1AGPA

Three-dimensional structures and properties of a transforming and a nontransforming gly-12 mutant of p21-h-ras
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures and properties of a transforming and a nontransforming glycine-12 mutant of p21H-ras.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords C-H-RAS P21 PROTEIN
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1993-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1agpA00
3KJEA 4POAA 1W48A 4L15A 1XTSA 4QM7A 2J1LA 1TEXA 4Y0AA 3W5JA 3W3ZB 4B3FX 3R8CA 3Q9LA 3QY0A 4LBYA 1FUUA 3NBYC 4NCJA 5LDDC 1WBDA 1ZUHA 5IT5A 2QUZA 3KJHA 5KOYA 1II0A 1CJVC 4JKIA 4DJTA 1FL9A 3SBDA 4NMMA 1JNYA 3GP8A 1I4LD 2ZI9A 3A36A 4URUR 2CCGA 3TQFA 1YZTA 4Q1FA 1NJGA 4DLSA 1G3MA 1W46A 3OFNA 4GL2A 2B8WA 3P32A 5L3SB 1II9A 1N6HA 4LYHA 2ZRJA 1TTTA 4RKEA 3U7GA 5UKDA 3G82C 2O52A 3C41J 2J46A 1E1QA 3DPUA 3QXHA 2ZRNA 3UWOA 2C78A 3SEAA 1GL9B 2O8BB 5KU1A 1CRQA 5L8VA 4PAOA 2GWHA 1ZM4A 2QPTA 1SKQA 2IYLD 1NY5A 3W8NA 2AWNA 3A4NA 4DEYA 1CR4A 2QSYA 4AK9A 1E69A 3Q8XB 2BEJA 1TQ6A 3RAPR 3I62A 4ARZA 5B58C 4A8JA 5B64A 1SQ5A 5BYKA 4P4TA 3DMNA 1FFHA 1DAMA 1WDTA 2YHSA 3FKSD 2B7CA 4M2LA 4QBGB 4TT3D 1JR3D 2NO9A 4KV9A 5TARA 2O8FB 2BEKA 4FXPA 2Y8EA 3WBKA 5LPNA 4ESVA 1OB5A 3RLFA 1BKDR 4C4PA 1G3RA 5JBQA 1NRJB 3AVXA 4CYMA 1RZ3A 1XTRA 4AKHA 3OIWA 1SVKA 1YU9A 2YZ2A 3ZD6A 1U81A 2ZJAA 2J41A 1UJ2A 1NLZA 4O0MA 4RD6A 4KFUA 5JJKA 2NPFA 4TTQA 4C0AC 1L2TA 2YWGA 1X8LA 4BZQA 1VECA 3SBEA 1XEXA 5F9HA 3EG5A 2VSFA 2WVJA 3C5CA 2CXXA 4EPXA 3A1SA 3BBPA 3TGPA 4HB2A 3U3KA 3R7WB 1PUJA 1N6RA 1CS4C 4R98A 2D74A 2JDIA 4ACAA 3HPQA 3I4LA 4GOJA 2ATXA 1ZNYA 1OFIA 2AXNA 1YR7A 3F3YA 1GRQA 2FFQA 1KKLA 1Z08A 3ZS8A 1OKKD 1NSFA 3WP0A 4C2UA 2DPXA 2CCJA 2FPLA 3DO6A 4B35A 5AUPB 3AP1A 3QEJA 4Q9LA 5AJZA 4LCBA 5DN6D 1A1VA 3OIUA 4JL6A 3LH5A 1R8QA 3FGNA 4ZV4A 2ANCA 5AWFC 2WPDD 1NBME 4DBLC 1CJTC 3SE0A 2ASEA 3PEYA 2PBRA 2VBCA 4IDPA 3PG5A 3TIFA 2CHGA 5E3HA 3GFTA 2GJ8A 4HB0A 3NTUA 3W6PA 1M8PA 1PUIA 3CR7A 4LDJA 1E9CA 1G5RA 1C4OA 1ZW6A 1RPZA 1KSJA 3NC1C 1R7RA 2ZRAA 1GKYA 1Z6AA 4QBIA 3SNHA 2HJGA 4JLMA 4NONA 2BMJA 4TMVA 4TTPA 5JMTA 3A4MA 1FMLA 5EP3A 2BKEA 5A5GA 1NMZA 5FUYA 1FP6A 2D3WA 3GFOA 3Q85A 4X8MA 2FMXA 4HEJA 5JLJA 5TVKA 2A5JA 2ZR0A 4WXPA 1FOEB 2ECKA 2P67A 2XZPA 3M1IA 4BLRA 3QXSA 1DARA 4C2TA 4B2LA 1DELA 1Z0KA 2OBMA 2VEDA 4V0KA 1YHNA 4Q19A 4US1R 3AVVA 1E2PA 1E2DA 3NBFA 1CEEA 2GCOA 4Q5IA 5BN5A 3FMOB 2QT0A 4DHEA 2ZS9A 3FHOA 3IBGA 3NHAA 3SHFA 4DLUA 1SXJB 3MFYA 3NEJA 2VF7A 4TMWA 3RRYA 1OE0A 4Z1MD 2ZSFA 1EFRA 4MITA 1UBEA 4UNQA 2ZYVX 2QMEA 1R0YA 1IN5A 3LBNA 4PZLA 2ZRDA 1XD9A 4KYUA 1JQLB 5SZKB 3C14C 3VNUA 2O0HA 2FFBA 1D6JA 2FGKA 1KI1A 2WKQA 4Q1EA 2J0VA 2EQBA 2O8CA 1T6NA 4DEXA 2KI5A 2WKPA 2ZM5A 3UPUA 1IM2A 2XTMA 3CNLA 3CX7A 4WZ6A 4UKDA 2OFWA 3BB1A 2AR7A 3FHCB 2DYKA 2W2XA 2SHKA 2QE7D 3K9GA 3VHLB 4E03A 1NN1A 2PT7A 3KL4A 4KVAA 2QMUA 2DWQA 1E0JA 2BIFA 1AQYA 3M0EA 5ELXA 4ZO4A 1MO6A 2PZFA 1N6KA 4Q1AA 1XXHE 4F38A 3AUYA 1BH2A 1H8ED 4N3NA 1VYUA 2W0MA 1J70A 2CVHA 1GFIA 1PLLA 2KBFA 1CIPA 3B6EA 2D62A 4O25A 3GJ0A 2WWXA 3CF0A 5F3WB 5CIQA 1EWRA 1QVAA 4G5SA 1G7RA 4FMDF 3VR2A 1R4AA 3QBVA 3IPXA 1KK2A 4B34A 2JIZA 4D25A 2WAYA 5BW8A 2P5SA 3W90A 2RGXA 1E9RA 1XCGB 4UJ3A 2ZI3A 5JWRA 2JJ2A 1LW7A 2WJGA 1W4RA 3BERA 3DKVA 5KDOA 4B6FA 4DLRA 4YMSA 1E9EA 4QKQA 3GJ7A 1N6IA 3CRRA 4PHHA 3EZ7A 3LXXA 1B0UA 4TYQA 2OHFA 3SHWA 1GRNA 1S3GA 4C9BA 3BFXA 2GK6A 1NVUQ 4XD7A 3GLGB 3BS4A 4R2IA 2V6IA 2P6RA 1AN0A 3KXLA 4MA4A 4NCIA 1W0KA 2VHTA 5JRZA 4QGHA 1MV5A 1W36B 1A82A 2XXAA 2C5LA 2CMKA 2XZOA 5FOUA 4IJMA 1JXMA 3FPAA 3RS5A 1KMQA 1MO3A 2CJWB 2QM8A 3GJ8A 5BYJA 2F1RA 3SI7A 4MH0R 3CH4B 3WBJA 4TYPA 1WA5A 4GNKA 4MGKR 4EPVA 4KSBA 1E96A 1G8PA 2VP6A 1PV4A 2OXCA 3CF6R 4OK6A 5BN4A 1OLOA 4OKSA 1U0JA 4MRPA 4DSUA 1SGWA 3HP1A 1M34E 3FFAA 3U61B 2I1QA 4TL9A 3THYB 3SQXA 2XOKA 1CBUA 4US2R 3IQXA 3LA6A 1ESMA 4M0LA 1NKTA 2YKGA 4JKYA 3EIHA 4Z51A 4MQBA 3K0SA 2JJ8A 1EG7A 1HE8B 2MSDB 1GITA 2AFIE 2J0UB 1T3HA 1W4CA 4XWOA 4G5OA 4M1OA 3EZ2A 5FOSA 4BZXA 2DWPA 4A9AA 1JR6A 2CJWA 2ODEA 1LS6A 2R6GA 2Q9AA 2JLZA 1LNZA 3FMFA 2G6BA 3GEEA 4HAZA 2GF9A 3KQNA 1VDZA 2VSOA 4OHZA 3HR7A 3EWAA 2FG5A 3BH7A 2ERYA 4LK2A 5EQTA 2FGJA 4TQAA 4Z8XA 3K0AB 1WRBA 2HXSA 2W6JD 3KQLA 4DUGA 4I1OA 4LY6A 1QZXA 2V6JA 2ZRKA 2FA9A 4I4LA 2XXAB 3N70A 2IS2A 3PUWA 4BLSA 1JBKA 1QDEA 3GMTA 4PO9A 3UWKA 1AS0A 1DVRA 1G3UA 1P2UA 2ZJBA 1NP6A 3WY9A 1HA3A 3C4JA 3K9HA 1XTKA 5HPYB 4TSFD 4JVLA 4LUCA 2GK7A 1RYFA 2FEMA 3WMFA 4EPWA 1UBCA 4QGGA 3ZLJA 5SZIA 1K6MA 3DHWC 2WOOA 4D81A 1E2LA 1G6OA 5E95A 5FPTA 4Z8YA 5JSZA 3EPLA 2QMOA 4OHWA 2OXRA 2E9SA 1IJEA 2F1HA 4ZPXA 1DTSA 1ETUA 1MOZA 1XXHA 2QTHA 2OLKA 2ZRIA 4QC2A 4QOSA 4BASA 1RRGA 4L9SA 3ZYCA 1FNNA 3RS2A 4MUAA 1KI4A 2R8RA 3RC8A 2ZI6A 2QP3A 5JECA 2IYRA 1OB2A 2RMKA 2CHVA 4AC9A 4B48A 2OLJA 3NG1A 2X2EA 2J45A 1E6CA 5C4GB 5SZHB 3TLXA 4NDZA 3KKQA 4LJ4A 1SHZA 2B21A 4GOXA 3ZIAD 2A7QA 4HDOB 2IYZA 1R2QA 1Q44A 4YMVA 5HE8A 1NIPA 1RKBA 1LF0A 1KDTA 3MWYW 2GJKA 2D4HA 3FKSA 4PTLA 3V00A 4MKIA 3VR6A 2OILA 2F1JA 1Z2CA 3BOSA 4L16A 4Q4AB 4NYJQ 5KPDA 3PEWA 1E2MA 3VFDA 