1AGCA

Antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyql-7q mutation)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B*0801
publication title Antagonist HIV-1 Gag peptides induce structural changes in HLA B8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Histocompatibility complex
total genus 81
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1997-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1agcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1agcA01
3V0AC 3KXFD 3JUYA 2CXKA 2EIEA 1HHJA 3IKCA 2ZUXA 1QLEH 4ZO6A 1P9MC 5J12C 1NBVH 3G5ZA 1EO5A 3RL2A 3O2VH 3DTXB 4U6YA 4ZFOA 5CD5C 1YN6A 1D5BA 1P1ZA 4CN1A 1T22A 4FQJH 4QRUB 2VXVH 5I71C 4WCYL 3EDEA 4G6JL 4OSUH 4TVPL 4XNMB 4AENB 1KJ2A 1NCAH 4P5KB 4Q6YA 1A3RH 2VXSH 3MUHL 4YNYB 1B6UA 1BREA 4W4OA 4K2UH 3E3QE 1IBGH 1V8HA 4Z7WA 4YJZL 1OCWH 3I02A 1SVCP 5JIIA 5EO1B 1YEDB 3OHXB 3CDFA 5C86A 3KPMB 2D03H 4YQXH 1LE5A 3TH2T 1MCJA 3MNZA 4OKVA 3RWDB 1G7QA 1NJ9B 4RMWA 4TVPE 3TO4A 2XZZA 1KLUB 3KJ4B 4ZFGL 4JHWH 2NY1C 5E2VL 4DOHB 1QBBA 5KOMC 3D6GA 4ZS6C 1E27A 2GTZB 5I18L 4OZFB 1I7UA 3H9HA 4JRYE 4OZ4A 4PJ8B 3QHZL 2OI9B 1EEUA 3H9SB 4KKAD 4XTRD 5T3XL 4PJIB 2AEQH 3CPLA 5E9DE 3GHEH 5FUZL 4TULL 3TVMC 5I1GH 2JCCF 4X6CA 2DM7A 3TP4A 3UO1L 5DK0A 3KLAA 2MQ0A 2NZ9D 3QG6B 4DVBB 5I74B 1C16A 5IMMA 1FORL 4H0HB 4OIBA 5C0EA 2CDGA 4F8QA 5T3XE 5HYSA 4HG4K 4U1MA 1WWCA 1E28B 4XNZB 2P5WD 3BKML 3K2UL 3DROA 3MGTB 1I9RL 4UQ3A 2DQTH 3WFHB 5J9PB 4R9HA 1SYSB 1G0DA 4OGZA 5T5FH 5JOFA 3UYRL 1S7VA 3MMEB 4QGTA 1RMFL 5FYJL 4OCXH 4JGJA 2W65A 3GSVB 3J7HA 4ZDHB 3VXQB 4ODWB 5GGVY 1WCQA 1ZGLA 2F53D 1XF1A 4OCRL 4NJAH 5FA3B 3JZ7A 4I3SL 5GGRB 3VU2A 1LE9A 1PAMA 4N0CC 4ELMF 4M61B 5T33L 4U33A 3O3BA 3UTQB 4WO4B 3WXWH 2X4NA 3U9PH 4P2RE 1RVFH 3PHOA 4RAUB 5GQBA 1I8LA 4UOW0 1FZMB 1LO5B 3REWB 2H1PH 3U9UA 4BM7A 5KN5A 4JCMA 5K9KA 4GG8A 1A6WH 1AIFA 5FYJE 3U79A 2A6JB 4XVSH 3ARBA 4E41D 1FC2D 3OJVC 5JDSA 3AS0A 4NKIH 1OWWA 1R3HB 2YSSA 4S2SA 1Q9OB 2CDFB 1NGWA 4BFIB 1TZIA 3RWEB 4HKJA 4JHBA 3BPLB 2CJUH 4DUXA 1ZWIB 5HDBF 4NC1C 4QHUA 1S8DA 1CDYA 1FQ9C 4G9DA 1F6FB 1XFPA 2BNUA 3JXAA 4FA8A 3FKUS 4LCCB 3G5YB 5E94B 1QEWB 4WW2B 5IEKB 3ULUC 3AAZB 5DJ8A 3RZCC 5C08A 2C9AA 2CUIA 4NGHH 5HHMD 2C7UA 2EXWD 3LKOB 3WIHL 3FHAA 3UX9B 3G04A 4HFUL 4Y5VC 5A3ID 2OS7A 1FPTH 3VFNB 2P43B 5DD0L 4HXBH 4MD4A 5DRWB 1MCDA 3WEXB 3F12B 3RGVC 2DL9A 4Y5YB 4YDLB 3ABZA 3BEWB 4Z95H 5HI3C 4HFWA 3LEVL 1K4DA 2X42A 3LV3A 1LK3H 1PBYA 2VLRE 3U36A 2VLJD 1NC4D 3C8DA 2MCPH 1ITCA 2QHRH 1I7ZB 5KG9A 3MX0A 4DVRH 3I2CL 4OT1H 4QKXB 4N5EC 1XGPB 3QFDB 3IDGA 2DQGL 3QIWA 2R4RH 4E5XA 3I6KB 3IFOB 4NWUH 4HIJB 3GRWA 4W68A 3SDAB 4B50A 5LWYL 3RVVD 1G7PA 1HDMA 1AI1H 4XNXH 5FKPB 1CFTA 3FQTB 4QTHB 4ZOBA 3C6LD 3VXSA 3PQYB 4JR9H 1AGEA 4NT6B 3MJGX 5FDYA 1XR8B 3EKCA 1IKNA 2VQ1B 15C8L 5C0AD 4V2BA 2EIZB 3IDJB 2C1OB 2DM3A 4AIZA 4YHPA 1DVFC 3TBSA 5C6PB 1Q1JH 2DWDB 4X6BB 3PWVA 5JIPA 4OIIL 4OQTH 2BERA 1CGWA 3RIAF 3VGDA 1LP9B 4PJAF 5EOQH 5F9JA 5GZND 1S5IL 5L0QB 2FHCA 4JN2A 4HBQA 2VC2H 3BOVA 4G59A 2Q8BL 3A6BL 1NMCB 1S7TA 4FQ1L 1XF2B 1AGFA 1J1OL 1MUJA 2VUYA 3GI8L 4FNLL 1KCSL 5DUBB 4LEOA 5HPMA 3FT2A 4KDTA 4FABL 2YUZA 4P9HL 3RY4A 1HKLL 2R15A 1ZLSH 1KJMA 3CMOH 4HC1A 5CSZB 3WD5L 3ZE1E 5BRZA 2OK0L 2ENYA 5IVXF 2EDJA 1RZJC 2GAZB 2OBGA 1R6VA 3TN0B 3RWCB 5IKCB 4LMQE 4QCIB 1J0YA 4TSBH 4KI5E 1A4KA 3QG7L 3VFTA 1NBYB 4Y4FB 5MI0C 4GAGH 1QOKA 2Q7YB 2DD8H 2VKXA 2HRLA 4JFEA 4XPGL 2LVCA 2C3XA 1S7UA 1HWGB 5E1AB 2E7BA 3C8KA 2PR4H 1SM3H 1AFVH 1KYOJ 2PUQT 4OGXH 4A6YA 3MOAH 4NPYA 1U8LA 5CINH 4UNUA 4UMGA 5DJ2B 1EFXD 3D25A 1X4XA 4WU7A 2NY5H 4HIXL 4MA8H 2R1WB 1T1YA 5EBWB 5HHNB 5C9JB 4CMMB 3QXVA 2HRPH 3O2WL 2NTSP 5F1KC 3SOBH 3WO4C 2H2PD 1CFQB 1RZFL 4EN3C 2J5LC 1ETZA 5ETUB 4PJ5B 5HGHA 1Q94A 4MAYC 4PY7A 4DZBA 1R5VA 4KHXL 4YXLH 3C87A 3WUWB 4JFYB 4F9PA 4LCIL 3WKMH 1JZ6A 2FJGA 4NCC1 5F7LB 4EI5B 4U6VL 3V4VH 4P3WA 2ZSVA 2VISA 4UTBH 5DJCA 4S1RH 3MREA 2OJZH 1F4YL 3ROLB 3H6JA 3X11A 4F7MA 25C8L 4OLYL 3L3GB 1NGPH 3EYQC 1I4FA 4R90L 5DA0B 3VFOA 3BRGC 5KANI 1D5XA 1E4WL 2K7PA 3Q2CA 2V5TA 3TBVB 2BOBB 3MSPA 4YGAB 3NA9L 4MB4A 2IPTL 1H5BC 4RRPG 1G9ML 3ALPA 4TNVF 1QQDB 3QFJB 1G7JA 1NEUA 3QUZC 2PKDA 1EGJH 3T3PE 5KVDL 1Z3GH 3W9EB 4JG0H 1ZA6A 3MV9E 2IGFL 5IGXH 5HXMA 3L5WA 1S3KL 3SDDD 1F3RB 5I8CB 4L29A 2GK0B 3SDCD 3K8MA 5JQ6L 4Y5XA 1YN7A 5FUCE 2P7TA 4U4BA 3ZKXB 4GLRI 2V9RA 2G60L 5D9SA 5DK2B 5A16A 2E9JA 3RTQD 4DFIA 1U8OA 3SGJC 1B6DA 3ZT5A 4PG9A 3VRJB 1FH5H 3D2UA 2IAND 4H20H 2CUHA 1WCBB 3MBEC 3EJYC 3TZVD 4LAJH 5E99H 4DZ8A 3T8XA 3VWJA 5JNYB 1DLFH 2BY3A 4MVBD 3VXUB 4XP6L 5LG1A 1U42A 4NQVA 1PX4A 1GGTA 4IRSD 2LABA 4GXUM 1XEDA 1B2WH 1CN4A 3E3QC 2FYYB 3EDDA 1N5AB 1Q9KB 3QH3A 2BCKA 5TDOB 1H3WM 2FEEI 3QXTA 1O7VA 2J8OA 1IEAB 3NIDF 4P4KA 1TMCA 1CDCA 2LTQB 2W0FA 3QEHA 5J6GA 4M6OH 5TGBB 3EOTH 5I1DB 3ARFA 4YDJA 4Z7VF 3K4AA 1DLHB 4CL7A 1N64L 1HEZB 3HFMH 4KAQH 5EU5B 2VXTH 2ZOLB 5F9DC 3AXLB 1S7RB 1G0XA 4OF3A 2Z8VC 2WQRA 4XXDA 5CIPB 5CD3A 4LLDA 1VFBB 3HE6C 5DD5L 1NFIA 1FVDB 3BIAX 3HAEA 2H3NA 4RGOH 2X70A 3W39B 4HK0B 1IKFH 1G1CA 1MVUB 5IBLD 3LPGA 5FXCH 4ODSH 4Z77B 