1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Serine protease
molecule keywords SERINE PROTEASE PB92
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
1KDZA 5CW1A 1GT91 5FFNA 4Z2AA 1SUCA 3DVQX 4WOBA 2PRKA 2X8JA 3CNQS 1C9NA 1Y4DE 2W2PA 2ZRQA 2ZWOA 5JXHA 3SQOA 1XF1A 1PJ8A 2PMWB 1C3LA 1AVTA 1P7WA 2Z2YA 3A3OA 3DE5X 1SCJA 3LPDA 4HX2A 4YN3A 1SUEA 2E1PA 1A2QA 2WV7A 3LPCA 4LVNA 1JEAA 3LPAA 1OYOA 4M1ZA 2TECE 3H42B 1KE1A 3F49S 1GTJ1 1OYVA 1UBNA 2SICE 2WUVA 4KPGA 4AKTA 1WMFA 5FBZA 4CFZA 1SCNE 3WHIA 1TMGE 1TM1E 2IXTA 2Z56A 1DBIA 2Z58A 3A3NA 1T1GA 2V8BA 2W2NA 4FONA 1Y48E 1DUIA 2B6NA 5SICE 3BX1A 1Y1KE 3BPSA 4GI3A 1GA4A 2DUJA 3QFHA 1Y3BE 1TK2A 1SVNA 1NLUA 1YJCA 1SCAA 3T41A 1P7VA 3TECE 1V6CA 4OMDA 5FAXA 2SECE 2HPZA 3EDYA 4LVOA 1GTL1 4RYDA 4AKSA 1BE8A 4H6XA 4OV6B 1SH7A 1BFUA 3DYBA 1AK9A 1SPBS 1SUAA 3DDZX 5ARDA 5JXIA 1OT5A 2W2MA 4JP8A 1ZVKA 1TM4E 1TM3E 2PWBA 2Z2XA 2DQKA 1Y3DE 1BH6A 1SIBE 2SBTA 2WWTA 3I30X 3Q40A 1KE2A 1PTKA 2XRMA 1KDYA 5JMOA 1AQNA 4ZARA 2HD4A 1R0RE 3VV3A 4BWGA 1C9JA 2W2QA 4KB5A 1SELA 5JXGA 1CSEE 1SN7A 2P4EA 3DE2X 1TECE 3EE6A 1WMEA 1YJBA 3GT4A 3GCXA 3OSZA 4HVLA 1IC6A 1R64A 3D9QX 1PFGA 3TI7A 1ST3A 3DVSX 1AH2A 1Y34E 2GKOA 5AVJA 4C3UA 3VTAA 1S02A 3D43A 2WUWE 4NMXB 3VV2A 3BGOS 1WSDA 3VHQA 3WQBA 3LXUX 1YJAA 3DW1X 2Z57A 3UNXA 3TI9A 1Y9ZA 2PKCA 1SCDA 1SIOA 4DZTA 5JXJA 1MPTA 1VSBA 3F7MA 1P8JA 1IAVA 1BJRE 4K8RB 4NE7A 4OMCA 4J94A 5B1DA 4B5LA 1T1IA 4ZOQI 1SBNE 5AVKA 1SUBA 1R6VA 1ST2A 1Y3FE 2ID8A 2SNIE 1TO1E 2PWAA 3AJ9A 1GA1A 1SBCA 5AMXA 4CFYA 1S2NA 3AFGA 5I9SA 1LW6E 1SBIA 1TO2E 2X8JB 3DE4X 2Z30A 4I0WB 4KG7A 1WVMA 3Q5GA 2ZWPA 3QMPA 3AJ8A 2W2OA 5ARCA 3EIFA 1SUPA 1SBHA 2G4VA 4MZDA 3F7OA 3WIUA 