4J1UA 1XGTA 4ZTOL 1BQUA 5IFHH 4PGCA 1CFTA 3DECA 1CQKA 3NZHL 5HYJB 2GTWA 4PTTA 4JGUA 1SVZA 4JFHD 4I0KA 3FB6A 5L88H 3QDHA 1F4WL 5DTFB 3L3KB 4NDMA 1AO7B 5I17B 1CT8A 1JIBA 3BXNA 1CCZA 1PLGL 4X7SH 3BJ91 1HHGB 4DW2H 4UMGA 4I0PD 4JN1L 4XI5C 5D1XD 3DARA 2DI8A 1RZJL 2LE9A 4M93B 3WYRA 4JPKH 3VFNA 5F7NC 1YEFL 4K3EL 4P46C 3GZKA 2VLME 2ARJA 3L1OL 5ESQA 3OKKB 2WINA 2N56A 3TYGL 3QA3B 4UOW1 1F8TL 3LKPB 3VD3A 5C0EB 1EEZB 4KUCF 1A6AB 1ZLVK 4X7TA 1XCTA 1IRAY 4PRBA 5AAWA 1T21B 1YPZF 4P2RD 1G84A 4GOSA 4V2CB 1FG2A 1FBIH 1S7WB 1F00I 3ULSA 4HQQH 4BK4A 4RGNB 2ADGA 3EOYG 4KAQL 1TFHA 1WEJL 1PSKL 4FQHA 2HRPL 5BRZE 1FYTA 5E8PB 3W9DA 1L9MA 5DD5L 1VGEH 2ZCKL 1CZ8L 3RVXC 4WI6A 3TCLB 2V2XA 4U1KA 2NZIA 1QBBA 2R1YB 4YHLL 2Y9RT 5E00A 5ESQB 4JFOB 4NN5B 1KPUA 4YXKL 1R24A 2EDFA 5DI8A 2VJXA 4N0UA 2DQFA 1NBQA 5FYJD 2VZ3A 5BS0B 2IPUK 5I1HL 2NY6D 2OZ4H 3B3IA 1Q9OA 3FO9B 1GAFL 5EIIB 3MNZB 4H1LA 5KSAB 1Q0YH 3BYYA 4G8IB 3T0EE 3KJ6H 2A0LC 2YSSB 5IB1B 2CLVA 1VFAB 2A2QT 4GBXD 1OW0A 4YBQC 4QT5B 4IOIB 2XZZA 1DUZA 1O5DT 1KBGL 4ZFZB 3T1WA 3MV9D 5EU7E 2JTDA 5BOPA 1H3PH 3QCTH 1GGBH 2PYEB 4R96B 3OF6D 1JWMB 3WIIH 4Z7VA 3JVGC 2ZG1A 3M17A 1DSFH 3RU8H 3NPSC 5DGRA 1E6JH 4AK1A 1AHWA 1D9KB 4ENED 1U3HB 4QXTA 2D7PA 1KTDA 4APQD 4LVOC 4X7FC 4CVUA 5M95B 2NY1B 1VHPA 4RX4D 5EB9A 3M45A 1GHFL 3RVWC 1UQSB 4R2GB 4PRPA 1NAMB 5F7LB 1YN7A 2FZ3A 1I8MA 1OTTD 2F74B 2X40A 1J8HA 1F4AA 3ALXA 5BVPL 2ZJSL 4K9EL 1N59B 1NGWB 4QWWC 1ZS8A 2CRYA 5CGMA 4I2XA 5ALCL 2MWCA 4E42A 1FGNH 3GBNL 3K81A 2DQHL 5E6ID 4PRIE 3RGHA 1K8IB 3AS3A 1VFUA 3QEQB 5C0DB 4H8WC 3RWEB 4P48A 2ICWA 4BQ9A 4FG6C 2IGFH 5J3HD 4R4FL 4KJWD 5IM7A 3MV9B 3W5MA 4LLWA 3FZUD 4IRSD 2OQJB 4O00A 4L4VE 4XC3L 5FV2A 1IQWH 3Q6FB 4LASH 3SGEI 1QLFA 5IBLC 2OJZL 3ZE2E 1GH7A 4PGZA 4EI5B 1PG7H 5BV7B 3OBAA 4EI5A 1V7MH 3VMOA 1IARB 1AGEB 5JQ6L 4P9HL 4NHUE 1KENL 3ULUC 5GGRB 4JFHE 4NNPL 3CPLB 4MDJA 1NFKA 3QG6B 3UTSA 4FQ2L 4DJMA 1OPGL 3WHE1 2LTQB 1X5GA 4PJIF 2IFFH 4YZFF 5F97E 4WWKB 1E6OL 3KXFD 1W8NA 1QFUH 5HHOD 3ARTA 1N4XH 2XPGB 2H1PL 4FZEH 4WUUD 2CO6B 2JJWA 1SYVA 2EXWC 4RGND 5ID0A 5TDOB 4PJAB 3B9KD 5KVFL 4RMTA 1EJ6A 4LCWA 2JB5H 5E1HB 1CFVH 2BSED 3U4BH 4WTXA 3VFTB 5I30H 2NR6C 1CR9H 5F7HA 2AV7B 5B38A 5K9OB 4CMHB 3ZE0E 1N2RB 4KHXH 4ZFOB 4L8DA 1NEZB 1PD6A 1XGRA 4XRCB 4Z77B 4W6WB 1A14H 3VFUA 3FFCA 5IW1B 5H94B 3MODH 1H5BA 4HWZB 1S7QB 5DJ2A 4G6MH 1T1YB 5AYUH 3O6FD 2VUOA 4J3VA 4M1DH 3SPVA 2DQGH 4UUJA 2EDQA 1D9KA 3QYCA 2FB4L 2ESVB 2D2OA 1A6UL 1WC7B 5C6WH 2DJSA 3RU8L 1F4XL 4Y88A 1BMGA 2X89A 4GRWB 4UAOB 5LGJA 1ZA3A 4OGXH 4NQDB 2E27L 4ONGH 3V4VH 3QZWG 1I75A 4MX7A 4DZ8B 5IMLB 5BO1L 5C0JB 5IQ7L 2R0WH 1T1WB 3QISA 1ADQL 1IBGH 1EIBA 5IMKB 2FNBA 1P84K 4YDJA 1KGCD 1XGUB 3I75B 4QYOA 5KSBB 3PL6D 1XGYH 3T0ED 1TZGH 2X5PA 3LKRB 5CJ5A 3MRDA 1A7NL 4Q9QH 5I18H 5K9JL 3IDMA 1QFHA 4S1QL 5EUOA 4OLVH 2UY6A 5I75B 4MHHI 4WEMB 2WUBH 4IDJL 3HNTH 1EEQA 1OB1B 1NUDA 3SDXA 3PWJB 4MA1B 5F1SA 2P7TB 1UEMA 1JGLH 1SYSA 4DOHB 5J56B 1E4JA 2OTUA 2XFXB 4M5YH 2X05A 1KTKE 3O6ML 3VFGL 2KPNA 2CXGA 3OZ9H 1FL5A 3OJDA 5T3XH 1RHFA 4JHWH 5HHMA 3QDGB 3T4AB 3WO4B 4JY6B 5DZOA 1JHTA 4MNHB 1QBMH 1UACL 1EEZA 4MZ2A 5CUSH 1S7RA 1RIUH 3QT2A 4UILH 2IQ9H 1J0KA 2ZPKH 1Q0XL 1JWUB 4LAQL 1P4BL 3TJHC 1MAKA 4X6CF 1BJMA 1HIML 3TH3T 1MEXL 2P24A 2YC1B 5C09A 2EDYA 4OB5H 3I02B 2IADA 3G9AB 1HQ4B 2DJ4A 1U95A 2WUCH 3HUJB 4WWKA 1ACZA 3AY4C 5TGBB 3VH8B 4PRID 2Z0BA 3ARBC 4OZGA 5TH2A 1I7TB 3T3PF 3HPLA 1EO8L 4IIQA 1RZKC 3X3FL 3BD4A 3UTOA 4RFNB 1X44A 4WEBL 3E3QA 4U1MA 4XTRC 3OB8A 4R0LB 4AIOA 2V5RA 1ADQA 4CU6A 1FNGA 5E2UH 1QA9B 3PL6B 3RNKA 4PJFA 3EFDL 2EIBA 1BOGA 1WWWX 5F9WB 4KDWA 5CEXB 2DLIA 3ALPA 4ISVB 3GIZH 3O41B 5J6HB 5KVFH 3BE1L 4XXDA 