4QHNA 4TQEL 4HMCA 1YEFL 2G5BA 1I1YA 5B21A 3CZJA 5GJTL 4DKEH 3W0WD 1MFBH 4LGSB 4GMTH 2XTJC 3MUGA 3WJLC 1FN4B 5GSRB 1QNZL 1A1NA 3UTSE 3KR3L 1TNNA 3EFFB 1EEQA 4HCRA 5L88L 3BMWA 2W60B 3PE9A 4FFWC 5DT1H 3T4YB 4APQA 5H2BB 2E9BA 2Y7QB 1K4CB 3AS1A 4DK6A 2F54E 5EPMB 5ILTL 2ITCA 4Y2DC 4J4PA 1UACL 5K93A 1ZEAH 2FGWL 3BHBB 3HRPA 4P2QB 1DBAH 4NM4L 4B7IA 1IGTA 4GBXD 3RWFB 5FUOL 1MPAH 1VGKB 4X6EA 4PGEA 1ZVSB 1GGCL 4MX7A 1FFOA 1JPST 4LK4A 4P5TD 1N0LA 4YO0A 1P7QD 3O6FB 4FQQB 4PP8C 1T2XA 5DMKA 5EFIB 5J4MA 5HYJB 4YLQT 1UZ6F 2AK1L 5D5MF 1P7KA 2VLKA 4DTGL 5F7UA 4KUZH 1NCWH 3IDXL 3VXSE 4EKXA 2YPVL 3ZE2F 3FAXA 2DI9A 3OXRB 1FL5A 2BJMH 3DMMB 3M07A 4TTDD 5GS0L 5I73B 1IAIM 2AAVA 4UV4H 3QCUH 5DQ9B 4G9FA 5DO2C 1XF4A 3T1FB 1JNLH 5HDLA 1C08B 2V7HA 2ZP0T 4I0CC 3I50H 5IEHB 5KSAA 3D85B 3GSRA 3IXTB 4PJAA 5E7BA 2ERJC 3MCKA 4GAYB 2K7QA 1FG2B 4URTB 3REVB 3DX6B 3KJ6L 5JW3L 4D2NA 5EORH 3HUJE 1XGQA 4QRRA 1CICB 1HOCB 3BGMA 4OIAA 1CFSA 5B8CC 1ADQH 2HLFD 3BD3A 2HVJA 4G8EA 3QR2A 1L6ZA 1H3VA 4MWFA 5EULV 3UDWA 4D0DA 5I8EB 2X9XA 5C0BE 3RFZC 1VEMA 4XT1C 3LKNA 4ODVH 2DQDH 3UBXB 2QQKH 4JQIL 2R0KL 2DIJA 2Q6WA 4ZUSA 5FHBL 5EZOH 5I1JH 2Y5TB 1ZLUH 3BXNB 3WLWC 4OB5L 4X0KA 1CDJA 3VFWB 1HILB 3S9DB 3NGBC 3ARGD 4OF0A 4ODUB 3WE6B 5C09A 1I8KB 3U30B 3OR7B 1CYGA 1ZK9A 3EUUA 5JLZA 2CH8A 1M71A 1D5ZA 4L3EB 3DXAD 5ALBL 3I3EA 5DYOB 1KC5H 1T7ZA 4JQVC 1S9XB 3O3DB 1TNMA 3U2SB 3VJ6A 1RY7B 4TYUA 1RD6A 2UY6A 1RZ7H 3ARXA 3IVKA 2NR6D 4JRXE 4P5MA 4PGBA 5C0RL 3BRDA 4IRJB 3HE7B 4OLXH 8FABB 2RCSH 1B0RB 3OB0H 1GC1H 3P77B 4DCQA 4HT1L 5F7WC 4KRNA 3QUXA 4QRSB 5AZEL 3BE1L 5EN2B 5IB1B 4MNQA 4U0QB 5E8NB 5EU7C 1KPRA 2NPLX 1K6QL 5HI5D 2PN5A 4PFEA 4P2OC 2F19H 5GGQL 3U1SH 1F90L 1B4JH 3PWNB 1ONQB 3MJ9L 1ZXQA 1UT9A 1F58L 3D39B 1EHAA 3SGKC 1HYSC 4XPHL 4P9HC 3FQNB 1YPZB 4E41E 5C2BL 5KBNC 4U1JB 4XZUA 3H3PL 1JGLH 3BP7B 2F74A 1WBXA 4KMLB 3U0PB 5GS3A 2EYSB 1MJ8H 5F7MC 1PY9A 3TGXA 5J57B 1A1MB 3O9WB 4NRYB 3DX9A 1JHLH 4N0RA 1ZLUK 4PJBB 3VRIB 1OAQL 3VI4F 2A6IB 5F7EH 3KYMB 3MRDB 1SVZA 1ORSB 4D9LL 3QNXA 3B9KA 3HC3H 2XZAH 3PJSA 4KY1L 3CSPA 3SDXA 1H3PL 1A0QH 4OLVL 5I0ZA 1CXIA 5DUMH 1NFKA 4WW2F 5CUSL 4OCYH 3W82A 4EJ1C 3W11D 3MZGB 2ZKHL 2OP4L 2PYEE 4IDJH 3FZUD 3WIFA 4K3DH 2JCCE 4ZMAT 1QP1A 5KANG 4PJ8D 4X4XB 3OKLB 1B3JA 5JW4R 2AJUH 2VLJE 5T1MB 2XKSA 1J8HE 4OGYH 5GHWH 4KGLA 4EBQH 2V9TA 3OB0K 1IM3B 4DGIL 1DDHA 3VDCA 4W4OC 4XCYA 4JB9L 1XGUA 1AH1A 3TM6A 3EGSA 3G9VA 4PRNB 1DQJA 3WFEL 5CZKA 4FZ8H 2PTVA 3BVNB 4PB9L 5EC2B 2GJ6B 3AREB 1MCSA 2NY7H 1BM3H 1CDIA 5E7FA 4N9GB 3TO4C 2D3VA 2OSLA 2Y36L 1SY6H 3VXOA 1LNUB 3TFKD 4LRIA 1VKXA 3UEZA 3CSBA 4MZ2A 3O6KL 4OZHA 1ZGLP 1KLGB 5FO7B 4OFYA 4ELME 5FUCC 1OP3H 1MCCA 1G9MC 5I19H 4AH2A 4LLWB 1IGFH 4ZUWA 1U3YA 4PGDB 2YKLL 4CU7A 5DHYA 1RHHA 3QB7C 4CMHC 2NX5D 4KJPC 4L4JA 1A21A 1BLNB 1QFWH 4HMEA 2A1WL 3CVHH 2LV4A 1JHKL 3HR5B 3GBNH 1MAML 4S1DD 4KVCH 3GMNB 4WO4D 2VE6A 1RULH 3QIBA 4WY7L 5D7IB 5DFVC 4AG4H 3VD5A 2W91A 3DGGB 5EO9A 4XVTH 5EOCH 2CKBH 3QO1B 4OTXL 5IQ9A 4HUUA 1LO0L 5JIHA 5HDBE 1BZ9B 1BJ1H 2P42B 4FQXB 5DQJB 1UA6L 1NBZB 1X5JA 2XYCA 4RMVA 2HN7A 1BD2B 2PW1B 5J1SC 2ICWA 2E7MA 4WEBL 5DK3A 5CZVL 4Q9QH 1OSPH 4MDIB 1RJYA 1WTLA 2EH8H 4R0LB 4POUB 1QFUL 2CGRH 3PXJA 1HINH 4MA3B 2P5EE 1QSZA 4NN6B 3TYFB 2XY1A 3OGCB 1GPOL 1JPFA 1QSFB 3OKMA 4M1GH 4PJEB 3BT2H 5IMOA 1L7IL 2V2XB 4Q97A 1I8LC 4ODHH 1M6OA 3KVQA 4KKLD 4R97B 1CD1A 3GMLB 4K7PL 3ARBC 4JQXA 1AY1L 3BYTA 2J8UB 3AU1A 4FTVB 1OQXA 4XWOC 3B2UD 4UDUB 4O4YL 5SWSE 4NNPL 5I66B 5DD6B 4IMLA 3TCLA 3QUMA 1ITBB 1OP3K 2ESVB 1NGXB 3QEGL 1Y18A 4LSSL 1ZT1B 1ZT7B 5MEQA 2XN9A 3LMJH 4J1UA 5DC9B 1AGBA 1BFOB 5LAXB 1BECA 1BFSA 1II4E 3U4EB 4DEPC 5E8OB 2OL3B 5IWLA 2I9TA 2V7NB 2BK8A 3SDAD 5J6HA 1A6UL 3VG9B 1XZ0B 1Q72L 2VERN 2YPLA 2X4PA 3FQXA 4X7CC 3LN5B 4HBCL 5IM7A 3ULVD 1AE6H 3PQYD 4TRPL 5HHOB 1IC5L 4NHUA 2GTWB 3CFCH 2ZUUA 2O5YL 4M6NH 5F8QC 2APFA 3R4DA 1HXYB 4PJAE 5F7YC 4RRPA 3P73B 2Y07L 5GRUH 4HWUA 4IOFD 1DUYA 1KPVA 3V5HA 4LARH 3CFDB 5HGBA 2DLFL 2I5YH 5H35B 1D9KB 3U7AA 4WUUA 1XCTB 3UCRA 3T0EB 1CVSC 1F3DH 4ELKB 1Q38A 2X6MA 5KTEL 3K74B 4D8PB 4UB0H 4ZUTA 2XWTB 2MMXA 5D6CB 2J6EL 2CLZA 3QIWC 4KMTL 4X7EC 5IF0B 4FFZH 2UWEE 3MLRL 2OLDA 1TZGH 3RRQA 4LRNL 4DKFH 5BXFA 1INEH 5IVXE 3RUGF 2Q76A 1TIUA 1N4XH 4XPTL 4YDIL 4K07A 5LJYH 5DJDB 3WFBH 4RGMB 3S6CA 1IKNC 3IYLW 1WEJL 2YK1L 3QYCA 1JF1B 4Y8DC 3S36L 4HUMB 4WHTA 3MUJA 2DRUA 1JHTA 4EDXA 1W0WA 2YD8A 5GRVL 2VDML 1XIWB 3TN0D 4XMLL 5FYLH 3Q3GB 1MLCB 2WANA 4KJYB 5GSVB 4CADA 3N1QC 2DKUA 4G8IB 4Y4FD 5F9OL 4L3AA 4OI8A 4U05A 3BP5A 3O45B 3EO9H 4JO4H 4N0UB 4PGCB 1TJIL 3MNVB 4HS8H 3SKNB 4X99A 1JZ8A 2HTKD 3IS0X 4G3YH 3U4AA 1TJGL 3EO0B 1KIPA 5EDXA 4NQDB 4Z7OF 5GS0C 4KDTC 3DSFH 3LQAL 4DFHA 2Z92A 1R5WB 4PRBA 4LGRB 2BNQB 2R29L 3PWUA 3CVIL 1VB9A 3K81A 2OTWB 4PJ9A 3GSNL 4I0PD 2JLLA 4LSVH 3QQ3A 3FO0L 2Z4QB 4ZNEA 1YNTA 4OFDA 5TE7H 5AG9A 4MS8A 4UQ2A 4G42A 1BVKA 1QO3A 3L6FB 5H94B 1I8MB 4MXWL 3LKRB 1U8IB 4JHAH 3B8SA 5GJSH 1A3QA 3PP4H 2RFXB 2ZUTA 4U0RC 4KJQC 3A6CH 4YUEL 4AM0B 1J5OL 1Q0YL 2ARJQ 4X8XA 3EYUH 3JWDH 1ZT4B 5T3ZH 5IOPA 1HN1A 1P4IH 2H41A 3WL9B 2YD4A 1MSPA 4EI5D 