1J8MF 4G5GA 4GMXA 1BMFD 4I81A 2XSZD 1ZCAA 1KYIA 2J87A 3PUZA 3TQCA 5CITA 2J5XA 2MMGA 1N2CE 3AF2A 4ZDWA 3I5XA 3DZDA 3ONWA 2YVUA 1YZQA 3WHKA 4FI3C 5DI3A 3VR4A 4TLEA 4LV5B 1UKVY 1NBMA 2BDTA 4NZYA 5TV2A 2F3TA 1KAOA 2WJJA 5F98A 1Z28A 5KDLA 1DG3A 4TL6A 4A0RA 1W36C 2YOFA 2JLXA 4JYCA 4O2LA 4IFEA 4LPSA 3R9XA 1WMSA 3HYRA 1GUAA 2GNOA 2AL7A 5HZKA 3RS3A 1XD8A 3OFND 1JJVA 4RD3A 3X1ZA 2L0XA 2WM9B 2QP9X 3SJAA 3GLGE 1AIPA 4ZCIA 2QTVB 1OW3B 1OH5A 4KU4A 4PC1A 4B33A 3WMGA 2QI9C 4BLOA 5CM9C 4GFDA 3FOZA 2WJIA 1KDRA 3GLFB 4PHFA 4PPGA 2AKAB 4US0R 1U90A 1HE1C 3UIEA 4B43A 2JA1A 3MUFA 2ZROA 3C7KA 2HXYA 4TYYA 1E94E 1HQCA 2Z5FA 5FBQB 1NY6A 3RDPA 4P31A 2VHCA 2VLIA 2H7VA 2QNRA 4E09A 1GRRA 1T3LA 4U7DA 4LSGA 3RWOA 3NWJA 4LHYA 2A5FA 2PMKA 1AJEA 3I92A 4TSFA 3A1TA 1US8B 1KAGA 2CNWA 2OAQ1 5HCIA 1KK1A 2EWWA 1QVRA 4CIDA 1OT3A 4QJ5A 2WHXA 3DZ8A 3CM0A 4OHXA 3I1FA 3W3AA 3T12A 3P4YA 1WXQA 2X1VA 2DY1A 2CK3D 3CR8A 4M21A 4PQYA 5IF9A 5DO9A 1KGDA 1GKUB 2BBOA 1CKEA 5CB6A 1XEFA 3DMDA 4M1WA 1AS3A 3CRVA 1VCIA 4PSAA 4V0OA 4S2EA 1KKMA 3KKOA 4A0FA 2ZEJA 4DSNA 3QVUA 2DBYA 1AZTA 1X3SA 3B1XA 4MUBA 3B1WA 4EFMA 3OESA 5K8TA 1G19A 2QENA 4ZIRB 1Z29A 3I5YA 3BE4A 1JECA 3PUXA 2V8OA 1F3OA 2Z4SA 1G7TA 2GZDA 4OK5A 4V0LA 4A2PA 3MG9A 1AKYA 1KHTA 2A5YB 1UPTA 3MSXA 3CX6A 3CLVA 4PANA 1OYWA 1NG1A 1OHHD 1MKYA 2VHJA 2XZLA 1HQYE 1OIVA 1XEXB 1JEEA 2XNDA 3EAQA 1E9DA 4MRRA 1UDXA 2OUKA 3L82B 1XTIA 2GA8A 2GRJA 2KJQA 3P27A 4ITRC 4JLKA 2QRNA 2JLYA 5DNYB 4TZ6A 3WNDA 1MRSA 3EZ9A 2VHUA 3K0FA 4O3MA 2RGEA 2QGZA 3IILA 4WA7A 2GHIA 421PA 1Z6GA 4WZAE 5C18A 2JCSA 2YWEA 4P33A 4JLOA 2ZITA 4KAXA 4PAMA 1K5DA 2Z0MA 4RCYA 1X6VA 3AQ4A 4GDFA 1RJ9B 2OBLA 3Q72A 4MGYR 1PLJA 3V9PA 4PAQA 3K53A 1HV8A 5DIFA 2JGNA 2ZJOA 4RJLA 3AVYA 2KWIA 1VIYA 2ZI4A 1E79A 3TKLA 1HYQA 3RC3A 4B2PA 3VTKA 4GRAA 2ANBA 2VPPA 1H8HA 1LVGA 1MO4A 1SVIA 4D80A 2C95A 5FL7A 2JLQA 1XCMA 4IOJA 1JJ7A 3LBIA 1P60A 3SJBA 2Q9CA 3VU9A 3SC3A 4LZZA 4RD2A 1MR3F 1GL6A 2IWHA 121PA 3CIOA 2YC2C 1CU1A 3DVLA 3LLMA 4LBVA 5GVRA 4P0TA 4Q4AA 1R6BX 2D2FA 1OFTA 1DO2A 1QG4A 3CKLA 1ZC4A 3KKPA 4AY2A 2G1KA 1U9IA 4B44A 4GZMA 4JLVA 1CR0A 4XWAA 5JZVA 4LRWA 1A2KC 1MABA 1QHNA 1G18A 2HT1A 3WYGA 3U60B 4ACBA 1DPFA 2WTUA 4A2QA 3QQ5A 4C7OA 2QT1A 4QXAA 1GG2A 1Z0AA 4Q4JA 3U7EB 4V02A 4B73A 1UEJA 2WWWA 1Q1ZA 4B71A 1E2FA 1M7BA 1ZD9A 1VCNA 3BH6A 4WOPA 4V03A 1BOFA 1LFDB 4PZYA 2X77A 4F92B 5HKKA 3LDAA 2GAOA 2RGDA 2AX4A 2NQ2C 3CONA 3RWMB 2ZXUA 4D4JA 5FOWA 2IEZA 3CRQA 2CE7A 4UNRA 2HCJB 3GLFA 4TLAA 5EUQB 1HT1E 3V4FA 1XD2A 3GQBA 3K0CA 3NKVA 4BWYA 4ASUA 2XX3A 5JWHA 4FMCF 4HB4A 3ZVMA 2CCKA 3ZIAA 1E1RD 2O8CB 4LHXA 4XTRA 2WIBA 3T1VA 1FX0A 1N6NA 3B7GA 1SVOA 4C30A 4OI4A 3V4RA 1E0SA 1QBKC 4JVMA 1GWNA 2JLRA 2CDNA 1DS6A 3A37A 3AP2A 2BVNA 5FR1A 4RD4A 4Q02A 1Q21A 1R10A 1XJCA 2I1VB 4PO1A 4Z1MA 2NO6A 3HYTA 1LS1A 5CIWA 1QF9A 2NTYC 3HPRA 3LV8A 4BRUA 3EZ6A 3K09C 4XH9B 4AWXA 3PFIA 1NKSA 2FEOA 1YZKA 2Q6TA 4CRWB 1YE8A 2QEQA 1RYHA 3EA5A 5EXSA 1GTVA 3CB4A 4UNNA 5AUOB 1QHIA 4NH0A 4TTRA 3ECCA 1QHGA 4RKFA 2GCOB 3K9NA 4Q21A 4EPYA 1UEIA 4FCWA 3IIJA 4IFBA 2IBMA 3QKSB 4M8NE 1TEVA 2KBEA 1GAJA 5AJXA 3T1OA 2OT3B 3U4QA 2D7CA 2AXPA 2KB0A 4MYHA 3JZAA 4NYIQ 4U5XA 3SR0A 2A5GA 3TVTA 3RRMA 1JPNA 2W2VA 4DSTA 3ZZ0A 1MRNA 1ZJ6A 3LRPA 2FDCA 2G3YA 1KJWA 3ZVLA 1KK0A 2P6NA 5EXPA 3I61A 4JLPA 4PX9A 3OAAA 3W34A 1U0HC 2ZUDA 4IOKA 4JT2A 1S8FA 1ZBDA 1Z83A 3E2IA 6Q21A 3X1XA 2QAJA 2DB3A 5A0FA 2AK3A 5JJLA 1RFLA 3IHLA 1KNXA 3N5CA 1UBFA 1AZSC 3SOPA 2C9OA 2JAQA 2VHQA 4HLCA 5FTNA 4FCTA 2W6IA 3OE7D 2OV2A 2R6CA 3VKWA 2GVDC 1GDDA 4A92A 3RNLA 1G16A 4ZCMA 5EP2A 3CZQA 4Q9KA 5KHOC 3SJCA 2E1RA 1O87A 3GFPA 2GXAA 2AD5A 3EXAA 1GKIA 2HV8A 4BE7B 4RSGA 2YWFA 2H57A 2ZREA 5L3QB 3AVUA 2OCAA 4C0QC 2PL3A 2OO7A 4A6XA 4KFRA 1S2MA 5FBLB 3QG1A 4LC1A 4URWR 4OBEA 4EKDA 1N3BA 3GLHA 3EPKA 4HLUA 2IHYA 2IX3A 4E07A 1NNEA 2PMDA 1BS1A 1EX6A 2B8TA 2REBA 4MDFA 4A82A 2GVZC 4KLNA 2C2HA 1E9SA 3B8HA 3MJHA 3T1TA 3PQCA 2AWOA 4L5BA 1G20E 1EFTA 1TADA 2N42A 4QG7A 2ZU6A 2PX0A 1E4YA 5FPYA 4A4DA 4L8GA 1S96A 2WSSA 1TU4A 4B3XA 1T5IA 3NEYA 3QPUA 4V0MA 2Z43A 3AKEA 4RZ2A 2XNSA 1ZMXA 5FTMA 5KNCA 2WMOB 2WOJA 4FMBB 2WWIA 4XD7D 2O8EB 1G7CA 2FV8A 2VH5R 4EAQA 1Z47A 4A15A 2G1JA 3MWLA 5DLQC 4QRHA 5FR2A 3LXRA 1T8TA 3MWKA 3LO5A 1FTSA 3C5HA 4D4LA 2OM2A 3UMRA 1SHKA 4QHSA 2DFNA 1DAGA 4MYTA 4ASUD 3ICEA 2IT1A 4WW0A 5LB2A 2BM0A 4CGZA 4NCNA 1XPRA 5FBVB 1A5TA 4Q7MB 1KDOA 3FE2A 4Q7JB 3U6BA 1W1WA 1E99A 5CM8B 1BMFA 4TMTA 2PJRA 2UKDA 1ZM9A 3U7FB 1CULC 5JWOA 4A8JB 3IUYA 4BLTA 4NCKA 4JBWA 2A3RA 4JZKA 3SN6A 2BV3A 4JL8A 3A1VA 4EJSC 1ZP6A 1BIFA 4Q9HA 5EE5B 2O8BA 2Q0HA 4HATA 2QQ0A 2W83A 1TAGA 3CRMA 1SKYB 2NIPA 1ZYUA 1IXSB 2XEXA 3BWDD 1CJKC 1FX0B 3DOFA 4CW7A 4A36A 4QM6A 5CK4A 3A1WA 5KDDA 1E2KA 1KO8A 1XF9A 1P3JA 2I4IA 1IXRC 2X19A 4F4JA 1EFCA 4M4SA 2CL0X 5CYPA 1F48A 3F5FA 4IDNA 3U3RA 1P5ZB 3Q7PA 5TB5A 5HZHA 4FW9A 4H1VA 2QU8A 1P9NA 4EFNA 3K0AA 4AYTA 3UATA 4BRWA 1P9WA 1Q20A 1AM4D 1G4UR 4LPKA 1G291 4DB4A 2C99A 4JLDA 3ZVRA 3SZRA 2WBLC 2EW1A 1HEIA 4UJ5A 5EE0A 3TNFA 1ZCBA 3QVVA 3U44A 3FDIA 1G6HA 5FUXA 1XMSA 5FL7D 3BD9A 4NPHA 1U9IC 1Z07A 3E5HA 1PVOA 2GBLC 