2ID4A 3VYVA 5B1EA 1EGQA 1TM5E 5K7SA 3DWEX 4DJ5X 1T1EA 1BE6A 1THMA 1V5IA 1GCIA 1Q5PA 1Y3CE 1NDUA 1YU6A 2IY9A 3GCWA 4C3VA 3PRKE 3DE7X 3DVRX 3A3PA 2ST1A 2PYZA 1PEKE 3DE6X 3DW3X 1S01A 4H6WA 2XTJA 1Y33E 3HJRA 1AU9A 4DWWA 3ZXXA 4H6VA 3I37X 3P5BA 3WIVA 2QTWB 1HT3A 1TM7E 1CNMA 4WOCA 1WMDA 1MEEA 3DE1X 1SCBA 1AV7A 2DP4E 1KDVA 2Z2ZA 1GA6A 2PQ2A 1GTG1 1BFKA 4CG0A 1SUDA 1AF4A 3I34X 3SICE 3DE3X 3GT3A 3DE0X 1GNVA 3L1KA 1GNSA 1Y4AE 3PTLA 3I2YX 4NE9A 3VSBA 5ARBA 3QTLA 1NDQA 1ZVJA 3ZXYA 1SBTA 3CO0S 1SIUA 1EA7A 5AQEA 1C9MA
chains in the Genus database with same CATH superfamily
2H0AA 2YW9A 3EH2A 1OFVA 2G5CA 1A7UA 1NU8A 1Y37A 2R65A 3ELYA 3W3AA 3FB1A 5LPNA 4YJHA 5DWVA 1HPLA 4TX1A 3LKDA 2J5RA 3DDWA 1A4XA 4ZARA 2GEJA 3PP8A 5AOAA 5JU6A 2P91A 1YQUA 1FTWA 1KAQA 1V4NA 1DBPA 2ZJYA 3KQVA 3N1UA 2WILA 4GE3A 1RXIA 3N8NA 4JHLA 4Y2UA 5KWEA 4NP6A 3MGCA 2O8DA 3ZV4A 4LWPA 1HLDA 5EI5A 4MYUA 1MB2A 2RIRA 2E7ZA 1MMFB 4NRDA 2XCQA 3IHWA 1SVKA 1P4RA 1NLUA 3H8WA 4HEHA 4IBOA 5T7BA 2WPDD 4FZVA 2QYTA 2B98A 1VIMA 1UUFA 4O4HF 4Y2YA 1UR5A 3AHHA 3KSDO 3ANSA 4CEIA 3C8HA 2V45A 1CIPA 1C1HA 3TOXA 1FUEA 1E5LA 1SPBS 4WW0A 1KK1A 2ZB3A 1YRQA 4XQEA 4FI3C 1NW9B 3UAXA 3MWYW 3BDIA 3EBOA 5CURA 1SKYE 2E18A 1GG9A 4J0FA 4QASA 4YDQA 4JXXA 3ROGA 3PHLA 4C88A 4X60A 5F23A 4A27A 1E61A 4MA4A 3AVPA 3V2UA 2A57A 1U7OA 2DBRA 1UM9A 2APJA 4BVFA 1P2SA 1I7SB 3RJTA 2YIDA 3I32A 1VZ3A 3GK3A 2PUWA 4QUGA 1AQUA 3RU2A 3NHZA 1S2DA 1F12A 1NV8A 2J6HA 3BUSA 2B36A 3FLEA 5AKHA 4CETA 4G6ZA 5IZCA 1IZ0A 5JJ5A 5JSHA 2AG0A 5FEUA 2W6JD 3AYZB 4BE9A 2X9NA 4NMMA 1XDZA 2LDXA 2RHGB 3BGWA 4K46A 3UANA 3JPWA 3R9XA 2QQEA 4M53A 3RTGA 2ZUCA 1K66A 3OF3A 2ZRGA 1LZLA 3RC1A 3ETCA 4GX2A 5DK6A 1MV5A 3MXTA 1AHPA 