1FIGL 3LEYL 3BKMH 4PB9H 3O9WC 5DGQA 3WJJC 3WKNA 2PR4L 3MNWB 3U6RA 2VISA 1BZQK 5LGHH 3NCJL 2W38A 2NY7L 5KW9H 1FVDA 1V5JA 5I1LB 3QZWB 3OV6A 2OBGA 5DD0H 1UVQA 4C56D 4TSAL 2NY3C 2A9NL 2B5IC 1LP9B 4OKDA 1T2XA 4LPVA 4P5KB 5DMYA 1T5XA 2NMSA 3VI4E 1M05A 4YFDB 5E8EA 1XF5B 4H20L 1RZ8A 1X6LA 1N6UA 1IGML 5C0RL 4DN3L 5CEXA 1RZ7L 5GS1A 5I8OH 1G7JB 5F88B 2MCPH 2K7QA 2APXA 2YA1A 1OAYH 3QUZB 4JKWA 4OFDA 4WU5A 5CP7B 5FDWA 4FABL 4JE4B 4KKCC 4KZEH 3QZWA 1RVFH 5D5MB 1HHKB 1J5OL 4EVNB 4I48B 1CQYA 1MQ8A 1KTDB 1UWGH 1P69B 4WUUB 3BGFC 4Q0XL 1CYGA 1JF1B 4HK0B 3QUZC 5EULV 3DX6A 2BNUA 2HH0H 2ITDB 4P2OA 3UC0H 5DD1H 1F3JB 5HHOB 2MMXA 5EZLB 2BHZA 4U3HA 1CGSL 4KQ3H 2UWEA 1LP9E 3OHXB 4G59A 2DN7A 3TO4D 1ZA6A 3MUHL 2NY4B 1D6VL 4HV8B 4K8RH 2CH8A 3NFNB 3WUWG 4X98B 3WS3B 4NO0B 5KSUA 1FLRH 3T0XA 2JB6A 3GSVB 1IAOA 4ZO9A 4QHMB 4MXWL 4ZTPL 4MVBD 4GQ9H 1T0MA 1GGIL 4JN2A 4NUGH 3TGXA 1VFBA 3WS6C 1BPVA 2P5WA 1XGQB 1FZKB 3OR7A 3MJ9A 5IEHB 1BEYL 3B6SB 1I1AA 5I74B 4IRSB 4AQ1B 4UNVA 3LN4B 4POYA 3O3BB 1B0RB 3VD5A 4JVUA 1TITA 1KLFA 1QBML 5HGGS 3H7LA 1ES0A 2NXZC 3GSOB 2VLLA 3QEQD 4UV4H 3V7AE 5E6IB 4KRPC 4GRLC 1LVEA 1KV3A 1RZGA 5CP3H 2B0SL 4M62H 1HINL 1BOYA 5IMOB 2OTWB 3FO0L 4YDIL 3DMMA 4XPHH 2UWEE 4PLKD 5JPNB 1LEIB 4NFDA 3BH8B 5T1MA 4WI4A 4M7ZC 3EOBA 3FT3A 4IRZH 1S7TB 4ZSOB 2Q8AH 1EVUA 1OTUC 2NY1D 4O4YH 3QHZL 2ZCLL 3BEVB 3ARXA 1DBJL 5IWLA 1GGTA 4MAYB 1S9WB 1U3HD 3IJYB 3WFCL 5IFAH 1XZ0A 5IT2L 1QNZH 2AGJH 2FH8A 5D1XA 1RUQL 3WFDL 1BBDL 5J1AB 5GS2D 4YGAB 4PS4H 1UCBL 4XPFL 4KAQH 3L3DB 3WJLA 1C5BH 5GGTH 2WBKA 2VB5A 2XY1A 3UPCA 2X1QA 3ZYOA 5DT1H 1RIHH 2FD6H 5HGBA 5I0DA 4OFYD 4RMQA 1EO5A 2VL5A 3I6LD 5LBSH 2JCCB 4LKXB 2YOCA 2QV2A 1R0AL 1NJ9A 3EYUL 3G5XB 3HE7D 2IPTL 5BS0D 5I15H 3NZ8A 5F7YC 1CGYA 1PGRB 1QO3A 4YBLB 4CVXB 2GUOB 3MOAH 1BGXL 4O2EA 5DD3H 4XRCA 4Z77A 1S7UB 1RZJH 4MJIE 2H9GB 4S1DC 2EEAA 3FB7A 4JPKL 3TN0A 4WDIA 5F9OH 3MRRA 2CUIA 4UI2A 1Z0MA 5F96L 3VGFA 1GOGA 4Y19A 5HHNB 1NANH 1CVRA 3P4OA 1U93A 4HUUB 4PJAA 1ROWA 3HC3L 2JJSC 4YGVA 2AABH 4GG8A 1C5CL 1VFMA 3WXWL 1I9EA 4P2RB 2ADJA 3R1GH 3T2PA 1G9NC 3UYRL 3BEWB 4CN4A 1OAZL 4HBCH 4LHUD 2NXYC 3PJSB 5HY9B 4JFEA 3QIBA 3QG6A 2EYRB 2XWBB 1ODAA 2Z8RA 4ODSH 3TPUE 5FGBC 2P48B 5BVJB 2B4CH 1J1OH 2FX7H 4NZTH 4V3DB 1FL6B 1DLFL 4BQ8A 5GGRY 2VDPH 2Y25A 2CRMA 4I77H 1LO4L 3RTQB 1U3YA 2CDFB 4NSKB 4XZUA 4XCCH 3PP3K 1EERB 4LIQE 4LSQH 3T77A 1EXUA 3ZDZF 2KQMA 3QNZA 4ONHB 2ZKHH 2NY4C 1Q8MA 4NUJA 1MCPL 4DK6A 5J57B 3U0TB 1A6TA 2WW8A 1YN6B 2YR3A 3MLXH 4W6YB 2FLBT 2LU7A 5CINL 5DHVA 3VA6A 3RNQA 2B1HH 2P42B 3VFMA 1JPTH 1XIWB 5TQ0H 5DJAA 3DLQR 2NZ9C 4WU7B 3D85B 5GRWA 3EJYC 5D7LB 2JCCA 5FYJL 5C07A 1KCVL 1BX2A 5E4IA 4DEPC 1F90H 4OFPA 3Q5TA 3MXVL 5IBUB 3PDDA 1CXEA 3JWOC 5JW4M 2IAND 3BPOC 4OZIE 1V7NH 4P9HH 5D7JA 4K7PH 3QEQE 1NFDF 2H2PD 2Y5TA 3QH3A 5L8JB 4ZYKA 3BP7B 4CNIA 2W9EH 4NNPH 2PXYA 4LSPL 2WZPD 3V6OE 3HPLB 4MQ7A 3SE4A 4NC0B 5K59F 1KB9J 2XRAH 1TMCB 2V7HB 3O4LE 4JRYE 5MEPA 4HGWA 4JCLA 3UJIH 2EYTA 4K71B 1LILA 3VW3L 1LK3L 1XGPA 4NKMA 4A2LA 4BKLA 3VGEA 1JWMA 2X1XR 5ACZA 1ED3B 1NFDB 3TCLA 5JPNA 1EDQA 2W60B 3TO2A 4OSUL 3X14A 5F93C 3AM8C 1CFNA 4FQXC 2P44B 2MCG1 4M4PA 4RFNC 3MJ9H 3KPOB 4N8VA 4WUUE 4PBVC 2VIRB 1ORQB 5C0CA 1FZMB 3BMWA 5EFIB 3BH9B 3UTTE 1WAAF 2UZXB 1YMMB 4OGXL 4HSQA 3M07A 1FNGB 5E00B 1GXEA 4ORGA 3SE4C 3HC0B 4EUPB 4PD4K 1B6DA 1EMTL 4QHNB 2VXUL 4OFIA 3RJQB 3PIQB 1H15B 5I66A 5IB3B 3JXAA 2IJ0C 1BZ7A 1ZHBA 4EIZC 4R8WH 1R3KA 2P5WB 5EU6E 5KVGH 3L3IB 1TMCA 5C08A 3MLSH 3GJFB 4L1DA 3B9EA 3SDCB 5K59E 2FL5A 4LLYA 5HDOA 5C0CD 5AEAA 2A1WL 1IAOB 3ARFD 3BQUA 4HBQA 1TDQA 2AV1A 3WL9B 4LLUA 2X89D 1GC1H 4RMRA 5FUOH 2NY0C 3ILQD 1WC7A 3ZTNL 4N8CH 3VFOB 1N64L 