1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE PB92
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Serine protease
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
1SUEA 3DVQX 5JMOA 3CO0S 4H6VA 3VSBA 3GCWA 2PMWB 3QMPA 2HPZA 1SH7A 3OSZA 1KE1A 1P7WA 1R64A 2X8JA 1YJBA 3TI7A 4NE9A 3T41A 2Z2XA 1TM4E 3VTAA 1TECE 4B5LA 3LXUX 3GT3A 3EIFA 4H6WA 3DE0X 3LPDA 5I9SA 5ARBA 1S2NA 1T1EA 1IC6A 3AJ9A 2B6NA 3DVRX 1SBNE 3DE3X 5ARCA 4LVNA 1SCAA 2XTJA 3LPCA 1KE2A 1YJCA 3WQBA 1V6CA 2PKCA 1YU6A 1PEKE 4I0WB 1GNSA 3WIUA 4CFYA 2WUWE 1PFGA 3LPAA 1SVNA 1TO1E 3D43A 1Y9ZA 1IAVA 1ZVJA 3UNXA 2W2OA 1ST2A 3H42B 5ARDA 3EE6A 1BE8A 1P7VA 2IY9A 4OMCA 4WOBA 1SBIA 1HT3A 1AH2A 1SUPA 3DE6X 3I30X 2V8BA 1ST3A 3TI9A 3ZXYA 1PJ8A 5FFNA 1TK2A 2P4EA 3DE4X 2G4VA 5JXIA 1GCIA 3Q40A 1SBHA 1TM3E 1WMEA 1AV7A 2PRKA 4HVLA 1BH6A 1Y33E 3DVSX 3DYBA 3BPSA 3QFHA 3VV2A 3DW3X 2Z57A 2WV7A 4OMDA 3QTLA 1AVTA 4ZOQI 1PTKA 2PWBA 2W2QA 1SPBS 1WMFA 1CSEE 1C3LA 3WHIA 3SQOA 1SCJA 1GTJ1 1CNMA 1BFUA 1TMGE 3DDZX 1Y3BE 4DWWA 2HD4A 3DW1X 1DBIA 3TECE 1C9NA 4C3UA 1BE6A 2WWTA 2PYZA 1SN7A 1AF4A 4JP8A 3I37X 2PWAA 2SICE 1NLUA 1AQNA 3P5BA 3DE1X 1MPTA 2DUJA 1TO2E 2W2MA 1C9MA 3VHQA 2Z2YA 2ST1A 1V5IA 3F7OA 3VYVA 1Y48E 1OYOA 1THMA 4K8RB 3EDYA 1Y3CE 5AMXA 3BX1A 1UBNA 2X8JB 4RYDA 1YJAA 5AVJA 2DQKA 2IXTA 4M1ZA 2E1PA 4YN3A 3ZXXA 1SCDA 3A3OA 4NE7A 3I34X 3L1KA 3F7MA 3AFGA 1LW6E 1SUDA 1SIOA 2SECE 3PRKE 2QTWB 2TECE 1GTL1 1TM7E 1SCNE 1EA7A 4KB5A 1S02A 3GT4A 1EGQA 1KDYA 3A3PA 5K7SA 4LVOA 1Q5PA 1R6VA 1TM5E 1AK9A 1R0RE 4KPGA 3HJRA 1ZVKA 5FBZA 1TM1E 4DZTA 1C9JA 4C3VA 1SUAA 5SICE 1BFKA 1WSDA 1AU9A 3DWEX 1S01A 1GT91 2Z2ZA 1Y4DE 4Z2AA 1WVMA 2W2NA 3Q5GA 4DJ5X 4WOCA 3D9QX 1SCBA 1T1IA 1SUBA 3A3NA 4AKSA 2SNIE 1SELA 2W2PA 5FAXA 1GNVA 4GI3A 1XF1A 5JXHA 3AJ8A 3DE7X 1SBTA 1JEAA 1DUIA 4AKTA 1Y3FE 3I2YX 4HX2A 4BWGA 4J94A 4KG7A 4H6XA 2Z56A 3CNQS 2SBTA 5JXJA 2Z30A 1SIBE 3DE5X 2ZWPA 3VV3A 1KDZA 4ZARA 3GCXA 5JXGA 4FONA 2PQ2A 1SUCA 2DP4E 1GA4A 1NDUA 5B1DA 1T1GA 4CG0A 2ZRQA 1GTG1 2ID4A 1MEEA 1Y4AE 1OYVA 1A2QA 1NDQA 2XRMA 1P8JA 1GA6A 3DE2X 4OV6B 1GA1A 1Y1KE 4CFZA 5AVKA 2ID8A 4MZDA 2ZWOA 1Y34E 5B1EA 1BJRE 3WIVA 3BGOS 4NMXB 1WMDA 3F49S 1OT5A 1SIUA 1VSBA 5CW1A 1SBCA 2Z58A 1KDVA 2WUVA 3SICE 1Y3DE 3PTLA 2GKOA 5AQEA
chains in the Genus database with same CATH superfamily
4HAZA 1EWRA 3AY6A 1ESCA 2BH9A 3CW8X 4KRYA 5J5CA 4GGPA 5I9IA 3GFFA 1EM6A 3L8DA 5IYZA 2XVMA 3DVQX 3L5OA 1T9HA 3E23A 4R2WA 2BGNA 3OURA 1S3SA 2FQYA 1M34E 4JC8A 1ZPDA 3C7CB 3ETCA 2AYXA 5UKDA 3LC0A 4CMIB 4K9RA 5K0SA 4G63A 2CZCA 1JDBB 4EGAA 5AM4A 4B3TB 1MXFA 3OPYB 3UMVA 1L5VA 1OXVA 1VIVA 3C8UA 3D6MA 3H3JA 3HI6A 4JR1A 4RYLA 1NU6A 4WBSA 2X8JA 4YECA 5DXJA 1WV0A 3MB8A 4UUMA 4Q16A 2AQHA 4M0UA 3ABZA 4F91B 3WQRA 3W1VA 3N7AA 2C58A 1O0SA 2ABWA 4ZRDA 5H8WA 3RK4A 4BLRA 2P6RA 1EGHA 1Z12A 1PJ2A 2I4NA 5KVVA 4H0CA 4MUKA 2IHBA 1YXMA 4O2RA 4W5OA 2CV0A 3OF3A 3CVXA 1VE7A 2HQSA 2XADA 3GLTA 3HCAA 3EGOA 3MTDA 4L1KA 4P34A 4BVKA 2ON6A 1KTVA 3IVRA 4DJFC 2ZT7A 2XUHA 5AK5A 5JRJA 5DB4A 4RF5A 5IULC 4G07A 3ODGA 1GCOA 4J29A 3MS4A 1Z35A 3WLFA 3J81k 1JHUA 3PQ5A 5DBEX 1N2EA 1J1ZA 4MRNA 5AM1A 3I1IA 1OH7A 4DRYA 5BSTA 1UMCA 5LU9A 1EGAA 2HDWA 5AKLA 4CEHA 1WCIB 3LKBA 4JJEA 2IS1A 4GE0A 5C4GB 3CJRA 2CUZA 4C5BA 3SDBA 3USES 3EIWA 3EMDA 4YLEA 1GO2A 4JEHA 4CL2A 1K8XB 1H9AA 3FYUC 4DM4A 1E5XA 1R15A 5C80A 1FUKA 3R2JA 2JIRA 1Z8NA 1CZRA 1RCUA 5A4KA 2GO7A 2PX8A 4HWOA 1IU9A 2BMFA 4N9WA 5CYOA 4CIBA 4Q4DA 4A8HA 1CY6A 4LBYA 5DN9A 4BATA 4I0WB 2DX7A 4MIOA 1A9OA 4P4UA 1CJSA 2QVCA 3FDXA 3LZCA 3V8RA 5AESA 5ITWA 3K8ZA 3C6QA 2H16A 1K7FB 2IH4A 3E5RA 1ML3A 1ZK2A 1TO1E 3OA0A 7REQA 4Z9AA 1X87A 2AUTA 2FTKE 4NJEB 5IK2A 4C87A 5B4TA 4JU8A 4WZAB 3QJYA 4YASA 2E6KA 4AROA 1AIPA 2ZLBA 4ID9A 3K9GA 2VZ0A 4HGOA 4WE3A 1WP4A 3U7QB 3A58B 1L9KA 3CR3C 2W37A 4GOXA 2H6EA 3S55A 5FADA 5K0EA 4UHKA 4B1FA 4EBBA 3L43A 1QOQB 4JH0A 4QICA 3FHJA 1M75A 1WEKA 3BXPA 4PGHA 2B25A 2YUTA 3T3DA 4DEXA 4S1VA 3RG2A 1G0OA 2AC7A 3VR6A 3WZMA 4D9NA 4DRZA 5JAOA 3IT3A 4L75A 3VH1A 4Y2YA 1EP9A 2FW9A 4M1OA 1LJ8A 2WU0A 3T7DA 1E7QA 4FK8A 2DWOA 2DR3A 2PSFA 4G86A 4BLPA 1SUPA 3H3FA 4QQFA 4H18A 1VPVA 4IYJA 4D8WA 3GFRA 2WE8A 2HSDA 1GZHB 2HWKA 4I99A 2JK1A 4LQDA 2HRBA 1OYWA 1MH1A 1W36B 1ODJA 3A6PC 4DV0B 3L18A 1VFPA 1AY0A 2BI7A 4ACAA 3F46A 3KSMA 3LCMA 3ZHRA 3OBBA 4Q9HA 4F84A 3RBVA 2Y0CA 2CT8A 2FEAA 3ZV6A 1TK2A 3FSJX 4HB2A 4K8OA 4BFSA 3RI3A 1R8XA 3DH0A 3CH6A 3STWA 3E18A 2F9FA 3TMKA 1UZNA 4D02A 5JBQA 4LHZA 1V48A 3LPNA 4L08A 1KAQA 4BZXA 3B3QA 2QV0A 4QWMA 5IDVA 1DAOA 2GZ2A 5J4LA 2E6UX 3KQUA 1LDBA 2P0YA 3ND5A 1KSGA 3U3MA 2NO6A 1A3CA 2VQ3A 3HLTA 3VR0A 2HSZA 1ISJA 2WMYA 2RGCA 2AG1A 3QFHA 4KN6A 2YXDA 1M0TA 4R1TA 1VPEA 4BYMA 4ECAA 2D3WA 4B47A 4KWIA 2ZSHA 1WUHS 4CG0A 3KSUA 4U5XA 1IEWA 3HBMA 1RQRA 3FF1A 4FMDF 1FQKA 3IDOA 2AMVA 1VLHA 2XQFA 3F6SA 2RI6A 3K9CA 2VZLA 1CWUA 3IR5A 5EYPB 4GW3A 4PAWA 5BOVA 3K72B 4JXJA 4TL6A 2W2QA 1U65A 1AQLA 2NQ2C 3EZNA 3O38A 5K8VA 3PS9A 3DL4A 1EYZA 3Q9UA 1FXUA 1YQGA 1LDNA 3DPSA 5C5IA 4D4HA 5HKLA 1Z22A 3ONFA 1VKOA 2VT6A 4UVEA 5ALNA 4ZC8A 3ZDRA 