2F6RA 4K81B 4PSKA 4YDHB 3C16C 4LV6A 2G0NA 4Q4JB 5FUVA 1D2MA 1XPUA 2ZRPA 4DVGA 4PPQA 4QFMA 5LB4A 4MGIR 1I2MA 1S1CA 1UKEA 4QGAA 3H0KA 4YQFA 4FINA 221PA 3L2OB 2ZE8A 4RVCA 3KQKA 2FSHA 1OFHA 3ADCA 2YOGA 1YQTA 4F4CA 4RCZA 2PH1A 4BEBA 2V3CC 4CEHB 2IYQA 3I3SR 4B3DA 5K8LA 4W5JA 1W4AA 1OXUA 3IPYA 1T3SA 1N0UA 2PEYA 1COWD 2XGJA 2X8AA 2EVWX 2A78A 2VO1A 3KKNA 3RS0A 2C98A 2YYZA 4GSYA 2P2LA 3HDTA 3KQUA 3NHBA 1NIJA 1SXJD 3M4YA 2QGNA 2RH5A 4GI7A 2IF0A 2RKOA 3NXSA 4FCVA 2C03A 3PENA 2ZI7A 5C2JB 1T0HB 2HYDA 4LWZA 3QOFA 4Q01A 3MGCA 4LC0A 2GBLA 4LHWA 3NBZC 1F6BA 1M2OB 3TBKA 1W5TA 4L9WA 1P2SA 2QY9A 5DISB 3JVUA 4BPBA 3B85A 3B5JA 1E2QA 4M53A 3IDQA 1R0XA 5AJYA 4KYIB 1G41A 2W2TA 3KTAA 3EPJA 2VP9A 4NU0A 3KUCA 4Q66C 2ZRCA 4YDSA 521PA 4PQRA 5DN6A 1OPXA 2QQEA 1HT2E 1DG1G 3EW9A 5FFMA 3THWA 2IS1A 4F4IA 2J59A 1GZSA 1WBBA 4QJ3A 1EWQA 3TK1A 1ZNWA 2GILA 1Q3TA 3U2QA 1Z0IA 2ATVA 2CNWD 4Q9JA 3AKDA 1R0WA 3ADDA 2I3BA 4TL8A 2JDID 3KKMA 3SYNA 4G5QA 4Q4HA 5SZJA 1NN3A 1OXVA 5CDFA 2HEIA 4FIDA 2F9LA 1OH6A 2R6AA 4XVUA 2QTFA 1XTJA 1E1RA 4ZDIA 2QAGB 3B78A 4GT1A 5KSPA 3QBTA 5FPKA 1YZGA 2ODWA 1V5WA 1JI0A 4OHVA 1N6LA 1E9FA 2LKDA 1CP2A 2IS4A 4GMDA 1ZVQA 3LNCA 4LHZA 2O0KA 2H8KA 2EFGA 1DADA 4N0EA 3S1AB 5EZ5A 4LBWA 1KI7A 1P61B 2GXSA 1X86B 3L43A 3EA0A 1XZPA 1QHHB 1SVSA 2ZSEA 3K0EA 2EFEB 2ZYWX 4NHOA 2GCNA 1IJFA 3BH0A 1T0JB 1XMVA 1NBMD 2A2ZA 1PZNA 1H8EA 3CPJB 3DM5A 3ZS9A 2F7SA 4DCTA 3B9QA 4DCNA 4F93B 2V1UA 1Y3AA 4HLUC 4II7A 3TRFA 3VHXA 3OF5A 1D2NA 4FWIB 1KY3A 3IEVA 3UMFA 1T5LA 2QE7A 2XSZA 5JEDA 1Z06A 4HAXA 1E2HA 4IW3B 2QN6A 3W9YA 4OI0A 4QNMA 2R65A 5D3QA 1VHLA 3LWNA 2HF8A 1E2GA 4EIWA 3BGWA 5GVSA 1K5GA 1OIXA 4P4UA 1FUKA 1DAIA 2HUPA 1XMJA 3ZZUA 3F0TA 3QXCA 1KI9A 2XB4A 4C0LA 1NI3A 5CYOA 1IN4A 4MKFA 5BN3A 1GNQA 2D2EA 1KSGA 4D0LB 1EFHA 2B7BA 4H1UA 4MKHA 4W9MC 5EE9A 1YVDA 4TZ0A 1H8HD 1W44A 3B82A 2NG1A 3QUSA 4OK3A 2RB4A 4OYHA 1SXJC 2IL1A 1N5KA 1EFRD 4NP6A 4PR0A 4CDGA 1J7KA 3AVWA 1EK0A 3KJGA 5CJ2A 4Q47A 1HY3A 3ZQ6A 5F2EA 2NZJA 2OG2A 4M9ZA 1XZQA 1N25A 1RRCA 5G53C 1NJFA 3BRWD 3IO5A 3X1DA 3LX5A 1ZM2A 2FZ4A 4PC3A 3QF7A 2FU5C 4TL7A 3H84A 1G64A 4CEJB 5CJPA 5FI0B 1I4TD 3BAFA 1RVDA 3CBQA 4YLGA 4IVQA 1F60A 4XTCS 2OAP1 5HR5A 2XJ4A 2AD1A 4Q03A 2HDNB 1KMHA 1TUEA 2XNDD 5DE3A 3RS4A 1VG1A 1MT0A 2P5TB 1IN7A 1RW4A 4LJ6A 4PC6A 1OXSC 1NF3A 3AM1A 4GZLA 3FFBA 2ODBA 4LJ7A 1F2UB 4A0HA 1NN0A 5JEEA 1C9KA 3THXA 1JAIA 2R62A 3TMKA 1ZNZA 5JRJA 1GNRA 1G8FA 4AI6A 3U3MA 1II8A 1J99A 4HYYA 4BLPA 3T61A 1F2UA 3I72A 4U00A 5M04A 1VIAA 1E2EA 3UG6A 3GLIA 4JLBA 1W2GA 1KZ7B 1U8ZA 2GESA 3P1JA 3A1UA 2VP5A 2MMCA 3OAAD 2C77A 5J4HA 5FL3A 3KQHA 2PZGA 2XB2A 2OESA 3AH8A 1KMHB 5AJVB 3VR5A 4BFVA 4M9SA 4DCSA 5F9FA 1N0WA 2YOHA 1RRFA 4DRZA 1Z5ZA 5CDFE 1GSIA 3X2SA 3R8FA 1LF5A 2WJHA 4C3ZA 2GTPA 1W7AA 1E32A 1UDWA 1OIWA 3K9LA 3TUZC 821PA 3T35A 3QF4A 3RHFA 4HUQA 5KUTA 3GD7A 1ZUIA 2NMVA 1ZM7A 4B74A 4N1AA 2D06A 3REGA 3B2EA 2PLFA 2FSGA 1X8KA 4DXAA 5G41A 2LKCA 2ZJ5A 1VG0B 4OJKA 4AD8A 1P72A 1SXJE 4JVSB 1R0ZA 1VCMA 1XFAA 2GKSA 4M1MA 4RZXA 2IYXA 2AHOA 3WYAA 1KK3A 2GAAA 4AURA 5G40A 4LBZA 1ZM3A 4M1SA 4IDOA 5IK2A 4DC9A 3SJZA 4ZKEA 4D26A 2OFXA 4JSTA 3KDSE 4DT1B 3IQWA 3DEFA 1XMIA 3ZQJA 1S1MA 4JLJA 4TLBA 1G8YA 2JLSA 2NGRA 2PJZA 4OL0A 2JJ2D 4KBGA 5H8WA 5FTJA 4DLTA 2JIZD 3U6KA 2JASA 3D6TB 3EC1A 3GJ5A 1NLYA 3T5GA 3SFVA 3PJRA 1XJ0A 1Z6YA 2C04A 4OQFA 3X1YA 3JZMA 5FUWA 5J4YA 3LY5A 4HDQB 1M7GA 3IEUA 3P20A 4KFSA 3AKCA 5ANRB 3ZZTA 4L4UA 4TMXA 4CT5A 1KOFA 2IK8A 1SULA 2HLDA 4NTZA 3U3OA 4LYJA 1QHXA 3ZDQA 4V0NA 2GJ9A 2UZ3A 2DFLA 3K8YA 2P6UA 4BFTA 4JSYA 2WWFA 1A4RA 4LJAA 2Z4RA 5K8UA 1VPLA 1CJUC 3Q7QA 4MYUA 3W5IA 3QKRB 5K8IA 1OXXK 1EGAA 1U8YA 5DI9A 4LJ5A 4M9XA 4EQ6B 2YWHA 3AGPA 3H2YA 2BOVA 2DR3A 1R5NA 3A4LA 5FBRB 3NH6A 1TL7C 3DKPA 3PXGA 3T5DA 721PA 5JS7A 3GJ6A 4XIGS 1JR3E 2FPKA 3WRYC 2PCJA 1FW6A 2BMDA 2VRWA 4P3YA 2RGNC 4Z54A 4RFSA 2LCFA 2WMNB 3PV0A 1ZU4A 1YJ5A 3EASA 1ZINA 3VMFA 2HCBA 2D7DA 1KI6A 2N1BA 4HAUA 2AK2A 1JB1A 3T06B 5DHFA 1G9XA 5DH9A 1TQ4A 5A4JA 3RSLA 4OQMA 4DDUA 2H92A 2ONJA 4NYMQ 2CL6X 4V0ME 4R2HA 5FPSA 4BFZA 3R9WA 3O8RA 1TF2A 5HCNA 3T34A 4DIDA 3A6PC 4DLVA 4MYCA 5E7MA 3EIEA 1EFUA 1CTQA 2OFOA 2W0SA 3TSZA 1WE2A 2ZETA 3U3JA 1L4YA 1WP9A 3LVQE 1S4QA 1JQJC 4D6PA 5KYKA 1CR2A 3CNNA 1GVNB 5DSZA 5EP4A 4EFLA 3PUYA 2Z83A 3KXIA 2NZ8A 1S0UA 2H17A 1J90A 4J0QA 3X1WA 2RAPA 4HAYA 3SYKA 1UM8A 1XP8A 3ND8A 3B1YA 1IAQA 2K5UA 4DDWA 1U0LA 1DAEA 4HI0E 4HSEA 3B1ZA 2YNMA 1UKZA 2FFHA 3K09A 4XOIA 1XX6A 3L8YA 1G5TA 1LV7A 3W6OA 3TJZA 1G21E 4KLZA 1VKJA 2JLWA 3GCGA 4RZ3A 4PHGA 3L0OA 4TQ9A 1WB9A 2QAGC 2TMKA 1YR6A 2QBYB 5P21A 3ZVNA 2X2FA 3RS7A 3TUJC 1ZAKA 2FE4A 1EESA 1N5IA 1CXZA 2UVQA 2ZRBA 4B47A 3BFKA 4NCHA 4E22A 1F2TB 1SXJA 1BO6A 1TQ2A 2FFAA 1NL3A 2EWVA 4UXIA 2CLDX 5JFGA 1QRAA 2XOKD 4ZCLA 3QKRA 5D3MB 3OIVA 2HLDD 4C0SA 1X8JA 3T15A 2ZE6A 3NC0C 1BYIA 1WCV1 2BKUA 2H16A 4OQLA 4B6EA 2CEAA 2ZVQX 3L8ZA 3BORA 4OQNA 2QG6A 4AKGA 3QXJA 1U94A 2N46A 1GL7A 1NMXA 1T8UA 1W49A 5CB8A 5J47A 2XAUA 4HZUA 2C9CA 3ASYA 1DAFA 4LYFA 3GLIB 4Q9IA 4BUJA 4DSOA 1DAHA 2OE2A 2J0UA 3AV0B 4AG5A 3AEZA 1XB2A 4U02A 1XTQA 2ZIAA 3DM9B 