3MZTA 1BD2B 4WCYH 3IDIB 4UTBL 4M8QB 2V2TB 4M3KB 2Q7YA 4ZQKA 2P46B 2QHRH 4JHWL 4CGTA 4OM1L 2A38A 1Z3GH 4MSWA 2FX8L 4MS8C 4XP1H 2IPKA 5FK9B 1MCPH 5ACMA 2D31A 4TPRL 1UACH 3P4OB 4JJ5A 1RJLB 5CP7A 5FDWB 1JGLL 3MRLB 2E7LA 2BVPA 4Z7QF 1I8KB 3IGAB 3ZDZE 5HYIA 3SJVA 3W0WE 4PV9A 1J0IA 4CMMB 2GSGB 3JUYA 4KV5F 3AB0C 2F54B 4DVBB 4PRNB 5JXAH 4U6YB 4WHYH 1QRKA 4XNUL 2Z92B 2Z91A 3B9KA 3IAPA 3GNML 1CE1H 4X6EB 1RUMH 5FHBL 5HPMA 3X3FH 2GJ6E 1P4LB 2Z8VC 1IE5A 1VEOA 1L7TH 4I0CC 1UVQB 1T1ZA 4KJYA 5KANG 4OJFL 1E4KA 4Y5VC 4L3EE 3HFMH 3Q5OA 3CLFL 4UINL 4J3WA 5B8CC 3BP6A 1IFHL 3MZGB 4RZCA 3WXVL 3KJ4C 2PNDA 4KK8C 5JW5A 2Q86B 3E2HC 4OCYL 4P9MH 5DQ9A 4M48L 2G2RB 1I7UB 5FXCH 2QSVA 1CFSA 2OI9A 3MPCA 3QB7C 4JREC 1GL4B 4HX1B 2FGWL 3VFGH 4S0TD 2VLJB 3S97C 2VABA 3TO4A 3MREB 2QHLA 5EO1B 4PJ7F 1CDHA 4K7FA 4ZUVB 5IOPB 2CRIA 3Q5YA 4HPYL 5HI4C 1ZOXA 5IHUH 1V3LA 2X70B 4DN3H 4G80A 5DVOA 3RWDB 4XBGB 4PY7B 2N7BA 2Y07H 4C4KT 3O4LD 4QEGA 2B39A 5D70L 2CUHA 3QDJA 2MTPA 3SHSA 1RULL 1UA6H 3KPOA 1N0XH 1YECL 3QIWB 3WKML 3FONB 1NSNL 1A21A 2AJXH 1AIFA 4PV9B 4CMMA 3TBYB 1U8KB 2YD8A 4LOUC 2FZ3B 3B83A 4JY4A 4OQTH 3VWJD 5GGUB 5SWSA 3PWNB 3MRLA 3MCKB 2R0ZH 5GGSA 2XN9E 4PJBB 3SCMD 3TH2T 5DFTA 3E8UH 4PJHF 4JO4H 3W5NA 1D5ZA 3ZKMC 4GAJL 1K2DB 5I1KH 4AQOA 4LFHD 4XBGA 1WT5C 2UY7A 5IW6B 1N6VA 3IS0X 4WHYG 4BH8B 3IDJB 5DRXA 1FIGH 3MYJB 3LEYH 5E2TL 4YXLH 1UEYA 3MMEB 1YC7A 4PB9L 4ZTPH 2ICWJ 3DV6B 2X4TA 1RY7B 3D0LB 2EYSB 3RX7A 3QEGH 3DTXA 2IC2A 4OF5A 4P57B 3GSVA 2MKLC 4HLZH 3EW3B 3WNPA 4HKXA 3LRSA 5TE7L 4UTBH 3FCTB 4IOIA 4Z7OF 5C0AE 4HKZB 3EYFB 2Z4QA 1H8NA 1I9JH 2FX8H 2I9LB 1S7XB 3CK0L 2XXMB 3D2UD 3OX8B 3S36H 3KS0J 3BUYB 1C5DA 1KIUA 4TUJB 4PYHA 3FO9A 1IEBA 3WFHA 1Q9LA 4H8WL 5F7DA 5A3IC 2PETA 3BISA 3KYKH 4G6KH 5D5MA 1M6OA 3WLBA 5AUMA 4X9BA 5D5MF 1X6NA 4QRQA 4Y4HD 4WFFE 2OXGA 3ZTJH 4YHYB 3MRPA 3CFEB 4FQ1L 3MXWH 2VDML 4OCLC 3R06A 2J5LB 3S9DB 1BZ9A 3DVGB 5TFSL 3IDUA 1S7SA 3PWUB 4LCIH 4K3JH 1VFBB 4U6YA 4BH7B 1U3HA 3MOBL 5DK2A 1A6VH 3D3VD 3LB6C 1ZVYA 5F70A 3W0WB 1QBLL 1F4YH 1FNEA 1MFNA 2X4SA 3MV8E 3ILPB 3NIGF 3S37L 3TPUB 4DGYL 2A73B 1LP9F 3SQOL 5HHXH 1NDGB 1TPXC 1J8KA 5LQBL 3RHWF 3RIAF 3V0WH 1VFAA 3RZWA 5AYQA 1DQML 1KYOJ 2W65A 2FBOJ 2O5ZL 4YHNB 3IFOB 5JW3L 4JFDA 4PJBF 5IVOA 4I0PA 3K3QA 3H9SA 1WZ1H 3ES6B 4FQQA 4J3XA 1FYTE 2YPVH 3K1KC 3V0VA 1HHJB 5E1AA 3DSFL 3LPFA 1NMAH 3DI3B 3BUTA 1A64A 3KPSD 5HHNA 2DOCA 3PV7A 4KVCH 4AH2A 3MRQA 3LHPH 2EC8A 2Q87A 2B7DT 4RDQF 3BO8B 1QYGL 2E3VA 1IEHA 3G5VA 8FABA 1SBSH 4GW4B 1HKLL 1HYSC 3PGCB 3QDJD 2P8PB 3D69B 3JUZA 1XF5A 1HXMA 2YRLA 3G5ZA 3QCVH 1NC4B 2VQ1B 1OHQA 1XF2A 2L7UA 4X6CB 4EZMA 4KMTH 3TEUA 3BI9X 5TQ2L 5DJCB 2G5RA 2J4WH 5DJCA 5HD8C 2D9QB 1MHEA 2VKWA 1CDJA 1UJ3A 1LO2L 1F58H 2XNAB 4WJ5B 4FQIL 2J8HA 4E9LA 1PX3A 5I1KL 2D0HA 1NC2D 4LLVB 1G6VK 5F96H 2Y06H 1MJ8L 4NKOB 5BS0E 2AXGB 3R4DA 4NZUH 5D7JC 1AGBA 4XNMB 4M43H 1WUNT 1HYRC 1QSFB 1TJHH 2VR4A 1YDPA 3GIVB 4K7PX 4JZJC 1A5FH 3CD4A 1JL8A 4LP4A 1HXYA 4X8JB 3L5HA 4Y8AA 2OR8A 1KLUA 3BPCB 5F7DB 4OZGB 5TH2B 3HNSL 3MBXH 1RU9H 3MRDB 4OCRL 4N0YL 2X4UA 1T4KA 3I02A 3C60D 3U1SL 5I1DA 4ODVH 1UFUA 4HKZA 1FRGH 4B41A 3IKCA 5B4MC 1R3LB 4Y16B 1T03L 5ANMB 1A4JB 3QR2A 4KKLC 1JPTL 5FGSA 3RTQC 2JIXD 1OP3K 5GJSL 1QP1A 1UG9A 2HVJA 3RGVA 4I18C 2R4SH 1K4DA 4LIQL 4FFVD 1QSZA 3O8XC 3MLXL 4PJ7A 5CZXD 2CLRB 2ZCHH 2ZOKB 4ODXB 4G8GE 2NQCA 5HVWA 1G7QB 3BPNC 1AQDB 1J1PL 3NA9L 1JYVA 1R5VA 3JWOH 4PJGE 5EPMB 3TNNB 2IF7A 3C6LC 3LKOB 1CLCA 3KWWA 3L6FA 3L3HA 4U1HA 1OP3H 1KFAL 4KI5F 3RY6C 5C3LD 1S8DB 2PKDA 1AXSB 3PHQA 5JIHA 1DQMH 3MXVH 2I5YL 4H5SB 4BSWA 5I8KH 3WUWB 2BOCA 2ENYA 2G2RA 3DRQB 1LK3H 1FSKB 4PG9A 4GXUN 3BQUC 1RIVH 4RMUA 1MREH 1LO5A 