2P68A 1CLEA 3ECAA 1Y3BE 4RSMA 2WP8J 4ZOEA 4ZPJA 3MEQA 3UAYA 1M2KA 2VTVA 5L7TA 1T0BA 3DEYX 5A4JA 2RGDA 4M9ZA 5HXAA 5LR6A 2I6TA 2Q6LA 2E4VA 4Y2UA 1NVVQ 3ICPA 4LDJA 3V4LA 4CQJA 4YLYA 4NE2A 4PG4A 1HNWB 2QLLA 3FI0A 4BMPB 3ZWWA 2RH5A 4HJRA 4HTAA 5AH0A 3RVMA 1QC5B 1TVKB 1FPQA 4IDDA 3TLZA 1AUXA 4K6CA 3B1FA 5KNLA 2Q07A 1S8OA 3C16C 2O2XA 3H17A 1Q16A 4HVAA 3ZC3A 1DCKA 3LUBA 3WYGA 4ASUD 3GMIA 4EK9A 1SKYE 1N2HA 3MXTA 1Q95A 3EHDA 5KX5F 1MEJA 4WBXC 3BXEA 1FRQA 3ELDA 3VR6H 5BWBA 3IUQA 4LNUB 3KUUA 2IVZA 4FE7A 4A8TA 2W2MA 5IT0A 2ADOA 4KSYA 2X77A 2ANCA 4M0KA 4MW1A 4BNXA 1JV2B 1M1YA 1HLPA 1RP1A 3MMSA 4AUKA 3U62A 3PEVA 2O05A 1K68A 1TPYA 4CDNA 1XQVA 3EVCA 2ST1A 4DEVA 3E1KA 5FNVA 1GUFA 2XA9A 3F1LA 4PV7A 1MNAA 1W1IA 3VTKA 4C0HA 4AJIA 3LFHA 3OOWA 1B43A 3CN9A 4TWIA 1NI4A 1WTCA 2GN8A 3UWKA 3G5LA 1OYOA 5E9QA 5SZIA 5C53B 1P73A 4MR9B 2JHGA 4LOIA 3WQHA 4MWGA 4ZKEA 5FOUA 3U6BA 5FA8A 3IEMA 2G4LA 5NLLA 2CHQA 3A2NA 1E1RA 4Q05A 2A3NA 2QLNA 2PZ8A 5ICCA 3MJRA 3JQAA 3PVSA 5D3ZA 5LXTB 4Z51A 4IILA 1ZD3A 3PEWA 3V33A 4QDOA 2GSWA 3OJEA 2XT0A 1UKCA 5DVZA 1E3JA 4BBPA 2OZPA 2BM8A 5HWSA 5J2UA 2FUG1 2GERA 2I87A 4FCTA 4N5LA 3LG2A 3N7UA 4RW0A 4F97A 1RXYA 3KQTA 4KAXA 3HDGA 4YFVA 5ESWA 4FB5A 4KOAA 3OF5A 5DBGA 1G8GA 4AJ2A 1FFXA 3ZXUB 3LT0A 5FNZA 3N3BC 2ZCJA 3P2JA 3P2YA 4RHCA 4LV8B 1KFCB 4ZQEA 4W5TA 2IKSA 1PV2A 3RUDA 3L9XA 1W19A 1K3TA 1XOIA 2WJAA 1UBJS 4DCJA 1U2EA 2R6HA 1FLVA 2VEOA 2YYYA 4M9RA 3RSSA 4LHVA 3AFGA 3CLVA 4YQYA 5DKFA 1JU4A 1UF9A 1UJ6A 4AUNA 2Y4NA 1PK9A 3GHYA 3SZMA 1GUAA 2BBTA 2TECE 1EE1A 1QANA 1YB4A 2NT3A 2VDKB 4RELA 5D51S 4F3YA 2RJ3A 2BGIA 3QE9Y 1ICIA 1ZRMA 5CYFA 1E69A 2UKDA 5CB4B 4W4TA 2GFQA 3O2NA 1SWWA 5ICFA 4OX9B 4KDEA 2YICA 1M5UA 1I4EB 1WDWB 3FUUA 4HLCA 1BVUA 1SRRA 1WPQA 1ODIA 1LQ2A 2Z4SA 3CJQA 3VH2A 1PS0A 4QXMA 3QF4B 2KJQA 3IQGX 1IULA 3KUCA 5JNTA 1WKVA 3IB3A 1YAJA 3P4UA 1BNCA 1MOQA 1YK0A 1YU9A 2ZI6A 2ZBDA 4H7IA 1CUYA 3HR4A 1IN1A 4HAIA 1E2NA 1N8NA 3ZE9A 1WCIA 4FGSA 3QFRA 2VWPA 1TU4A 3EXG2 3OQIA 3R20A 1K9VF 1C7JA 1CZHA 1TD1A 3C3JA 4HN4B 4XTRA 5E6UB 1DUVG 4Z5XA 5K05A 2PH5A 1B7GO 3IPCA 3ZKAA 1C81A 2PIAA 4K1LA 1EXVA 2VTBA 1ZSVA 3AVPA 2V97A 5IVIA 1FUUA 1SUAA 3EK2A 2FG5A 1M6EX 4RU1A 3RWMB 1OF1A 5AM3A 3IT0A 1VB5A 2YV4A 4CIVA 5K6AA 2YXPX 1GL6A 1LI7A 1S01A 2Q1TA 5KTTA 5D3MB 4EG7A 3NTXA 1I2DA 1TCCA 1Z16A 1JA1A 2YFKA 3I6QA 3MOGA 5JCZA 1XCLA 2VP5A 4XCQA 2YJTD 3ETHA 4TSFA 4BNKA 4JJAA 1IBKB 1A04A 2V1XA 3WRYC 3VU9B 1WE2A 4CKCB 4XVHA 1TT7A 4KGXA 5A4AA 3B36A 1WHSA 5A9RA 2P2DA 3WTBA 3N0XA 1I51A 3JQ7B 1OX6A 2IPAB 2P9JA 2NZVG 3M6XA 1U8EA 3IUSA 3B38A 5E4JA 5FHQA 5GY7A 3S1LA 1M2HA 3COPA 1XMSA 3IX7A 4JZKA 4ZYZA 3L8GA 1XZ8A 5JYCA 3VPHA 4N01A 4EA8A 1FW8A 5BWNA 4MW4A 4XYEA 3IE0A 1BOOA 3FHCB 3V1KA 1MTOA 1U4SA 2I0FA 1LBTA 2BWJA 5CT9A 5G1NA 1G64A 1Y5LA 2X2FA 1WG8A 3F4LA 1N3BA 3H0EA 3L1IA 2YFQA 2GT1A 4FFOA 1NQUA 2TSYB 3KHTA 4AKSA 3F3MA 1UBEA 4CN9A 3SE7A 4O2BB 3BDAA 3D3JA 4XVRA 4X8LA 4TS4A 3QFCA 2RGBA 4FE4A 4A8PA 1J25A 4Q3OA 3SP1A 2VHVA 4CRWB 4L76A 2J0QA 1Z7YA 4I1OA 4J0GA 1C50A 4EG3A 1XK7A 2VS1A 3ESXA 3NV9A 3QXGA 3QEMB 4LTMA 5CLJA 5FIUA 1T2VA 5FL7D 4LJ9A 3ZGXA 3U44B 1JEQA 3D2CA 2DQ4A 2IE8A 2VN8A 3ZHZA 1DUIA 1U2TA 1TI7A 1F6WA 2HLDD 3N8DA 5H9WA 3NEYA 1TYBE 1GGNA 1Z4OA 2QPTA 1ZK1A 4INOA 4QJ5A 5L8VA 1AQJA 3Q7RA 2NM0A 4CYMA 3O4GA 1TK9A 4FYXA 4O59O 4NV0A 1E8DA 1CD5A 1PNOA 1P2BA 4IP0A 4ZJPA 5G1PA 3GFTA 4J94A 2H1RA 1OW3B 4WSOA 1DC3A 1C30A 1G21E 1KPHA 1SY7A 1WBJB 3H5NA 4JLNA 1X0VA 2Z56A 3U4DA 2LVBA 2ZM5A 3NOXA 1OX5A 1U8ZA 1Z62A 2ZK7A 2PO7A 4GYYA 4DR1B 3ZDCA 3DO5A 1JIUA 1PBTA 4Z0TA 4NYJR 1TW3A 3D4PA 3Q98A 4N49A 4DQKA 2CBZA 2A5FA 1Q7RA 2XUAA 3VV3A 3C7AA 5J4KA 4LF9B 4B71A 1LV8A 3G0IA 3GP3A 4HS9A 4N4AA 5TPZD 3VPFA 2C5FA 4V3BA 2B20A 3A1EA 3DLCA 3CJTA 2FSGA 1JQKA 4FX2A 4HADA 5F5NA 1DAPA 1O6FA 2Y6UA 3WDMA 3RJTA 1AUVA 3RS4A 4QYIB 4TRNA 5BPHA 3V4RA 3MSXA 3OLCX 1UWCA 3DOCA 4DPMA 2ZUBA 2QYTA 3R23A 3MAJA 4PO8A 3OSUA 4UC0A 1FMJA 1QOZA 4NEGA 5EZYA 2XQIA 3AO0B 4EARA 1JIJA 3B6MA 3FMOB 2QE6A 1C4OA 4EB8A 1IEXA 1EG7A 5BYBA 1MQAA 1O6BA 5KHLB 3AR4A 1DAKA 4YIHA 4CDMA 4K86A 2PWZA 2ZRQA 3IIJA 2H4FA 4F1WA 1OHHA 3G8YA 5G2OA 2P75A 3KAKA 4OQQA 3CCFA 3SR0A 1XVVA 4IF6A 5CFQA 1BN7A 1MJFA 2ID4A 2NAFA 5HP4A 4IDNA 2RHGB 1Y9JA 3L0ZA 3OCCA 1XCGB 1R1DA 2PEYA 4OXNA 4R84A 4HNUA 3RYCA 1E61A 1UP7A 1CVLA 3H4TA 4PZCA 1NDQA 4PLPA 3EWNA 2R7NA 4L6IA 4MWCA 4W6ZA 5AKIA 3CINA 2G77B 3PR3A 4FJ0A 1ZRSA 5A71A 3L93A 2JKZA 4G4SP 1E20A 2V7GA 2XQVA 1D0IA 2JI4A 3K2QA 4JWKA 1OA0A 3TLYA 5LQNA 3KP1A 1VPTA 1QE0A 3OZBA 4GC9A 2BLNA 2Q4TA 3TN7A 1Z7GA 1EQUA 5H9VA 3WXMA 3UGJA 5ELXA 2G0NA 3C4QA 2EU8A 4IZIA 4RZUA 2OKCA 4DMKA 1AZLA 4PFKA 2JJ1A 1MQSA 3B9PA 3FJYA 4YJGB 2VUSA 4NFHA 4ER6A 4BFWA 1FTWA 3EVFA 4IHKA 1XTZA 5MF6A 1CEQA 1LZKA 1V6AA 2I78A 3ZGVA 3INNA 2IL1A 4YP5A 1OBOA 2DLNA 5ALFA 4KX5A 3CA8A 3ESBA 3EXG1 3G88A 1XZIA 4E2ZA 2C4UA 4RY2A 3CE6A 4KFSA 1R74A 5SYMA 1Z68A 4DHWA 2DC1A 2LIPA 5EWJA 5LQRA 3SVLA 2AEFA 2VQ6A 4AB1A 4UMFA 4QASA 1CCWA 1TAHA 4G9GA 4V0SA 1ZIPA 2IP1A 2VK1A 3O5AA 1GZ4A 2EW1A 4ZO6A 2KPOA 3HRIA 3EIQA 3NYRA 4JUFA 