1QD0A 4OLUH 5I1IH 5J3HC 1MHHB 3P9MB 4M02A 3HZVA 4RZCB 3UJIL 1U93B 3DETC 4PYHA 1ZSDB 5BMFL 5IB2B 3DHMA 2H32B 1BJMA 1H0DB 2QQLL 4OFKA 1CLZL 2XI9A 1YEGH 2R9HC 4LDLB 2ZUYA 4I8DA 3NACL 1MCQA 3BPNB 5F89A 3QFJD 3VGBA 3O8XB 3OV6A 5F6IC 1I8IB 1FGVH 3ULVH 2GY5A 3LS5H 1AXTL 4O2CB 5JW4N 4KFZC 3MLWH 3BKCL 1ZA3A 3C2AL 4HIHA 3H0TB 4OFIA 3STLA 4R2GC 4F57L 1SQ2N 3V0WL 5BJTA 5E4EC 4HAFA 3AY4A 2OM5A 1CXKA 1W72A 3F6LA 1VFOA 2J3SA 1BBDH 3GM8A 4P49A 4NQCB 2WP3O 1HHKB 3DVNA 2K9UA 4TSCL 3QEQE 3MCLH 5IW1A 1T0NB 1OP5H 1BAFL 3RPIA 3UTTA 1M7XA 1DBJH 4XXCC 4JZOB 1D6EA 1F4XL 2V2WA 3O6LL 1AHWA 3NIDE 4A2MA 5EC1B 4UV7L 4Z7QF 2R2BA 2VAAB 2HVKB 4GW5A 4GH7B 3S88L 3BWAA 1EVUA 3WN5A 4Z7VE 5IG7B 2XQBL 4WNQA 3HRZB 1DBML 1INQB 5F1OB 3BH8A 4Q74A 3VGGA 5ENWA 4ORGA 4Y5XC 1V05A 1O7SA 4QHLA 3MFFA 1D5IH 3QWRA 4HZAA 3VFVB 1RAMA 4YHOL 4PJHB 4Z7UA 4ZD3H 1UYWH 4CBPA 3FQRA 2WM0A 5AWNL 1MFAH 1SJXA 2DQIL 3ILPB 1IQWH 1WF5A 4QRPA 1U2CA 4WI9A 4QHKI 3L7FB 1QRNA 4E42B 2MHAB 1RI8A 3VFUB 1DFBL 1EIBA 3TV3L 4L8DB 2HJLB 1ZLWH 4LQFH 3MYZA 3HB3D 3SDYH 2A73B 4C56E 5E8PA 4G80A 4TSAL 3T0WA 2YPKA 4D9QD 4JFFB 2DBJA 1BFTA 4D3CL 1DL7L 3JWOL 4GW4B 2C1PB 4YAQA 3BUTA 3QI9A 5CCKL 4P4KC 4L4TA 1ZLVH 4OJFH 2ADIA 4WHYH 5CFHA 4M6MH 3LS4H 2VQTA 4U1NB 4RWYH 3BI9X 4WWKB 3ARFC 3BISA 4BK4A 3KPQB 4NM8L 3VD3A 4UNVA 5KS9B 2A6DA 3RVWC 4YPGB 1OP5K 2RAMA 1KXVC 2R1YA 1NSNL 5DD3H 1MHCA 1I9IL 3MRPB 3QISA 2O5XH 1ACYH 4MXVF 2ZUVA 2OYPA 3CSGA 5J12B 5E4IA 3LH2L 4XWGH 3QEUA 3HNVL 4WFEE 5C07E 4KKBD 2W1NA 2Y4SA 5BZWB 3ZYIA 3FFDA 2DS4A 2NXYC 1U36A 1TQCC 3L3DB 3QIUA 1UZ6E 5JA8B 2F5BH 5D5ME 1OAZH 5E56A 4RGNE 4LHUB 3JV5A 2R2HB 3F5WA 3TBWB 1X5HA 3O6FD 1MIMH 5F7DA 3ZE2E 1OAXH 3NH7L 5HYJD 3D3VB 4I4WA 4PJFB 3OR6A 2FBOJ 5GRYA 1IAIL 4FRWA 3VG0L 1YC7A 2YPLE 3SCMA 5IB3A 2VQUA 4HDIA 3LB6D 3OKKA 3PABA 4P59H 2NY1B 3QDMA 4U1LB 5F1IA 3MLVH 3Q1SL 4APQC 4XBEH 1YMHA 3P4MA 1MJ7H 1NKRA 3DMMD 3Q6FB 4WTWA 4MXQC 1MFCL 1F97A 3BP6B 1JK8B 4J4PC 1NAKL 4HV8A 2X4TA 2G9HB 4QRQB 4R3SB 1ZLVK 5DDHA 3HLAA 2FBJL 2ZSWB 1Z2KA 4GQ9H 4KKCD 4F7PA 5HHVL 5JPNB 3D85D 2YN3A 1R3LB 3TVMB 4GRLC 3D9AL 3DARA 2ZG3A 3EYOA 4V2CB 1JMZA 4EQ2A 2IADB 1HQRA 1S78D 1RZIA 3ZDZF 2BMKB 4PJBF 1WBZA 5EO0B 3HG1B 4GS7C 4LSRH 4R8WH 1UWXH 3IAPA 1CICD 1F3JA 2YMXL 1FZJA 3K8KA 3RUGA 5C8JB 1KEGH 1IT9H 3B5HA 2X4QB 1G9NH 2YUXA 3H9SE 1K85A 3SE9H 1JGEB 3LEXA 3O0RH 3F7VA 4GMSH 4NYLB 5LXGH 1YMMB 2DBLL 5HSFA 3I3DA 2VABA 1KB5L 3P0YL 3M45A 2EEAA 1ACZA 3UJTL 3R8BB 4OBSA 1CE1H 2WLZA 1U8MA 5CIPH 3BDXA 5L8KB 2EH7H 5KSAC 4Z8FL 4Y16A 3MODH 1NDMA 1TFHA 3ROOA 4HKBA 4M8QA 4F7CA 4RFOL 3THMH 4OLZL 2X4RB 5I1KH 4L3ED 2XNAA 3KXFA 4S0SD 3PGFL 3RNQB 1GVIA 4JO3H 2RR3A 3ZKND 4H5SA 3KYNB 2EDXA 1R3IH 2HG5A 4KK9D 5FGSA 3KNBA 3ARSA 5ICXB 4ONGL 3UDWC 1R3KA 2FATH 4G7YL 1MJJA 2J88L 3HE7D 4IRJD 4YHKH 4BQ6A 1QFOA 1P4LB 1CTNA 1UM4H 3BZDA 4NO3B 1FVEB 2JF1A 2G2RB 1T4KB 3ALXA 4P23B 5GGSA 5GRJH 5LGHL 3NAAL 2YC1B 5E6ZA 5AUMB 4J3XA 4GSDL 5IQ7L 4F2MA 3GI9H 3RZCB 1FYTB 4HH9B 4NN7C 2VIRB 1T03L 1BMGA 4C4KO 1UWXK 3D39D 1C8PA 1YY8B 1G7IB 4Y5VB 2PNDA 3V7AG 2DIBA 4LF3B 5KJRH 3C09C 3ES6B 4RFEA 3ZHDA 5D7IF 3MC0A 3VI4E 4Q6IB 4XBGB 5GGVH 5IMLA 3BRFA 3MZTA 4LLVA 3PHSA 1UFUA 3O9WD 3HR6A 4LPVA 4K94L 5EOTB 4M7LT 1GZQB 1FP5A 3GNML 5KSVB 4YXKH 4BZYA 3CIQA 3O41B 4JZJA 5CMAB 3MRNA 5LGJB 1IEBB 1KJVA 1YJDL 5A2JH 3HI1B 4WI3A 5B39G 1HZHH 3C9NB 4J3VA 3QUYB 3LQAC 4OQTA 2BSTA 1JGDB 1VACB 4KZEH 3QUKB 4PJEF 4F7EA 5DEFA 2A77L 4N1EA 1TDQA 2P5WA 3L95A 5K59F 1MI5E 2AJVL 3ARDA 3LRSA 1I7TA 1MCKA 5JW4Q 4G5ZL 2DQFA 1BZQK 1DVFB 2GEEA 2NTFB 4MLIA 3UXFA 2EEDA 2FX9H 2FSEA 4AEIL 1G6RH 3EJZD 2GJZB 2X89D 5MHSD 4FQLL 1QLRB 1E4KA 1ERNA 1FE8L 3T65B 4EIGB 4YDVB 3TPUB 1V3LA 5DI8B 2GJ6D 3ARED 1IC7L 1XH3A 4XP4L 3GMQB 2QADD 4JFDE 4E0RB 3DUUA 3RIFK 5EIIB 2IJ0C 3OAYH 5HHXL 3DUSA 3S97C 4LGPB 4OKDA 5IFJA 5DRXB 5CEYB 5KW9L 5D72L 1QUNA 4JKKA 1ND0B 3HCVA 5I15H 1TJHL 3VGFA 2LQRA 3TBYA 1MJUH 1E0OB 5C0CB 1J0HA 4WENB 4ZNCD 1FL3A 1LP9E 4R6UA 3MO1B 3P0GB 3HZYB 1SEBA 3QNYA 2ICWJ 2XA8H 3DGCR 1LO4H 1HIMH 5GIRB 5MI0B 1KEMH 2VXVL 5LQBH 2SEBA 3EYFA 3LKPA 1GZPB 1K5NB 4OSUL 2D31B 4OF8A 1HH6B 1PKQA 1A7QL 5DJZB 4GXVH 4KDVA 5HHMA 4YBHA 4PP2B 1XR9B 1JWUA 1FO0B 5DRNA 4LRIC 2N7AA 5B4MD 4FQXD 1OCWL 2NY4C 2GT9B 4LCUA 4PRIB 4MD0A 3WNKA 1GGIL 1ULVA 1BD2D 4YQXL 4D9RD 4V1DA 4P99A 4F7TA 3V5DA 4LIQL 3WO4B 3OB8A 3P4OA 1JE6A 1UXWA 4X9FA 4PV8B 5E5UB 5FO9B 4EN3B 1I9JH 2J5LB 1NC4A 2FL5B 2EDQA 2P1YA 2E9WA 3D48R 5DHXB 2EIBA 2L4OA 4QT5A 4MAYB 3R06A 2HYMA 1JPTL 3VE0A 2E6QA 3CAFA 1QSFD 5C6TH 2ADFH 1T7XA 4PRHE 1MEXH 3QIBC 4GRWB 4LIQE 4UUJB 3OAYK 5I1CL 3FO2B 3ARZA 2P8MB 4FZEH 1VFAB 4NUGL 3GHEL 4X6DB 1MCHA 1EGJA 1PSKH 5I1GL 3SO3C 2Z31B 4LLQB 4FTVD 1A7OH 3HS0B 4JPWL 4LLYB 4GKZB 5E8EB 5DD1L 5EZIH 2VL4A 1H5BB 5C0AA 2ESVD 4LBEB 2FNBA 3MRQA 4LCWD 3IETA 3QUZB 4PJ5E 1U91A 1IZJA 4O9HL 3WHE0 2EEBA 2FIRT 2DQTL 1ROWA 3Q5OA 3B9VA 3MRJB 3EOBA 3NCBB 3U6RA 4HWEH 1ZHBB 3VXPB 3JVGA 3JWOC 4MSWB 3HMWH 1UM5H 2I27N 2FB4H 5MERB 5HHOD 5IR1B 2Y06H 5BOZG 1T0PB 2R23A 3FFCD 1MNUL 1U8KB 4JQXC 3MBEB 2WV3A 5F7KC 3MR9A 2BVTA 1B88A 3FO9B 4XCFH 3S35X 4BH8A 