2C9CA 3BWXA 2CVOA 4AB1A 1QZXA 4J1TA 2O3JA 1KORA 2AWOA 3VDRA 5IXSA 5CCXA 3ZDCA 1MO6A 3U44B 1LW6E 1PKEA 4LXGA 4NXMB 3STHA 1FFCA 1AKWA 3RS0A 4C6TA 3FBTA 3KAKA 4XM2A 3EXIB 2BBOA 2QUHA 2VJMA 3AY7A 4BN5A 2M6RA 2C4WA 1WMBA 1K4YA 2PGIA 1N7GA 2PZAA 3ETDA 3FPLA 4CIVA 1RHJA 5K8VA 1RAIA 1O6FA 5HBRA 1XEAA 2WNIA 1BQEA 1B76A 1E5QA 3TB4A 3CW9A 4O4LB 2O3UA 2WQ7A 2JVJA 4UHBA 4UNQA 1M10A 2H7CA 2OLKA 2CVHA 1HMYA 3PFWO 4G4GA 2SHKA 3CZQA 3ZN2A 3HNPA 4RF4A 2WTMA 3AF3A 3BQNB 4MMXB 2GZRA 4UHKA 2PA3A 1OZHA 3MZ0A 5C32A 1HT3A 2H4ZA 2VA9A 3L1HA 4C30A 5KOHA 3VPBA 4AY6A 3RRJA 4QUJA 3LXMA 1QU3A 3N2LA 3TD2A 3BKXA 3H2HA 1YO6A 3SR0A 3OCJA 3WWYA 5HR5A 3OZAA 4ZAWA 2JLRA 1JTVA 1S8FA 1LSSA 1N2ZA 3ONNA 3PFIA 4IDEA 4Z0HO 2CCKA 4UBOA 1YB5A 2OD9A 3E7XA 3R4CA 1AV6A 4I55B 2W7TA 1XZIA 4HAXA 3NYQA 4CCYB 2HNBA 2QL5A 5A7GA 3BWCA 1K7EB 1F38A 1Y6ZA 4RXMA 4DMGA 2J07A 1RKUA 1BO6A 3Q3VA 1A77A 1SURA 1WHSA 3N2GB 4WXYB 1DP4A 5TT0A 3ZDYB 4YYEA 1J9ZA 4FMCF 1EP1B 3A3OA 1ZNYA 3T61A 4DCSA 1BCRA 3HVJA 1PG5A 4K6KA 4ATNA 2P9BA 5JH7B 3FMGA 3OT4A 1EK0A 3EX7C 3PEWA 4DUGA 3DTTA 1PZGA 1U8AA 1SA0A 3V55A 1M6EX 4YDSA 3KNZA 3FWNA 2HCBA 3ESYA 3KQTA 5EWJA 3VOTA 1G2IA 4CTNA 2J85A 4XA8A 5F9MA 2GLXA 1BNCA 2ISQA 5JY1A 2Y0CA 4P86A 3T41A 2EFYA 3KRTA 4HQNA 1WXDA 1NVUQ 1XNQB 1X2BA 1GXSB 5GM2A 1G3IA 1VBFA 1U0SY 4LV8B 2FRDA 3V7FA 4ZAZA 1JR3D 4NOLA 4DNQA 4J29A 5LMCA 1P1KA 2Z9DA 3ECCA 3ZHVA 4D3ZA 3KQMA 4QYTA 2GHRA 4MV4A 1KZGB 1PL6A 2ASEA 1MLDA 3MFQA 3ZVLA 4JJZA 4JQCA 5GQSA 2B8WA 5M7EA 1YHYA 2J0UB 1VKZA 3IMEA 2IYWA 1IATA 4P83A 2CNOA 1C9JA 4EYOA 3I5XA 1TD1A 3D7SA 4H0CA 1EDOA 2WFAA 1E1RD 1N0WA 1EI9A 3JQBA 3NAZA 3EUWA 3QBTA 5LYJA 3R74A 4C87A 2PD6A 3EXFA 4TYWA 1VECA 2DSNA 1MX9A 