1EUCA 3TF5A 1H6AA 3C8ZA 1US8A 4YQFA 1ZYUA 4BQNA 2CMFA 1Z47A 4UAGA 4FBGA 3L4KA 1DEXA 3RS0A 3GA7A 5JYEA 2CXOA 4G41A 1U0TA 3L3BA 1WU8A 3EAQA 4I08A 1TPZA 1DC4A 2OCDA 4O4LB 5IBQA 4CNBA 1IG3A 3TI7A 2YHIB 3MINA 1XZCA 2RGYA 4BASA 2Z2XA 3LQFA 1TM4E 1QHYA 2MSLA 1KPGA 2QMEA 2MWMA 1XZDA 2I29A 5EUCA 1E3IA 1JHQA 3FWNA 3Q11A 1FX0B 4XPIB 1JKMA 5G41A 3M83A 1M1NA 2IX9A 1BC5A 1W5EA 3MCVA 3UT5A 3MFYA 1R5BA 4P3KA 3UK0A 1PJRA 4GYWA 4KLAA 2Q45A 2F3SA 2QMZA 1ZITA 4LPSA 1F7VA 2IYYA 1F2TB 1OLUA 1T8TA 2X7JA 3PRJA 2GARA 4M8IA 4N6GA 4DSZA 2OD2A 3UKJA 5KDDA 4Y2SA 3HYSA 4WKOA 1PO7A 3C1OA 3P9XA 2H2DA 3G5UA 4F9EA 2I7VA 1FUIA 3OPVA 3L7LA 3MLEA 3TGLA 4GKJB 4M21A 1G19A 2H65A 2VYVA 4E2WA 1A1SA 4WL0A 3AC0A 1C7FA 3CN7A 5AM0A 5FD8A 4YFYA 1WY5A 4G01B 5DPMA 5GONA 5L3SA 1ZUNA 4OUDA 3R7WB 1T3GA 1RMTA 2MSDB 2YMQA 3IJ5A 4J0QA 2PPLA 4KIJA 2CHGA 3IKMB 4XLTA 3SHFA 4CU5A 3U13A 4C21A 4DPLA 2PRYA 1P17A 3OZDA 1A50B 2WTUA 3UUWA 1BS2A 3IVXA 4XOIA 1G5IA 1GCAA 4L02A 3A7EA 3DOJA 2BGRA 3HJFA 3UMJA 3FF4A 3LPLA 3QXSA 1OH5A 1MFZA 3R7AA 1O03A 3PJEA 4OU4A 2H52A 4RGBA 1WETA 4D0SA 2XWQA 1YACA 3O7MA 3LUJA 1Y9EA 4BLUA 1GDDA 4QNNA 3WBJA 3KPUA 1Q0UA 1X9HA 2PUAA 2VEDA 1PR0A 4ZRNA 4RDXA 2C61A 5DTIA 4GG1A 4L5JA 6REQA 3TSOA 2FRXA 4ZOCA 3H9QA 2I2AA 3AY7A 3TXXA 1XP8A 3RUIA 3GZ4A 1NNSA 2CL6X 3D6VA 2HOQA 1UMBA 2MTBA 1Q15A 2O07A 1M54A 3I9V6 4DSAA 4HAYA 5A9SA 2ZS8A 2GBGA 2HA6A 3CGWA 4JU9A 4WOBA 4B48A 1RM4A 2AL7A 4AJEA 3VNSA 4JENA 2FZ4A 1JPUA 1SBIA 1MX9A 3A14A 1OKKD 4X97A 1E2LA 2H2IA 4KXVA 2CNOA 4JT2A 4KL8S 4YMVA 3D0KA 2FOLA 3ONNA 3MHTA 1W9HA 5EJ9A 3KOXA 2OFXA 4ZQFA 2QX6A 2FEWB 3WHPA 1NNLA 3F6PA 3PD7A 5TF4A 2NLOA 1J8DA 1N6KA 4W5JA 3S68A 3N6XA 4RA6A 3CSDA 4E4YA 4B9AA 4QG3A 1N5DA 1IQRA 1QHSA 2HU7A 3K92A 4YJFA 3ETJA 4E0BA 2ZWAA 3VPGA 5K4HA 3W8RA 1PT6A 2MJLA 3T9FA 3GLIB 4R16A 4WFIA 4C0XA 4IDAA 8AT1A 5H3HA 4Q21A 3LDUA 4WJKB 4G9BA 2Z2JA 5B3JA 3MW8A 3VTZA 3N8GA 1LK0A 2IS6A 4XJTA 1LRJA 3KZCA 2EJBA 5JJCA 2O3SA 3F74A 3R5FA 3UMGA 3A1DA 5K8UA 2F59A 2WB2A 2GN1A 3A3YA 4O8ZA 2AF3C 1QMPA 4BX8A 3BWDD 1VSUA 1RXEA 1PDWA 4R0MA 3AEYA 3IMKA 2JFVA 3TMYA 4DR2B 3MT8A 2PSHA 1U7TA 3WLTA 4OFXA 4UTPA 1C7QA 2QYHA 2YIVX 4YIKA 4B2IA 3FOBA 1JJ7A 2GOYA 2B2XA 2VZ9A 4TZTA 5KSWB 4EPYA 1XKXA 4DM7A 1KFKB 3QU4A 3AB3A 4KU4A 4ZVRA 5KNBD 4IIBA 4DLYA 1CF2O 4Q3NA 1ZUHA 3GAFA 1B0ZA 5JFGA 1GXSB 2PMEA 3H04A 1R8JA 4HQ6A 1NQTA 1BAPA 1F60A 4CR6A 4QWWA 3F78A 3SQOA 1AM4D 3QA3E 1VMEA 4LF5B 2A35A 2VJOA 4M36A 5EVJA 5A7FA 1SVLA 3EIOA 3PP8A 4FUTA 3GVPA 3U17A 3QKIA 3OFND 3NIBA 4LOJA 1JBQA 4M98A 2X8AA 4NCNA 4TTSA 4CMJA 4DT1A 4M60A 1QYVA 3HP7A 1QFSA 2UVPB 1YKFA 4EHAA 1JT9A 1EZ1A 2X0EA 3WLAA 1NY5A 3DHEA 1E96A 1Z2CA 5E7IA 1IHXA 3X1XA 3RF7A 5KPJA 2AHOA 2XJ4A 4R6WA 1NG1A 1TC1A 2G6BA 1H4VB 4REQB 1QQBA 3EH1A 3WAJA 1YL6A 3STVA 2CWDA 3N2LA 3II6X 1RAEA 1NBEA 4TSRA 2REBA 3E6AA 2C7BA 3I52A 3VR3A 2X3YA 3I37X 4GI5A 4L8LA 1AK2A 1GZ7A 3OQ6A 3QEAZ 1J70A 4PICA 3GG2A 3WNQA 4FI3C 3C3MA 4KWTA 3ANSA 3A9SA 1FQWA 3NYWA 4I9HA 1RXCA 1LLQA 1F5SA 2BEWA 3O9ZA 3HA5A 4WVFA 4AVYA 1ID8A 1NMYA 4WFJA 3VTFA 3IDFA 1GLGA 2POCA 5KHAA 4BLQA 2O8DB 1ZG3A 3ED1A 4L3WA 4CKBB 3CZ4A 1VDMA 4H27A 5FXMA 3V2IA 2WBLC 1QYWA 2X19A 3BIOA 3CNLA 1QHHB 3D4NA 3IDZA 3H7AA 4YRSA 4R1QA 1AZTA 2IZ5A 1QPBA 2X4IA 4ALMA 2D0IA 4PPNA 1F48A 3DEHA 3VHQA 2CJWA 5BO5A 1Y80A 3O83A 1Z8FA 2Z2YA 3H6HA 4R1UA 1J9GA 2VHZA 1SAYA 2H8GA 4JLKA 1ABFA 4UHCA 3DFFA 3I4FA 3ESAA 4OI4A 1N2BA 4NZOA 5CK4A 4YJGA 1YDEA 5TQ0A 2C9BA 1L4FA 4FHEA 4J1NA 2O8CB 1VRWA 3CH5A 4C2UA 2FMUA 4RIHA 4BB9A 1ORWA 3NAZA 3DQQA 4GR4A 1QSGA 3FRIA 3MIIA 1KZGB 2PD3A 3T99A 4QUAA 5ADWA 2YW2A 3L1VA 3AI1A 4B09A 3AVWA 1N6NA 3A8TA 1R4AA 4A2WA 4DLSA 3FNFA 2XNDD 1P1KA 1FSPA 2P9TA 3IAEA 4AL4A 1UBOS 2XVXA 3SFTA 4AJ9A 1IB0A 3AVOA 3WL5A 1Y7LA 2WYVA 4AX8A 1QO7A 3K53A 4DGSA 2WSIA 1BYIA 3SF8B 5IDXA 1BRMA 2J0UA 2JA1A 2ZJ5A 1AG9A 2IXTA 4DIOA 1PEAA 1ZCFA 3BUSA 3BCSA 4YRKA 1I5EA 2VSOA 3LLMA 4YN3A 4JXZA 3L6RA 3KBBA 3DDWA 3VDQA 2QD1A 1PJLA 2VDMB 4CLHA 1IFXA 5CT5A 1ZK3A 2CMGA 2WUEA 3IAS1 4ZAWA 2C1EA 1ZVMA 2PRZA 3GARA 4NVRA 3W8EA 5CA0A 4R8RA 4MR7B 2O1SA 2R4TA 1EP2B 1QQTA 3AUSA 2AA3A 3JWGA 4OK3A 4M0CA 3KLNA 2CYCA 4ZOLA 5CAEB 3F6CA 4L9SA 3T61A 3DXFA 4KPYA 2WHQA 4NFLA 4RFVA 2IYLD 1RYMA 2B4TO 3VO2A 1PQWA 2G28A 3HY4A 3AINA 1IPFA 4HEJA 1JJVA 4Q4AB 5E2AA 1RJGA 1MB4A 1N2CB 3PDHA 4KB5A 1EGQA 5B37A 3IEUA 5HJ5A 4IW3B 1VIYA 1I3KA 4WK6A 3LMKA 2W2XA 1ZMBA 2CSUA 4F93B 1QO0D 3K0CA 2ZSBA 3ZZ0A 1P44A 4E5VA 2QRGA 4PBRA 4PS1A 3TVTA 4F04A 3B48A 1TU0A 2FDRA 2ZWIA 1IDN1 4KE6A 2DHQA 5I9TA 4N8DA 3UWMA 1EWQA 1G8FA 3HU5A 4BC0A 1GG8A 1E9DA 3ANMA 1WB4A 5JHGB 5K20A 1UBCA 1FA9A 2ZAYA 1OBCA 4IUCS 3OQNA 2NTJA 4MQ4A 5K4AA 3GK3A 4LJAA 4RADA 2PBLA 3BWXA 2BHLA 2J4DA 4NP6A 3FPCA 5D5HA 1JFVA 3A1TA 3E0XA 3B2EA 4HTFB 1SXJD 3EQZA 3GEDA 4I8DA 3AI7A 4PZZA 3HO1A 4MKZA 5HSGA 4A82A 2W8ZA 3RM3A 4DSTA 3GRCA 4NDAA 3P9IA 4OBXA 4KXNA 1XWIA 4MJ3A 3RKUA 4BFUA 3KNZA 4D7AA 4OAPA 5LQJA 4ARZB 2IS2A 3UWOA 4G65A 1KHHA 1AT1A 4R3WA 1EBUA 1ECFA 2B69A 1XPJA 3EEYA 3RJZA 2A59A 5JDCA 3L8HA 3UAGA 1ULBA 1ZINA 1V8OA 2JEOA 1D2MA 2ZRDA 