3RANA 3A58B 4YONB 2DFTA 1W0KD 2V55B 3NH9A 4PO8A 4WXRA 3ADKA 2CL7X 1M7HA 4CZ2A 2HJVA 5FH9A 1OJLA 4FD2A 1JXOA 3KTAB 1DAKA 1YR8A 1WQ1R 4BEJA 1UKYA 1Z63A 3AF0A 4E5UA 3QKSA 2AKYA 2Q3HA 2GCPA 4QBHA 1QHSA 2NOAA 2GETA 2ODNA 2IYWA 2RGAA 1UAAA 4DCVA 2WICA 3GLHE 4FWTA 3EWSA 4IOMA 4PC2A 5H70A 1ZRHA 2ORVA 1Z22A 4LX0A 2IW3A 2ZSBA 2EFDB 4PHTA 4TN1A 4HAVA 3WNCA 1SVMA 4HLDA 4IDHA 3FTQA 3AVPA 3O8CA 2EYQA 1P2VA 2BMEA 4M1YA 3GLGA 4HUQB 1DEKA 1XWIA 3QF4B 2F3RA 4JVNA 1F2TA 1Y63A 4Q1BA 2RHMA 4AKEA 2F43B 2ZRGA 1D9ZA 3ZGXA 1JR3A 3KB1A 3TH5A 2QL6A 3F8TA 4ZDKA 4WAUA 2CE2X 5KNDA 2QBYA 3OHMA 1GIAA 1X1RA 4M1KA 1AS2A 1YZNA 4P4SB 1ZD8A 4B75A 3CRW1 4I99A 2BM1A 2RHDA 3QG5A 2C9YA 1ESNA 2ZAMA 2VP0A 2J0QA 1YZUA 1FQKA 3N2IA 4UXHA 4YC7A 3AVTA 1FMJA 4RY2A 5IDVA 4F91B 2WKRA 1Q1QA 2IF2A 3FYHA 3DL0A 4DLXA 4JJZA 1YZLA 1E1QD 3O8BA 4JT4A 4D0GA 2FX3A 4I1VA 4ZKDA 4B32A 4CEIB 5KPJA 1Q1EA 3R9IA 4KBFA 1P62B 5FOTA 3SQWA 4C7OB 4PPFA 2ZAOA 2ZYUX 5JCZA 3HWSA 4IXNA 4UNPA 1ZU5A 4B2IA 2Q21A 2G83A 3VQTA 1T9HA 5GADl 4NYMR 2WSSD 2R6DA 3SDZA 3DDCA 5JSZB 1S9DA 4KHZA 3TUIC 3CUEF 1SKYE 4KJZA 5DYIA 3BB3A 5GJCA 3WXMA 4B3GA 4IOLA 3OEEA 3CPEA 3FB4A 2E87A 3HU2A 5EXTA 1N6OA 3LVRE 4Q4LA 2GDJA 3G5UA 5FOVA 4W5HA 3UANA 1HUQA 3FVQA 5H1YA 1PJRA 3VR1A 2BHRA 1AK2A 2FNAA 1IOZA 2ZJ8A 3GEHA 1AKEA 3C15C 2FSFA 1N6PA 5EZ6B 4RD1A 3IIMA 4R71A 5IHPA 3PUVA 3T1QA 2AN9A 3AF1A 2ZRHA 4TQUS 4MRSA 3VNVA 2ZR9A 3AGQA 2FJUA 2QROA 3Q5EA 4IVPA 4Q4HB 3DOEA 3MCAA 4FMDB 2RCNA 3UG7A 2QM7A 1HURA 2BJWA 4G1UC 2RGNA 2J9RA 4QL3A 4URXR 1CR1A 3TAHA 2G9NA 4B3BA 2C8VA 4KCGA 1VG9B 3P4XA 2CLCX 3K0CC 3LW7A 4MRVA 2P3SA 3SU8A 4BFWA 5HE9A 2YINC 3VAAA 4ON9A 1KJYA 2BWJA 1SVLA 4WBSA 1MO5A 2R6FA 1CRPA 3KXKA 4X8HA 3J81k 3WMEA 1KI8A 4QBFA 5IRCD 3CO5A 2ZS7A 1WF3A 3THYA 1AQUA 1IBRA 1D9XA 1E4VA 2QP4A 2VIIA 3QJYA 1XU4A 2REOA 1FNMA 1YR9A 3AKYA 3K0FB 3LFUA 3QKTA 4M1TA 5G3ZA 5J4KA 1VCOA 1Z2AA 2FZLA 2WWYA 1UADA 5TY0A 3QEOA 3ZH9B 1E98A 2W58A 2NO0A 3THOA 1P75A 1JAHA 1OF1A 4UNSA 2KSQA 1A2BA 1GOTA 1QHHA 2RGGA 3AVOA 3HU3A 3QPWA 3SYLA 1S9HA 3KB2A 3TSWA 1JALA 3WNBA 4LJ8A 5AUNB 1Q22A 5KSYA 2ZQ5A 1YKSA 1ELOA 2VQSA 2WJVA 1RRPA 2RGBA 4I1UA 2V7QD 1IQPA 3CZPA 5JI2E 3ADBA 4AKIA 3ND9A 4G01B 1NSTA 3TW8B 1P4SA 2REXB 2GJAA 4QHTA 3A8TA 2QAGA 4XSGA 3VX3A 4D4KA 2WAXA 2FF7A 3IBYA 4BFYA 1KZGB 3PCRB 1IHUA 1ZIPA 2QZ4A 5LD2B 5HTKA 5L3SA 2ZTSA 1G17A 4BFUA 1TF7A 3CWQA 3QI2A 2VA8A 3MJRA 3EARA 4DDTA 3C8UA 5KNBA 2CBZA 1U98A 4HLQB 1XDBA 3UKDA 1UF9A 4CVNA 1LB1B 2V7QA 1K8RA 2IUTA 3D7MA 4TT3A 2ZJ2A 2HYIC 621PA 3EZFA 3THXB 3W6NA 3O8DA 4URZR 5FOXA 3AF3A 2IEYA 3TE6A 1HTWA 3EPHA 2FPMA 1GILA 1KDPA 1IXZA 3THWB 2G0TA 3REFA 1OSNA 5KSOA 3JVVA 2BC9A 2O5VA 5B57C 2ZJZA 2GEVA 3WHLA 2MSEB 2GJSA 3ETLA 3I73A 3U44B 2GEDA 3CX8A 3HU1A 1S3SA 4GOKA 3IGFA 3PR1A 4RZUA 3RVBA 3E70C 2PEZA 3KUDA 1O3YA 4G3XA 4IEIA 4C0JA 3AF4A 2YV5A 2XTZA 2V9PA 3AVQA 4M22A 3H86A 5B2ZA 1TUIA 2Z6VA 4ERNA 2IYSA 1W36D 4WIAA 2QRZA 1KSHA 1NVWQ 1KI3A 1B23P 2BCJQ 2FH5B 1I2DA 2IYYA 1DOAA 1H65A 5KSZA 1Q57A 1IY2A 1XJQA 2ZVPX 2FOLA 4CEJA 4FMCB 1KJZA 2IUSA 5DI3B 2ONKA 4D2IA 3BC1A 4LJYA 3RABA 2GXQA 3RSOA 2J7PA 1AGRA 1I4DD 3MD0A 1KNQA 1D2EA 1NLFA 3N2EA 4JBYA 3VKGA 1ZD1A 3PEUA 3TVDA 1IONA 1Z8FA 1TX4B 3BJIC 3Q5DA 3QPVA 2IWRA 1DE0A 1L8QA 2BCGY 5AJWA 1M1YE 4DCUA 4LI0A 4CF7A 5EJEA 1E0AA 1Z6TA 4XSHA 1U8AA 1EX7A 2JATA 3PEVA 2OCYC 5TMPA 4OI2A 2VTKA 1W4BA 2DCUA 3IKJA 4NYIR 5LD2C 3ASZA 4X8OA 2ZE7A 2BMFA 3NVAA 5DGXA 2B92A 3CF2A 1VYTA 1W47A 4JMPA 2J7PD 4Q7KA 3BFVA 3MWJA 4Q48A 4IRUB 1N0VC 1D8TA 2IYTA 4KSCA 2QSZA 2A9KA 4LJ9A 4DZZA 2O8DB 3FWYA 1XNJA 3KJIA 1ANKA 4AIIA 4OHYA 3LW8A 5BWMA 1W2HA 1LTQA 2GXUA 4RD0A 4TYNA 2ZSDA 3LQRA 3R20A 1IN8A 2H1LA 1U99A 4CT4B 2WIAA 2PLRA 3L0PA 1ONBA 1E2JA 1RE0A 1FZQA 3D3QA 4KVGA 4ZIRA 2F43A 2R44A 5FTLA 1NG9A 1NN5A 1TQDA 3E1SA 4NL4H 2OZEA 4K46A 4MGZR 4BECA 4JYBA 3TAUA 1QHYA 1GP2A 4EQ6A 4PFSA 4A2WA 5JHHB 4HB3A 4KFTA 1BYUA 1PLKA 1AGPA 2YJTD 4IHQA 1KO4A 4NKRA 1G7SA 2H5EA 3S1AA 4URVR 1DBSA 1E0KA 4UQOA 2GZHA 2WPDA 2B6HA 4AYXA 5E4FA 1KO1A 3SS8A 1OH7A 4WVFA 2ZUCA 1CF4A 4PPNA 2J7KA 3FMPB 4N0DA 4FN5A 1XRJA 1L7VC 5CK5A 5E7IA 3K1JA 2ZRFA 4JLAA 1Z3IX 2KE5A 4EPRA 4M9QA 3OIYA 4EDHA 1N5LA 3AUXA 1KTVA 4JL5A 5KO2A 3U7HB 2WJYA 1OKKA 4G0NA 4XVRA 3NIBA 3I32A 4DLWA 3LX8A 5EE1A 2EU8A 3K70D 2JLVA 1OV4A 1OXTA 2VF8A 2P65A 3EC2A 3R7WA 5CLQA 2PZEA 1G3IA 1LY1A 5CLLA 5H68A 3TW4A 3K70B 3B1VA 4CEIA 3KZ1E 2JEOA 3QSYA 3IIKA 3O47A 1C1YA 2EFCB 4ESHA 1KSFX 4ZDJA 1MH1A 5J40A 3GLIE 5DHAA 2BBTA 4HZUB 3P26A 2IS6A 2DFKB 3GJXC 2QPOA 3PITA 5TXGA 3EX7C 4EJSA 1NVVQ 4B3CA 2QPAA 2JJ1D 4PSVA 2XTNA 4DLZA 1P9RA 4P4SA 2ZRLA 1X1SA 5E7JA 4W7SA 4O2RA 4G5RA 2UZIR 3BK7A 1RIFA 3MMPA 2XJ9A 4WZBE 4HAWA 3H1TA 3UK6A 4BFSA 1D5CA 3D31A 2IUUA 1M6NA 1SZPA 3B60A 3CH5A 1Q1BA 1A7JA 1ZC3A 5FI1B 2PX3A 4QGFA 4X8LA 3OZXA 4BLQA 3GLHB 4D82A 4K8OA 4IXMA 5J4LA 2DWOA 4ZI3A 4CEHA 2IYUA 1Q3HA 1F5NA 4ABYA 2JLUA 3QIAA 1QG2A 4JBXA 5L3QA 1YRBA 4EJSB 4JIMA 1CLUA 4Q18A 3RRNA 2ZU0C 1KO7A 1VTKA 4EPTA 2W6ID 3OE7A 1KIMA 4LYAA 1G5PA 1FTNA 2BBWA 3EIQA 3LLUA 1VG8A 2R9VA 8OHMA 5JCPA 1YRAA 1R5OA 4LGMA 3GEIA 4QNRA 2ZPTX 5BQ5A 