1FAKT 3FN3A 3QSKB 2GUOB 5E6IC 3QFJE 2QJDA 4ENED 1D9KD 1DTUA 1FCGA 5IB4B 1BWWA 1RVFL 5C3LD 3TA3A 4LKXB 3IU3A 1AGCB 5EBGA 3T0ED 3UTPE 1A6WL 1AGDB 1T0MB 1DN0A 3RUGE 2EDKA 1K3ZA 5T1KD 3PWJA 2EICA 2AJYH 5FHAL 3S3PA 5IWLC 3DWTA 2VRAA 1IE5A 1CFNA 4XRCA 4MQ7A 1EHNA 4NQUA 3BEVA 5IFHH 1BHGA 1AXIB 2PW2A 4ERSH 1S5HB 4L9DA 4HX1B 1G0YR 1EFXA 4JM4L 3VXUE 4JZNA 2JK5B 1XIWD 2YHGA 2P8LB 1LO2L 3GK8H 4MA7H 4MNGA 4N9OB 1MIEL 5ESQB 5HJ3A 5KVGH 2FR4A 1HXMB 1KUMA 4Z7OE 1ZS8A 3MV8D 4QXTB 4WJ5B 1FPTL 4P0DA 1A7PL 5C7XL 3FAWA 1D5MB 2FEEL 4UNTA 3HE6B 4QOKE 3V5KB 2BHYA 4ZTOL 4XNYL 5I1AA 1MCWW 4NQDD 3OZ9H 1T3FA 1LK3L 4ZOCA 5JZ7C 3FRUB 1P6FA 4G8GE 4GG6A 2JB5H 2DMCA 4JFOB 5IJKA 4BZ1H 4HXAH 4DVRL 3PGDA 1JUFA 5E8DL 4M43H 2E27L 4N0FA 1P84K 4N5UA 4KQ4H 5CEXA 4C83B 1Q0XL 1T1WB 2DI8A 4PJHF 3JV0A 1V5JA 1T5WB 4NWUL 1AP2B 5IFAH 2H26B 5K9QI 3OTTA 3QPQD 5D1XB 1MHPL 4HJ0C 5EZJB 4G8FB 4ODXB 4JR9L 3U46B 2X7LA 1JWMA 3W9DB 4KXZI 4Y2DB 1MRFL 4YHLH 1N6QH 3LQMA 3SDDA 4YE4L 3SDCA 2DMKA 2GW5A 4P2RB 3FO1A 5INCA 1GH7A 2VWEE 5AZ2H 4OAWA 3RTQA 5EOQL 3B3IB 2FO4B 2OZ4L 2IANA 3CXHK 1CQKA 2D0FA 3GBMH 2OL3H 4HPYH 4JPKL 4NZUL 3LAFA 3OKOA 4QY8B 3V6OE 3TZVA 2ARJB 5E5MB 4MS8C 3WDIA 3T0VA 3O8XD 3L9RB 4MVBA 2B2XH 1U3ZA 1T1XB 3GB7B 4L4VB 2ZPKH 3S8WA 1RV6X 3GMMA 1NGZA 4MCZA 3MRRB 4IRSA 1ZLSL 2ID5A 5D7SL 4P2QE 3IFLH 5C0JB 1JV5B 1F11B 3O2DL 4QXUH 3EO1B 1U8HB 4PBVC 3UZQA 3GDBA 3N85H 4K71C 3VXRB 3UJJL 1FVCA 5GGUB 1KGCE 4TSBL 1ADQA 1KTKE 4K8RH 3V52H 2FX7L 3IJHA 3IS1X 2NY3C 4Z7QE 3V9FA 1CK0H 4JFHD 5HYJE 3CDYA 2ERJB 1DQQA 4PG2C 2BFVL 4TPRH 3QQ9C 4H1LB 2VLRB 5FM5M 1SM3L 4G6KL 1AFVL 1CU4H 3QDJE 1WT5C 5B8CB 2AI0H 3KPRE 4IRZL 3D5OF 3IF1A 1LDPH 4WHYG 4WU5A 5TH2B 4XCCH 3OG4B 1HSAB 1KLFA 1BFVL 3PNWB 2DICA 5GRXG 1JMXA 3OKEB 5BZDB 3VGAB 1RIUL 5IK3A 3ZDYF 2HRPL 3AY4C 5EH1A 5BS0E 5JR1L 1PG7H 3QULA 2Z93A 4JAMA 3VD4A 2AV1A 3C2SA 5D71L 1FZOA 2JJUA 5IV2A 3JTTA 4K94C 3AMLA 5ABDE 2MFNA 5DWUH 1GAFL 3PHQB 3LDBB 3EFDH 3NTCL 1N3NB 4PD4K 2CIIA 5JPMA 1KN2L 3W0WA 4GKNA 5L2KA 2X4UB 1AJ7H 3IGAB 4MNHA 4LPYA 3VWKD 4P48A 2NY0C 4UTBL 3T2OA 2C3VA 4JY5H 3DV6A 2AXGA 2R56L 4O51B 1JZ3A 3C8HA 3WN5C 3Q6GH 4JFFD 5GRWA 4Q7DA 1FV1A 2ICEB 1EBPA 4YBQD 3VFGH 5C0IB 3MLTA 5EUOA 1U0QA 1HHGA 2AJXH 1X6NA 3SKMA 3IXAA 2APWA 1RIHH 4WRLA 4MXVE 4WWKD 3ZKSD 4GBXA 2ICES 2IFGA 1Z3GL 3O3EA 3I6GA 3G5XA 4JJ5A 3GRWH 4P2OB 1A14H 3T2NH 4XX1G 4P5TA 3WNPA 2K3TA 1LQSR 3PWPD 1M7IA 2DYPB 3P9LA 4H25A 5DJAA 4NO0B 1KELL 5AD0B 1XGYH 4AT6A 3BIKA 3TPKA 2H32H 4LEXH 4JKPH 5CD5D 3MLSL 3DX8A 3TNMA 5I76A 3RNKB 4NQED 4LVOC 3SY0A 5E99L 5FV2A 4ZTPH 4UTAH 3F6IA 5FK9A 4IS6A 2NY2C 3QI9C 2CUMA 4U1GC 1EJOH 3S5LG 5IB5B 1EAPA 5I16A 1ZTXH 2RGSA 2FZ3A 4Y19E 3SBWA 4KUCF 4CVXA 3HPJA 1JNNH 3B8YA 3NOIA 3D3VD 1HHJB 1DQLL 3D39E 4L8CA 4F8TA 2Z91B 1QACA 4M03A 2NY1D 1NFDA 1X5LA 4M6OL 4LPCA 4OZGA 4DWHA 3NCMA 4Y7MA 4ZS6D 4XVUC 3RL2B 4R4FL 4U6YB 4M4RA 3HTLX 1Z0NA 3NFPB 5D1QA 1EO8H 4MJIA 1T22B 1OVZA 1QSEA 4RMUA 2VXTL 2NYYD 4NZDA 4Y2OA 1WZLA 3ZDZE 4PJBE 1KJ2B 3QIUC 5IESL 3CZFA 5TF0A 3SHSA 1YNLL 1GGBH 3BUYB 3N9GL 1SY6A 3DO3A 5EBMA 3IJSA 4KTEL 3ARGA 3HG1D 4XC1H 3BN9D 1LE5B 1E4XH 5B39A 4WV1A 3MNZB 4OKVB 4CVUA 1IKFL 1G7QB 3SCMC 4C54A 3LN4A 2WINA 1UH2A 4ODSL 3TO4B 1A3LL 4QGYA 3DXAA 4PRPA 1HI6A 4HF5L 4FQCH 2OXHA 3L5XH 3ET9F 4N68A 2HA1A 3O6ML 3DURA 1KCGC 1MFBL 1BX2A 1I7UB 3CVHA 5E03A 3H9HB 4OZ4B 1YMMD 2VNCA 5INDA 5L9DL 4BYHA 12E8L 4NO5A 3BKJH 5JORA 1N7MH 5SWZA 1F6AB 4M7KH 1KCKA 5DT1L 2CKBA 4CMHB 4D94A 4LDEB 4X6CB 4Z78A 2ZNXA 1YEJH 2OJEB 4N0CD 5DUPH 3IRZA 1R5IA 3MRBA 3TIDA 4NFCA 2A83A 4ZUUA 1I3VA 1ODAA 5F6HI 2EXYC 1LD9B 3SE3C 5C0EB 4X4YA 2VZ1A 5HYSB 1V3MA 4BSWA 2KBGA 1X5ZA 3BH9B 4K23H 1CIUA 3J8F7 4BQ9A 3D18B 4KUCD 2UYLA 4QRUA 3DX7B 5ADOH 4X7TB 4XP9H 1S7VB 4P23D 4AENA 2H9GB 4W70A 3VFSB 3DRQA 3MXVH 3OBAA 2NW3A 1NL0L 2W65B 1ZGLB 4YNYA 2FHFA 4KZDH 4HLJA 3MYJA 1O5DT 2EE3A 4OFVA 1DBBL 3ZSTA 3ULUD 4XP1L 4F33B 5EU4B 4OF6A 4GW1B 4WHCA 1IAOA 3RZCD 1FYTD 5D7IE 2C4XA 3BAEL 3KPMA 1WC7B 2VAJA 4K7PY 1S9KC 5FYKU 3S37X 3PHOB 3RWDA 3HNTL 3U9UB 3TWCH 2CK0H 2OR7A 5KN5B 2A9MH 2N4IA 1T80A 4GG8B 1AIFB 1F8TL 4RNRA 4CDGC 1IFHL 3ARBB 3I50L 2FHBA 5HI3D 2GTZA 2R4SH 4D9RE 1EEZB 1MREH 2HMIC 2YSSB 3GJEA 5FM4A 1NGWB 1T66C 1XF5B 2QKIA 4HKJB 4PJIA 1NCBH 2V9QA 4MJ5A 4QHUB 5IROC 4PTUB 3RWHA 2AXHA 3DVGB 4N5ED 2AEWA 4PJEE 4DEPB 2HKFH 2FD6L 2BY0A 3FMGH 5C08B 2QQKL 2ICCA 4YHYC 2C7UB 2X4SA 5F3HA 3Q5TA 3RA7L 2MPAH 3QUYD 3G04B 1M1SA 3UMTA 1NMAL 3NA4A 4F58H 2FLBT 2CRYA 3MGTA 1JI1A 4XVJL 2F54B 4GRWF 5J9PA 1MQKH 2R0WH 2EC9T 2ESVE 1LK2B 1JRHH 4HFWB 4YC2C 4N8VB 4X6DF 1K4DB 5D7LA 4EXKA 1BF2A 1OGTA 3MMEA 5EA0H 1G7LA 3QWQB 5KG9B 3DBXB 4ODWA 4XCNA 4RMSA 5DJ6A 2EDDA 2CLRB 2NX5A 4HKZA 5GGRA 3HC4H 3IDGB 1KFAH 1GOGA 2X1OA 3V6OC 4JZJC 5ID0A 4E5XB 2QSQA 5D7KE 2RCSL 5I2IA 4MB3A 5HHOE 4WO4A 1G7PB 2NZ9C 1HDMB 5F8RC 3B2VL 2IAMD 1OGAA 1LO5A 1UZ8B 5HDQH 1UCTA 1TTGA 3VXSB 2Q8AH 3CXDH 1AGEB 4AMKH 3CFBA 2A6JA 2ZUQC 4Q0XL 4AEHL 5JTWA 4ZYKB 5ANME 3VCLA 5FGRA 3MA7B 3ARDC 4LAQH 3JTCA 4BQ8A 3KPSE 2VL5B 5D2NA 2ZCKH 5B3JF 1R3HA 1B4JL 4UT9H 5C0CD 5L2KE 4AIZB 3FOLB 4YHPB 5GGTL 