2IDZA 4OHFA 5DLQC 3R6TA 5K3OA 1H0RA 4C2TA 3I42A 3AF2A 2O54A 4LVCA 1YDHA 1TOAA 2OLEA 3BMQA 3BRWD 1KNQA 3L7DA 4ZO9A 5BSGA 2VDJA 2JGRA 3C15C 3JSAA 3EZLA 4F3RA 1KL7A 5EERA 2DY1A 1PL8A 1HSOA 1U8FO 3DPIA 3U4HA 3KQYA 3WMWA 3L1JA 1EDEA 4N40A 1JTFA 3RRYA 3PNSA 1S96A 1X6VA 4K28A 3RRMA 4EDFA 1AKMA 3ABIA 1PD1A 3BCRA 4TV9F 3WIOA 4QJIA 2ZU6A 3FTNA 4J3NA 1JBEA 5DI3B 2ZJFA 2ECFA 3C4VA 1ZJ6A 1ONNA 1NONA 5B1IA 5F1OA 4R81A 2Q41A 3JQCA 4IHJF 1KQOA 3UT0A 3BILA 3H9CA 3ET4A 1XNQB 4OQFA 5DF1A 5IZCC 5KQGA 1P3Y1 3L7NA 1W6UA 1QGUB 2OC9A 1T29A 1QGOA 3LCCA 1VJTA 4UNNA 1L4MA 1O3YA 2Z8XA 4B2PA 3M3HA 5C51B 1CEEA 4K1XA 4BZZA 3I2YX 2D3TA 1UJCA 2PU7A 1D9XA 3IJEB 1WW8A 1QG4A 4OYRA 3EFHA 3DR5A 1M34B 1V4BA 2Z8YA 3W06A 5FTJA 4PPFA 5CD9A 1JTEA 1QRTA 2FMFA 4Q82A 5CJPA 3ZN2A 1Z88A 1A4RA 4WJLA 3I9LA 1SC4A 2HJWA 1YBFA 3GJQA 2SBTA 4P7GA 3SR3A 2QROA 2WV9A 5BOSA 4TN1A 3OD5A 2FUCA 1S3IA 4MARA 4EW3A 3W9YA 1P91A 1QS0B 4MRVA 3ADKA 3AWIA 4LXGA 3HPQA 4FKZA 4D4GA 1ZN7A 2AXQA 2JIZA 3O2QB 4Q3LA 3AF6A 3SFVA 3ZU4A 3DBOB 3JYOA 1QQ5A 1JP7A 1W96A 2PAFA 1UANA 4LHWA 3JQ6A 3PUXA 3F4BA 1RM3A 4MW6A 3HFSA 3D6TB 5HMMA 3T1VA 3W6NA 3PUKA 2WVJA 4EI2A 3U4GA 4B4DA 4D41A 2QRUA 5HG0A 1C1YA 5JARA 2M9MA 1GU1A 1F3OA 3JS5A 3N58A 1HZZC 1O08A 2WAYA 4KMOA 2IU0A 2E1RA 1QH0A 3SAJA 1ZOPA 3WS7A 4KO2S 3ECSA 2RK4A 1Z63A 2ADMA 1EB8A 3E58A 3CW2A 1P6UA 2PKEA 1EQAA 1UPAA 2I4MA 2J7PA 4IX1A 1RNLA 3M3DA 2PMKA 4G8DA 4KKVA 4MS1B 4WCFB 3LUHA 5LP6C 3TD9A 1N1EA 3R75A 4M6WA 3AEQA 3NR2A 2R25B 3TIXB 5H4GA 1G8JA 5JJIA 5CLFA 3NP7A 1ATZA 2R1TB 1Z6ZA 3FETA 2VLBA 3AYZB 5IHXA 5KQMA 4G5HA 3K5PA 4GZ3A 4LXXA 1LJLA 2CVQA 2WM3A 3AR3A 3JALA 1XEWY 1NASA 4L3OA 1PN3A 3Q87B 1YMUA 1VHDA 4FGKA 1U28C 3KZVA 4P5PA 1ZQ9A 4LF6B 3AZPA 2P2GA 3ZIDA 1TCBA 5KCMA 4YAOA 3MT7A 2Q28A 4REQA 5JZ9A 1QCCA 4GM4A 1UPTA 2AFHE 3KTOA 4M9QA 3VU3A 4BAGA 5L45A 1GN9A 3ETNA 1HZJA 2BSXA 3FJOA 1CJUC 1HSZA 2CJPA 3OZUA 1H9CA 2FF7A 2P9QA 2B21A 4GF5A 2WQ7A 1DWOA 4C7KA 3PSHA 5DHSA 2Z9CA 2ZWOA 1JFFB 1EUDB 1IVSA 3WGGA 1M2VA 2W0SA 3RODA 1NWHA 1J8MF 4RENA 5FOVA 1ECLA 2AJLI 3K4PA 4RLSA 5JECA 3OIVA 1CJCA 1VCNA 2QTCA 2W48A 3O4HA 4N9QA 2O8DA 3E4CA 4MMYB 3EFOB 4PRLA 4AXXA 4MGKR 1UFKA 1UKBA 3ICQB 1QHHA 4CCWA 1EVQA 1K0FA 3UYLA 5DNYB 1QGED 2INGX 1EGVB 4A27A 6GPBA 1AKWA 4QPJC 5IKPA 1JJBA 1REQB 3LF1A 2J3IA 4HQRA 4JC4A 4IUDS 4LMBA 4ZC1A 5FX2A 2VVTA 1LS6A 3PTLA 4F45A 2ZI5A 4JR2A 1FFDA 3K94A 2Q5HA 1JDZA 3F8SA 1GUYA 3I28A 1WMAA 2XNSA 3H4VA 4LOAA 4MXDA 4BRSA 3SQDA 4IH9A 2AI1A 4P32A 1KYXA 1XR3A 5L4SA 1JR3A 4ZFNA 3K9QO 2ATIA 3P32A 4OXRA 3KJFA 1XD9A 4RZXA 1OX4A 2ZIWB 3UO8B 3OH8A 1YO6A 2HJRA 3C6KA 1GCUA 4FMDB 4M7OA 4TLBA 3AW9A 1IY9A 3WAKA 4JR0A 5H81A 4I9NA 4CT4B 2YBEA 4A5OA 1P0IA 2W5UA 4P58A 1R8QA 1OWOA 2B37A 5T4EA 4DM3A 3U7HB 4OQXA 4RM2A 3Q8LA 2MHCA 3SS7X 4NENB 4IVQA 1F2VA 4IV0A 4C30A 3TLJA 3SF8A 2FW1A 2R00C 1XRJA 3NGMA 4TMZA 4G26A 1FE8A 2WG2A 4ZIRA 3QVTA 2LPMA 1R0ZA 2GDZA 2YASA 4BEVA 2C2YA 3GW8A 2XTZA 2CVZA 5C8YF 2CLDX 3CKLA 1M5TA 2FQQA 3GDGA 1ZD8A 4J1SA 4N3GA 4PNPA 4RMIA 1OTYA 2EKPA 3O9VA 2PD6A 3AHHA 3QA9A 3GT3A 4X44A 4PW0A 4MGHA 1Q0ZA 3TSYA 2ZJ6A 3KB1A 1ETUA 5F2EA 1ZI8A 4WRRA 2WDPA 1ZXBA 2AFIA 2FPGA 2NPOA 4S24A 3T7EA 1F17A 5ICEA 4C0LA 1DRVA 3RRZA 3UIEA 4ZK6A 5K0TA 3TXYA 2ZUUA 3NPMA 2BCJQ 2GN2A 3G2LA 3V97A 4BE9A 4H7PA 4CJXA 5FR2A 4PLGA 2J09A 2OKGA 1BXGB 4P4SA 4YXWA 4Y1FA 3PPYA 3VR6D 2PNJA 3BCHA 1XVUA 2L2QA 5F3WB 2WJVA 2JFUA 4UBIA 4CU2A 1DS6A 1KJWA 4ODIA 3ETGA 1JIIA 2YYAA 4Y2JA 1O97D 3P26A 5KX5B 1X7ZA 3TINA 1OXTA 3QE4A 2IYOA 5K3FB 4CTNA 5KTMA 1H23A 1I4TD 2OZKA 3U4AA 2IUTA 2FN4A 4KQHA 1L1RA 4ID3A 4NPHA 4DMRA 3D64A 4OATA 3P9NA 1YL7A 4GL4A 4JNCA 3SC3A 2C78A 5JQGA 5IC6A 1LQUA 2B2CA 1MIOB 2GBCA 2HDHA 2NTVA 3GZNA 5LUBA 3SFZA 1IL0A 4EJSA 5I7SA 4WLVA 2Z2KA 3LO5A 3DBHB 1PT5A 2QLJA 2WUWE 4GKBA 3EIHA 4EX6A 4JHLA 3GEHA 4XLZA 1C9EA 1TCVA 2HSGA 3AU9A 3FMVA 4Q4HB 2AXPA 1SKYB 2G63A 5G53C 3VO9A 1WQ3A 4TYNA 4G0YA 1BRTA 4TMVA 5FTNA 4D6PA 1Q7BA 2G4CA 5F52A 3UC5A 1PS9A 1F6BA 1VC2A 1JDTA 1EM8A 2NO5A 4INZA 3LK6A 2GFHA 1X1EA 3KWFA 3OETA 4QOFA 2IBMA 3OKCA 4HX5A 2OCBA 3ZJYA 3IAM6 1Z29A 4JEIA 1AMOA 4G0PA 1TVCA 2A78A 2HF2A 1JKIA 1L5YA 3O1JC 2YHBA 1KSHA 4I7EA 3F73A 5HF8A 4DA7A 1PWZA 2VF8A 3NZEA 2B1JA 1G5RA 3GD5A 4UHJA 1DDOA 3RSGA 3K6SA 3D3NA 2Y1CA 5E3HA 4IMJB 4G09A 4MRAA 5H80A 3RGGA 1H5NA 2ZZNA 1DO2A 4H17A 4URVR 3FCEA 1T0UA 1H2EA 2SKCA 1KEZA 2D1FA 1KDRA 5DYWA 1BQ3A 4LJ6A 1VPDA 4B3JA 4R31A 4MHTA 3HA7A 3GJ0A 5EZSA 2WKSA 2IEDA 1K88A 2P4EA 3JAKB 3NBZC 1U0LA 2HSWA 2Z6UA 4ARCA 4ZHQA 4N41A 4L0MA 1PL7A 1IN7A 1NQ5A 2E48A 3QPVA 4YCNA 3CT6A 2PQ0A 2PGOA 1P2GA 3O8QA 3ENKA 3V7YA 4J0CA 3V9PA 2AT1A 2Q9AA 3QKSA 3HN6A 4QSHA 5FA6A 1USGA 1RQLA 4BQSA 2BI4A 1SKMA 2A2ZA 2PANA 1JYEA 4JUAA 3S8EA 1BS9A 1FQJA 4EATA 5AIAA 4QXPA 1LTQA 2B1IA 1ND6A 1XLTC 3HVIA 1DIGA 1G5HA 5T6MA 4NXMB 3MBIA 3ZW9A 3H1TA 1IUNA 2JCGA 2OHIA 2UZ1A 2Z57A 4CF7A 5KC8A 2ORIA 4AD8A 1JKXA 5I7WA 2I54A 1Z6GA 1C3JA 3RRJA 4HGQA 3SC6A 1KF0A 3ET5A 3A1VA 3ZHXA 1N8TA 1Y6QA 3LH5A 4K6HA 4MPRA 3E7FA 4UVIA 3W1WA 2R8RA 2PWBA 4H1UA 4D3DA 2UZ0A 4URXR 3KQKA 4MV5A 