3EYOB 2EEBA 1ZVSB 1S78D 3FJTA 2ZUXA 1DE4B 3KYMB 3LKPA 3BSZL 1QSEE 5AWNH 2R69L 3HR5A 1EBAA 2CDGB 1MRCH 1NCBH 2A83B 4KVNH 4LU5L 5J11B 1QZ1A 1HEZB 3L3HB 4QRUA 4JR9L 4LRNL 1KNOA 3A6CH 4HIHB 4NC2B 5DFVC 5HHPA 5JZ7C 5LKNA 3HE6D 2BZDA 3QFDB 5F9JB 2GTZB 3DMMB 2EIEA 3RY6A 3BRGC 2J6EA 5LXGL 4TTGA 4MAUL 4Y8DC 4U1IA 4GLRH 4D8PB 3ARUA 1WVZA 1RZJC 2X2YA 3DGGA 3ZT5A 4DVRH 4LCYA 1BF8A 3CDGA 1FVCB 1ORSB 3HUJF 4N0RA 5JOFB 5C8JB 1I8LA 4JFFD 3REVA 3UROR 2HFGL 4M7KH 4LVNB 1UH4A 1XIWC 2RQ8A 4HIJB 1EAJA 4LAJH 1O7VA 3L3OA 4K7PL 1FC1A 4U1SB 1F8TH 2HJLB 2W9EL 3QFJE 1K9TA 3FRPA 5FYKL 2XICA 1MI5A 5CSZB 2ZCKH 4NYLB 1AKJA 2VOTA 3ZHLA 1NC2B 4XX1E 4PJ5A 1YUHB 3O41A 4L8CA 2VXSL 8FABB 4K7FB 4YXKH 2YKLH 1U58B 3R0MA 1CLYH 4DUWA 1KULA 3L9RA 5JTWA 4M6AA 3MO1B 1T6VN 1N64H 3DGGB 2VLJE 3GSNB 3HNSH 3MBXL 5JIIA 2OZ4L 4MJ5A 2RBLA 1YEDB 3KPPB 3L3JB 3FFCE 2X42A 4LCUA 1G7HA 4IIQB 5KVEL 4XMKH 3OSKA 1X4YA 4K7PY 5CFHA 1T03H 3CVHH 4IRJB 2CMRL 1ZHLA 5C3TA 3MRHB 3ZE1F 2DDQL 4KK6D 3O0RL 3ZYJA 3C08H 3QUYB 4L3EB 4N0CC 5C0ND 5IB5A 5DMKB 5JXAL 2GI7A 2IMNA 3KYMA 1U6AH 3NOIA 2H2SC 1UM6L 1EFXB 3PQYB 1RUML 1B90A 1A22B 3OXSA 3FB5A 4ODUA 3V8OA 4ODTH 2AJVL 2FL5B 3RVXD 4WNQB 5SWZD 4MD5B 3UP1A 2EXYD 2K1MA 3CMOH 3NN8A 4HZLA 4ELME 3TF7A 4I3SL 1RZKH 3TN0C 4OIIH 4LVHB 4ELKB 3G5VB 5E8EB 1YEGH 4FNLL 5D8JH 5IVXF 5DA0B 4QCIA 5D1QA 1QRNE 3TZVB 1U36A 1X5JA 2C26A 4JQXC 5DJYB 3H9ZA 4XWOC 3D3VB 2ZUVA 2BSRB 1LO3H 1IC7H 1FZMA 3X17A 4NQSB 4G43B 2DM2A 1UB5A 1JNHB 2IBZX 4OD2B 4WNQA 5GRVK 1FG2B 3U83A 3EYSL 2NTFA 1HHIB 3BP5B 2R69H 4P9ML 3Q1SL 1MNUL 1T89C 3FMGH 1T7VA 1NCBL 3CXHJ 5E94A 2QSTA 4NP4H 1RZIB 4TNWF 4X98A 3CAFA 5I1EH 1U8HB 3T65B 2HFTA 1PVHA 4P3CL 2E9WA 1FSKC 4Z7VE 3S5LA 1AFVH 4Y1AD 2ESVE 4YPGB 5C0FB 5J4MA 3CIQA 5KSAA 4IRJA 5LXGH 4WW1B 4X6FB 5A40E 3OKLA 4PJIB 4B53A 4X6FA 4F15C 1MSPA 2DQGL 4NGHH 4I3RL 3QSKB 5I19L 2WBWB 1MCQA 1VPOH 1G7IB 5JW4N 4NWTL 1CLOH 4B5EA 4V3EB 5F7FA 3GI8H 4M5ZL 4YHIB 4TSBL 3RA7H 1W0YT 2R0WL 2CK0H 3VDAA 3U0WH 4N90D 2VIRA 1T89A 2PO6D 5FKPA 1CFVL 3G6AA 1WSST 2RHEA 3BHBB 5BXFB 4R0LC 4KJWC 2OL3H 2XNAA 4WJ5A 3TO2B 2GITA 3VWJB 1NFDE 3FZUC 4RWYL 4IRSC 3V6OC 3V5DA 2BSTB 3WFBH 1G6RA 2PXYC 4ZS7L 1ZLVH 2PW2A 5HDBF 2CSPA 4P2CG 1K3ZA 1K8DB 3G6DH 3T1FA 5D7IF 2ZG2A 4O02L 3SDYH 1JTPA 3RIFF 4F3FA 2BVQA 4L8SA 4XB7A 1S7VB 1LEKA 3O4LB 2EDNA 4PJGB 4Z7VF 2AEPH 2P5EA 4QGTA 5D6DA 5SWZA 3SGEH 1X5XA 1ZXQA 4KJQC 2XQYG 2YUWA 1D5ZB 3P4NB 3QIUA 1QR4A 2BVOB 2AXJA 5BVJA 4WFHD 5GIRA 2BOCB 4GUPB 1N6QH 2VE6A 3SE8L 2E27H 4MJ6B 2EIZA 4QY8A 3H42L 3FQTA 3OR6B 3TVMD 1JMZA 1P4BH 5KSVA 3UJTH 4KJPD 5J9PB 4G6KL 4TRPH 1NH6A 2DD8H 1YJDL 2NTSP 3KPRE 2XZQH 1OSZB 3LQAC 5F1IB 3SDDC 1UM5L 3NCYP 3BFOA 3PXHA 4NQXA 1BM3L 1ZT7A 1ZEAH 1JGUL 1H5BB 3STZA 3IXTA 3O4OB 3T3ME 1WZKA 1J18A 5GHWL 5TDPA 1MF2H 3RDTA 4X5WA 3LD8B 4F8QA 3HNTL 43C9A 3TFKD 4WDIB 1A6ZA 4D9LH 1VEMA 5GGVL 2AEQH 3LKNA 3WJLC 4WFFD 5F7KC 1FN4A 4PRPB 2BOBA 3Q6GL 3V6ZA 3DURA 1QSVA 4S1QH 4XNXH 4MA8H 2YN3A 2H26A 5C08D 4Y5YA 3QFDA 3EYSH 5F9JA 4WI8A 3DSFH 3R06B 3WIFB 1G6RL 1OSZA 5JW5B 2W0FB 5ADOH 3MBED 2C1OA 4JRXA 3L3OB 3R8QA 3E6FB 3TBSA 2VR9A 1HEZA 1KB5B 3MLWH 4JHZA 4U0QB 2EDWA 4H8WH 4JFEB 5IF0A 2A6KA 5HPOA 1MY5A 3CSBA 4OB5L 3FQXA 3S35X 4PGBB 5GGRA 4P2RE 2EDTA 1YPZB 1G7LA 4HFUH 3U7YH 4EDXB 2DIJA 3K80A 3VXUA 1Q0XH 3ZE1E 5HHQB 3GMLB 4HIIA 4KZDL 1A4KB 2E9IA 4KRLB 4MJIA 2E8YA 1CTOA 1FFPB 2OL3B 3BPCA 1J7VR 5D9SA 5IEKB 3O8XA 3EDEA 3H0TB 3KWWB 3L6FB 1UJ3B 1QLRA 2PW1A 3E6HA 4N5ED 4Y1AE 3BPLB 5IVNA 3HZVB 3SDDB 3BDXA 3VWJA 4JJ5B 2VZ1A 1WISA 4OD1H 1LO5B 5J13B 5EDXA 3SN6N 1FYTB 2H26B 1CDIA 4GAYA 4Y19D 5IESH 1KT2A 4FQIH 4P2OD 4XBPB 2Z9TA 3VGGA 2EKSB 1TJHL 2BXZA 2MQ3A 