1Q9OA 1F2XK 3EOYG 4JO2L 5DVLA 2BNRA 1MHEA 4J8RA 3B9AA 3K1KC 5F9JB 1E4KC 4BK5A 4JN2B 3RVXD 1H15A 4M5ZL 1X5KA 1TITA 4LCCA 4JG1H 4DGYH 1QEWA 2RQ8A 5IEKA 4QXGH 1MJ8L 4U1IA 4LEOB 4BKLB 5HPMB 1EHLL 3FT2B 2BRQA 1FLRH 3LKOA 2HWZH 4XMPH 1KCRL 3KPPB 1KCUL 1QSVA 4FFYH 4PRID 3VFNA 1KPUB 3KYKH 1PLGH 3ULUH 5EIVA 5C0BB 2BVQA 2MWCA 3BEWA 2G75A 3TYGH 3RHWK 2IC2A 1A0QL 4EN3D 1NGQL 4OCYL 3KPNA 2DQUH 1UJ3A 3BPCA 4N0UE 1PVHA 4MAYD 1U6AH 3G08B 5ACMA 5TQ2H 2NY5C 2VDPL 4JFEB 1XGPA 2VSCA 1L0XA 4GT7A 4XPAL 1MRDH 2IH3A 1AKJA 3F62A 2BNQE 4HIJA 3SDAA 4EBQL 4F3FA 1T2JA 1CFBA 2DJUA 4JDZB 4K3HA 2KUTA 2A2QT 4HS6B 1U8LB 3EYQD 2Z31D 3D25B 1FG9C 5A3IC 4WU7B 5HVFB 4NT6A 4JRXB 2XACC 1XR8A 7CGTA 1PFCA 3IB4A 4AIOA 3LIZH 3D0LA 1NANH 1T1ZB 2ATPB 2PXYB 2P24A 1N5YH 2NY7L 3IDJA 4PJCA 2C1OA 3QUZD 5F6IB 3ECBB 4PRDA 3OAZK 4V3EB 1ETZB 1CD0A 1SY6L 2F8VA 4UOJA 3GSUA 4GKOA 2R1XA 5HGHB 4PY7B 4ZS7H 4ISVB 4W6XB 4R2GB 1JF6A 3U4BH 4CJ0A 5E4EB 2DQHL 5DUBA 2ZSVB 2VISB 3RVVC 1X9QA 2B20A 4NOBA 4X4ZA 1UGNA 2IQ9H 3MBED 2JJSA 1LQVA 5J7CC 5CSZA 1LMKA 4HGMA 1C5DB 5E08H 1MQ8A 1FAIH 5IVZA 3RKPA 4R7DB 3S34H 2BDNH 2PYFA 2GAZA 1YNKL 4NC0B 4PB0L 1ZA6B 2EYTB 5CWSB 3KLHC 2X1PA 5M95B 2Q7YA 1KCVH 3PIQB 1LEGA 4Y5XB 3P11L 2ZCLH 3ERYA 1YN7B 3JVGC 2VUOA 4NQXB 1TPXC 4TVPD 3OG6B 1PZUB 4NQCE 3FONB 1E6OL 2VXUL 5SWZE 4UIKH 1U8OB 1VPOL 4V3DB 1OSPL 4HUXA 3NPZB 3D2UB 1YEIH 5B38G 4I0PA 2VKWA 4DZ8B 1UKTA 1IMHC 1MCRA 2R1WA 3H42L 5HHNA 1VGEL 3BT2L 3FHQA 4CMMA 1J8HB 5C9JA 3TA3C 4XPBH 4NQVB 4X7SH 1FO0H 2XQYK 1GYAA 4X4MA 1C12B 1TENA 4UT7H 3SQBA 2BCKB 3GJFB 1A02N 3WUWA 2IEPA 4P4KB 1A47A 1A6TB 1JRHI 1MAJA 4PJHE 3CGTA 3IDIA 1HSBA 2W0FB 4O2FB 4EI5A 2QL1A 3ARFB 3ROLA 2P49B 3L3GA 4G6MH 2CRMA 1MFEL 3SKOA 2HJFB 4MLSA 3TBVA 2KH2B 1I7RB 1SMAA 2PETA 3LEYH 1IM9B 4NUJA 5EU6E 4BELD 1UB5B 2EDWA 4ELMB 2BRRH 4KK6C 3QAZC 1M4KA 5D1XD 5JW5B 2CR6A 1AE6L 2H2PC 3P30L 4FFWD 1SMOA 1FL6B 3NZ8B 1DBKL 4JFFE 4XXDB 3ZO0A 3CFCL 5CD3B 4M6NL 4LLDB 4HW6A 4C58B 4Y4HA 4Y2DD 4OUOA 5I8CA 2H3NB 2GK0A 2I5YL 3V7MA 4P2RD 2NXYB 4PLNC 2HLAA 4ONOA 1TQCB 2AGJH 3RWJB 3WIIL 1LVEA 2X9WA 3B4NA 4QHNB 2EC9U 5FYJD 3AUVA 5IJKC 5GISH 2IBGA 4UINH 1A64A 1I1YB 5DGQA 1WCBA 4W81A 4OV5A 2MSPA 1RUQH 4Z7NF 5I8KL 3C60A 3PL6C 5JNYA 2VH5H 4ZFZA 5ALCH 1VADB 3FT3A 4WTZG 2V5YA 4HPOH 1RJZA 2E7LE 2V6HA 5J0BA 1HHIB 1I1RA 1QBLH 2XXCB 1J1PH 3TF7A 4APQB 3WFBL 2V17L 5HBBA 2Z8WC 4S1QH 5L2JA 1Q9KA 1KIUA 2ITCB 3X12B 1T89A 3PUCA 4M62L 3S5LA 3MRHA 1JPGA 3SDCC 1IEAA 3CC5A 1W8NA 5DO2D 2ZOKB 1Y6MR 3BWUC 5GRZA 3H3BC 1KG0B 5TGBA 5D96C 1QHPA 5IMKA 1D3CA 5TQ0L 4GRLB 2JB6B 1IL1A 4WVRA 1HEZA 2OCFD 5EU5A 5SWSB 1CZ8H 5F9WC 4ZQKA 3TZVC 4GS7B 4MQTB 2VLRD 1UH3A 4G6JH 1P7KB 4TVPH 3ZDYE 3AXLA 4I9WE 2VLKB 3OKYA 2O61A 1YEHL 4KGJA 3LRHA 4AL8L 4I48A 2DLHA 2X05A 4IRSC 1X7QA 5CIPA 1CGYA 1FL5B 2DQJL 3SE4C 2F58L 3QJHA 4OZIA 1NMBL 5D2NE 1U9KA 1MCOL 4MQXC 1FNSH 1UJTA 1BQHG 1NANI 4HK0A 2BNRE 1JPSL 1X5YA 4G9FB 4Z77A 3WLWD 4ZFGH 5E2VH 2V7HB 3C5JA 4XGZA 5KSAB 4TUKL 2NW2A 2DQCH 4U6HA 4PJAB 1FNGA 2Q3AA 5T3ZL 2W92A 3N1PC 2JKXA 4L5FH 1P4IL 4WFHE 1KYOK 1FN4A 1QYGH 4RAVB 3QHZH 4Z7WF 3IU4H 2EECA 5I1IL 4QRRB 5T3XH 2GCYB 3BGMB 2IALB 2LU3A 1CFSB 5D1ZC 2WIMA 5FUZH 4G8EB 2W60A 4TULH 4MWFB 3OX8B 2Y7QA 5D4QA 1YYML 4D0DB 5EPMA 5AYQA 4I77L 1YEGL 5T3ZE 1H3GA 3LKNB 3BESR 2WLYA 2XT1B 3QHFH 2NZIA 4G6FB 3BHBA 2OX5A 4ZUSB 2B1AL 1FORH 2EDBA 5IVXB 3PP3K 3LS5L 3RI5K 1VGKA 5D2LF 2V5SA 3K2UH 1ZVSA 4P2OD 3MLWL 4PTTB 1I9RH 2VITB 1CG9A 4FQQA 5C0FA 5JLZB 4DK3A 4XCEB 1Z0MA 2DYPD 1U3HC 1D5ZB 4NO0D 4KMQA 3UYRH 4G43A 1RMFH 4P46A 4LPXA 5FYJH 3VJ6B 4KI5D 3C09B 2WSKA 4OCRH 4YH6A 5MEPA 3DVFA 2L7UA 4PGBB 2ZJSH 4I3SH 1J0ZA 2GQHA 5GZOD 5I1HL 4OCSL 2DAVA 1CWVA 3VMPA 4NC1E 1ZGLM 3CLEL 43CAA 4DCQB 5DQ9A 4GBXC 4MNQB 2DI7A 3T1FA 4UT6L 3FB8B 1KPRB 1C08A 2YD3A 4XH2A 5IEHA 1OTSC 1QR1A 3BMVA 4MJ6A 4P5TC 4UIMB 1N2RA 1OD9A 4PJXA 1IEHA 2Q3ZA 4YEEA 5DJ0A 4Y1AA 1DQDL 4EUPB 3KAAA 3I6LE 5FB8A 3WS6A 1HOCA 5C0DA 3SJVA 1G6RA 4ZD3L 3L3IA 4XZUB 4YR6A 1FCCA 3TESA 1JTTA 5TFSH 1S9WA 4P9ML 1WBXB 1A9EA 4F15C 1EJ6A 3ILQD 1S7SB 3UBXA 4TTDC 4K3JL 3WIHH 2Y5TA 4LQFL 2BC4B 3MRIA 4HFUH 3SBWC 3VGHA 4JFPA 3SDYL 5DD0H 1LEIA 3S3JA 5EOCJ 1TLKA 4F37F 1I8KA 3OR7A 3NABL 1DANT 3PJSB 1BJ1J 1OWRM 5T1LB 4L3EA 4X8JA 5LBSL 5DYOA 1S9XA 4MHHI 2QV2A 4ZXBD 4AK1A 4RMTA 3MV9D 4M7JL 4I2XE 5CILH 5TF1H 3I2CH 4HGWB 4U31A 5D1QC 3WIFB 5I1EL 4YX2H 2DQGH 4IRJA 3GIZL 3GMPA 1ACYL 1Z5LB 8FABA 1NC2A 5LWYH 1B0RA 1DE4B 1AXSA 3QDGE 3RVUD 3ARQA 2WWMD 3P77A 1WBYA 4O5LL 4U1KA 5EN2A 4XCYB 4XWGL 5IB1A 1FFPB 5E8NA 1N59A 1JTOA 3QEQB 4NBYB 2FH6A 2BVOA 4Q9CA 3EGSB 1MLBA 2BSRA 3RX7A 15C8H 1LDSA 5DRZB 4JO1H 3GHBH 1YYLL 5DFVD 1U2HA 5SV3A 1NAML 3V95A 1RURL 4OIIH 2H8PB 3VXOB 1F4HA 1MELA 1CLOL 2WWKO 1WLHA 1S5IH 4FQHB 2NY4B 4U1JA 2D0GA 4JGUA 3A6BH 4FQ1H 4UDTB 2Q8BH 4OZHB 1J1OH 4TTGA 3W5NA 3GI8H 4FNLH 4LKCA 3K46A 5DS8B 4FG6D 4EDWH 1VSCA 4QHKJ 5DJXA 1NLDL 4FABH 4S0UC 1A1MA 3O9WA 4M3KB 4NRYA 4P59L 4X80L 5DHYB 1RHHB 3VRIA 1HKLH 5MEOA 2A6IA 3WFZA 3MRDA 3WD5H 2VE6B 3AC0A 2OK0H 3QIBB 4PJ7A 2ITDB 4JFZL 1EH9A 5EO9B 2CO6B 5FAAA 4HHAA 5IQ9B 4NNXB 