2OSVA 2PZMA 3KJZA 1CSEE 1FP4A 4L2IB 2ZAGA 2ZIAA 3N7TA 1GZUA 1W4ZA 1WPRA 1EINA 1CUSA 1GAWA 2VUHB 1QFXA 3KSAC 5AK0A 1O96B 3HNPA 3MN1A 4DDHA 4YDSA 3B5IA 3T1HB 1UWLA 2ETXA 2EX4A 3AWDA 1MAHA 1Z4JA 3DBVO 1QF9A 1HLFA 2JCBA 4YACA 2ZIVB 3ME5A 2HBYA 4QELA 4M3NA 3BERA 3JQAD 5KJ6A 2NYUA 3EDCA 3N2GA 3W2GA 5AW7A 5KSYA 3MWYW 1B3BA 2P3OA 2JD2A 2V6BA 2YJNA 2CBGA 2PA3A 2WI8A 3BQ9A 3G49A 3H8SA 3MWKA 1Y8CA 1DTWB 3QJGA 1R9MA 2CGEA 1GT6A 2AXEA 4LDAA 3X44A 3ZU2A 1E3LA 3UCFA 4DQ0A 3IRVA 3G59A 4V3CA 5AUNB 2HEGA 5B6JA 3CCBA 1VLJA 1E6WA 1NMSA 1KAOA 2REQB 3PX3A 3O73A 5J4VA 1J24A 1JEYB 3GRUA 2JFNA 1YB1A 3IQHX 1GN8A 1WABA 3IKTA 3IQZA 3FZGA 4WESB 4RPLA 4XH9B 3SX4A 2G8LA 1DEOA 3TZEA 4K88A 1GV1A 4BQEA 3PSAA 1RADA 4HDSB 1JLKA 3I0ZA 4MQEB 1E0AA 2XGGA 1PL0A 2Q7DA 3TGPA 1D2GA 3EPPA 3UMYA 4D6XA 5AW9A 3B1WA 3B6ZA 5IN4A 4ZYLA 2IQ5A 1QIKA 4QATA 1HG1A 2QR2A 2WM8A 4BJHB 2DECA 3KLOA 1N6OA 3BM5A 3H2GA 4YT5A 1NYQA 3DBIA 4MA0A 4EGSA 1JPVA 2OHOA 1T2UA 3GWZA 4MICA 5KAMA 1Q1ZA 4EMBA 1U3DA 3B20A 4KRGA 4I4CA 3A6HA 3OQOA 4D3ZA 1YZQA 3EFOA 2EZUA 2C31A 1PTJA 5CM8B 4JXXA 3NUZA 3B1ZA 4WLUA 1P39A 1I1NA 3WK4A 1KAHA 4EI8A 4IQ4A 4I8IA 4G0UA 2FG6C 2FUG6 4JLBA 1XEXB 2FPIA 2X2EA 5I4IA 3GFGA 1A82A 4L4ZA 4PFSA 3V8QA 3QMVA 2FY8A 3E5NA 2E18A 3BBPA 2BMJA 3P9YA 4XQ9A 4YRPA 3QELB 4R1PA 2FYTA 4A9AA 2YV5A 1UBFA 2E3JA 2ZIXB 3C3EA 5HIMA 5AXBA 5KOJB 4S2UA 2IBTA 3MS2A 4X6XA 3GEEA 2DQKA 3FPJA 3KKNA 4FDVA 2WVHA 1FFSA 4RY0A 1UODA 1YE5A 2K5UA 2Q1UA 3SMQA 1XTRA 2NUPA 1BEZA 3H84A 3X1ZA 4QPPA 1LFAA 2VUUA 3ZXXA 3LLCA 4YRZA 3DEAA 4Z3OA 1E5QA 1XJ5A 4FLEA 3ASZA 1G8KA 2IUEA 2P3QA 5CCEA 1KO1A 4RY8A 2TMKA 1JAIA 1AURA 2FEPA 2H3EA 1N1MA 4R2IA 3KM0A 1CR6A 1BOFA 1KFEB 3WSVA 4FHDA 4AZ3B 2K7FA 5ILGA 1L4EA 3GGGA 3V1YA 2PM8A 4ZZIA 3DP7A 3HKCB 3SEAA 1IDOA 4YP9A 3T7RA 5CCBA 4N48A 2I80A 2FPPB 2UDPA 3MTEA 4TLMB 3HZHA 1M6NA 2B4AA 3BTOA 4BWYA 4L7QA 1IN5A 2V7TA 1O95C 4Z4IA 2CLFB 1UFOA 4O63O 1KDYA 4JBIA 4H1VA 5I5EA 5AXDA 2EARA 1A5TA 1GKLA 2GK7A 5IFLA 4BKOA 2VFAA 5E8RA 2WD7B 3BC1A 3NASA 3L0SA 1JPNA 4S1TA 2FPRA 1PZEA 1T6YA 4M1YA 5JSYA 4I5IA 2XI4A 4RPIA 1Q5PA 3I45A 3PKIA 5DRYA 1E79A 4IIFA 4PYKA 1SCQA 2AG6A 3QIVA 2P35A 4U2FA 5C0OE 4CKWB 3THSA 3ZIUA 1J2UA 2CLOB 5ALOA 3HEAA 2WFZA 1G1MA 2WYUA 3LKZA 1CE8B 1DBVO 1JBKA 1SWVA 2Q62A 4WOJA 5GWXA 5CXUA 1BTOA 5JXWA 3SIPA 5BN3A 1TIBA 1LU9A 2O1EA 4HDMB 3TLGB 1ZJWA 3SYNA 3HP4A 1OBVA 3BIJA 5C4IA 3HFJA 1TB4A 4EHJA 4W5WA 1C9JA 4B3CA 3PTZA 4J0HA 3GRFA 5JZVA 4B3XA 3X0DA 5FT9A 3ROZA 3UA4A 3GFVA 1BDIA 2GK6A 1LRKA 3W04A 3M82A 3QIAA 4CM9A 1ZCZA 3GN2A 3N2KA 1BMFA 1PVOA 3OJLA 3PGMA 1QJ4A 3IQEA 3CVWA 2IPLA 2ZRGA 4F4DA 3IAFA 5BR8B 4HT3B 4AZWA 1H2RS 4UCXA 4D96A 4B6SA 5HM8A 2AW5A 2PL3A 1Z4IA 2D1SA 4PSUA 3BMNB 5HIJA 4Q19A 1JQ5A 2QR5A 1L1FA 3BK7A 3LKVA 3EEOA 3EXHB 2J07A 2AD5A 3ADPA 4UEJA 3THYB 4WCDA 3SEZA 4H3KB 1EE2A 2AN5A 3CRW1 1AHHA 3NBQA 3RLFA 2PVSA 2Z95A 1VL0A 2VAXA 5LJLA 3K9WA 3N9IA 4Q4HA 3VR5H 4LCBA 3MRVA 4V39A 2EWWA 4PQRA 1OQAA 5B36A 3NM5A 1A96A 3ZH9B 1VYHA 4LJ7A 1M5RA 4TZ6A 5BUQA 3ETLA 3B52X 5F9MA 2VZ8A 4PPYA 1OAOA 4BMNA 4B8WA 1DQSA 1OWNA 1JHXA 3A9WA 4UQLA 3MOIA 3QW2A 4IEIA 3PEFA 4O33A 4BX0A 3LP5A 1OLSB 3AEXA 4R9SA 1SC9A 3T3OA 1YDGA 1C3VA 2XX3A 1H0HA 2EF1A 5ELMA 4DPKA 1Z25A 1M2EA 4IIJA 3EIUA 2GNPA 1OGJA 3DS8A 3QX9A 4K9PA 3SR4A 5A5GA 5ICSA 2EJUA 2AH5A 4MA4A 3EX7C 3CUWA 2XNCA 3LA8A 4M1MA 4PONA 2M2IA 5DHPA 3TOVA 4ZMBA 6YASA 3TTTA 1JZTA 1Y3FE 3I1YA 1EBFA 1FRFS 1X80A 5DNCA 5CDSA 2HJHA 4LTDA 1ABEA 1E2PA 3GH3A 1ODKA 2FX3A 3Q10A 2VC2B 3HJGA 3W9BA 2WG0A 4KUGA 3R5TA 4TKUA 2YYSA 3IP6A 4UOQA 1Q21A 2PYDA 2CLHB 3EZFA 2FJUA 1UL1X 2R4QA 4KTTE 1GGHA 1NA5A 3MELA 4GVXA 5LBUA 1ZDMA 2JAUA 3A9VA 5JPCA 1WUTA 4WN9A 5E6RA 2IEZA 2GH1A 4IWNA 3EEBA 2XMCA 1YB7A 2EX0A 3K09A 1ULAA 1DOAA 1Y82A 5AK6A 1NZJA 2WK1A 5K6AC 2FR8A 2D8MA 2YJ4A 5IKEA 3F7NA 3FLBA 2DOKA 2JJ1D 5JRZA 3VDXA 1FU8A 2PQ2A 1U98A 3DF7A 3G2OA 2OBYA 3KOYA 3KR0A 3SHWA 4DWOA 3QEBZ 5KQSA 1WUKS 4KVGA 2Q5FA 3BQNB 4FN5A 4MVJA 1PUIA 4IICA 1WEHA 3WMRA 4D6YA 4G1CA 2PXAA 5CUQA 4YPVA 2ZRIA 4UATA 1N5RA 1QYRA 5HTOA 2PL1A 2J9GA 3IHLA 1ZH4A 3MGAA 3RS8A 5E1OA 2X5XA 4KVFA 2O0MA 1T1GA 2SHKA 1IWOA 2BHNA 4KMRA 5REQA 5ADHA 1X1TA 1T5OA 3GLGE 1KVRA 1YB6A 3PPWA 4RH0A 1Q44A 3RFFA 4UDNA 3W8DA 3QOYA 1GGFA 3K31A 4LJRA 3IMFA 1IHPA 2G08A 3DEJA 1ZOOA 3FFWA 4NBSA 4QUGA 4UUBA 5KC9A 1EDDA 3MD9A 5KOHB 3JQBA 4L5AA 4RF3A 4BNHA 2IYEA 2R86A 2YY5A 2FR1A 1I13A 2XY4A 2G9QA 2JCYA 3SC4A 3UFXB 5LMCA 4I55A 3C3KA 4MSUA 3D6UA 3F2IA 1C7EA 3B60A 4IGEA 3RC2A 4BVGA 1NOIA 4PXSA 3OEYA 2QLMA 2WM2A 3ZQKA 5KTPA 4XGQA 4BO0A 3PLAE 4H7DA 1SQ6A 1Y1LA 5FR1A 4NXNB 1FFHA 1VCMA 2RONA 3QX7A 4O4IA 4E30A 2V45A 4KUHA 1KGSA 1DTWA 1USKA 3P9SA 1GYQA 1LBQA 3EXIB 1COZA 3B7PA 3QMWA 4RD1A 1FIUA 2QX4A 4NR0A 1RE0A 3DDCA 1XTBA 1A9XB 1NYTA 2O3UA 2YZMA 4GXNA 5KDOA 1YQQA 4JX9A 4FLFA 1BKYA 2IYXA 1Z38A 2AI3A 1VLQA 3OCYA 2QM7A 4QOEA 1NL3A 3LHSA 4RAQA 1ORVA 1Z06A 5CM9C 2A9RA 3ZIAA 5CPBA 3U5ZB 4S1WA 1SCIA 2UVDA 3AFOA 5CXXA 3RS9A 1MB9A 1YR9A 4LRSB 4LYDA 1OMOA 4GOOD 5CW1A 3O3CA 5DOVA 3S27A 5JE8A 1DKQA 5F23A 4FILA 3LOQA 4AW9A 