1OH8A 1W0JD 1OFUX 2PT5A 2GZAA 2ZSAA 4QJ4A 4OI1A 5GJWC 2FSIA 3K70C 1Z0DA 4KI0A 2IHBA 4TMZA 4F7WA 2FN4A 2Q3MA 2V4ZA 1TPZA 3RRZA 5AUQA 3I8XA 1GM5A 3KFXA 2IXFA 4DLYA 2WWHA 4A8JC 3OEED 1NVVR 4DDVA 1TMKA 5D3MA 4PC7A 1G1MA 4BFXA 4RFSB 4YMWA 3CPHA 4DB2A 5AK0A 1U2RA 3WRXC 4DKXA 2VP2A 2MSCB 4PZZA 1GNPA 2VP4A 4IKEA 2F55A 1E9BA 3OEHD 1Q0UA 4TWZA 1W0JA 3BXZA 1R8SA 1IY0A 3PVSA 2EYUA 5EXXA 2Q9BA 1Z6XA 1IY1A 3KFVA 4DUGD 4C0BA 4A0GA 2QORA 1SVWA 2W6JA 4R7ZA 5DYGA 3QENA 1W5SA 2WZQA 1TF5A 3GLFE 3FKQA 2BBSA 4NYJR 1FP7A 4YMTA 5LBIA 1XEWY 3MLEA 2EFHB 3TSOA 3UXMA 3B9PA 3CWZA 2G77B 3VR3A 1R5BA 5FPHA 5KTYA 2IXEA 2YC4C 4ILEA 2O0JA 4S35A 3KX2A 1RJ9A 4HZIA 3ICQB 3TR0A 2F9MA 5C46F 5GJBA 1G3QA 3QE0A 3CNOA 4URYR 2O8EA 3M6AA 5HKKD 1XBTA 4D0NA 4KO8A 2J0SA 3LD9A 5JI3E 1VYVA 2IA5A 2OCBA 2WSMA 4Y0VA 3QNUA 2OSBA 2NO7A 1XXHB 3ZD7A 2ZJYA 2V54A 2QA5A 2A30A 4OJQA 3FHTA 4DT1A 3AP3A 4LV8B 1J8YF 3L0IB 3NDPA 2CHQA 4JS0A 2PCLA 2OBNA 3LAWA 4C0HA 5GJVC 4DWJA 3NDBB 1JEDA 1KI2A 3SFZA 3GJ3A 1ZUNB 4XJXA 4TMKA 4XVQA 1P7CA 5JS8A 1MABB 3LQQA 1FPMA 4OQXA 2ZUBA 1G8GA 4P32A 2JJ1A 2BJVA 2CLSA 5AR1A 1M74A 2R2AA 2ZRMA 1TNDA 2HT6A 4D4MA 2IYVA 4KXFB 4AG6A 4A1FA 4GP6A 4KODA 5C1BA 1P73A 1N5JA 4IDQA 2C96A 3IO3A 2ORWA 5C4MA 4NE2A 2VL7A 1JPJA 1ZNXA 2CVFA 4JLNA 1DO0A 4W5WA 2H18A 1IN6A 1ZIOA 4TLDA 5G3YA 4HUTA 4YXWD 1CJMA 1Z0JA 2RGCA 4RFVA 2IC5A 4H9GA 4Q00A 3VU9B 1KO5A 4YXWA 5IK2D 1E79D 2HF9A 4Q7LA 1ODFA 2F1IA 3W8RA 5L3RA 4LOAA 2P0EA 4IVRA 2QMHA 4C0KA 3Q3JB 4JJKA 1L4UA 3IHWA 1KY2A 5TDHA 3L0SA 4HDCA 4NBSA 1EXMA 1G8HA 2V1XA 1US8A 2ZANA 2O8DA 4EUNA 5B30A 1VMAA 3AB3A 3U5ZB 4A6PA 3ZJYA 3NBXX 2WV9A 4I1SA 4GBMA 3QKUA 2IXGA 1UBGA 3HJNA 3HR8A 2ERXA 4MRNA 5FTKA 4YMUA 1V43A 1NMYA 3QXXA 2A5DA 1II8B 4GPTA 1RC8A 4Q1DA 4BZPA 2GF0A 2ZI5A 4XWKA 2NO1A 4ZI2A 2LWIA 2DHRA 2J3EA 2VSXA 5EP1A 3I8SA 3VX4A 1Z0FA 1OHHA 5EE3A 1HH4A 3GJ4A 3GPLA 2ZYTX 1XPOA 1E9AA 3D8BA 4UXJA 4BQSA 5JJIA 3VKHA 3H4MA 4MKGA 4B76A 1E3MA 1AA9A 1OYYA 2ZR7A 3MRSA 3WYFA 1VHTA 1T91A 2VYFA 1Q12A 4IEEA 4PXAA 1UFQA 3U4QB 4QHYA 4ARZB 2OEPA 4Q1CA 3PIRA 1E2IA 3LBHA 5J5CA 5J4VA 2NPIA 4PQFA 2GEUA 3WP1B 1E2NA 1P6XA 2ZE5A 4GP7A 2Q3FA 3UMSA 1COWA 4BGDA 3BB4A 2O8FA 1KI6B 5JHGB 1G4AE 5L3VA 3RYTC 1XEWX 4R9UC 2AFHE 5EUMA 4LHVA 2ZS8A 2CK3A 3B13B 2XITA 3BIFA 4TYWA 3G0HA 4KITB 4AYWA 1P2TA 1TU3A 2G88A 2WWGA 3CW2A 3TR5A 3OEHA 1T4GA 4MDEA 1XD2B 2ORIA 3FMIA 3MAAC 2W00A 1J2JA 1XCPA 1NVXQ 4DIEA 5BXQC 2OCPA 4TLCA 1FQJA 5FBWB 2FWRA
chains in the Genus database with same CATH superfamily
5CT6A 4G4IA 4POAA 3N0TA 1W48A 1WEHA 4QM7A 1TEXA 3W5JA 3R8FA 3H4TA 1AU9A 1EU1A 3Q9LA 2ZZMA 2NVUA 1PP4A 3F71A 3IR7A 1KAEA 3G7UA 1ZUHA 4HOYA 3HM9A 3AFIA 2QUZA 3L4BC 5AM5A 4B6GA 1SZDA 1D4FA 1SO8A 2C0CA 1P1HA 3SXJA 4DMRA 4XLLA 3DUFA 5BMVF 3EVGA 3K6KA 1II0A 1X7XB 1CJVC 4JKIA 4R84A 4DJTA 4CTNA 4HQ0A 1GGKA 1N7GA 2ZTUA 4GOOD 1WLSA 2Q6LA 4TT8A 2RKBA 3ZWCA 3QU2A 3WGZA 2V97A 2XI4A 4PV7A 3QYFA 3ZY2A 1LNQA 3R3ZA 4WQMA 1ORIA 4DIKA 1N6HA 4KGDA 4W8GA 1QQBA 1TTTA 1Q83A 4N8EA 1J0DA 3U7GA 1LXCA 1WW2A 3CJRA 3P2YA 4U7PB 2O52A 3R77A 3C41J 4MVYA 4NATA 5EL0A 4KPFC 5F2NA 1X7DA 1E1QA 1N32B 3QXHA 4Y2RA 4C5AA 4MV9A 1C0KA 3UWOA 1A50B 4JI7B 1G6KA 1A77A 3NFRA 1UC5B 3USZA 1NBWB 3NPMA 2PX8A 4EG4A 4DV2B 2QPTA 2IYLD 2X3YA 3DEIA 1X3LA 3QYPA 4RF2A 1VMDA 1E1DA 3WGKA 1FF9A 3RU2A 1CR4A 3N87A 5B1YA 1WW3A 4DHWA 5AM4A 1U5BA 2BEJA 3A9TA 3FM9A 4YT5A 3RAPR 1G5HA 4P2GA 1XRRA 4HYQA 5DDIP 5F1OA 4A8JA 2DJIA 3OWXA 1Y1PA 2JVIA 1PBNA 3GL9A 4AJNA 3OQIA 5B64A 3HJBA 1FFHA 1YB7A 3WOVA 4K9MA 4BO1A 5KI6A 3FKSD 5BSWA 1AUPA 1UBHS 3EFOB 4M2LA 2CW5A 4KN6A 4QBGB 2G70A 1JR3D 3F47A 4TT3D 4F3CA 2O8FB 3RR2A 4ZC8A 4Y9TA 4FXPA 3Q3VA 2G80A 1I24A 1AB5A 1KYYA 3PFWO 3RLFA 4C4PA 3WX0A 3E7WA 4E2WA 4LY0A 3WKDA 1RLIA 2I2CA 2UV8A 4BNMA 2X8JA 4RDXA 1Z16A 3FSGD 5TGDA 5JBQA 2R60A 1XTRA 3PC3A 5AKJA 4CUJA 1TIPA 2WD8A 3OIWA 3HZOA 4G1MB 1YU9A 5KNCD 4UW9A 1T3GA 1U81A 2ZJAA 2IY8A 3K4HA 2D00A 3NQ41 4O0MA 4RACA 4RD6A 4OQEA 2IV3A 3FTEA 5JJKA 1EUZA 4RM2A 1H3FA 4EYSA 4DR5B 4XYBA 1X9GA 1Z33A 2YWGA 5SY6A 4A16A 4BZQA 5F2KA 1M2KA 3A9CA 2ZFUA 5DNVA 1YQGA 5F9HA 4ZJYA 5M34A 5TPWB 3EG5A 2VSFA 1E3IA 1SH7A 1F4LA 1U02A 2WVJA 3ETJA 3R7AA 4E1BA 6REQA 1W19A 3G8BA 1ZNQO 3G5TA 4BMCA 3FTCA 3OP1A 1I3CA 2YUTA 1BG6A 3R7WB 1PUJA 3ZHZA 1KRXA 1C9YA 1E8DA 4DMLA 3KS9A 3HPQA 3I4LA 1HK7A 2FJ0A 2Q5QA 1Z7WA 2ATXA 3G2PA 3NHKA 2AZDA 2AW5A 5IBPA 4IZOA 4K2AA 2BGRA 5GWXA 1KKLA 5FA8A 2ETXA 3T0FA 1NSFA 1O89A 2HREA 3PI6A 2OENG 2WTBA 4RJIA 2HRQA 4B6PA 3UHFA 4MP8A 4PCUA 4B7CA 1GLVA 4MUNA 1K5PA 3B70A 4MPJA 1AV7A 1MMFB 5DN6D 1V48A 2DUNA 3VH4A 2CFCA 2WG0A 1A1VA 3HJAA 5DNWA 1NXVA 3EULA 3LH5A 4R8RA 4XR9A 1R8QA 2OCIA 4Y18A 3FGNA 2QD3A 3WRWA 2OHXA 2ANCA 2ZT8A 2WF6A 3FPFA 5AWFC 4YR7A 2WPDD 2CFIA 4DBLC 3SE0A 4D3XA 3AW8A 3F8WA 3LJKA 2VBCA 5AVJA 4BP8A 1YZVA 2BSQA 3OLCX 1HFEL 3GMDA 2XMPA 5H7XA 5K0TA 1SUBA 2QG4A 4FHEA 1NONA 5IJZA 3L8FA 4H2DA 3W6PA 1NVBA 1GGEA 1X15A 3CR7A 1ZW6A 3KAPA 4CTMA 4W5OA 1BDMA 2AJBA 4AUMA 4QBIA 1R7RA 4X92A 1XMOB 3M5WA 5JMPA 4QGSA 2BMJA 2A9OA 3FJYA 3A4MA 2OP1A 4S0ZA 5E8RA 5EP3A 3TQSA 5EMLA 3OZEA 3PHIA 1YDEA 