2ED8A 4K7FA 3SO3B 1KACB 1EEYA 4MDJA 3BQUC 3T0AA 3O4LA 1F3DJ 1YQVL 3F8UB 3QZWG 4KQ3L 4KWUA 4JPVL 4XPGH 5J11B 3H3KA 1WZMA 5T1MA 3KGRA 1HE7A 2BY1A 2VR5A 2ICWB 4HWBL 4XNQB 5IT2H 1IM3A 5B22A 5F7NC 5HYEA 1RJYB 4LCYB 1KEGL 5IBTL 2X89A 4AQOA 2XFXB 4NSKA 4HIXH 5C08D 4KC3B 5C70A 4MGXA 4GRWE 3SE9L 3M1BA 1JPFB 3OKMB 5EC2A 2GJ6A 5L6YL 1SEQL 3AREA 3O2WH 3BX7C 4X6DE 4FXLA 5ESAA 1M6OB 5IHUL 1RZFH 3ZDXF 1CD1B 1CE1L 3KHQA 5DXWA 1JYWA 5C07B 2F54D 4TOYL 3AU1B 2GFBB 3D0VB 2DTML 3FZUC 1WAAA 5E6IB 3NFSL 3IKKA 3ESVF 4IMLB 2VJXA 3SGDI 1V7ML 4J3OC 1KF9B 5D5MB 4U6VH 4LLWA 1Y18B 6CGTA 2RHEA 2XN9B 3IDNA 4OQ1A 3VFMA 4J1UB 5KZCB 25C8H 4OLYH 3W2DH 4R90H 3T0DA 4TN9A 2I9TB 4LSDA 2Q86A 2H2SC 2Z8RA 3NA9H 3T2QA 5J6HB 3GMNA 3IDMA 1MAKA 2IPTH 2YPLB 1A9BA 1G9MH 2X4PB 3FQXB 5B3JE 4JM2F 3VXSD 2E7LC 2ZNWA 4NHUB 3FL7A 5FIEA 3QO1A 5KVDH 2Y25A 1BZ9A 4YK4C 5GGSY 4TNWF 1DUYB 4FQXA 5F88B 2R8SL 1S3KH 3V5HB 1JGVH 5HGBB 1NBZA 4KROC 2XWBB 1YEEL 1UM6L 5CGYC 1BD2A 3V4PL 5EWIL 2G60H 5F44A 3DIFB 4WUUB 2R69L 2YD9A 2DJSA 1WZ1L 3VRLF 2OR9L 1IQDA 4ZUTB 4JPIA 3G6JA 2CLZB 3MGOA 2B7DT 3D1MC 4BZ2L 2BHUA 5GS0D 5H37H 1QSFA 4WO4C 3Q48A 4XP6H 3HPLA 5BXFB 1QBML 4EVNA 2FO1A 1Y6NR 1KNOB 2XWJB 3GMLA 5B38A 5EG6C 4BSJA 3WHXA 2JJVA 2MTPA 5C0BD 5D2LA 5I8OL 4YXKL 2J8UA 4FTVA 4WHTB 5DLMH 2XQYG 3ZYZA 5D2NC 1JHTB 1W0WB 1DQML 5BV7L 5DD6A 4ZSOA 2VDKL 5F1NB 4YBLC 4CADB 4PJGA 4LCWA 3O4OC 5I30L 1WSST 4IIQB 1ZT7A 3GBLA 1RZ8B 3HC0A 3CSYA 5E95B 1INDH 3NCFB 1N64H 1S7QA 4X99B 2AJZA 5B3NA 3NCJL 2OL3A 1KIPB 2VDNH 4R26L 3VXME 3L5JA 2Z92B 2FX9L 4PRBB 1KB5B 3L7EB 3PWUB 1G6RL 4ETYA 1NGYA 1XGTA 4YFDB 1R0AH 2EO1A 4JRXD 4XB8A 2XTJE 3FFCA 3QQ3B 1HXYA 2R9HD 1FIGL 3KPTA 3ZE0F 3JWDC 3P4NB 3P73A 5LKNA 5DD5H 4H8WL 2PXYD 5LCVL 1YDPA 4LNRA 3UTZA 3EYVB 5H35A 4ZAKB 1D9KA 2OMBA 4RDQF 1XCTA 4TQEH 1P2CB 1UJ3C 3SJVE 1DANU 3T0EA 1ZVYA 1PY4A 4PGZA 1YEFH 2YRZA 2UV3A 5FO8A 4R2GD 2IF7A 5T1KA 5IOPB 5GJTH 4LVNC 5DURB 3HNSL 5SWQB 4MJ2A 3HI6L 3ZT7A 5AYUL 4C59B 1QNZH 5IF0A 3GUTA 4IEFB 5ISZA 3KR3H 4K71B 3HZVB 5KSBA 4I3RL 2NY3B 5DJDA 1L4IA 1GOHA 1LHZA 3RVTC 4WTZA 4P4RA 4U49A 5ILTH 4JN1H 3SN6N 4IOFC 1UACH 4NOFA 1DUZA 2FGWH 4L4VE 4Y89A 2FJHA 4QWWD 1ZHKB 4NM4H 4M7ZC 3V79C 3KPOB 4OFPA 5FUOH 4KJYA 4K9EH 1IGCH 4D0CB 3N1GC 3MV8A 4G8IA 1WWBX 4HIHB 1NMCC 3STLB 3MNVA 3SKNA 4XHQA 4K3EL 3VXRE 3QO0A 3EJJX 2AK1H 3EO0A 1W72B 3VI3F 4NQDA 4BUGA 1WVZA 4ETQA 5HHQA 3PV7A 1I9JL 4DTGH 1RJLA 3F65A 3D2UD 2AKRA 3IDXH 4CVWA 4Q58C 4WGVB 2A0LC 1AO7E 2PYED 1CXFA 5IW1B 2KZWA 2JJSC 1ED3B 1MI5B 5KVFL 3RPIB 1J8HD 1I9EA 1D6EB 5MP6L 2V2WB 3JTSA 1V3KA 2JJTA 1EHXA 1NUFA 1U8IA 4JY6A 2NY0B 4FZEL 2RFXA 1FLTX 3WN5B 1A7OL 4MHHG 4AM0A 2P44B 1BQHA 2WP3T 5ENWB 1ZANL 4ORGB 1B0GA 5JXAH 1HQ4B 2YBRA 4P4KD 4QHLB 3WL9A 1GXEA 4JFDB 1I85C 3KJ6H 4Z5RB 2HT4D 4RZCA 1OSZB 1U93A 4Z7UB 1ZSDA 5IB2A 1U95A 3FQRB 2H32A 3RVWD 1H0DA 4I0PC 1IM9D 5BOPA 3S4SG 4QRPB 2CKNA 5D8JL 4JQIH 4NBZB 1UM5L 4KHTL 4M1DH 1VFUA 2R0KH 5TDNA 4S11A 4JVWA 4GKSA 3O8XA 5FHBH 2EDLA 1X5AA 4TUJA 3AROA 3L3KA 3M8OL 5E8PB 1OM3H 1JYVA 1OQOA 4O2CA 4LVOB 1H3UA 4YHIA 3O4LE 3H0TA 1QR4A 1UVQA 2XRAH 3LCYA 3QI9B 5F96L 4Z7NE 4U1GB 2HT3C 5ALBH 2ADIB 5EU7E 1R24A 4EI5C 1Y6KR 3OJDA 3ZYOA 1S7XA 2M1KA 3OXSB 5CBAA 5T5NG 1Z9MA 3MV7A 3I9GL 3SE8L 2MKLC 2AJYL 3R0MA 2A6DB 3ZKMD 2R1YB 5CEZL 2C26A 3DRTA 4KJWD 1U3JA 1KJ3L 1EXUA 4FP8L 1ZHNA 1Y0LA 3MRCB 4HT1H 4APQD 4N90E 3QEUB 4MXQD 4Y4HC 2P5ED 1K6QH 5IG7A 3HRZA 4J4PD 1INQA 4YXHL 5DVOA 4BA8A 5CEZE 4NN5C 4PRHB 1AD0A 1F90H 2FDBP 3MJ9H 3QIUB 4ZFOL 5CHNB 4Q2ZB 1F58H 5EUKA 2IQAA 3IFPB 2XZCH 4X9HA 4Z18A 3P3YA 1NQBA 3V6FB 4GRLD 3CFJA 5C2BH 3VA6A 5ERWB 3T1WA 2DLIA 5SWSD 3Q5YA 3H3PH 4OV6F 5F1SA 1YECL 3VW3L 1WUNT 1KJ2L 1A7NL 4I4WB 4L3CB 3C60C 3ILPA 1S9YA 1N0XH 1URLA 3OZ9L 4RFNC 5E2WL 2VLKD 3FB6B 4E42A 2MHAA 2IMMA 3VFUA 1CBVL 3OKKB 2PCPA 3PABB 1Q9WA 3QDMB 4L8DA 2HJLA 3VWKA 2MKWA 4JM2A 4BUHA 4HXAL 4BZ1L 1OAQH 4M43L 4KQ4L 4KV5F 3C5ZC 1T89C 4D9LH 4HV8B 2X4TB 4GW4A 4OF7A 1T04A 2CD0A 2M2DA 5DDHB 4G9FD 1H3PH 1BQLH 4Z7WE 4DJMA 5A2IH 4F7PB 5CUSH 4WWKA 5KSAD 5TDPA 2A74B 2EDHA 2UZIH 1IZKA 2EE2A 2CLVB 1U92A 2OP4H 2OTPA 1TVBA 5IVOA 1HQRB 2OMNA 3DHJA 4LSTH 3VXNA 1RZIB 3GJFH 3FT4A 4NCDA 4YHLL 1WBZB 1BJ8A 2X4OA 1EK3A 2V5MA 3G6DL 4QRRD 1OLZA 3RGHA 1O0VA 3PWPA 4YWGH 1FJ1B 1FZJB 1BIHA 3RUGB 5L7XL 4OD3L 3SDXF 4JB9H 4HPYL 3WFEH 4NQEA 5EBLA 3T08A 3LEXB 1T7WA 3E8UH 1WJ3A 4G6FD 4PB9H 3C5SA 4I3GA 5BVPL 1WISA 4NKOB 2B2XL 2VABB 3V0VA 3ULSB 4XAWL 4RBPH 4X6CE 1G7MB 2Y36H 4R4NC 2IBBA 3OAUL 3TBWA 1I1AB 3ROOB 4HKBB 4WI6A 1FBIL 4AQ1B 4M8QB 4F7CB 3O6KH 3MNWA 3D3VA 4DN3H 2XNAB 4PJFA 3KXFB 1QKZL 4DQOH 2CDEA 2YEZA 1W0YT 2E8YA 1GIGL 1U8PA 4O58H 2YKLH 2HG5B 3RX8A 4K8RL 3KNBB 3W81A 1R3KB 4QOKB 2A1WH 3LHPH 3Q6FA 5D93C 4Z0BL 5MENA 35C8L 2XKNB 3BD5A 5C6WH 1JK8A 1HHHB 4WW1A 4WY7H 5GGSB 1F42A 4G8GB 2AI0L 1T6WA 3TLRA 2Y9RT 3MLXH 4XMKL 2W07A 4OZHF 2D7QA 3BKYH 1MCFA 4OGAD 3KWWA 4EOWL 1LO0H 3BJLA 3E6HB 5EU3B 3WFDH 4ORZC 4CGTA 2V5RA 3X14B 4F2MB 3SEPA 1XGRB 2IADA 3GJFK 1XF3A 3RKDC 4WEUD 5GS1A 2BP3A 3GSOA 4KTDL 3HG1A 1S9VA 3BJ91 5T1DL 4WEBH 3VFRB 4P46C 5CZVH 2YOCA 4O2EA 