1NUPA 3LUDA 5M3BA 3RSGA 5BVGB 3I23A 3WIOA 3GLIA 3FWPA 4D97A 4Z51A 1UCFA 1T2AA 1E18A 2JK1A 1HNXB 2E9SA 3IOYA 2C4HA 3H5IA 1BDIA 4EFDA 1XDGA 4XQGA 3RYCB 1Q7GA 1YDHA 3V4OA 1Z6TA 4P4NA 1OHHA 2Z9BA 3P27A 2J0EA 4YRFA 5HF5A 3H6GA 3ILXA 3WFJA 4NU0A 1BDHA 5JI2E 3HKCB 4XARA 1NXSA 5E3IA 1FMFA 4BO2A 4J0CA 3TBFA 2Y3IA 3O9ZA 5JANA 5TVGA 5K45A 1HDOA 3DPUA 3C97A 4FDAA 5KHLB 1P4GA 3A14A 1AK1A 3H2KA 1VJTA 2ZJ6A 3UPDA 1JWLA 3IUEA 3VYTB 1YDFA 2C8LA 2BF4A 3VPSA 5AW7A 4UOQA 5KYTA 2O19A 5DPMA 5FNZA 3V8VA 3HK2A 1EFLA 5LOVF 2HU5A 2IXEA 3WKAA 5L9AA 3H84A 1PK9A 5TMPA 1TZ2A 1K5GA 2XJ9A 3LCRA 1S0UA 2XQJA 3U3XA 3NJ4A 4BNMA 5ABPA 1CJKC 1AXRA 4R8VA 1MAVA 5HF6A 4DLNA 2VLBA 1G66A 1N57A 2JZOA 2D4AA 2W6JA 3IBCA 3PSHA 1X7ZA 1XK7A 4F72A 1XZFA 4YJKA 3JYLA 3VI4B 2YWGA 2XE6A 4BY9E 4Q82A 2GM4A 1JL3A 1W30A 5B6JA 1G64A 1QGYA 3KT0A 1E9SA 4HZUA 2HWWA 4O4HA 1U5BB 3QU9A 3I04M 1CQJB 4P7JA 1ATIA 3KKZA 3M6MD 5ELLA 5CA1B 2H2FA 1KAEA 3U13A 5K6AA 3M7IA 1GNVA 5H3LA 4NE9A 2GSDA 4CLDA 1Y89A 3BILA 1SBTA 1RI4A 3W3AH 5BV1A 5HJ5A 4TMFA 3ROFA 5DI9A 1CK4A 1K9VF 3UMVA 3U6BA 3QXHA 4OSEA 3D3EA 4RD1A 1TCVA 1IPEA 1XRLA 1X1SA 3B12A 2A9KA 1DJPA 3Q7RA 2IEBA 5IXJA 1UBMS 4B6JA 3LTNC 3EY4A 3R3JA 4X45A 1Z35A 5HG0A 1VJ5A 3FHLA 3RK0A 3EGIA 1SCJA 2NZ2A 4FNOA 3U6KA 4NZPA 3LPCA 5KQRA 3O03A 1XR3A 3PGJA 2PRYA 2OWEA 3UK1A 3L8HA 3E82A 1IXZA 4DL9A 3RRMA 3H9QA 4YJ2A 4D25A 3K2BA 1EP2B 1JG3A 1K6MA 2F1RA 4I55F 2W2NA 4KDFA 3KHTA 4ZOAA 5I9MA 4BYGA 2IHYA 4LIPD 1Y5MA 3OQIB 1PBTA 1T36A 2RBGA 1FFBA 4FHEA 4LZPA 4E1AA 5SYAA 3FOAA 2C8JA 2FN3A 3GH1A 5LU9A 4HD8A 3SFZA 5LB2A 3NHJA 4EF5A 3GAAA 1L1QA 2E89A 5CXSA 1FFGA 3O3MB 2BDUA 4UPDA 2XRYA 4NCXA 4ZGBA 4Q9LA 4QICA 4BWFB 2XYGA 1Z2PX 1V8PA 2WTXA 