4YJKA 5DLEA 1CJBA 1S1MA 2LUOA 2IEYA 1H4TA 3KT6A 4XUCA 2A4MA 3Q3EA 3RHZA 3ESDA 3WI7A 2JGLA 2QXUA 2W43A 4ZAYA 5KYWB 3RHTA 5E7JA 2GKOA 2O8NA 1SD5A 2PG3A 2VYVD 3FPEA 4MQUA 3DLBA 3L79A 1FEZA 5FQNA 1ZMRA 3EA0A 4MUJA 1EEHA 3L8EA 3QBTA 2OQRA 5CVTA 1PU2A 1ZIYA 4B9EA 1D04A 4RHYA 1DQNA 2OBFA 3CO0S 4MCIA 2G83A 2G5TA 1I8TA 3OTIA 3U16A 4B5KA 3QITA 2DPXA 3SF0A 3VGPA 4WH0A 5BQ5A 4Z6KA 1R5JA 4DMFA 1W7AA 5BNZA 2H9AA 3AQIA 1QKJA 3SJZA 3WOVA 1UOPA 5LFAA 4TTTS 4Y1RB 7AT1A 3RSHA 2H57A 4W8OA 4KPEC 4IOKA 1G42A 1YASA 2NUTA 3HJCA 2AJTA 1KKMA 4OSOA 4OQ4A 2PA0A 4W7SA 1U2DA 1W25A 2ID7A 2W2TA 2XAUA 1GPJA 4K9DA 4BFZA 3AHIA 1U0HC 1VG9B 2PPVA 1S9HA 4XYGA 3TZQA 1W1WA 2A5JA 3RB8A 3CZ9A 4C9BA 4KYVA 1NNI1 4DE5A 4DLWA 4MW5A 4FUQA 1EK2A 3NPAA 1G21A 2FPSA 4MYUA 3THWB 2P1RA 2FRDA 1PFQA 2QW1A 2RC6A 3EPKA 5I9SA 2RHWA 2CXTA 2O7NA 3DHWC 4MWZA 5I45A 4MQ5A 4LMAA 1N6LA 4ZOAA 1MC5A 1XO1A 3BF7A 4NBUA 2FPPA 3P19A 2CDBA 4H4EA 4KNWA 2LWIA 2XDQB 3TWOA 1E1QA 1RJWA 3FTCA 2BP7A 3PZRA 5EJ6A 5JZBA 3A1SA 3GLRA 3JQQA 2YRXA 5CDFE 3F5SA 3ZK7A 4IIEA 1NPDA 1QYDA 3Q0IA 4B17A 5DEOA 1M2WA 2F3UA 1H6BA 2HPAA 3K96A 2RGXA 3JQGA 5F3DA 1KRXA 3IAAA 1UIRA 3REGA 1M7BA 4JGGA 2REOA 3DBLA 4E5UA 3VPBA 1CUCA 1V6CA 2CD9A 2XWSA 2FOIA 3U0VA 4EHHA 4EL5A 1R0YA 3M3PA 3ZTTA 2BR4A 1T9DA 2DFTA 4REOA 5L3QA 1UADA 2BVNA 3BD7A 4O2AF 4KN9S 3RG8A 5GTDA 2I71A 4HDMA 3HYNA 1P1JA 3FKJA 3CWZA 1E59A 1XVTA 2YJ3A 3K1AB 5ALTA 1XZLA 3TUIC 2PJRA 2ZM6B 3DEKA 3HKEB 4K6GA 4MV1A 2O2SA 5F5LA 1Z56C 1X42A 3FMPB 3BRCA 2PBZA 4ALNA 3DVAA 1U3UA 5FYDA 3S1AA 4C0KA 3H2ZA 4MK4A 2D5BA 4HDKA 3A06A 2XGJA 1EWVA 2J3MA 4MKFA 5AKGA 1MUUA 4DFDA 3NC1C 3LRTA 4B7XA 5SY4A 3AHCA 2JD1A 2W00A 3UNXA 2AKEA 2J3QA 4L0CA 2GEKA 5CT8A 1KVUA 3DFUA 3E2PA 3A1FA 1OFUA 1H93A 2O2HA 5EE9A 5KQLA 2OG1A 3OVMA 4OQYA 3EXHA 5AHRA 5HS6A 3TKLA 4RMNA 1WWKA 2OA0A 1T9ZA 1N6IA 1M2OB 3T3MB 1RWXA 2VG8A 4FQ8A 4B4WA 4AAYA 4BECA 2QVBA 3FYHA 1Z6YA 3S44A 2I55A 3MAAC 1LPSA 5IP5A 2CLKB 3KQLA 1K8QA 1T2EA 2W22A 4NULA 3V8BA 3X1MA 3RYFB 1J21A 4D98A 1QP8A 5JVDF 2ANBA 3VMFA 1JXMA 1J0BA 3BSWA 1CZLA 3TI9A 4Z4CA 4F9GA 4RVOA 4HB3A 1CIJA 3WKCA 1J0XO 2ZRPA 3JATA 4NQZA 5GPBA 4ZDWA 1W581 3ZGZA 2WWYA 4CMKA 3PA6A 2P79A 1Q7CA 1X1RA 1ZW1A 3R5SA 3RS2A 1W4LA 3BZWA 3DBRB 3WA7A 1P2UA 3H2IA 1F3LA 1M6HA 3FKQA 4PTYA 1FTGA 4RJLA 4X8HA 5T4BA 3VR3D 4E4RA 3G9ZA 4EMSA 3ICCA 3MJCA 5K8TA 1N6PA 4KGZA 1KQ3A 3QKWA 4YDRA 2PRKA 3HUUA 4X64B 1VE6A 1D2EA 4A0FA 3RGWS 4HLNA 3WWZA 2ODQA 2O2GA 3W6ZA 2D4HA 3G5TA 4Y1EA 4ZREA 5FUYA 1X1SA 3W6PA 1ZNYA 1KI6A 1D1TA 2ZIFA 4MLCA 4OMDA 3QTLA 3AP1A 3CZRA 4GPEA 1YZLA 4M22A 3T9EA 2OOSA 4FNMA 4F1KA 4HP8A 4QHYA 4JMLA 5TS2A 3QY9A 1NF2A 4II7A 4MDHA 4LHYA 5DT9A 1RDFA 3P4XA 3BS4A 1JG1A 4A3SA 4NZ9A 4TKZA 1R4MB 3U7FB 1V11B 1QG0A 4NCXA 4C6SA 3FGPA 3T5AA 4FTWA 1SCJA 3HZZA 4RE5A 5EIWA 3WGTA 4XA8A 2P6PA 1ZLYA 1S7GA 3PICA 4KR2A 5IM4A 4N7BA 1ZBDA 1WP9A 2P7IA 1L5NA 3SM3A 3U4QB 3C87A 1BA3A 4RZ2A 3SS9X 3V3TA 5TC4A 2BE7A 4H4CA 4LDZA 3RVKA 3K70C 1XVAA 1SBZA 4AS3A 3COJA 3AVXA 1RBYA 2FPLA 1XNHA 2EC5A 2XTNA 1TVMA 4QKQA 4OH1A 1J00A 3EMVA 3GT7A 3E03A 5EA2A 4EB0A 2O8EA 4MKRA 5AFSA 3OOJA 3SYLA 1JA9A 3Q8WA 4Z4QA 2V5AA 4RTLA 3WMGA 4EOGA 3T7IA 4M53A 1U5BA 1B8PA 4MYTA 2QTVA 3T15A 3TRJA 2M6LA 1RJFA 4D0NA 5IJAA 5HCUA 4TV9B 1ZU5A 3UFXA 4GI7A 4P4LA 1N77A 3ZHQA 1VGRA 4INAA 1GZVA 2O5CA 2IW3A 3BRQA 5M5BA 2FB9A 1Z6AA 5E6SB 4KUEA 3ON5A 1GNPA 1XMQB 4HMQA 2VTDA 1X7HA 4JSTA 3TZLA 1T35A 4IHJB 4UUQA 2LIVA 3KHSA 4F6RA 5TGTA 4PNZA 2R47A 2YRWA 2QY9A 3TOXA 1XN1A 5DNWA 4AICA 1MB0A 4J75A 4QQ8A 3BWBA 1IOWA 1BW9B 4LOKA 9LDTA 4ZVKA 4CZ2A 2YN4A 1GARA 2F1IA 3BE5A 4DLUA 2JHPA 3GJSA 4LYHA 3NLLA 3NOQA 3TPZA 1BXRA 1M3SA 2W8BB 1U0OC 5MHTA 5JAQA 1HYHA 1IZ0A 3E70C 1XX6A 3JASA 2JVKA 4ICIA 4E1BA 1ZXXA 3H9BA 2CFSA 3DWGA 2I4RA 2W6IA 5ULLA 3DZJA 1SD2A 5EG5A 3VSEA 1TUBB 3LF2A 1LPMA 3GPIA 1Y3CE 1BGWA 5AMXA 4D74A 5IJ0B 3DCJA 3TLMA 3AM5A 2VCHA 2QI9C 4UUPA 1ZCJA 1V7QA 5FOQA 3MHPA 4RJIA 2ROQA 4URHA 2BEVA 1PEDA 1PLKA 2QUAA 3MJEA 4HOYA 4B87A 2QQ5A 1FXSA 1E2MA 4QXOA 1NV8A 4U0JA 1NJ1A 4LX8A 4XGIA 3IAS6 3IEKA 2Q0QA 2HH9A 4M8KA 2QRLA 1PJCA 4GNKA 1AMUA 3ADBA 4JUBA 4X45A 2O52A 2A86A 4TM7A 1QB7A 3WYBA 3WIEA 4QBKA 3FNQA 1IEQA 3WDLA 5M3BA 1XVLA 2LD4A 5FBRB 3E22B 4FOOA 2VSQA 1YZTA 1RAGA 2RBEA 3I34X 1Q22A 3I6ZA 4GSLA 1SCUB 2XE4A 3IBSA 4LZNA 3SQXA 3B3AA 3A26A 4B33A 4O4JF 1O6GA 1PG0A 2O0HA 3GJ7A 4DV7B 3EGEA 4CIWA 3BK1A 5K3AA 3IILA 4J0DA 2OTCA 3JD0A 1KWGA 1BQ4A 4EUNA 4ND4A 1TEVA 4MWTA 4HWRA 6NULA 4PR0A 3I5MA 5IJXA 5L9AA 3DL0A 3PC2A 1XXHA 1A8QA 1TJYA 1VSVA 3EGVA 3MZ0A 3K0KA 3I9JA 4X1IB 5IXYA 3QHAA 5ED0A 1A8IA 2ECOA 2PLAA 2QRPA 3N0TA 5BW8A 1GSAA 1TZCA 4EUKA 5DW0A 1YNOA 4MUHA 2UXDB 3OECA 1NN3A 3M4XA 1GTZA 1D5WA 1FB5A 3BSSA 3FCCA 4CLRA 2XV1A 5JFTA 1WMSA 5BR7A 1T6XA 2JBAB 2W71A 1LK7A 4Y2PA 4X41A 2EF0A 4H35A 1RJ9A 1R4NA 3CB4A 2QSJA 2ZSJA 5GVRA 5TT1A 5A0VA 3VU0A 4PLYA 5DTEA 1OT3A 3HSSA 4LGMA 3I72A 2G17A 1C1HA 1I6LA 2XT6A 4PYOA 4YRBA 4ISBA 3MJ4A 2Y05A 2GZ3A 3AUKA 2CNBA 3BAFA 2EGUA 3ESZA 4R1OA 4D46A 3NVAA 5HQ3A 2N1MA 4FYKA 2QTRA 3ENWA 2HDNB 3GCDA 1UK6A 