2DDQL 4RFEB 5HY9B 3QZWA 1QFUH 4HJJL 3UC0H 3EFDL 3BO8A 4YC2B 1UWEL 1RHFA 1JGEA 1GPOH 5T5NF 1VDGA 5E2JA 1L7IH 1YMMA 1AJ7L 5BV7C 3LZFL 5CSBA 4O02H 5E70A 4RBPK 4K7PH 4C4KT 4JANB 2OTUB 3ARRA 3Q6GL 1RU9L 4CN4A 1AY1H 1OAKL 5ESVB 2Q7NA 5C08E 4QTIL 4JZJB 3WNOA 5KAQG 5T1LD 1S78C 4NNPH 1KJVB 1RIHL 2PO6A 3ZSSA 2ARWA 3H2WA 3QEGH 5DZNA 3KYNA 4LSSH 1FSKC 2NY6C 5C0GA 2P48B 2ZUQB 1MWAH 4GAFB 5DEFB 2P5WB 2J7LA 5ICXA 3GRWL 3LRSB 3ARDB 4TUOB 1I7TB 2QR0A 2ZCHL 2XPGB 1A6ZB 4M7LL 2DQFB 1JVKA 2Y5EA 1P4LA 4H8WC 1WFUA 4NO3A 4PJDF 1Q72H 4H0GA 2KPNA 2G2RA 4HBCH 4P23A 2QSVA 1XGYL 4TRPH 1IC5H 2E7CA 3QEQD 4PR5A 2YC1A 3E6FA 1HWHB 4FOMA 2O5YH 1FFRA 4LL9A 1KIQA 1XH3B 3U30C 2DQEH 1K2DB 3RZCA 4FHBD 4RA0C 1FYTA 2DLFH 4HH9A 3FB7B 1D6VL 2HFFA 3MJ7A 1QTYT 3MOQA 1NCDL 3QDJB 4HS3B 1YY8A 3KPRB 4NP4H 3ZKNC 3ZYJA 4NHCL 2NY4D 3DV4B 4Q9BA 1Z9LA 4HK3J 1V7NL 2ZZUT 4Q6IA 2J6EH 5CJOL 4CUCA 3TBYB 4KMTH 1IC4L 3LSOB 3GSXB 2V2TA 5BS0B 4DW2L 1FL3B 1MCNA 5DVMA 4YFLI 4LRNH 4HC1L 2ED9A 3HHRB 5EOTA 1J05B 1GZQA 4XPTH 2VZSA 4YDIH 1I3GL 1SYVA 3ARPA 3EOAA 5KSVA 1WEJH 2YK1H 5TE6H 3K0WA 3S36H 3LKPB 4NKQB 3O41A 4U7SA 1DSFL 3QIBD 1IEBA 1OARH 1PKQB 2VDMH 5ACZA 4XMLH 3HI1A 5C1MB 1EUTA 1FGNH 1JWUB 1K8IB 3C9NA 3TCXA 3QUYA 4C56D 5D7JA 1VACA 3RJQB 3MV7E 4GAJL 1EMTL 4PDCE 3RIAK 2CR3A 5F9OH 5BRZE 4MAUH 4MD0B 5M94B 1TJIH 1A4JA 4Z0XA 2NXZC 4V1DB 4A6YL 1RIVL 4OD2B 4M93C 4F7TB 3V5DB 2E3VA 3P4OB 3F7YA 1UB6B 4PREB 4QF1A 1WIUA 4EUPH 3O9WC 3LQAH 1A6VH 2R29H 3CVIH 1LILA 1RK0A 3ZDXE 4JFEE 1QLRA 3GSNH 5K9JL 2WK2A 3T65A 3EIFA 1BIIA 2AQ3A 3VE0B 4YDVA 3TPUA 1XCQB 3BW9A 1AQDB 4M5YL 3CXHJ 2XICA 1BEYL 1N7ML 4MXWH 4E0RA 2EKJA 2IAMA 3FTGA 4M7KL 4KK5D 4WFGE 3M17B 4WFED 5C07D 3D69A 4LSQL 2QSCL 4YUEH 1W0VA 1J5OH 5F7FA 1Q0YH 3V6ZA 5C92A 1ND0A 5E6ID 5E24E 2X9YA 2VLLA 2UVEA 1ZKAA 2Y1VA 4UBDC 1EZVX 3MRQB 4XC3L 3IETB 4RGND 1KENL 2XN9D 4Y19B 2B4CH 2VDOL 5H37G 3EJZC 5EZLB 4UILL 5GIRA 2QQLH 3U6RB 1CLZH 5AAMA 2YPLD 1TPXB 4XP9L 3NACH 2D31A 3IFNL 1LO3L 1HH6A 4RCAA 5GRVK 1A6PA 2QADC 2R23B 3MRLA 4KZDL 1FO0A 4X5XB 3MJ6A 2AEPL 3BKCH 4BH8B 2GT9A 3VRLE 5BQ7A 3GGWB 4F57H 3V0WH 3TA3B 2GSIB 4Y4KC 4HUVA 1P4BL 1UG9A 2HKHH 5FO9A 4LPWA 5I1LB 5ACLA 1DN0B 2FL5A 1MCWM 3VD7A 4TSCH 3PWJB 2X44D 4N8CL 4MAYA 4P57A 3QPXL 3MUY1 4NKMA 3QHTC 1NDGB 1CFNB 4MQ7B 5JZ7D 1T20A 1F4XH 4GFTB 5E00A 3O6LH 3BEVB 3WDHA 1NCBL 4TNVK 2PW2B 2VDRH 1VFAA 3H8NA 1PEZA 3S88H 1OT2A 2Z31A 4LLQA 2JELL 1RUKL 2XQBH 3BP4A 4JZNB 5B4MC 1DBMH 3H9SD 2GITA 4JKWA 2HKFL 3IRPX 3FMGL 4LHJB 3MOBL 2APVA 2FR4B 3QAZB 5HJ3B 4HJ0D 2MPAL 5F6HJ 2R0ZL 4B5EA 1ZS8B 4N8VG 3ZTNH 3QUZA 4FQ2L 3S35L 4YHOH 3P2TA 3GIVA 3QBTB 4C55A 3WLBA 5AWNH 1C5BL 5MENE 2R0WL 1TETH 4XNUL 1JRHL 2DQIH 4NN6C 5I1AB 2NCMA 1ZHBA 3ZE0E 3O3UN 4MSWA 1DFBH 1DZBA 5IR1A 5DZOA 4NIKB 4HKXB 3UAJC 2KQMA 4XBPB 3PGDB 5CP7A 3S4SA 1JUFB 1U8KA 4TSAH 3MBEA 4N0FB 4LSPL 4GJTB 2WBJB 3FO9A 4MS8D 3UPRB 2GUOA 3PL6B 1CT8A 3JWOH 4FQIL 3O3AA 4L9LA 4NNYA 4ZAKD 4Z7UF 2X10A 1LGVA 5CCKH 4NZTL 3P40A 5GGRY 5IW6B 1AGCA 4NZJA 1AGDA 1T0MA 4AMKL 2X7LB 1JWMB 4NM8H 2R2EA 2UVFA 5FDWA 5DURD 3RBSA 3QWOA 4BJLA 4OCWL 4P3DB 3RWIB 5F7HA 4X6FB 5DMIL 2I07A 1I9IH 4HCRL 3SDCB 2J4WL 4ACPA 3TO2A 2AV7A 3FO1B 5DHVB 1K9TA 1MF2H 4P3CH 3R1GL 3G9AB 4OAWB 2NY3D 3NIGF 5D96B 3LH2H 3HNVH 1WIOA 3MV01 1IARB 4PV9A 3SO5A 2IG2L 3QQ9D 5F9WB 3TZVB 1GHFL 1OLLA 4JRYA 2IH1A 4O00A 1L7TL 1UWGL 4LP4A 4CW1A 5E9DA 2EKSB 3T0EC 3GMMB 4MCZB 4FFYL 3A67L 4K8RC 1PLGL 3U48A 3V5KA 3BSZL 3NH7H 4J3UA 2VSDA 5DFTA 3X3FL 1IAIH 3PV6A 1CL7L 3VG0H 5HVGB 4Y0GA 2D4DA 4PJDA 3FRUA 3JV4A 4P2YA 1FFQA 4PIRF 5K33A 1FVCB 5CGTA 2Y72A 1MI5D 3Q1SH 1FDLH 3TT3L 3ARTA 5HPOA 2BVEA 1DQQB 1MFCH 4C83A 2VLKE 1MRDL 1NAKH 1CLYL 2WIIB 1JL8A 5FYKL 4HUWB 2VDLL 2H26A 2FBJH 5D1XA 5D1ZB 3U7YL 4JDTH 3WNNA 5FEBA 3IF1B 1WGOA 2HP4A 4G8FA 3NCYS 4OZFH 4WI4A 3D9AH 1BVLB 4JDVA 3W9DA 1M05A 3MV11 3LIZL 1M7DA 5IK3B 4Y2DA 5FV1L 4G9FE 1N5YL 4JFDD 2VN4A 3QWRD 1RFDL 5KVEH 4JAMB 2HH0H 4P2RA 2AV1B 4WUKH 5FYKE 4UOW1 1F45A 1PYWB 2YMXH 1GRWA 5IV2B 3JTTB 3R0NA 2X1QA 2L0DA 2Y6SC 3RDTA 5ANMB 1N8ZB 2FO4A 1OW0A 4QRPD 3U4BL 3S96A 5JPMB 3KPSB 4JFQA 1MCEA 5L2KB 4QRRE 1U3HB 5E5MA 3WNMA 4QYOA 2DBLH 4G6AC 4MNHB 5FCSH 3DI2B 2JJTC 1KB5H 32C2A 3EW3B 2C3VB 3GB7A 3DV6B 2D7MA 2AXGB 3MBXH 1F02I 1KBGL 1NUDA 4Z8FH 1FV1B 1IGYB 3MJ8B 1VEOA 4RISL 3O11A 2QTEA 1JV5A 3MLTB 4RFOH 5JHLL 1J1XH 1BOGB 1F11A 3SKMB 3IXAB 2AK4A 3PGFH 3WV0A 1JN6B 3CK0H 5C09E 4U6XA 3O3EB 5GGUA 1K8DA 3D87B 4JJ5B 3CFKA 4PLJC 4ONGH 2P45B 4POZC 3F58H 5HDOA 3QDAA 5CP3H 3ZHLA 2B0SH 4H25B 3P9LB 1RJCA 4M48L 5DJAB 4R4BB 1OF2B 2VLRA 3DYMA 5LGHH 3WIHA 3MLZL 3NAAH 1IGML 1QG3A 4AT6B 2N56A 1YEIL 3DX8B 5I76B 5IHZA 4BSVA 4LU5L 3SY0B 1QBAA 2RJMA 3B9DA 1HSAA 3GKWL 3PNWA 3OKEA 4PRHD 1SBSL 4HLZH 2ATKB 3SKJL 4JKMA 1FIEA 1J86A 1SJHA 3QIUD 4MNQE 2W9DL 4X7SL 1EAPB 3JUZA 5I16B 4X5LA 3TBTA 3OWEA 1T5XA 2JIXB 4K55A 1X44A 4CVXB 2ORBH 3HPJB 4F9LA 1QRKA 2D9QB 3RWGB 3PHQA 2AQ1A 3SPVB 3GMRB 2HJKA 4KV5E 5DFWH 3OF6D 4KRLB 4C57C 4L8CB 5FF6A 4PJ5D 3IGAA 3QDMD 2DM4A 4K94H 1IAMA 2YR3A 5FECA 3GNMH 3UPAA 4G6ML 1CXEA 5D1QB 3LQZA 4MJIB 1QSEB 2O26U 