1UOPA 4V39A 2RBKA 3EVBA 4LZLA 5BXYA 1LDGA 1TO6A 3R3WA 1N2CA 1FJ2A 2B4RO 3AKCA 4RTOA 1T8PA 1QJ4A 3ZZMA 4JB0A 1TEHA 3IELA 4PSKA 1E7MA 3IKTA 1MJFA 4AZ0B 4Y7DA 4HRVA 2CZQA 2P2NA 1RWVA 1A50B 1G7CA 1TMKA 3PQDA 1E1QD 2RH4A 4QTZA 5IT4A 4W5TA 1GJRA 4BO4A 1KPHA 1VL8A 4BGEA 2OAQ1 2RH9B 4FEGA 4DXAA 1P1BA 2WM3A 3I9OA 3KUDA 4DMKA 1N2BA 1Z39A 3KK0A 2XSZD 3CR8A 3KQSA 4CV2A 5L3QA 3PNVA 1C9YA 4CJXA 1JAZA 4MI9A 1KH2A 3CLHA 2VCHA 1R6AA 2HUNA 3OECA 3NOOA 1TLLA 2O2JA 4R1TA 5F2KA 2BSAA 2VATA 4GAEA 3AUKA 4WLFA 4WBNA 3ZE8A 4ZVRA 2HDOA 5CB4B 2GNAA 1RJ9A 4TQUS 2WIBA 5TPWA 2J6IA 3GMSA 2F9LA 3KE8A 1BW9B 3FJYA 2VJNA 4PZPA 5E4TA 2ODTX 1RWKA 2QR3A 1TA9A 2RHJA 3H1FA 1DRUA 3LP5A 1D6MA 1DKMA 3SEQA 1RQXA 1KDRA 3I64A 3KQWA 4OKIA 1YB2A 4L8VA 2HV8A 3LLVA 2XNSA 3BE4A 3HDYA 1YL7A 2AFIE 4Z4CA 4OQFA 4KFRA 4F5DA 2UVPA 4V2IA 3AV3A 3DJFA 1VMEA 4X20B 3ZVRA 1JNXX 1NBMD 3EC2A 1L3BA 3EASA 5KKCA 3MINB 1H2XA 4C3VA 3G8CA 3EMVA 4LI3X 2PH1A 3P4XA 1LJ8A 4IJKA 5T67A 4H16A 3UK7A 4FWTA 1IY2A 4GVPA 3YASA 4B31A 1XYVA 3K6SB 4JR0A 3THYB 4OQMA 1Z3IX 5IH7A 3RTAA 2Q7XA 4PLHA 4EDFA 4DILA 1NOIA 4CEJA 3KZCA 4IRMA 4CMKA 1N2CE 2DP4E 1VQ1A 5LOVB 4X62B 2C3MA 3C5VA 2DFKB 2YWBA 3RSCA 2RGGA 4KQXA 3ZNOA 2R8RA 1H0RA 3S2UA 4FEEA 3DTYA 1F14A 2VJQA 4MCHA 5TS2A 3L7CA 1ZNWA 4CF5A 3ZVMA 2IUTA 1MP0A 3UN1A 1VHDA 3NC1C 4LXUA 5JBQA 5I48A 1JDZA 1GLGA 2FRXA 3LL4A 4TTTS 4QYIA 4YACA 3BWYA 4IFEA 3LC0A 3SXPA 4EJ6A 3IP3A 1ILEA 3Q72A 4ZALA 1T3GA 3OZTA 4LYEA 3PK0A 3ZNQA 2A58A 3FTCA 3OLQA 5E38A 3V2IA 4C0QC 1ZIDA 1AZSC 1YQ9A 3NVAA 4WXPA 3LVBA 2FPRA 2NXJA 3TD9A 1OROA 2QE7A 4ZHQA 5KJCA 4IO1A 1E5DA 1KVTA 3FVTA 3RUFA 3HEBA 4DYDA 1S8NA 3V6MA 3AP3A 5E4JA 3CN9A 4NX2A 4JT9A 1HFEL 4RABA 5EXEA 