2B98A 3TSWA 5IUNC 3RRXA 3OM1A 5JEDA 4X1KA 5J40A 1R88A 2YFYA 3RABA 3ZJUA 1NVVR 2H59A 3DR3A 3X1DA 1QIMA 3D2LA 5THKA 3TEFA 2AFHB 1S7CA 2C7QA 2Y9PB 2HO4A 2ZT8A 4LFBB 2QPOA 1QE5A 2XZPA 1IH8A 3ENZA 3KJNA 4JQOA 4TV8A 4GS5A 2CJFA 2W4MA 4PCLA 4D8UA 1LDMA 1D1PA 2IZ7A 2WZQA 1BYUA 2YQ4A 3T9CA 3THXA 1VRVA 1W93A 1C0LA 2ZPUA 2MSCB 3MWLA 4X90A 2NW6A 4TXHA 3C48A 3TW4A 2JIZD 4PYJA 4IYRA 5EGSA 4H1WA 1E1LA 3FG9A 4ZI7F 3PHCA 4FI3F 2VJQA 3EY4A 3PEYA 4KI0A 5C8ZA 2ZSDA 2H54A 3WK9A 4U7TB 1V8DA 1KSFX 4U7WA 1V9SA 3GIWA 3MF4A 2GDJA 1O4VA 1ZOIA 5JT1A 3Q5DA 1M7GA 3HUTA 2ZRNA 1PK7A 3IP5A 4MVJP 4R3NA 5A3JA 4DUYB 1YCDA 1N2XA 1IQPA 4HDCA 4A0HA 1XF1A 4HS4A 2J7PD 4QBIA 4ER7A 1UBRS 4A92A 1OFGA 3GPDG 1NW5A 1L7OA 1TTQB 2XZTA 1YRQA 1ECCA 2VPXA 3K0CC 4UM5A 2ZRFA 1CDZA 5KEIA 1D03A 3D1JA 5CEFA 3AUYA 4CM6A 4B3GA 1EFPB 2NO4A 4KYTA 5C8YB 2YWRA 5I7RA 4KFTA 2PJDA 1EX1A 1NM5A 2H9IA 4L9AA 2AVNA 2QTZA 2JHAA 4P3NA 3Q9NA 3BXXA 5TGZA 1KTIA 3BDIA 1TO6A 2WUGA 3GN1A 1SJ9A 3EZ7A 1XQYA 2KLBA 1VG1A 4M7PA 4BWGA 1QVAA 3AVVA 4JFRA 2C2BA 3NMUF 1NVAA 5EIXA 3AG6A 2X2PA 4OM8A 3CNQS 4JV5B 3V48A 3PYXA 2FSVA 5K0ZA 1SIBE 2DWQA 1GUBA 2YDYA 1EFVB 4L5YA 4TLLB 3JPWA 5D3QA 4HDAA 2Y0DA 4KO4S 2G9ZA 4C2BA 4E5SA 2QK4A 5AJHA 2BM0A 1ZHFA 3UC9A 2WF7A 4MEBA 1Y8AA 2XF2A 1NF3A 2EIXA 1WV1A 4HNAB 4OHRA 4E03A 4IMPA 1I2CA 4EM6A 5KSZA 3CGGA 5JDCC 2BT4A 4OGLA 2P8SA 3PYLA 4OHPA 5J9FA 3SC2B 2JI6A 3NUGA 3CU5A 2WOJA 1V16B 4WZ6A 4YUVA 2VNAA 5AQ1A 4QBHA 2HXYA 3LGSA 1U0RA 4MHOA 1BD4A 3K0FA 1W4BA 5DZSA 5KNDD 1UFVA 3CNNA 1GPUA 3SX0A 1U04A 4EO7A 1T9CA 2YWCA 1EJBA 1P4AA 2JIPA 5AVZA 1GNTA 1I2BA 3DKRA 4JQZA 2Y92A 2O1WA 2HWUA 2BGWA 2J9FA 4DIFA 1QAOA 3GJ8A 4NYMQ 3QLTA 4YV1A 1JR3D 3EGIA 3H7IA 3IEPA 2A1UB 2WVGA 3VPXA 1B00A 2YNMA 3PDUA 4K0RA 3ZKWA 3FOFC 3TKYA 1KMMA 2F3PA 1SG9A 3KCQA 1J5PA 1SVUA 4XR4A 5K0LA 1JH8A 1P6XA 5LQSA 2ZI7A 3DMYA 4B0OA 5KYUA 1MO3A 1Q3KA 4ZKDA 1ZEJA 3ORSA 2QL9A 2GF9A 2HO5A 3QPCA 1LSJA 4X1YA 4U2EA 1Y1KE 1SOWA 1POWA 1U6IA 2DGDA 4NBVA 3AKEA 2HMUA 4KDCA 4IKOA 3PKZA 4UAUA 4MZDA 4BNIA 5B1EA 5A5EA 4AJPA 1M6YA 5LZ8A 2QRVA 2GJAA 3N8IA 4RFSB 3SBDA 3AVUA 4XX1A 1YRLA 2C88A 3RYHB 3TEJA 1V9CA 1GM5A 4RKFA 2JZCA 1FNSA 1STOA 3OOHA 2X0FA 1QR2A 5EJ8A 2NU7B 13PKA 1L7BA 4ZMSA 3QKRB 3LWBA 3V5NA 1N9GA 4AS2A 1VYUA 3PA8A 2HUNA 4HQ0A 1UXKA 2VT3A 4RA9A 5EJIA 1VSTA 1JLMA 2RGNA 2NU6A 5HMLA 5JS8A 4YH1A 3GFPA 5ENVA 2ZSKA 3SYMA 3ZNPA 5B3KA 3ZCRA 1U4OA 2E87A 4BFLA 4EO9A 2VHUA 1KXZA 1S8NA 2WYHA 3L40A 3V4ZA 4YXWD 3QU9A 2K7ZA 1BW9A 1VBMA 1AN0A 4GMDA 4E6PA 5JASA 2CXUA 1J0AA 4UM9B 4D25A 1H94A 2IYTA 4CT5A 3A32A 1DP4A 2W8BA 2HBZA 1XK6A 1Z0DA 1FF9A 4C7OA 1M9NA 4RMGA 4H6VA 5LKRA 1T5IA 4ZU1X 4Q1VA 2OWDA 2HN9A 1OB5A 2Y0EA 4DLTA 4LKRA 2HPZA 4UCWA 1NW3A 5C3MA 6ABPA 3MYRA 4B40A 5IAKA 4B7AA 2FZ5A 3I5XA 3DMNA 3LLUA 3M1LA 4BO5A 3ZDAA 1YI0A 2PCJA 4HVTA 4C2AA 4ERXA 4S35A 2IUUA 2ZRHA 3KE9A 1J6UA 3LX5A 3OY2A 1QX3A 4MQLA 2VP4A 2A9OA 2PNFA 3IC5A 5KYNA 3KU1A 4O3FA 4NY1A 2CXNA 4WMLA 2FSHA 1NYLA 5KTRA 1ECGA 3AUXA 2Z0MA 9GPBA 4WWHA 2FQWA 3C24A 2G07A 4F85A 3RREA 3OZVA 1E18A 5DK4A 1CY0A 3DE0X 1Y1SA 1UXJA 2VWGA 5GOTA 3UJCA 3H6KA 4RGQA 4DHEA 4F9TA 1YSCA 5CITA 4RJJA 1H05A 1F0PA 1W94A 3FDFA 5KDLA 1OROA 3KS9A 4Q7EA 3VKGA 2IQIA 2ZP1A 4ZU3A 1NP6A 2HHCA 4RLHA 4S12A 1XJ0A 3UB4A 2WP0A 2XUIA 3CNHA 3PQFA 1NUQA 1NE2A 1EVKA 2QAGA 1HYBA 2DFPA 2W2KA 3EHEA 4KBYA 1SVMA 4Q48A 5BSWA 5F35A 3EVAA 4K9SA 1O77A 1JI3A 3L04A 3GLFA 2F8SA 1E1CB 4BHTA 3BK2A 4UBOA 1AA6A 1E1MA 2WFLB 3FYUB 5C2JB 4P8RA 4UVHA 5KJFA 2JS7A 3G2KA 1NUHA 3PV0A 5HFNA 1AO3A 1H85A 1YQXA 2AJ8A 1U99A 1K08A 4U2DA 4BMXA 1YJCA 1JG7A 1U11A 2H92A 1E2QA 1W4RA 2GJ8A 1PUJA 3I5UA 3PJFA 2Q3MA 4GP9A 2C7VA 4M9SA 5EMJA 1PRYA 4ANFA 2JBAA 2AX3A 2ZAOA 5KIAA 2BGMA 4F9FA 4IUYA 1J39A 1QO9A 3KT8A 2FUNB 3LY5A 2G40A 2RGWA 2B8EA 4UUNA 2J32A 4WASA 5LP6F 2EBWA 2AMYA 3CBGA 4PO1A 5E1MA 1QH1B 3M1YA 3TQOA 3MPOA 3SZUA 3QSGA 1OZGA 3A25A 2DQSA 3HL4A 1QVWA 1USIA 4JLJA 1SHLA 1GDTA 2YKGA 3VYRB 3I04A 5JSUA 1Z7WA 1YCHA 4ZCMA 4OKIA 4KPUA 2XCOA 1BCSB 3UMBA 5EPUA 1S5PA 4JELA 4HNHA 1SK9A 1BCRA 1ST2A 1VJDA 3BJZA 3SLRA 1OB2A 3DWFA 4U9HS 2AFHA 1W76A 2Z4RA 3NBUA 4EQZA 5BNIA 2YHSA 3AJAA 2GLTA 1WZUA 5M2QA 1RPNA 2YS7A 4EW1A 3M6IA 4D9MA 5DGDA 4I1UA 4QHSA 2X1MA 4MLZA 1GVHA 3P1JA 4BCCA 4CQMB 2ATXA 1RHUA 2EWMA 1IUKA 2X5NA 1UKYA 4O08A 3CVUA 1C1XB 1JG2A 4V0RA 5J5VA 4R2JA 1N8SA 1QIJA 2V8BA 4D8TA 1XDBA 2YYZA 2JGJA 2D7CA 4JYAB 1SVWA 4QAJA 1IY1A 5AJVB 1H2XA 1ST3A 3UXEA 4D4JA 2A8YA 2TYSB 1RFGE 1EFDN 2J3KA 1T36B 2AR9A 3L0PA 3OM0A 1SMKA 2M1ZA 4P33A 5F4BA 3I0MA 3MG9A 1RC0A 5G0VA 1SKAA 1VA5A 1W88A 2PH7A 2AK3A 4MGEA 4RH1A 5CT6A 4YNBA 2DTDA 5HRCA 3ISJA 3HB4X 5JPDA 1B26A 3X2EA 2QZ9A 3RWBA 3U3OA 5HQTA 4C6TA 5TQJA 2E4YA 3FGOA 4CIAA 2YMPA 4Q3DA 3RJMA 4L8WB 4AP5A 2VDWB 3HP1A 2A58A 1JL3A 4LKOA 3RC7A 3B82A 4GH5A 4UBJA 2X0DA 3Q8XB 3BPSA 4DYVA 3L7KA 4GRIA 2C77A 4CEIA 1W0KA 3MUFA 3F5MA 4MYHA 4Q6WA 3PHGA 4YI3A 4TWRA 4EJSC 3PK0A 3B53X 1CUGA 3VR2A 3ND8A 1U5CA 1CLUA 2V5UA 4WGFA 3RSFA 3ZZNA 3KZMA 3NX4A 4AJ1A 4HZUB 4WEQA 3K5WA 3DYIA 3ESYA 3G79A 2VAVA 4W7HA 3A70A 2FW8A 1ULSA 