2ICEA 3LEYL 3VGEA 2N7BA 5JOPD 2BRRL 4LSUL 1YJDH 5CJQH 4ONFL 4ONHB 4OM0L 4N0YL 4CNIB 2AXJA 4I5BB 2A6KA 1QFWI 5EBMB 2YRLA 5F72S 4P2OA 3SDXE 2F15A 5B39B 1AC0A 3V4UH 2LAAA 3CLFL 3VFPA 2ADJB 2WINB 3OMZA 3UTPD 1OAYH 1YUHA 4PRPB 3TT1L 4PLKD 4RMRA 1HI6B 3BGFC 1EFQA 3SGKA 3C08L 2FIKB 4JM2C 3VWKC 4AEIH 5AD0A 4S1SL 4FQLH 1FE8H 3DURB 4F9PC 3RNKA 4YFEA 1BX2B 3ZT6A 2WUBH 1IC7H 3QCVL 3U0TA 2VH5L 4YBQC 5INDB 3IJYA 5JORB 1X6LA 3WFCL 5SWZB 3QP3A 4WWKC 4YHNA 4LQ1A 3INUL 4YHMH 5KW9H 1I1AD 1MCBA 3VXUD 1KCLA 1R5IB 3KPLB 3MRBB 3TIDB 2I25N 3FB5B 1I1FA 3T04D 2A83B 2VOTA 4ZUUB 5IW3A 4KK8D 1RUPH 4JFXA 3TH3T 1NH6A 4X4YB 2Z91A 1J11A 1IAII 2EDTA 1YEKL 3NZHH 4BSWB 1F4WL 5HYFA 5IHBA 4FMFA 1WFNA 3TIEA 1U58A 4OZHE 4QOKD 8CGTA 3BQUB 5DQDL 3NFPA 3RU8H 3ALWA 1CZ8L 2WW8A 2HMID 2UYLB 4L8BB 1T66D 5ICYA 2HFEB 4JREC 4FFEX 1C5CL 4G8GD 1AQKL 1A7QH 3DRQB 2NW3B 4DAGL 4MA1C 2APXA 1OAUL 3MYJB 3BUYA 5HI4D 3VWJC 3UZEA 4NJ9H 1YQ2A 4XP5L 4LVHB 1IAOB 3BDYL 3MGAA 1GGIH 5ICZB 1I75A 5JO5A 5EU6B 1AR1C 1FNSL 1ZE3C 4LIQH 1C1EL 4CU6A 5F93C 4LASL 4NQSA 4RNRB 3HZMA 5JXED 2EIDA 4ZXBA 2DQCL 1JWSA 2LFGA 3MV9A 2X5PA 2RIKA 4U3XA 4L8SA 1JPTH 4L5FL 2VB5A 3BZ4A 4YFLF 5IJVB 3GJEB 2VDQH 1QYGL 1Q9LA 2BY2A 2NYYC 2QKIB 3IU4L 2OXGA 3B83A 3BZEB 2ZUWA 5I1CH 4MJ5B 4U1SA 5KVMC 1F6AA 3RWHB 4J6RL 4NUGH 3TJEL 1L0QA 3RP1A 5DVNA 3QUML 2OJEA 4JPWH 5DD1H 1OTUC 5HGAA 4UU9A 5GS1C 3QHFL 3T77A 4XPFL 3KDMB 3BN9C 1HCFX 2X4SB 5F3HB 1UCBH 1LD9A 4PJDE 1KTLA 4CVZA 2D7PA 4KPHL 3HI5L 4O9HH 1RZGA 3BH9A 4CRPA 5I71B 4DN4L 3UTOA 3ARDD 3QA3A 4YK4B 4P2QD 3S37L 3D18A 2GSGB 4KROB 3OPZL 3DX7A 5D7LB 2NLJB 4X7TA 5DEZA 1JNJA 1OGTB 2XN9E 1U8QA 5TPWL 3VXTB 2M26A 1G7LB 2H9GA 3VFSA 4WI7A 3GSQA 1KGCD 1MNUH 4XCNB 4PUBL 1CFVH 5DJ6B 3DECA 2NX5B 4I18A 1DEEB 3QXUA 2ZJSL 4HKZB 1CF8L 4F33A 5EU4A 5DMGD 3VH8G 4GW1A 5ID0B 4PLOB 4HMDA 1AD9A 5I2IB 1BBJA 5JUEL 4M1CC 1WC7A 4NHUE 1OGAB 1T21A 2PO6C 4I13B 3QDJD 1KIRB 3KPRD 3MRKB 2IFFL 4XI5D 3CFBB 1DJSA 4H26A 3RX5A 3VMOA 3VCLB 4EUPG 3BZFB 3KYOA 5JHDA 4BFBD 5FHAH 1N26A 3L1OL 5KSUA 5D2NB 2DKMA 4Q9RL 1EEZA 3HA0A 4GLRH 5BS0D 4Z76A 4WUUE 4MCYB 3QQ4B 3CMGA 1XF5A 3OKDB 2BNRB 4YBLB 1MHEB 4P23C 4J8RB 1SJEB 4ZFFA 3O4OB 4NWTH 2XY2A 4PTUA 4OUUB 3FQWB 3ORJA 2WZPD 3DVGA 1H15B 2Q20A 5TFSL 3BDBA 2XG5A 4JM4H 1U41A 5K9OA 1PGRB 1IAKB 5FOBA 4U1IB 1WWWX 2BSSB 3FQUA 2AK4E 1LO2H 4FXKA 3CDGA 1MIEH 3UTSA 1FFNA 1U8NB 4AY0A 3UYOD 1E6JL 3EDJA 1A7PH 5C7XH 5HD8C 4DKDC 2BVQB 2F54A 4Q6IC 4X9GA 2QBWA 4V1DD 3VMNA 1LK2A 1X3DA 2G75B 4XNYH 4N8VA 4ZTOH 1JNHB 2DWEA 1PG7X 3W5MA 2FWOA 3KPNB 3BPCB 1UJ3B 3FOMA 3WS3A 2A9NL 5BO1L 2FH8A 2E6PA 3DBXA 5F21B 5CILL 5DC0A 2C3GA 5TF1L 5E8DH 2E27H 4BFEA 4OM1L 2CLRA 2BVUA 4LVNB 4PS4L 2K1MA 2VXQL 3K4ZA 2YXMA 4YX2L 1Q0XH 4BH7A 1P53A 2IH3B 1AKJB 4F3FB 5A1AA 4UZGA 5I75C 1FNFA 3MA9L 1A1OA 5BW7A 1BQUA 1MHPH 1MY5A 3LPFA 1UZ8A 3QUYC 2UZXB 5D7JC 4ZNEE 2APTA 4D0BB 1RUAH 4ZYKA 1A6AA 4GG6F 3MA7A 2RBLA 1EO7A 3D0LB 1MRFH 4JO1L 1X5GA 2VL5A 3GHBL 2P24B 3IDYC 3MLUL 4YE4H 4PJCB 2VR9A 3FOLA 4DGVH 1PX3A 1TVHA 4FFVC 4PRDB 4Y19D 4M7ZB 1SBBA 1TVDA 3GSUB 2R1XB 5TE4L 3K7UA 3KLHD 1JFQL 1KTDB 1OTTC 2YA2A 1OPGL 2OZ4H 4JPKH 4NZUH 4HUKB 4Y88A 2QQNL 2FEDC 3I85A 3E1F1 4PBWD 4RIRA 4ODTH 5E2TH 2BXZA 4BKLA 4EDWL 2CRIA 2IAMC 3HUJA 3KG5A 1VA9A 4YGVA 3DI3B 3RGVB 3MXWL 3KPPA 4W4NA 1KPUA 5I17B 5D7SH 1W72L 3G5VB 5C0BA 5I6XC 1X4YA 3L3OB 1FNAA 4QHMB 2UWEF 5IVZB 3TA3D 3QUXC 4X98A 3O2DH 3FN0L 3CX5K 2PYFB 1UQSB 5CKGA 4QRTB 3K80A 2W59A 3UJJH 2B8OT 4NRZA 3P0VL 1MFDL 4OBRA 2FX7H 4N1HB 3G08A 3RVXC 1LEGB 2HT2C 4ALAL 2BFVH 4HIEA 3RAJL 2BSED 3MACL 4ZPTB 1BZ7B 1LEKB 3QRGL 5A40E 3MRFA 5DR5L 5IT2L 4G6KH 4JDZA 5HYIA 1KN4H 4HUXB 4BQCA 4IRZH 4HS6A 2AXFA 4YDKH 3UTTE 4IMKA 4I2XB 3AB0C 1RZKH 4I0PB 4JRXA 1BFVH 4AEEA 2O5ZL 4MZ3A 4HQQH 1RIUH 3I75A 4KK6D 2HFGL 1NEZG 1T1ZA 2ATPA 2PXYA 3ZL4L 3QDGB 5JR1H 5ADPH 3ECBA 4OI7A 4R7NB 5D71H 2F53A 3B9KC 4XHJC 1GAFH 4ISVA 3NTCH 2IWGA 2AEIT 1CE6A 4JE4B 1QA9B 4H88L 1KN2H 2IPKA 43C9A 3IDIB 1HSBB 4Z7UE 4XAKE 1JF5A 4NDMB 4B7LA 4E41A 2R56H 2XOTA 4QRPE 3UZVB 3PGCA 3W2DL 2Z31C 2XV6B 2WBJD 3MRGA 3SKOB 3HZKA 2PTTA 1QRNE 3PL6D 1CCZA 4NUJB 5E0QA 2P4AB 4WTXA 1C5DA 4XXCA 1DN2A 1QLEL 4R7DA 1MCLA 4KU1A 1NBVL 3QXDB 3X13A 3MJ9A 5DSCA 3O2VL 1NAMB 4FQJL 4Y4HB 2EYTA 3NIGE 5CWSA 3GEWB 4L4TE 3PIQA 1JGVL 1NCAL 4JVUA 4NN5B 3CUPB 2X2YA 2YN5A 1A3RL 2VXSL 4NQXA 2HLAB 2FGZA 1G7HB 1J10A 3G6AA 1QVOA 4X5WB 1CGSH 3FONA 3H9ZA 4K2UL 1KELH 1IBGL 1J87A 3WSQH 1PD6A 4PBXA 5EUOF 2KKQA 3CX2A 2BVPA 1YY9C 3TC9A 3MLSH 4GOSA 2D03L 2PYEA 4OV5B 4MD5A 1ORQA 2JCCA 3C60B 4OZFG 4L9LC 4RFNB 4ZFZB 3LOWA 3MUZ1 3FT3B 4JHWL 2VLJA 2DJ4A 1J8HA 5CBEB 3FCTA 1RJZB 3PG2A 3T0XA 2C4FT 4FXGA 3KS0H 2LVEA 5HYQA 5L2JB 2GJJA 4HWZB 1C12A 3CCHA 3C5ZB 4MQXD 5DLML 5C0NC 3S5LB 3GJFA 3MRHB 2AEQL 1JPGB 1DQLH 4LPUA 1A5FH 3CC5B 1A6TA 1QLFB 4WFFD 3C6LA 4O2FA 1BPVA 5IMKB 1TCRB 2XIDA 1IL1B 4R4FH 4WDIA 1INDL 4LLMB 5JMOC 2HJFA 4ZQKB 3GM0A 1I7RA 1IM9A 4OLWH 1UB5A 4ELMA 3QDME 2VDNL 4MMZC 3WUZA 2O61B 5IESH 4J3SA 3BGAA 5D1ZD 2FJFB 3HMXH 5JW5A 1SHMA 5D70H 4I48B 1YNLH 5FKAA 1FL6A 3NZ8A 1R0AL 3N9GH 1X7QB 2J1KA 3QJHB