3SGLA 5KYYA 1OGYA 1HE5A 1RIFA 3JARA 4HUJA 2D1SA 3EAGA 4N9WA 4P5PA 3C45A 5AW0A 5KPDA 3S1SA 1O9BA 2EP5A 3LPLA 1DC6A 2XVZA 4Y2TA 4U9HS 1ZONA 2D0PB 2J7PD 2YQZA 5EMJA 2Q6LA 3R9KA 3V1LA 5IDQA 1T26A 4S0ZA 5JISA 4JEHA 1SVLA 1PK8A 3M6UA 2FSUA 5ALEA 4V0NA 1EVZA 2PUBA 1JHXA 2JJ8A 3EA4A 4EH1A 1DLJA 4EAAA 1DO0A 4QC2A 2P5TB 3NBZC 5LOVA 1J2JA 1K0UA 1JT9A 1WUJS 1II8A 1QVZA 3P0IA 2RH8A 4PLYA 1R0RE 4JI2B 1IBMB 2C9OA 2NU9B 4RSHA 2IYQA 2CY0A 2XMQA 2XQFA 2H5LA 3DF9A 3I01M 2AMLA 2AZDA 3MJ4A 3NX4A 2LXNA 4FGUA 5KBYA 4EPVA 1A5SB 1TTTA 3AVQA 3CUKA 3FGNA 3QPDA 4KMOA 2P0EA 2WK1A 3WXMA 3FSJX 1N8NA 5K05A 1WBBA 2FW8A 2GKOA 4Q9IA 3UYKA 4X7RA 3T4PA 4I9NA 1E1MA 3DV2A 5CX4A 4M87A 3CZAA 3BGOS 3GN2A 4XWOA 5E6UB 1MB9A 4DWVA 4I6EA 2GUWA 5C1DA 2BM9A 4I4IA 2IS6A 3P94A 2VBGA 3F3KA 5EE0A 2YV4A 1EH5A 1CLEA 1EJ2A 1TO1E 2H29A 5KVCA 4IRXA 4M8IA 3KTAB 5KNBA 1JKIA 2DR2A 4ZWNA 4JI7B 5EQDA 4F97A 3SYKA 2GFQA 4GHWA 3JQFA 3VAZA 1OFGA 4TM7A 4I1RA 4MWDA 2V7QA 3WWOA 3T3NA 2VDWA 3ZHUA 5GJVC 3GLHA 1JSZA 2B5OA 3OIYA 4EMSA 2H1OA 4Z1MD 1YKGA 1J09A 3FA2A 3EA0A 5E7MA 4ANFA 2VK2A 4ZQCB 2LD4A 3PQ2A 1CF2O 2PL1A 5AJTA 2I6TA 5C1OA 1ESDA 3ZDDA 1G41A 2NU9A 1DCFA 2PQMA 2I4NA 3LUGA 4JSYA 4KQFA 2R6FA 2UUCB 4MWBA 5FUXA 2FQQA 2CHVA 4U7PB 4RADA 2W6IA 4CHGA 2YJ4A 2BTEA 1U3CA 2ZI6A 2MSLA 3Q7QA 1Q2XA 4B74A 1TT5B 4A73A 1GSIA 1ZR2A 3N2KB 5SY9A 3ZCTA 4PNHA 1QB7A 5JO0A 1K1EA 5EQJB 3MUNA 4KACA 2M1ZA 4DWJA 3VH2A 2DUWA 1TQ6A 3M9XA 3WYAA 6REQB 4QGHA 4C0SA 3FZYA 2CC2A 421PA 1CYEA 2JK0A 4HATA 1VJ0A 2GS9A 5U1PA 5A5DA 1KTVA 2HDHA 4BJ1A 3QXJA 4LS3A 4DJFC 3VKGA 1PK7A 4ICIA 4C05A 4V03A 4WFKA 1RBMA 2AW3A 5HMLA 3T95A 2R7NA 2SCUB 4EHBA 1P2BA 3JQGB 1IHPA 3LS2A 2VNHA 4JROA 3V8EA 3IBSA 4A1FA 