4JPVH 4JO1L 4PJBA 4LHUG 2OXHA 3A67H 2XWJB 1NEZA 4A6YL 3WFBL 3RZCB 1KXQE 4BM7A 4ZFFB 5DLMH 5F7UA 1WZ1L 4GKZA 4HWNA 3O2WH 4QHLA 5E2VL 4TVSa 2H32B 1QVOB 4P3DA 1CZ8H 4XWGL 2B1AL 1GGIH 4HS6B 5J12B 4EI5C 1YMMD 1V05A 1DBBH 3MSPA 2JJTC 1MJUH 3L95A 4QO1A 2CR3A 4MQXD 3BKCL 3DXAE 4WFED 5C0GB 5J06A 4CDHA 3RWGB 4RQQB 4CDGC 5IHZB 3I3EA 3U82B 3BEVA 3FL7A 4Z7OE 2QJDA 1LEKB 4AEIH 1YY9C 4HWEL 1Z9SA 1TZHA 4ZSOA 4G7YL 1IM3A 5GRJH 1CF8L 3CFJB 1DL7L 3MGTB 3PWVA 3VI4F 4LEOB 3L3KA 2HTLD 3L5WA 3HC0A 4EUPA 2E7CA 4UIKH 1P53A 1YJDH 2B0SH 4RAUB 3K7UA 3FO1A 4ZXBD 3JV0A 2HH0L 2CLVB 3ZHKA 3EDJA 1U8JA 4PJFF 3S3SA 1BM3H 3CFKB 1QLFB 3NFPA 4KKBC 4LIQH 5CJXA 1MCOL 1NCCL 1G0XA 3DHJA 4Z7WE 2MOVA 1U8LB 3FN0L 2X7LB 2JJTA 3VI3E 5C0AB 4G9FB 1J0ZA 3BZEA 1R24B 1I4FA 1AXTH 4Y5XA 3PNWB 2Q7NA 3GSQA 3LEXA 1KLGA 3QHZH 1JFQH 1GPOH 5IJVB 1D6VH 1H3XA 5KSBF 2FR4B 1QFPA 1FLRL 3GJEA 2BX5A 5CBAA 4OLEA 4LMQE 4N5UA 4QNPF 1AC0A 3LIZL 4EQ2A 3B6SA 1M4KA 1FFOB 3TPKA 1FFOA 2V7HA 5FM5O 2ORBL 4GXVL 4PB0L 3P9MA 2FATL 3EDKA 4LLVA 4JEGB 4JM2A 4GRWF 2BRRL 4H0HB 3GGWB 5EO0A 4RGOL 3U4EA 3QI9C 1G7PA 4RAVA 1Q9KA 3MTRA 4TN9A 4JREB 3V79C 4DFHA 1I1RA 3QUXB 4NN7C 4C59B 2OP4H 5HVHC 3L7EA 2HMID 1HHHA 3SKOB 4YK4B 4M62L 2R56H 3QNXA 4G9FA 1JCKA 3QUYA 4JZNB 4DKFH 4K8RD 3O3EA 1I7TA 3I50L 3KXFE 5HHOE 2HA1A 3DV6A 2ADFL 3S36X 2I27N 1ZHNA 4M8QA 1CD1B 2V2TA 1ZMYA 4G8EA 2VDNH 1LK2B 3RY5A 1CD1A 3A6CL 1AHWB 1MHHB 5DVNA 1ETZA 3ULUF 3PDOA 4GW4A 2R4RH 3Q3GA 3ARZA 1WWCA 3UTTA 1NCWH 2QADB 1D5XA 3QBTB 4KUCD 4F9PA 1OLLA 5D6CB 3L5WB 3CDCA 2VNCA 3HN3A 4ZOEA 1Y0LA 1QBAA 3G04B 4P57A 5D7KE 3DV4A 5F7EL 5DUPL 2FJHB 4N0FB 4P4RB 1IM3B 3FB7B 5I16A 1OAUH 3QXDB 5CLWA 1TVDA 4GW5A 4H1LB 5CSGA 3FONA 1JHLL 4NKDA 4HZLB 4PJHA 4ZOAA 5GGSY 3PHOB 4N1CA 4O4YL 3U36B 4XVTH 3UAJC 3KPSA 5L0QC 3CFEA 3IF1A 1NBYA 1AC6A 1A0QH 3JSSA 4EXKA 5LBSL 4TUOB 1QHPA 2QR0A 1Q38A 1BQSA 32C2B 4QRRB 5B3JF 3LKRA 1K6QL 3IJHB 3QQ9C 1OTSD 4ZAKB 3CH8A 3EYQD 4KKAC 4P2RA 1OGAB 1ZHKB 3HPJA 4PJ9C 3E3QC 3PP4L 1F3RB 5CSBA 3O2DA 1KIPB 4AENA 4F58H 1YEIL 4QXUL 1JTTA 4G7YH 3GSRA 5IR1A 4X4ME 4YC2B 5DC0A 1ZA3B 1S9XA 4FP8L 2IPTH 4XP9L 3VMPA 3BWUC 3GMMB 4CL7A 4E41A 1IM9B 1EGJL 1M71B 1S7TA 2M2DA 1U3HC 3RBGA 1M71A 1RUPH 4M8VA 1WBYB 2R2HA 1MH5B 4HJGA 2E5EA 3DUUA 3WFHB 4AIZB 4MNQD 3SJVD 5EZJA 4OIIL 5EBGA 5EUKB 1ZVSA 1S9VB 3FAXA 3SDAA 4A2MA 3CC5A 4KKNA 4TVPH 3SKNB 4HLZG 4F33A 5CEYB 4ODSL 3GMQB 4Z7WF 1XF1A 3IFNH 4NJAH 4OIBA 5DJXA 4MA1C 4QTIL 3IJSA 1I8KA 3IGAA 2VAJA 2VDPL 1KOAA 5CZKA 5D7LA 5I76B 2LU4A 1VFOA 1PFCA 1PG7W 1C8PA 1VGKB 1FE8H 1N8ZA 2R0KL 3FB8A 4GW1A 5EO9B 5EUKA 3OR7B 5IEHA 2Y36H 1DLFH 12E8H 2W9DH 5KVDL 3U0TA 3EIFA 5FIEA 2P1YA 1YEEL 3LZFH 5IJKC 4EI6A 4HMCA 4D2NA 4FFYH 3MJ9L 3WL9A 2J2ZA 2NLJB 5D6CA 3V9FA 4JKMA 4PYGA 3BDYH 1KIPA 5CLTA 1AI1L 1B0GB 2F58L 3RFZC 4RNRB 1R3JA 3BPOB 3IDIA 4PUBH 4JDVA 4L3CA 4JLRB 4Z7WA 4GKSB 3V4PH 4LKCA 4K94H 3ZO0A 4PJXA 4HCRH 3RGVC 4ZUWA 4HMEA 3UBXG 2XV6B 3GBML 5INDA 2O5XH 2IG2H 1AGFB 1JGVL 3TO4B 2NW3B 2XRAL 2LFGA 4BJLA 4NT6A 3QIBC 1Y6MR 2OI9B 4JFYA 1B6UA 3O45A 3BPLC 3BH9A 5CJQL 3G5YA 1QFWI 3HZKB 2C7UB 2F5BL 5T1LD 3RQ3A 3F6IA 3TBVB 5CWSA 2F74A 5E99L 3Q1SH 4TTDC 5C6TL 4NWUH 4MCZA 1JPGA 4J3TA 2A77L 2AW2A 3WMSA 3S4SG 4S0UC 5SX5K 3HI6H 4X6CA 4NQXB 1P4LA 3S6CA 3BP4A 1KEGL 3WUZA 3ARBA 3MLPA 3TBWB 5IK3B 2BHYA 4EEEA 3T0DA 1OGAE 4X4ZA 1RZFL 4NPYA 5DHVH 1ZS8B 2H2PC 4XP5L 2VLRB 5C0CE 3F65A 3H42H 2EZ0D 1MFAH 4C56B 3WIIL 1AGDA 1C12A 2DD8L 4M6OL 1WK0A 2Y5TB 4Z7UA 5E2WH 2NX5E 5J1AA 4NHUB 3C9NB 4KZEL 2VQTA 1U8MA 1W0VA 4MWFB 5D2LB 4LPYA 4U6HB 4MMZC 2CK0L 2VRAA 1J5OH 4EUPG 4TULH 1FH5H 1MF2L 4U3XA 4HUNB 3GI9H 1OWRM 4R8WL 1HK6A 3D85A 4N0UB 3THML 1GZPA 4XNYL 