4PCUA 1T0JB 1YS9A 2H8KA 3KB8A 1VM6A 4OLFA 4QXRA 5HGJA 3VYUB 1T5TA 3ZWPA 2EBUA 4LECA 4DKXA 4D8YA 2O1XA 4KOEC 3N5KA 3PNBA 2IUYA 3TUJC 4A26A 4DXAA 3FTPA 4DYDA 1CUBA 4TSKA 4C4YA 4D5EA 3GNQA 3PT5A 4CM4B 1LDEA 3DEIA 3DDNA 2JLUA 1XAIA 1CYEA 1UMKA 2OBNA 2PLFA 5ITZB 2X6QA 4N3CA 3FM9A 1R6BX 4ZI3A 1USWA 4L8VA 1SZPA 3HU2A 3KR2A 1CQPA 3LOUA 3DW1X 4HUQA 2FXVA 4XXHA 2JFWA 3IUBA 2Q1XA 1FFEA 4EQ6B 4I1PA 3VR5D 3K0AB 4O3MA 1C9NA 2AWOA 1AHIA 5JUWA 1NUTA 3HFGA 1M66A 2I33A 3KSDO 3COZA 3WP0A 4UTXA 5KREA 2WKRA 1KO4A 3QVGA 5EKDA 5EPEA 3GJZA 3V1UA 1P5JA 2QUJA 3SZLA 2Q49A 5DO9A 5KYTA 1NQOA 4II2A 3Q0EA 4J1TA 5IX8A 5BNWA 1R9JA 3GH1A 1IN4A 4ACBA 3L41A 3L9WA 1B15A 1IZ7A 4A0GA 4W63A 3UMRA 2RB4A 1KU6A 1RVV1 2XGMA 3DZKA 3FMIA 2EFYA 1P31A 2B9VA 4IJ6A 4MS3A 4BEWA 1WO8A 4RHTA 3DE1X 1SHJA 1PJQA 1YS7A 3OT1B 3TSCA 5LSAA 2BISA 1F4PA 2WU1A 1HOTA 2QD5A 2CMDA 4W8HA 2Q3LA 2YFHA 5CJJA 4R68A 5KOHA 2AOTB 1CX9B 3K9FC 2ERCA 1V1MB 1DQYA 1E5DA 2YC2C 1P2DA 2DWUA 2FDXA 2XGSA 3GR6A 2YVQA 2ET6A 4UJ5A 3QYAA 3TOSA 1NZFA 2DBQA 1MO2A 3CEHA 1HXHA 1BN6A 2R1VB 4U39A 2JASA 4LDQA 5CLGA 3TLBA 1Y48E 5ER9A 2QUKA 2GM3A 3H6GA 3QVKA 1EH5A 4GOJA 5DFAA 3RBAA 4OQEA 4V0OA 4BRZA 4EB3A 1Q0TA 4D0LB 1ZNQO 1RWMA 1VZ2A 2P2YA 1II8A 2PDAA 4JBXA 5GP1A 4HPJB 1JDVA 3HDJA 2OZLA 1U9YA 3BFKA 3KVYA 1E79D 4QG7A 1UIMA 1BHSA 1N2IA 2JLYA 2W6JA 1MR3F 1SUWA 5TMBA 1LV7A 2HIMA 2PRJA 2DM6A 2MINB 3OIGA 3GUVA 2A1IA 4PU0A 2G09A 5EP3A 5K0FA 1JZQA 1XQ9A 3L77A 1MT3A 2ODTX 4JI1B 1RRVA 3WO0A 2P2NA 2WIDA 3DGFC 4EVQA 1MOZA 1TKCA 2ID9A 5DU2A 3QXCA 2HNKA 2VJMB 2ZE6A 4LRXA 1KZYC 1YK1A 3LXXA 4DLZA 5LIPA 2HW8A 1RACA 1SA0A 3L1UA 4C0WA 1JDPA 1X8XA 1XCJA 5KMGB 1PV1A 1I3NA 3PWSA 1X7WB 3FA2A 4MVXA 2GYVA 1U8CB 4CM9D 2P78A 5EWLB 2HK9A 2Z09A 4AO8A 4ARSA 4LSMA 3W5AA 3WLLA 1Z6TA 4QU8A 4A6EA 5C52B 4G84A 2XUKA 5CYPA 4P36A 1Y1QA 3ECCA 4UXJA 1LW6E 2PVCA 2QENA 3LCVB 4DUGD 1ZOSA 3PIIA 2GAIA 3WQSB 3R0JA 1RP7A 3L0BA 2NSYA 4NAHA 2HA5A 1IBSA 1R6AA 2WSBA 4HYQA 1DPFA 3SVZA 5DTJA 1Q1NA 5KOIA 2I7DA 2WMOB 3DM5A 3T1YB 4IDGA 4LN1A 5AVXA 3WLMA 3WZLA 3PIRA 3RSZA 1MW9X 4WZBA 5D01A 3ZCSA 2W93A 2J5QA 4K40A 1L8LA 1U2PA 5K3SA 3CFYA 1PZFA 2Y1GA 1NVDA 1RQ7A 4OK5A 1QHFA 3EIXA 4X61A 1GSOA 2VP2A 1GQRA 3E9YA 3UV7A 1N4DA 4NTZA 3G2NA 3HQ4O 5BN4A 5L51A 1Y8ZA 4F8JA 3THOA 4ZQBA 4O0LA 3ZHVA 1V26A 1OE0A 3LOPA 1HKHA 5KKAA 5KTKA 4RK7A 4B6FA 1T8YA 4KTVE 4JB3A 621PA 2IE0A 3FDIA 2Q4RA 4RCYA 2AOUA 5FBZA 2DETA 3GLGB 2XNKA 4U7JA 4S1OA 3T5MA 1HC7A 4CUJA 1J2TA 4DZTA 4DCSA 1B2RA 1M2NA 3PB3A 3JX9A 4P80A 1PTJC 4ZEOA 3WNBA 5EE5B 3H65A 4A8JC 5CFOA 3D2BA 4BY9E 3DWEX 1AU9A 5CVEA 1DIBA 1DAFA 2H18A 4U4AA 3CLRD 3W34A 4PXAA 3LWNA 5BQ3A 1PR2A 3LGXA 2C9ZA 2F2TA 5G1OA 4C03A 1HMPA 4GUAA 3EC2A 3MSCA 1UOOA 4R05A 5BSFA 1P0MA 3ZVLA 1IOLA 1KIAA 1J99A 4QUIA 1OC2A 2EBHX 1ABBA 1QH1A 5EGNA 4YCBA 4ZTZB 3QXJA 3IXQA 4JQYA 3S0JA 3GEGA 3HXTA 1Q50A 3ONVA 1EIZA 1OUMA 3GQVA 5EKUA 3ZHBA 3E81A 5G4KB 1NNUA 1P0QA 3FPGA 4RIEA 4ZVVA 5I9BA 2V0NA 4EHLA 2ZYGA 1SC6A 2HA2A 1KZ1A 1I0LA 2JIBA 3FJ1A 2AJBA 4GLFA 4QGFA 2QNBA 4ES6A 1U2QA 1ACMA 3MM4A 2YS6A 3G89A 3TAXA 4OYYA 3UJ8A 1A2KC 4KQXA 5DW3A 3ORYA 4YMWA 2FFQA 2W2PA 3KSZO 1S8AA 1NAHA 3KXKA 4GPBA 4TXJA 3IQFA 4G1BA 2M1XA 3OLWA 2AW3A 2X23A 4D8XA 4BYGA 2IVFA 5H3LA 4DZZA 3AI2A 3FPHA 3JRNA 2O2YA 2F48A 3CUVA 5K8LA 5F76A 1O94C 1LX6A 2H4YA 2VDPB 3JVUA 2X0NA 3NAGA 3K2EA 5ETJA 4AQDA 1JEAA 3CURA 3BXHA 4BU1A 2RH9B 2Y0PA 4NBNA 1GGJA 2V7VA 4MP6A 3IAXA 4J0IA 3AF3A 4HX2A 1RHQA 1CPYA 3DWIA 3FX2A 3GCGA 3QPUA 3UQZA 4Q1CA 3IT1A 4LRWA 4MIKA 4YRDA 2XRYA 1A72A 3AJDA 2QRQA 5J4HA 3SIRA 4GQAA 2GPSA 4MYDA 3KKPA 4OB6A 3RC3A 2G9UA 6ADHA 2A9PA 1BSVA 4L27A 4FOLA 3CLSC 1HEYA 4X6YA 3HJAA 1KVSA 3ZOZA 1G4UR 5JXJA 4MUIA 2ACKA 3O8LA 3PXCX 4TS9A 1UMDB 1UXIA 2FLWA 1GQQA 4I1RA 5CA1A 3KZOA 4J1QA 3K0EA 3NWEA 4GFDA 3JYPA 1KOFA 2C8KA 2QJOA 3SXUA 4F4UA 2FE4A 1WW3A 2WJ3A 4CFSA 3DCYA 4E7PA 4B2LA 1K4YA 2VNJA 3DFKA 1R18A 4KXWA 3C4JA 1XP5A 2HTFA 4R7TA 3WP1B 1MPXA 1VE5A 4L4YA 2CVPA 3VBEA 1Z5UA 3INYA 4GP7A 4QRHA 3E7PA 5EIBD 2ESRA 3VAYA 1RWVA 3RC1A 1JIXA 4JBYA 5DIFA 3VZSA 1QNFA 4O2AB 1P4RA 3NHFA 4WADA 2VPYA 2QLFA 1L3IA 1WVGA 4Q4JA 4TYMA 1ATIA 2ZRAA 4KZPA 3LDAA 1WHTA 4J7XA 4EB6B 1XDGA 3NW9A 4RO0A 2J33A 1YCFA 5C5EA 2V7EA 2AE1A 2QGFA 3LUGA 3R8XA 3TW0A 4CIYA 4OLHA 4G4IA 1YQEA 3G02A 4FZVA 3AMVA 1L7RA 3KKKA 4RV9A 5JS6A 4AIIA 4XVCA 1OASA 2NWQA 4FDUA 2DTXA 5DMHA 2IITA 5GV7A 5LQMA 3DTVA 1A2QA 1W35A 5H83A 3LCUA 3NVMB 4EX7A 1XDSA 4YRNA 3D4IA 3UY4A 2DT5A 4NG4A 3HACA 1JYSA 1MRZA 5BSVA 4OD0A 2ZB4A 1RXUA 2D0PB 4RIFA 1YZNA 5TB5A 1NXSA 3RUEA 1AGNA 5FNVF 3UAWA 1N7IA 2XB4A 5CVUA 3PNPA 4CF3A 3M81A 2Y66A 4PHFA 1U7DA 1HNXB 4EO4A 1EFHA 3QEJA 4UHFA 3UMSA 2Z1DA 1UZMA 2NZ8A 4WAUA 4PG8A 1EXDA 4CKEA 4KWHA 4JK3A 2I66A 5FCDA 3QX8A 1CHNA 3HMKA 3PQEA 3LUCA 3CG0A 3SHQA 4YXFA 1W4AA 5JVDB 1YE8A 3SLGA 2PTGA 4QEKA 1EG2A 2EEPA 3MTAA 4D4KA 2REXB 3RIHA 2ODPA 3DMDA 5DNDA 5LKAA 2I22A 2Z2IA 4MUEA 5BQPA 2PIDA 1UKAA 2WILA 3FOZA 4B3MB 3BORA 1Y8RA 4ND6A 5FJJA 2J4FA 4D57A 1YUMA 5FULA 4D80A 5J2UF 3BE8A 5AYVA 1R4ZA 2R1VA 2VA8A 5CNJA 2H63A 3ZY6A 3SJCA