1IWOA 1FP6A 1G2OA 4O2BF 2W71A 2PGAA 4HUJA 3RJMA 1C2TA 2A5JA 1WCIA 2CJFA 2ECKA 1GNVA 2O2EA 3CUYA 2YL2A 1Y1QA 1Z56C 3OU7A 4PNPA 1AC5A 3HG7A 4C4ZA 4JXXA 1DARA 3GX1A 1EZ4A 3QTTA 4B2LA 1DELA 4CL2A 4GPEA 4P35A 2CDBA 1E2PA 4FOLA 5C4IA 3F6RA 4C14A 4BX9A 1KEVA 3I2HA 2GCOA 4W1SA 3WJAA 3B12A 2A67A 2J4FA 3HUUA 4HMQA 1XRPA 2GB4A 1PF7E 1F12A 1M73E 2XOXA 2HJ9A 3JZFA 3KV3O 4GMHA 5DSTA 4YIKA 4NZNA 1SXJB 4RZQA 4CV0A 2NPOA 3F5DA 3T9BA 4ENVA 1OE0A 4PRLA 1EUYA 5JOQA 2ZSFA 1EFRA 3C8MA 1UBEA 2ZYVX 3AJ9A 4UVDA 3W4KA 3WTCA 4R9VA 1H2BA 3LBNA 4LCEA 1UC9A 2ZRDA 2RKWA 1L4EA 5LYYA 3D5TA 3FPJA 2BM9A 1PWHA 1NBHA 1TE2A 2MT9A 3UZUA 1PFYA 3K16A 4UUQA 1JQLB 2BYTA 2WYIA 3AZQA 3C14C 3VNUA 3IOCA 3KG2A 1LRKA 2O0HA 3OP4A 4QPCA 1Z38A 2FFBA 1ECLA 4DLAA 3O2JA 4K9QA 4CQMA 2V9ZA 5EMMA 2CXOA 4B3IA 3I1IA 3OD5A 1YOBA 2HJRA 3OM1A 2NTNA 3SG0A 2IIQA 2BONA 5DYTA 2H7CA 1L5FA 1IM2A 5I7FA 2XTMA 4RIEA 3UCXA 3GQBB 4GD3Q 5H80A 4UKDA 2OFWA 4GW3A 3ONEA 4N3GA 2KPOA 3AUAA 1OZGA 5L4SA 5LP1A 3B1FA 2W5UA 4PLFA 4OL9A 1EWTA 1VB3A 4Y6RA 3K9GA 3VHLB 4ND6A 1ENOA 4LYEA 1VOTA 3KL4A 4MVXA 3CEHA 4KVAA 5KNDD 1E0JA 3EQ6A 2HCTA 4KUGA 4YHHB 5ELXA 1MO6A 2A59A 2PZFA 1Y5RA 1N6KA 5CW1A 4AW9A 1XXHE 4O0LA 1O0BA 3GFGA 2WR8A 1X74A 3PQ8A 1I0ZA 3KPWA 4GOMD 1A8IA 3IP8A 3UY4A 3I9NA 4QPZA 3NGXA 3IQEA 5FA5A 4XVCA 1WM1A 3JSXA 1EGVB 1GNLA 1CX9B 3N9IA 1BEZA 1KY4A 3PGKA 5IBQA 5TE9A 2GLXA 2HEGA 5F3WB 3ZBTA 2QUIA 5BUSA 1UMCB 1G7RA 2QRLA 3UAOA 2PFKA 4HDSB 3IPXA 3TOCA 2IY7A 2KLHA 4GKAA 4AL4A 1RR6A 4Q3LA 2QRMA 2GBFA 1DX4A 3UWSA 4ZQGA 3EHDA 1E9RA 1XCGB 2VOEA 3G85A 2ZI3A 3MT8A 3DWEX 4JC5A 3BXOA 4UJ3A 2WJGA 1W4RA 3A6DA 1PK7A 3DE7X 1FMTA 3FH0A 4B6FA 4CMKA 2FR8A 4QKQA 4G56A 3BRQA 1NI5A 1EDEA 4PHHA 4BP9A 3EZ7A 4FTWA 5AVWA 4DA4A 1M33A 1RXCA 2VJDA 5HBGA 3SHWA 4K40A 1YT5A 1ZUWA 3L0BA 1S3GA 3Q6MA 3SSOA 4JC0A 5AHXA 4NJOA 1KH3A 1RAEA 4K9DA 4ZI7B 3ESBA 1NP7A 2UZ1B 3DVSX 2V6IA 4WE3A 1UL1X 3KXLA 1UBOS 4RNCA 2VC2B 5CGZA 5A3VA 4J8PA 5JRZA 3TNYA 1A82A 1BXKA 4AMGA 1VJDA 4BO9A 1U3WA 3FPAA 5DCUA 2PFSA 3FTPA 1KMQA 5TS2A 4RVOA 1TRHA 4RETA 1NJ6A 3EVBA 2GYYA 2QM8A 1MJNA 1E1NA 3L46A 2WUDA 3MF4A 2F1RA 1IHDA 2BRUA 2WC1A 1DMSA 2WIDA 1F8YA 2W4MA 3EXIA 1WA5A 1QFJA 3K0BA 1SK8A 2O6LA 4GNKA 5LBUA 2D13A 3WIBA 3ZY6A 3W5DA 1E96A 5IVPA 1AKUA 4ZREA 3CF6R 1SG9A 3QYJA 1XHLA 4UBIA 2G07A 1U0JA 2QTBA 3M5DA 1ESEA 4MRPA 2D8MA 2VH1A 5EPEA 4B2YA 3ZDCA 1M34E 1TFRA 4DF3A 4G09A 3SQXA 3A05A 2XOKA 3IQXA 4YCAA 1Z4PX 3DTVA 5F1PA 1Q19A 2XA1A 2WLTA 1M83A 3A4VA 3E7PA 1DCTA 4JKYA 3ZGLA 3K0SA 1M66A 2OD9A 3V1TC 1IK4A 4UBLA 2MSDB 3S2UA 2EZ9A 1JB9A 3E2PA 5FORA 1CB0A 4P82A 2QLJA 4G5OA 5JCOC 2G7ZA 4E08A 4PYOA 1J5PA 1ODTC 5C3UA 2ODEA 2R4QA 4J29A 3PNVA 5EIHA 5TGZA 3GEEA 2XEDA 3AR6A 3HYLA 3KQNA 4U7TB 1VDZA 2W70A 3UJBA 4AWAA 4BRSA 4R8SA 1RXIA 3PB3A 1X1CA 1L7OA 1U9ZA 1RAHA 1ZUD1 2RARA 3PCTA 4NJMB 3GP3A 4AJKA 4JC4A 2B7LA 2BR4A 2W6JD 2QJOA 3EE6A 3SQDA 1ZFNA 1JU3A 4Q39A 4NEHB 1LH0A 2J3JA 3KR9A 1WV0A 3CH7A 3QXGA 1U8EA 1NXPA 2XXAB 5BSUA 4MP6A 3L04A 3N70A 2IS2A 2HA7A 3VJKA 3ZWXA 3A3KA 4MPRA 3T94A 2ADOA 1PJSA 3GMTA 3U80A 3H83A 3WDLA 2WRZA 3WWDA 1AS0A 3H5IA 3HCWA 1G3UA 4D96A 4ER7A 3IVRA 1G59A 1VE1A 3K9HA 2J5QA 1GYQA 4I8DA 4JVLA 4XPIA 1T6YA 1Y82A 2GAIA 4EDHA 1BQ4A 2GK7A 3LZDA 4IIVA 4CG2A 5ITSA 3TEMA 3GRPA 2WI8A 2PPVA 1K6MA 4X61A 3ZLJA 1L7BA 4KAFA 3K8OE 4U2EA 4CLRA 4D81A 1YVRA 1LA2A 4OAPA 3WSWA 3EZGA 4M87A 3OKFA 3IUBA 4R3UC 1PD1A 2BMWA 5BYAA 2FZ5A 2GUGA 1QIDA 5LA6F 4ZPXA 1DTSA 1I51A 1PK9A 1XXHA 2QTHA 2ZRIA 3OWOA 3P4UA 4FONA 3ZW7A 4H18A 4BASA 1JEYB 1NX6A 3RRFA 1DC5A 2PKXA 2LTAA 5I9SA 3OCVA 1KI4A 2R8RA 5ALOA 4LSZA 3E58A 1JFLA 2CHVA 4AC9A 3IXMA 4RHUA 2XAAA 3H8SA 1ZXXA 2MSKA 2X2EA 5BR8B 3B53X 4Z4CA 2ZIZA 1QRSA 5SZHB 4NI5A 3KKQA 4IGIA 2VHVA 3OURA 4LJ4A 2HPAA 3WRXA 3AONB 1FTQA 3ZIAD 4M7RA 1PR4A 3DC2A 5SYMA 4GC9A 2GEKA 5HE8A 3T5CA 3TBFA 3ZCTA 5P8WA 4DS3A 1LF0A 4DA6A 3MWYW 2GJKA 3F49S 3AYXB 4Z7OB 3VOBA 4RK6A 4WNCA 1Z2CA 1BCRA 4Q4AB 1B8PA 1WABA 3VFDA 3G5MA 4I8XA 1NDHA 1T36A 3E9MA 3LHFA 1SUDA 1SELA 2HAEA 2J87A 4KR6A 3TQCA 2I2FA 2XD4A 1GZ7A 3I5XA 5TPZD 1QVWA 2YN2A 2BI8A 3DBHB 4BJHB 4ZYYA 4UASA 4Y2QA 2WTMA 3KLNA 1XJWA 2SNIE 1AO0A 2P5YA 2ZW9A 4GBED 1UKVY 4OIFA 3VNBA 2BDTA 4NZYA 1ZK1A 4FFPA 1KAOA 4OBBA 4MVJI 5AVRA 1ZZGA 1HL7A 3O0DA 1DG3A 2TS1A 3AHIA 2JHFA 3R3SA 1YRHA 3CG0A 4HDKA 4O2LA 1PN3A 1WMSA 2IX9A 1GUAA 3BD6A 3CF4A 2PH3A 4PLYA 5G0SA 4ALJA 2O19A 1BWRA 2WFZA 1RWWA 5BMVB 4RQTA 2NSYA 3LHDA 4BUCA 2XUQA 3SJAA 4HF7A 4R8MA 4HJRA 1OW3B 1JJAA 4PC1A 5DGTA 5BORA 3RFTA 1OH5A 1Y1TA 3N74A 2QI9C 2IEDA 1NQAO 2E82A 3FOZA 4AJHA 5DM1A 1F20A 1UP7A 2VWHA 2XYRA 1QX4A 1KP3A 2JH3A 3B6JA 4JOCA 4S2UA 5U4QA 3DBIA 1FFYA 3RKUA 4BGVA 3NBMA 4NDNE 4B43A 1F0NA 3MUFA 3C7KA 3AILA 3DNFA 3CV3A 3DZCA 3O94A 1GR0A 3RUAA 1JSXA 2IHVA 2Z5FA 3K92A 1I4OA 3ER8A 3H5WA 3LC0A 4P31A 2CLEB 1OA1A 2H11A 2VHCA 1QU2A 3VM6A 2BEUA 1GRRA 1NE7A 1T3LA 3KSMA 4WN9A 5E4YA 4LSGA 3SEZA 4G0WA 1U0TA 1DMRA 1J8VA 2VJAA 3FUXA 2CXUA 4UHDA 4LXXA 2PMKA 4WCFC 4DIBA 3U56A 3I92A 2HNAA 2CNWA 3PR3A 3UK0A 1EFPA 1BGWA 1PR6A 2WKWA 2FPSA 1PX2A 2MWMA 4XPIB 1QVRA 2JI9A 1T24A 3HTXA 3JALB 4AO6A 