1UYWH 4WFHE 5T5FH 5I1JL 3QH3B 5IJVA 3Q6GH 4OKVB 5JDSA 2COQA 2DQDH 4MCZB 3OKYA 5IKCA 1JFMA 3CU1A 2J8UA 4G7VH 1F02I 3UTPD 1VACA 5EU5B 2MQ0A 4WV1A 4JM2B 4M7JH 5J89A 4P59L 5EIIA 1OWWA 2AJ3B 1UXSB 2XFXA 4XXDB 2EKSA 2BFVL 4XP4L 1YNKH 5D2LE 1JN6B 2E9JA 1A7RH 3U48A 1G6RH 1R3HB 3VWKB 1CLZH 4HWUA 4AH2B 4XNUH 5D2NA 2F53B 1IGIH 2AK4D 4LSTH 3N9GH 4WTWA 3W9DB 3ULUE 3OF6A 1Q9LB 1UJ3C 1S9KC 5L2KA 3GB7A 4N1EA 5IHZA 2IADB 1CGXA 1INEH 3OPZL 2EH7H 1BFVH 3MRCB 2AJXL 1WFTA 2PXYB 2NNAA 2FJHA 4N0FA 4XPHL 2O5XL 3ULUL 4X7TB 4BA8A 1FJ1B 1QG3A 5DEGB 1A7PH 4O2FB 5DEFA 2J8UF 4FS0A 4OKVA 5H35B 3PXJA 4KTEH 1FZOB 3B43A 1A7BA 2PTTA 1D5BA 3MFFA 3Q3GB 3BP5A 2I60L 3NIGE 5GZND 5E8NB 2AJYL 4XAWH 1BQLH 1SJHB 2JF1A 1C08A 1MPAH 3H9SE 1VDGA 3BRFA 4MQ7B 4NQDD 1JUFA 4P2QD 4D0CB 1U8QB 3RI5K 2HLFC 4GSDH 4HLJA 4PJBE 3P9LA 1ZTXH 2DWEA 3G6JB 3RWCB 2XKUA 4A6YH 4XPGH 3GMRA 4HXBL 1FNEB 3HI6L 3W39B 5DO2C 2FGWH 4LEXL 4HHAB 2V9TA 4X5WB 1B2WL 1U8IA 4XCFH 4KC3B 5EIVA 4FFZH 3QWQB 4UDTB 5C9JA 1A7QH 5ILTH 1YECH 1ZLSH 2VLKD 5DS8B 5IHUL 2L0DA 1GOHA 3T4YB 3C6SB 5GPRA 4C57C 5T3ZD 2WQ8A 3DXAA 2AAVA 3GRWL 2HT2D 3MLUH 4MX7B 3W82A 5IMLA 1A7OL 5MEOB 3BOVA 4HKXB 1MH5A 1IEAA 3H3KA 1FVDB 2ARJB 1QACA 4PG2C 3ARDD 3VGAC 3KGRA 3WJJA 2UV3A 3UBXI 5E24E 1T3FA 5ESAA 1BJ8A 3FN9A 3MUZ1 2GTZA 5I1AA 4F7EB 3SGKC 5IESL 2AABL 4WWKD 3VG0L 5KS9F 1AO7E 1UXWA 3MRIA 5CHNB 3MLRH 3QIWC 3ESUF 3O6KH 3DTXB 3V4UH 4G6AD 2D03L 5LQBH 5FYLD 2YK1H 1NCTA 1INQB 3L5IA 1FNSH 3OB0H 4C55A 3MLVH 2X41A 4M7JL 2C4XA 2B1AH 2ORBH 3H8NA 1R5WB 4UBDD 5EO9A 1J10A 4HW6A 3WFZA 5DRZA 4CVXA 2EECA 1DDHA 3L5XH 1MI5B 3QUXC 4IRSA 3V6OA 4FQPA 3UZEA 2E7BA 1WCQA 4M9PA 1I85A 5TF1L 1TQBB 5HDQL 2NXYB 2JELL 5A2LH 1IAIH 1N59A 1NGWA 3U2SB 4LSQL 5KOVC 3PGDB 4DKEL 5B3JE 4HHAA 5I16B 3FQTB 1TVBB 3F7RA 3N9GL 2H9GA 5D2LF 2BVPB 2VLJA 3HRPA 4XH2A 3LY6A 1KSRA 2NX5A 4FXKB 1I8LC 3QIUC 5IIEA 3QDMB 3SBWA 3O45B 1CDCA 1YEKL 5TDNB 5BJTA 3U4AA 2ITDA 1MHHA 1X7QB 4H1LH 1DUYA 3T2NH 2WWMC 4PRPE 4JB9H 4X4XA 1RQ5A 2OR7A 5D4QA 5HJ3A 3ZSTA 1MCWM 1YY8B 3H9HB 2O5YH 3NCEB 5CEZH 4DUXA 3FN0H 3MOBH 1LQSR 4ZNEE 2WBJA 1F2QA 1P84J 4I5BA 1JHLH 3EFDH 3I9GH 3LV3A 3RUGF 1HQRB 5D7SL 3QG7H 1R3IH 5DEGA 2P8LB 3P30L 4ELMF 1WEJH 2YRPA 3MV7A 3BVNA 1TJIL 5F7EH 3LPWA 3VXRE 1JHKL 5HGAB 5JMOC 4W6XB 5C09E 2DM7A 1D9KD 2R8SL 4GSDL 3GEWB 5ALBH 3FQXB 1BQHA 1ZSDA 5JO5A 4H5SA 4BUGA 3MQIA 3O81A 2PYED 2UYLA 5GJTL 1KTLA 1AJ7L 1Y18A 3KLSA 3QP3A 5GQBA 5GSVA 4OT1H 5DF0A 3IETA 1BREA 5DJYA 3FQWB 5CD5D 1DANT 4GBXB 3DMMC 1QSFA 2L7JA 1KCRL 1OGTA 5FA3B 4MAYC 1AXIB 3D18B 1G7QA 1EK3A 3WO3B 5EFIA 4KTDL 2NY6B 4LRIA 4RWHA 5AZEH 4DEPB 4KQ4H 1K6QH 4G9DA 4M6MH 2RGSA 2FECL 2WWKO 4POZC 2NYYD 5DJXB 2LVEA 3ARQA 4X6DE 5K93A 3QO0A 2EO1A 3CDYA 1VERA 4BZ1H 1DBMH 1PKQA 1U8HA 4X5XB 1XF3B 1NAMH 4CRPA 2GSIB 4HH9B 2Y06L 3T8XA 1UWGL 5C7XH 3EHBC 1A1NB 3CFJA 5TQ2H 2XN9D 5DUPH 5AG8A 1FHGA 4YO0A 4MXQC 1MHCA 1I1AD 2P5ED 4WGVB 5DD1L 1S9VA 4U1NA 3VG0H 2ZNXA 2W1NA 1A5FL 1G9NH 4EN3A 4PGDB 2HAZA 2Z8SA 1MQKH 2EDJA 2IH3A 4YPGA 5IB3A 3C6LB 1PYWA 2FX9H 3QNXB 5BVPH 2XI9A 3KPPA 3L3JA 2QBWA 4I0PC 2A1WH 5TF0A 1S7RB 1QQDA 2ATKB 3QIUB 1MFDL 4OZHA 2XG5A 3QO0B 3GGWA 2YPLB 3ZDYE 1CXIA 3GBNH 1FAIL 4J8RB 4KRPB 3PDOB 5E9DE 1X9QA 4I0PB 3TIDB 1RAMA 4LPTA 5IMMB 4G9DB 1PZ5B 4KPHH 5F9DC 3IU4L 3U46B 1CD0A 1CXKA 4ZPTB 1AO7D 2SEBB 1Z3GL 3V6BR 1IGYB 4KVNL 4FFYL 4ODVL 4OCSH 3RVUD 4JR9H 4LFHG 1YN6A 4OQTA 3TZVA 3RKPA 5HYJD 5KVDH 1EGJH 4NM8H 3W0WA 1IKNA 2CRZA 4JDZA 3C5ZB 4YDIH 1MY7A 3P9MB 3ZE0F 3HS0B 3OKMA 5GISL 4L8BB 4J8RA 5KTEH 2EE6A 2OR9H 3UMTA 1KFAH 4KI5D 7FABL 2O5YL 3WSQL 2YPLE 4LASL 3P11H 4ZPVB 5FGCB 3GUTA 1H5BC 1I8MB 3BVNB 3WIHH 4OGZA 5MI0B 2VLMD 4ZS6C 4O2CB 