1DBWA 1PT5A 5EHNA 3OJ0A 5G4KA 5J2UA 1FDVA 3TXXA 3VISA 3VH2A 4XGIA 1BHQ1 4QJ5A 2QUKA 1MDBA 4XDZA 3BCHA 3PWTA 4MV5A 1HDXA 1Q84A 1GYRA 1WXQA 4QLBA 3CR8A 1UFRA 5IF9A 3FWZA 1G38A 2WB4A 5DO9A 1K8XB 1W0CA 3PWSA 3KAQA 1REQA 4QUEA 5EOVA 1Q6YA 3CRVA 1Z82A 2YASA 1OQAA 1O0SA 1JSLA 3DR3A 3KQVA 4N3CA 5ALEA 3KKOA 4OGLA 1QG6A 4PBSA 2ZEJA 5TMEA 1UC4B 2DBYA 4H59A 2AQIA 2H0AA 3GYGA 1XDGA 3GT0A 3MHPA 5EN4A 4F9TA 4FGJA 4JJGA 1LVHA 5F64A 1G19A 3TI7A 4Y7DA 4ZIRB 3PLRA 3SIPA 4F4HA 1JHMA 5A4MS 4HXEB 2GFHA 3PUXA 2PIDA 4QODA 1G7TA 4V0LA 4QSHA 3HY4A 3TLBA 1U2EA 4A2PA 1AKYA 1KHTA 3PBKA 4B4VA 4R2KA 1X9HA 4PANA 2C4MA 1ZR4A 4JJ8A 3DTYA 1MKYA 3PXEA 4W9RA 2M6KA 1L7QA 2XMZA 1PNTA 1XEXB 2HJSA 5IAKA 3RAEC 1V41E 3EAQA 2PUVA 1UDXA 4JLKA 4PLZA 3B2QA 4UM7A 4CMEA 1U9JA 3WNDA 1Y6RA 2VHUA 3K0FA 5D5PA 4O3MA 4N5LA 2RGEA 3IILA 4XJSA 3GBPA 5IJAA 4CMHA 3DONA 1WW8A 2P5UA 5ALSA 4CMBA 1SD1A 3K0KA 1A9ZA 1Y7LA 2ZYRA 4JLOA 2ZITA 3E3AA 3SR3A 1POWA 2Z0MA 4PQGA 1J0EA 1RVV1 1QQ6A 4BNYA 1J2RA 3U39A 3UK7A 3CNQS 5H59A 3A9WA 4NZZA 3V9PA 5L6MB 2G4LA 3AUFA 1EVZA 3LLVA 2GK3A 3ILVA 2ZJOA 3HDQA 3PNPA 4O4LF 3WKEA 1YF3A 1VIYA 3QVMA 2YX1A 2ZI4A 1E79A 2NT4A 4U2BA 1L8AA 1V1RB 1HYQA 4HBGA 5I7OA 2Q1UA 1CUFA 3OICA 4AWBA 3K1ZA 1H8HA 4R69A 4BQNA 2VTDA 3IIIA 3DJYA 4A1OA 1OAKA 2FDXA 4NBKA 1DQSA 1F14A 3N6VA 3LBIA 3GPIA 3OLVA 2VHEA 2Z6AA 4JQSA 3VU9A 4PIVA 1DLJA 4E4RA 4KUHA 4F6LA 1GL6A 4DE5A 4BTVA 3AHFA 2I2BA 4BNTA 4GMGA 1XHEA 4OOEA 1DX9A 3CIOA 2YC2C 2IPLA 1KH1A 1PJ8A 1BSVA 2BKAA 4HGRA 2B4TO 1OTHA 2A7XA 5E4JA 4AU1A 2I4OA 2CB0A 1ATZA 3FDXA 1JPUA 5CB4F 2Z6QA 4Q4AA 4X3PA 3OFVA 1DSSG 2D2FA 4ZANA 3CKLA 4PE5B 4TTTS 3ZJVA 5E9AA 4AY2A 2C5FA 3D3WB 1U9IA 2H59A 4GZMA 3Q87B 1NV9A 1T0UA 2PS9A 3MM4A 1A2KC 1C30B 4LISA 1L5GB 4F9GA 5EJGA 3WYGA 4QOEA 4ACBA 1DBRA 3V8VA 1TJYA 3QQ5A 4KYVA 2LD4A 1G4HA 3EQ2A 3A1CA 5ESDA 2Q2WA 4ZO9A 1P9LA 3U7EB 4MX8A 4EPRA 1IDOA 2C2KA 1OC2A 3CB2A 2V9CA 3BWEA 1Q1ZA 4V02A 2SCUB 1WHSA 3VR4D 2GO1A 1M7BA 4B71A 1JLLA 1FRNA 1IOVA 2GZMA 4CDMA 4QDOA 2CHUA 4E5KA 1WSAA 1BGVA 1GLGA 2H4JA 3HKBB 3RKSA 3HWX1 4C4SA 1LK5A 5IJWA 2HCRA 2GZ3A 4B31A 3RGWS 4AECA 2GM9A 2RGDA 1XAHA 5LN1A 1X9IA 2JFGA 2O2GA 2NQ2C 5KVVA 4IS2A 2CWWA 2PSHA 2ZKLA 4F56A 4ZAVA 5FOWA 1M9NA 1H22A 2IEZA 2CE7A 2OGZA 3IALA 5AHOA 3HSSA 5AKIA 3L7OA 1P7WA 4YO8A 3GQBA 2PBLA 3K0CA 3OQPA 4YXFA 4DR3B 4ASUA 5IYZA 4GI5A 4II2A 1FVXA 3MZ0A 1SMKA 2CCKA 3ZVMA 3T1VA 1FX0A 1XT6A 1UPCA 1T4CA 1UXJA 4C30A 5HSGA 2QF7A 3OJCA 2ROQA 1GWNA 2BFOA 2JLRA 1DL5A 2VHXA 1IRXA 3O4GA 4ZI7F 5AI6A 3PFGA 1XQWA 2XHZA 1BRTA 4KR0A 1TJ5A 5FR1A 3S2IA 3UT0A 4TRMA 3CZMA 3UHPA 3QE9Y 3QMPA 1XJCA 3TLCA 5JJCA 5JVDB 5FTNA 1WDLA 2LP4Y 3HYTA 7ABPA 5JNVA 2DF8A 2NTYC 1VLLA 4B82A 2BP7B 3K09C 4XH9B 2CUKA 3NTLA 2FEOA 1K7SN 5CTJA 3TTXA 1CV2A 4CJXA 1RYHA 1XNRB 4F85A 3KXDA 1WB4A 5IVIA 5JISA 3LYHA 4UNNA 5AUOB 3VZCA 1SCBA 1NW4A 2GCOB 1KJJA 3WMWA 1QYXA 1VFNA 2WTNA 4WV3A 1SUEA 2ZTHA 3EVDA 4IFBA 3EGIA 3QKSB 4YRBA 4EJFA 2C3UA 2X15A 1HO3A 1Q1AA 2CNNA 2YY5A 4JQYA 4MHOA 2JFQA 1YA4A 3LLSA 2YJGA 3S0JA 1UPUA 1E5VA 1J33A 3GUVA 4MW9A 2XBMA 3TVTA 1I6LA 2A84A 1JPNA 1NOIA 1VMEA 2YR0A 4DSTA 2C2WA 3ZZ0A 4DR4B 2PRJA 4GQBA 3WTBA 4C3OB 3LRPA 4AMZA 1ZJJA 1ZGCA 5AD1A 1EZZA 3RCBA 3ZE2B 3G2IA 4EF4A 4Q3AA 3ABQB 4EHIA 5EXPA 4JQCA 1GD1O 3I83A 3FKJA 1UDAA 1YWGO 3B5IA 4JT2A 2QSUA 4J1SA 4WN9B 1JQEA 1CNMA 1YS4A 2DB3A 4W5RA 2RK4A 2HC9A 3WDSA 2AK3A 3RBVA 3MXOA 2AA3A 1ORHA 3IHLA 1CY1A 3C6MA 4I55F 1PDVA 4DT1A 4XYLA 1KYQA 5K0NA 5C7OO 5FTWA 5L51A 3SEFA 4UFPA 1BKSB 2OV2A 2ERCA 1OI2A 1P6UA 2HU5A 2BTQA 2R6CA 3DTNA 5KJCA 4K9NA 3BSWA 4A92A 1G16A 1KEWA 2Z3VA 3G9QA 1XVLA 3OCZA 3A25A 3TZQA 3CZQA 4Q9KA 2WPNA 4NEGA 2PUBA 3T5MA 2ZBDA 3T5AA 3ZK8A 4RV4A 4E2XA 3COPA 4O6VA 2AD5A 4IYRA 1MIOB 3RSSA 1GKIA 4DG5A 5AVVA 2PS0A 1P7PA 2Q2OA 4LFCB 3O0TA 3HYNA 1SXHA 2HU7A 3R6TA 1BKYA 3M6WA 1CVLA 4KOEC 1F7VA 2AJLI 2Q4DA 2R7KA 3H9JA 3QG1A 4LC1A 3SVZA 1WDMA 4YI5A 4OXKA 1O6ZA 1N3BA 1JKMA 3DBLA 3GLHA 4A0QA 5JC8A 1HLGA 2IX3A 1USGA 4E07A 1BS1A 4MVJH 3I1JA 3PJDA 2UAGA 4PGFA 2GVZC 2C2HA 2C94A 3B8HA 3STHA 2DHQA 1PVDA 3PQCA 4XGQA 3T1TA 5BSHA 4B3SB 3JZDA 4LRUA 1QLHA 2FLWA 4EF6A 1TADA 4MARA 4Z7JA 1TAUA 1YVEI 1OBCA 4LQLA 4QG7A 2ZU6A 1KEEA 2PX0A 3ANNA 4EHAA 1TUGA 1AZLA 4B7XA 3W7BA 2QD2A 4CM4B 1K6EA 2ZGVA 4RSRA 1S96A 1TU4A 1UMCA 2EP5A 4OHMA 4MA0A 4MULA 3ZHSA 3QPUA 4EMUA 2YYYA 4QUJA 3VZSA 4V0MA 4RF4A 5CD1A 4F60A 1TD9A 1ZMXA 2LV8A 2P2SA 1P1IA 4YDRA 1SUCA 2WWIA 1ZWKA 1EK6A 1ZMRA 2K7FA 5AOBA 1CUZA 1Y8RA 3PHCA 1JAYA 2PRZA 2VH5R 4I0WB 5FQOA 4EAQA 4Y2UA 4A15A 5KX5A 5LXTA 1JFSA 3AHGA 5K3BA 5LR6A 3UJAA 1ZH2A 1TVEA 5DOZA 4J0KA 4MQ6A 4O5OA 2FEAA 4WKPA 4FHZA 4MYTA 4BKMA 1P5FA 3TKYA 2IT1A 5EJAA 2VEOA 5ALNA 5LB2A 2BM0A 3D8NA 4LFAB 1E8NA 3SR4A 4OHUA 2GR9A 3REOA 3FE2A 1N33B 1FP4A 4UQPA 3JPYA 1PQWA 4ZU3A 5CM8B 1VSBA 1BMFA 2CYBA 1HDOA 1MX9A 3ANXA 3FNBA 1ZM9A 3GLRA 3DL2A 3OPXA 3VNSA 3U7FB 4ZYLA 2MSWA 4A8JB 3AL0C 3G8AA 3DXZA 3IUYA 4BLTA 2DC1A 5TT1A 2QNIA 1RYNA 2JBHA 2MHCA 4NCKA 1QK3A 4GR9A 4AJIA 3IP7A 3NT2A 1RLTA 3MELA 1WXWA 3QTLA 4Z4HA 4KO4S 2PTHA 3TCKA 2W83A 1QGDA 3BTUA 3RNOA 5IFLA 4IRXA 2DLCX 2C82A 3WLJA 5H5JA 1IXSB 3O75A 1CJKC 4YP5A 4G25A 3GBSA 3DOFA 1YSCA 4CW7A 1XL0A 3OA0A 2GT1A 4GSLA 1DXQA 1N2SA 1RWBA 1KO8A 1XF9A 1P3JA 4M7WA 1IXRC 3S44A 2Y99A 1A9XA 2WSLA 4YJDA 5CYPA 1F48A 2JFVA 4BNLA 4OLFA 5K7SA 3U3RA 1SKAA 2IVFA 1P5ZB 2EHJA 4KO2S 5TB5A 3SS9X 2C4HA 3HEBA 3T9CA 2XCRB 1JQAA 4TOIA 5JE8A 2DRIA 3VPCA 1A95A 1DUSA 1DV2A 5I9TA 3UAVA 2YIDA 3E3MA 5JO9A 4DB4A 3KHUA 4JLDA 1TJ3A 1YFZA 2QK4A 3Q11A 4JI6B 4D44A 2EW1A 2Y77A 5EE0A 1ZCBA 1EHCA 4RX1A 4EHFA 4D5GA 5FL7D 1XN4A 2ZWOA 1TM4E 1Z07A 3E5HA 1WXGA 3E82A 4QEKA 2GM3A 4K81B 4PSKA 5JT1A 5A2GA 2QTNA 4LV6A 2G0NA 3FROA 3JQCA 4Q4JB 5JYDA 4C22A 2Z09A 3H75A 3IEXA 1LBQA 4NARA 3DKKA 4PG5A 1CR6A 2YJZA 4ZOLB 3Q7SA 4RK0A 4P6VF 4QFMA 2R7NA 1T5HX 2JLBA 1I2MA 4X7MA 4YQFA 221PA 2ZIGA 3L2OB 3MJTA 3SBOA 1Y8QB 4TTJA 1C80A 4A2CA 1PX0A 3VPSA 4QO7A 1OFHA 2Y1WA 1B1CA 2HK8A 2BAGA 2RG7A 2YOGA 2ZKIA 3EOZA 3JAWB 1W25A 5EEGA 4BMYA 1DEXA 4MR9B 4DBVO 1W4AA 1XXLA 1OXUA 3WL7A 5LJIA 1X7WA 2A78A 2WWVD 4B5KA 2VWGA 5A05A 4UM5A 3BWVA 2Q99A 3KQUA 3M4YA 4YCNA 3FCEA 2HK6A 5HTOA 1G0NA 2J9XB 3PHHA 2RH8A 4ONEA 5FP0A 3CXUA 1S02A 2V5AA 3DMPA 5SV2A 2NNWB 4KRYA 2HYDA 3SZ3A 3NM4A 2O5CA 3W2GA 4CG1A 4EK9A 2A1TR 1Z39A 4J94A 4KPEC 4Q01A 1R9MA 1W73A 1W5EA 3GCZA 3OHPA 4LHWA 3NBZC 1ZOIA 2BUAA 1EINA 2Y1LA 4L9WA 5BT8A 1CQJB 2WV7A 3GDWA 3HRIA 2QY9A 4MPTA 3HXPA 5HJ2A 1GNTA 1LDYA 2BTEA 3B85A 1JU9A 5C8XA 2L2QA 1E2QA 4M53A 5IULC 4KR2A 5AJYA 1NU8A 5HQJA 4MUJA 1GQOA 3EPJA 2C5BA 3PWKA 3ACBA 5MDHA 4RJJA 3KUCA 4GKBA 3TM5A 4RE6A 4MIOA 2JGDA 4D9HA 3TOVA 3TR6A 2GPWA 2QZPA 1YDWA 2RJ3A 3W3AD 5JD4A 2IS1A 3EW9A 4NCXA 4TSRA 3CVUA 3ZN2A 1GV1A 1I6KA 1RQGA 1T13A 1DI0A 4UHBA 5IZ4A 1WBBA 4MV6A 2OTCA 4RPKA 3TK1A 3JD0A 1CY8A 2GILA 5ELMA 2PD4A 1Q3TA 2O1XA 4L0CA 4EVIA 1MBZA 1T15A 1HR0B 3F78A 1IBMB 2XWPA 2ACKA 2ZIFA 1L1RA 3M1AA 2Z8YA 3Q15C 3EBPA 4YGYA 3Q7TA 3NOOA 2GRAA 3H99A 3ADDA 2I3BA 1U28A 5DN9A 1QB7A 1YQWA 3VKUA 1SBIA 2CHFA 2Q7OE 2JDID 4FHDA 3U7JA 4G5QA 1RKUA 2JFHA 5SZJA 1O96A 4GEKA 4OFZA 5KAPA 1IZ0A 3TDNA 2F9LA 1SU4A 1OH6A 2X6RA 1OWOA 4XVUA 1GTMA 1NJ1A 1XTJA 2VNHA 5DHPA 5C1PA 3GA7A 5AK3A 5BOSB 1PV1A 1R18A 4GT1A 4YPFA 2Z8YM 4GRIA 3OQIB 1QAMA 3ROMA 4DMGA 2ODWA 1MVNA 1NF2A 1X13A 3MPOA 2IS4A 1CP2A 1RI3A 3BZBA 1ZVQA 3JARA 4BVKA 2O6HA 4JN6B 1U3DA 4J0DA 4ZGBA 3UJ3X 1E77A 1RXUA 2AE1A 4N0EA 4CKCB 4G8JA 16PKA 4U63A 5EJ8A 3E9DA 3FSEA 1A27A 2RGWA 2ZB8A 1K68A 3MSCA 1L4NA 3PRJA 4LBWA 4XCXA 5AVSA 4WKBA 1CQIB 5I6DA 3QX7A 2QR3A 3WIUA 4E7OA 3L43A 3EA0A 4UM8B 1QHHB 5FT9A 5KTPA 1ADJA 2ZSEA 2JANA 3A9VA 5JQGA 3K0EA 2EFEB 4MGHA 2ZYWX 5DWVA 4AJ1A 3L01A 1XMVA 3FW1A 1NBMD 1YAHA 3G5LA 4RGYA 2A2ZA 5A71A 7REQB 2V1UA 4MO9A 3N1UA 5DBOA 2PSFA 3B9QA 4GPAA 1Y3AA 3ABIA 4HLUC 3VHXA 3OT1A 5EHXA 1D2NA 1NXTA 4RYDA 1O95A 3NHJA 3UMFA 3JYPA 3OE5A 1CHDA 2QE7A 3IEVA 4YRPA 4QFBA 4PZ0A 3DC7A 5J2TF 3SWWA 1IWPB 1U1DA 5D3QA 2ZDHA 4LXYA 5LZ8A 1NR7A 3LWNA 1ZGAA 1UZAA 3FMVA 3BGWA 4KIWA 5JS6A 3IOMA 4DA0A 2WMDA 2HUPA 1EXDA 3S27A 3ZZUA 4YCCA 4NCAA 3DHVA 3QXCA 4C0LA 4Q3NA 2CHEA 4BTLA 4KQ9A 1NI3A 1MG5A 1U7OA 4QTZA 3SHOA 4LXTA 1QR6A 1W44A 3EWIA 1V5IA 2Q4BA 4RHCA 5T4BA 3HUFA 1JFFA 1SXJC 1YZYA 4FUTA 4GWLA 5AMXA 4CKEA 5LQKA 3NGMA 2EZTA 3E9NA 3G7NA 3P0FA 4PR0A 1RJGA 2P2DA 5LIPA 5CJ2A 4Q47A 2HQOA 1Z18A 3MCWA 3GH3A 2HA3A 4OIMA 2D1FA 4WJZA 2NZJA 2OG2A 1RRCA 1XZQA 3HI6A 1H6BA 1QYIA 4CU5A 2Y0EA 1A9RA 3MGAA 4M3NA 2PA3A 4UBJA 3X1DA 4DARA 3NV9A 4PC3A 2GCEA 4L3WA 3QF7A 2D1RA 4O4HB 5CJPA 5EIBC 4LG1A 3VJMA 1G20A 4X84A 4QPPA 9MHTA 1XG5A 2P78A 1EA7A 3FNIA 1L4HA 1M2JA 3BCRA 2MYTA 2AFVA 1A9QA 1V16A 4IVQA 4NMXB 5DTJA 4MLDA 2F1KA 3CNBA 4XTCS 4EMBA 5HR5A 5T57A 1QH8B 1SBHA 1QFMA 2XJ4A 2YN4A 2HDNB 1KMHA 1TUEA 3IDOA 3TCXB 2XNDD 1NWCA 4PLVA 5DE3A 1TPYA 4OH7A 3UKOA 4BKRA 5K8JB 3BRSA 3O1IC 4CIVA 1OWLA 1EIWA 3H2HA 1DV1A 2I6FA 5HOQA 1OXSC 1N8SA 3DVAB 4LCJA 5CNJA 2NYVA 1PO7A 2Y05A 3PFBA 4QSMA 4GZLA 4Z9YA 5EIXA 4XI9A 1DHRA 4A0HA 3AETB 4LZWA 4EJMA 3C6QA 4BVEA 5JEEA 1ZH6A 1ZNZA 4ZEWA 5JG7A 5JRJA 4AI6A 3ROQA 4MUFA 3ROEA 3G89A 2GN8A 2A1TS 1TA4A 2PKRA 3STUA 3SY8A 4DMFA 1FJGB 1L7AA 3SSNA 1QZZA 1H4QA 1Z88A 3EXEB 4FYIA 1F2UA 3I72A 4P53A 4R1TA 4ZGWA 1VIAA 1RHKA 3WFZA 1K7YA 2V4UA 3UG6A 1J1UA 1KZ7B 4BJ6A 1AXEA 3N2ZB 3RM3A 1GJRA 2MMCA 2I8AA 3WJ2A 2HNKA 3K31A 4RL6A 3JQBC 2VPQA 1SEVA 1MQSA 3I42A 1GZ6A 1PZHA 2X5NA 3ESCA 1RWVA 4BFVA 3KCQA 1F8FA 1T4BA 5LQRA 2ZPAA 3DLTA 4G1VA 2VAVA 3AV3A 4UCWA 4CMIA 3IYLW 5C32A 2DH5A 2EGHA 4M9SA 5KWJA 2X3UA 1Y7PA 4TKMA 2AMJA 2Y0DA 3UT5A 3GD5A 4Q37A 1QIIA 3TJRA 4DNFA 4I4TA 3LHKA 4CV2A 4WZBA 3O93A 1GARA 1W34A 2Y1FA 5JS2A 3NVDA 1W7AA 4HCJA 1FE8A 1NOJA 1Q5PA 3KD3A 2UVPA 3K9LA 5BWBA 1GKLA 4GF5A 2AG5A 4GKKB 3GB9A 1F0KA 4XFKA 4BB9A 3GD7A 1H1TA 1ZUIA 1ZM7A 2B8EA 3GUZA 4ZVPA 3EH2A 3UJHA 4B74A 4PVCA 2D06A 3LCRA 3REGA 1NGSA 5HQTA 3V8RA 1EQAA 1WXEA 5G41A 2PDAA 4I4TB 1G66A 2WVGA 4DXAA 1IUNA 2IP4A 2NSDA 2P1DA 1FYEA 4GKJB 1RIIA 1SXJE 1R0ZA 3X44A 1DCKA 2GKSA 4O2AF 1ZMOA 2AHOA 3V4ZA 1KK3A 2GAAA 1VJ1A 4BLWA 2AKEA 2DPHA 3FRHA 4AURA 2P4HX 2FKAA 4LBZA 3M1YA 5CX4A 3Q41A 1EYZA 2B4AA 4DLNA 4R2WA 5IK2A 5F78A 4GZ6A 3JWIA 4MLPA 5IC5A 4ZKEA 3NTOA 2JL1A