4LARL 4LPCA 5D7JB 5LAXA 3PDGA 3P4MA 1D5XB 2HT4C 2NCMA 5A2JH 3CUPB 4JO2L 5DZNA 2B8OT 4YDKL 4S1SL 1OPGH 4RRPG 4U2ZA 2WWKT 5HYSG 1KB5L 3PABB 1OSPH 1W0WB 4KKLD 4ONFL 2IAMD 4P23A 3SE3A 1LGVA 3RL2A 4YO0B 4NBYB 3WFEH 2H1PH 3QQ4A 4OZIF 1QA9A 4M48H 5JW4Q 3ROLB 3NCCB 4LPXA 5DT1L 4QGYA 2HLAA 2C5DC 4MNGB 4PJCE 5D1QD 5I1GH 1JVKA 3FO2B 5CBEB 1JJUA 3BSZH 1DQJA 3HR6A 5HJ3B 1J0JA 4Z7NE 1JK8A 3VXRD 1I7RA 1MCHA 1YUHA 1VKXA 5A1AA 3ARED 4QF1A 3PE9A 5TDNA 2P7TA 3DYMA 5C09D 2CJUL 5DJ2B 3GSNL 3QQ3A 4L9LC 1I1FA 1JPFB 1CICD 3D18A 3QPXH 1XF4B 5I71B 1PKOA 2UZIL 5KANI 1KCLA 4R3SA 2VO5A 3DVFA 2P8MA 4L4VB 2HFGH 4XGZB 5EOQH 5AYUL 5IB2B 3QULA 5CAYB 1HN1A 1N0XL 4Y5XB 3GSWA 3MR9A 5ECJE 1M6OB 3CVIH 4HT1H 5HI3D 4NRYB 1GYAA 4A6YA 1A4JA 5D72H 1MJ7H 3ZL4L 4UIMA 4Y5XC 2NXZB 2NY2D 3THMH 3H6JA 5J3HC 3VXUB 3QFJA 3AMLA 3QFJB 1BJ1H 3BGMA 4F7MB 4GAJH 3ZHDA 4E0RB 1NGYB 4PGBA 2YEZB 1Z9LA 3HG1E 2X4QB 4YHMH 5HHMD 3QJHB 1RSFA 2F5BH 5IOPA 5JXEA 3DUSA 4HXAH 4FRWA 1L8JA 5CJOL 4Y4KC 1O7SA 3FHAA 1F45A 1NL0L 2ADIA 4Z78A 4M6NH 3RUGA 1IAKA 5SWZE 2P5EE 4I77L 3EYOA 5DHYA 3D39D 3N85L 1AGCB 1HILA 3I2CH 4F7CA 2YUZA 5MI0C 3ET9F 2Y6SD 5DTFA 5GGUA 5SWSB 5LGJB 1QRND 3OGCB 3CMGA 3T0VA 1QPXA 4ODTL 4HJ0C 4XAKD 3CMOL 1RUAH 2I24N 5ENWB 3ZT7A 4NC1E 4I3SH 4YK4C 2WUCL 1LO0H 5E9DD 1ZWIA 1LHZA 4JZJA 1JUFB 4ONGL 4XPBL 3V4VL 3CC5B 3HB3C 3BAEL 4LSTL 5D8JL 3MV7D 4ZOCA 1ADQH 1IAKB 2CLRA 1MEXH 1IL1A 3PGFL 5FF6B 5FO9B 1MRDL 3LKNB 1XGYL 2UWEF 2BVYA 1EH9A 3HRZA 1YN7B 3C5ZC 4X5LA 3C5SA 1XH3B 5I2IB 3WS3A 43CAA 4DGVH 5I1CH 2NY3B 5I8EB 1T0NA 4OGAC 2I9TB 3BGMB 4F7MA 4MD0B 5DHYB 3TT1H 5GRUL 4ZQKB 2Q7YB 5HI5C 1SJHA 4NKOA 4KXZH 5IGXL 2XPGA 1KNOB 4G6FB 4LLWB 1BQLL 5H2BA 3MJ7B 4JDZB 1XAUA 1YC8A 5HHVH 1TTGA 3CJJA 4D3CL 3ZDXF 4BZ2L 2C3HA 4XX1G 3PV6B 5D6DC 1DE4A 1T1ZB 3QUXA 4C83A 1PQZA 4CN1A 2E7LE 1IGMH 1IGJA 2BY0A 2BNQE 2W0FA 3O3DB 1A1MA 5CZVL 5I6XC 3IF1B 4N8PA 3RVTD 4K3HA 1CL7I 2YD5A 5BXFA 1NGQH 1SEQL 5CJBA 3QPXL 3AXLB 1RZGB 3DJ9A 4G5ZH 1HIMH 4L8SB 4KROB 3TA3B 2H41A 1S9YB 3SE8H 5DRWA 3K4ZA 4LSDA 5A16B 1K8DA 2BVTA 5B39B 1UGNA 2KH2B 3PQYA 2VSDA 1AQKH 4TSCH 1IC5L 4OQ1A 4OI8A 2DL9A 1P4IH 4YR6B 4Q0XH 3QA3A 4NWTH 3DBXB 2OI9C 2M1KA 3C09C 2AI0L 4L3EA 5DURB 3KJ4B 4PRHB 4TSBH 3STBA 3INUH 5CILH 4YXHL 3H9SB 3ZTJG 2NY5L 1RVFL 1P1ZB 2KL6A 3QCUL 1JF1A 4X7CC 4JPWL 1QKZL 4ZS7H 2L4OA 4X99B 3RGVB 3VXSE 3MJGX 1CDGA 3H9YA 4OZHB 3FTGA 1V8HA 2N1KA 3NABH 1FPTL 2OL3L 4NHUA 1FQ9C 1CGSH 2A73A 4KQ3L 2KBGA 3S98A 4LHQB 3ZTNH 3ARBD 3SKJL 4L4TD 3L9RB 1VSCA 3HCVA 1EV2E 3C2SA 2YK1L 5DUML 4LEXH 3P77B 4X4YA 4Q9BA 3N85H 2VLKA 3KPRD 1HZHH 4Z18A 5DK2B 4NQVB 2PTUA 1B2WH 4YHPA 5IJKA 5DVMA 3OKMB 5EU6A 4G8GD 4ESKA 1NC2A 1XCQA 1AE6L 4YAQA 5IP4A 5C0RH 1BEYH 3EDDA 4U1SA 4F37K 5ISZB 4Q7DA 1QHOA 2R1YA 3SGJC 4FHBD 6CGTA 3CX5K 3WNMA 3TBTA 3QDGA 3QDGE 3F7YB 2HWZH 4ZPTA 5HYJA 4Z0BL 5GJSH 3VE0B 3B2VH 3T2NL 5HTSA 3SKUD 3QRGH 5C07B 1RMFL 3ZLQC 3GMNA 4FXGA 1MRDH 3GSXA 2ZCHL 4R2GC 1F4HA 5T1KD 3VFMB 5I71C 3UPRA 5HHPB 4FZ8H 1NMCB 4OUUA 2OS7A 5BV7L 4UDUB 4JFFA 5BQ7A 5GHWH 3H3PH 1WV7T 5A16A 5CGYD 2OL3A 1T2QL 3VFNB 5KG9B 1QNZL 2AGJL 2V2WA 4MXWH 5DSCB 4WGWB 1J9CT 1R3IL 2WLZA 3FAWA 4I4WA 3P2TA 5HYEA 3QDMA 3E1F1 3VXOA 4J6RH 3WN5C 4BZ2H 4PRBB 2DKSA 4DZ8A 4XCNA 5EZIH 4RIRB 4I13B 4PJEF 1EEUA 3WHXB 3ZKNC 1AGDB 2XTJE 3E2HB 5ICYA 3JTSA 4C56E 5JOPD 4HFUL 2YD2A 3VH8A 2V6HA 3RVVD 4GKSA 2OSLB 4KQ4L 1T7ZA 4LP5A 1BFOA 2ARJQ 4BFEA 3D39A 4HUVB 3TA3D 5FHAL 1AD0A 2DM4A 5IBUG 2EICA 5ID1B 4JPIB 4PY7A 4HS8H 2Z31D 3DSNA 3MACH 5D2NC 5AZ2H 1ZAGA 5DHXB 3BZ4B 4U33A 5I76A 2YZ8A 4E41E 3ZZ1A 1CL7L 1BGXH 4M6ML 2DLGA 1CXHA 3REWB 3PWPA 2XA8H 1KG0A 1KJ2B 4HX1A 1RURH 3KLAB 2Q8AL 3DGCR 4N90E 4PJAE 5K9KA 4LSUL 2MPAH 1JHKH 3NCBB 5ESAB 4LSRH 2R9HC 1EFXA 5HYSB 1FPTH 4ZUUB 3RWDA 3FQWA 4GAGH 4AEFA 1DBBL 2Z31A 4Z5RB 3PV6A 4UT6L 2B4CL 5ICYB 4AY0A 5F9WC 2WV3A 2HTKD 4NQCE 4AYFA 3N06B 1JZ3A 2BNQA 1OY3B 1DUYB 1X7QA 5GRYA 3UTQA 4XMPH 4HWEH 4O58H 1MFDH 5CMAB 4PG9B 1YMHA 4HWBL 3MV7B 1MAML 1MHPH 1S5IH 1R0AH 3HNVL 1OTUD 3LS4L 5DSCA 3SOBL 1YEDA 3QI9B 2ADIB 4Z78B 2BY3A 3GM8A 3IJHA 2GSGA 3MOAL 2GEEA 2AEIT 3EFFB 4LL9A 5BCAA 4RA3A 2EE3A 1T04B 4UOW0 1TJGH 5JHLH 4LCWB 1F42A 1DN2A 5B39G 1K2DA 5GRXG 3W81A 4F57H 2ZUYA 2CXKA 4LKXA 4KMQA 3D39B 1KXVC 3VD4A 5DJ8B 2QQKL 4PIRF 2VXQH 1GIGL 1WBXA 4OZGE 5IVZA 4QRRA 5D1ZB 2W60A 2YPLA 3R1GL 4P5TC 1YEGL 4FNLH 3ZKQD 5IQ9A 4HBCL 3LCYA 5JHDA 4JQIH 4WO4B 1PY4A 1I3VA 2NNAB 4F7CB 1GVIA 1WJ3A 3FOLB 1TXKA 2IPKB 3ARWA 1ZLWH 1T1XA 2FWOB 3NZHH 2Q3AA 1Q72L 4U1LA 4Q6IA 1NPUA 1TZIB 3CSGA 2OTPA 1EJOL 5DD5H 4XTRD 5EZJB 3VXUD 5L0QB 4LLDA 4KI5E 5J7CC 4NZDA 4D9QE 3OXRA 4O51A 2FEEI 1LEGB 1P7QB 2Q76A 3D25A 3O11A 4K71C 5EU3A 4BFGA 3X13B 1JF5A 2CIIB 3VFWB 5D7KD 5F7MC 4EUPH 4FFWD 4NN6B 1SBSL 3O9WD 4ACPA 1NUFA 3OHXA 1T83A 4L4VD 2GQHA 4OGYL 4GRMA 1ERNA 3MJ6A 5EOCJ 3RY4A 4DKFL 5D71L 1G1YA 4F9LA 2AKRB 5T1DH 1TVHB 5D1ZC 4HKJA 3KPMA 3AREB 4HK3N 4R4BA 2A6DB 3HA0A 1IEAB 4JN1H 3MNVA 2IALA 1J8HB 5CJXC 5JORA 3P11L 2F8XC 5L2JB 4UDUA 2Z93A 4NO5A 2Z93B 3K2UH 3MRMB 2VN7A 1AR1C 3I6KA 2H3NB 3SDXF 5H37H 4E42B 2KQNA 4IM8A 4X9GA 2EYTB 4LSUH 3CH1A 3SDAD 5AG9A 1FL3B 4HUKB 5EU6B 5F71A 1JK8B 2HMIC 1KB5H 1W72A 4UQ2A 5I8CA 1TQBC 4KY1H 1LNUA 4K8RC 4X9HA 5EZOH 2DLHA 4E41D 1N5AA 2HRPH 3MRQB 1IILE 3C2AH 4V1DD 5KSAC 5DQJA 4FTVD 1R3LA 4Y16A 4LPUA 5I1GL 3P4LA 3ZE2F 4DQOL 1GZPB 1DBAL 2JCCF 2ICCA 3SGDI 5DWUL 4OM0L 5FYJU 1CICA 4G43A 3ULVC 4ZMAT 1MFCH 3UCRA 2AQ3A 3BX7C 1XIWA 1GAFH 4EQ3A 1NCAH 4JRXE 1K85A 4NCC2 3VWKA 3KPNA 3KJ6L 2QEJA 5I73B 4U7SA 4RAVB 1NUGA 4ZPVA 1F11B 1SQ2N 3VGAB 4TVPL 4RRPA 1WBXB 3TESA 5FOJA 3AB0B 5DJ0A 4WI3A 2C7UA 4OZ4B 5L2KB 3PGFH 5C08E 4AEHH 1GHFH 1MVUA 4NCC1 3ZL4H 3NN8B 3W11C 3LD8C 1RJYB 4NJAL 1SM3L 3V5KA 4KRPD 2IFGA 5FHBH 5IKCB 2QLVB 5DJDA 3OKEB 4ETQB 1NDGA 1A6AA 3RNQB 2CDEA 2LAAA 2X4PA 2IANE 2VC2L 2XACC 2XWBA 1EVTC 5EBLB 2AXFB 5T3ZH 4TOYH 4OCYH 5C0AA 3F12B 5CJOH 1NC4A 1T7YA 3ABZA 5GGVH 1DR9A 4H0GA 1NQBA 3RKDD 2MJWA 4DWHA 4NRZA 4ISVA 12E8L 2W9DL 4N0CA 5HHVL 4WI9A 2JB5L 3U4BL 3EYFA 1QR1A 2D7NA 4U6HA 3OMZA 4OZFG 2EH8H 3EDFA 1D3CA 3VDCA 2F53E 4JZOB 5GS0D 2ZSWB 1T3FB 3LRHA 2XN9B 5IBTH 3OWEA 3NAAL 1T22A 1CFQA 5MEND 1M7DA 3NCYS 5EU3B 3DUSB 1RJZA 3AGVA 5EWIH 3T0WA 1QEWA 5MEPB 3ARFC 4UT7H 2NY0B 5DC4B 1BBJB 3L7FA 3MRJA 2AJZA 1Y6NR 3PP3H 2FO4A 4E0RA 1ZANH 4HCRL 3DXAB 4MD0A 1VENA 2R2EB 4XPBH 3IVKB 4FQ2H 4D9QD 3U7WL 4UIMB 4JAMA 2VL5B 2OJZH 3NVQA 2IFFL 2YRZA 4X5XA 2F58H 3CFIC 2ICEB 5IROA 1QSEA 1B4JH 5GRVL 4BQBA 2IMMA 5JQ6H 3X3GL 4MNQA 1WQVT 4HH8A 3HE7C 4QHUA 4QXGH 3OGCA 4Y2DD 4LCYB 5I8CB 1IBGL 1DQDL 4GRLB 2J7LA 1ONQB 4XC1L 3TWCL 1PY9A 3BGAA 2Q6WA 1DVFD 3AU1B 2CGRL 5C0BB 2IBZY 2ZSVA 3SDXE 3VFRA 1BIIB 4YFEA 1UYWL 3JV6B 3DVIA 2YKLL 5C2BH 3N1FC 3C87A 5F3HA 9CGTA 4HIHA 4JPVL 1D5MB 5TE7H 3M1BA 4LMQI 2DBLH 4OLWL 4ZFGL 3VXNA 3SEPA 1KEGH 1DBAH 5E2VH 2ICEA 3GMQA 1TCRA 5DEFB 1IQDB 4PY8I 5IR1B 3BH8A 1R6VA 5LWYL 3AAZB 3IDXH 2C3VB 4R7DA 1ZT7B 5J6GA 1OCWL 2WIIB 1M7IA 3BIBX 1OGAA 5T3XL 5FA4B 3BMVA 2P8LA 2PCPA 3QDMD 4CAGA 3VXSD 2FEDD 1UENA 3NCMA 2ITCA 1RIUL 4DK3A 5L7XH 3UTSB 3P0GB 4XVUC 1GJIA 3UTPE 1B0RA 1DQTA 4E5XB 1U3ZA 2VDOL 4HAGA 4LQFH 2Y1VA 4YDVB 4S1RL 4IJ3B 1GCFA 1TETL 2QADC 3GMNB 2GJ6D 5HI4D 1MI5D 1MCSA 3MJ8B 1BD2E 4UU9B 4TNWK 5DUBA 4PP1D 3TN0B 3OAUH 4IDJH 4JRXD 4PJ8D 4OCWH 1KIRB 4X6DA 1OL0A 5JXED 1MHEB 3U2SA 2VSCA 3EJYD 2O5ZH 4YHOH 2VR5A 5JW3H