4YMUA 1C3JA 1XTZA 3EZLA 3PENA 3T3DA 1TF5A 1F06A 3L4EA 4O5AA 2WB4A 4DIFA 2I2BA 3EFHA 1HL7A 4OEHA 3NRJA 4C14A 4G4JA 3PHIA 2C4KA 5CDTA 3O38A 4KXQA 4I9FA 1UEXC 3BMNB 3EVNA 3I2IA 1M1YE 3N2ZB 4O1HA 4RXUA 1N2JA 5ARDA 4GEKA 1O1YA 1U0LA 2J9YB 2IELA 1KO8A 2JGDB 2QJOA 1EMDA 3NBUA 4Z0PA 4XYEA 3GF4A 2IPNA 3B36A 3RVLA 3UK6A 3PA6A 3LRXA 4IHQA 1EDEA 4C4PA 1QG0A 2ZUVA 1JAHA 2EVWX 2ATIA 2RGDA 2PH3A 2YUTA 3K5WA 4HDRB 2QT1A 3AQ4A 2QJWA 4KUHA 4C89A 4PLGA 3I0NA 3JYHA 3DOIA 3DXFA 4HVLA 1ID8A 4RULA 2TMYA 5DGDA 3GLFA 1ZQ1A 3UVEA 2YYYA 3VO1A 4FJ1A 2Y1OA 5LB4A 3AK4A 2JIRA 2O0MA 3I2JA 4KQMA 3E9CA 2NUAA 1OI2A 3IQGX 2R5NA 3S55A 1V5GA 3UV6A 4FEAA 5GGXA 1G5RA 2F55A 4TTRA 3SF8B 4C7JA 1LBQA 2F8MA 1DWUA 3JQAD 1QCDA 3AB8A 2Q99A 2G5TA 3HFRA 4CKBB 4PCLA 4XOIA 1K97A 3ZCQA 4JSTA 4JXJA 4I1PA 2O7RA 3PC8C 1Y3FE 2B82A 3RREA 4KPUB 3ZX4A 3C7DB 3E9EA 3DCYA 4BO9A 4COKA 4E5DA 1TO2E 2VUUA 2QD1A 4GOMD 2PUCA 1QRSA 4PRLA 1AF7A 1UANA 4TROA 2R1TB 3TZEA 3KVRA 4Q66C 3TLBA 1MC1A 3SEAA 2C9YA 2O1WA 4ZO4A 2XXAB 2ZKIA 5A6SA 1V0JA 3DMTA 4C7OB 5EZYB 2IY9A 2Q9CA 3L8MA 2Q5EA 3EGEA 1QH1B 1VIAA 2B69A 1H42A 3H17A 4N3BA 5DM2A 4CGZA 2DYKA 2V5UA 3GRCA 3ZHSA 4ZJZA 4QELA 1MO5A 3P9RA 1C7RA 3KR9A 1NUTA 2KSQA 3VPHA 1VLQA 2WVGA 1VSTA 4UCQA 1BOOA 1Z07A 2GBFA 4RPJA 2Q7DA 5CGZA 1QG4A 1T8UA 4RPLA 4AL4A 3C8MA 3DEIA 4E13A 1FPQA 2HUPA 2EGHA 3PFGA 4D9CA 5L4SA 2BZ1A 3HM9A 4EA7A 1EA7A 1M3SA 1V3QE 1NUSA 1YXMA 1Y9AA 1XXHE 1MQ8B 4WZAB 5AQEA 2AVNA 3AP1A 3DEZA 3GUVA 3B9BA 1RLJA 5EGNA 1X8XA 4CU2A 4EGJA 4CXMA 3C3KA 4WCVA 1HV8A 5ECWA 2WIKA 1L4KA 5AI4A 4DCCA 5H68A 4HDOB 2IF2A 3GX1A 1Z4OA 5H82A 4XGQA 2QM3A 2QA5A 2V65A 2XKJE 1K6IA 3T0IA 3CXRA 5B1HA 2JGFA 4IGFA 2LKDA 1M6VA 1E1YA 4R1PA 1CULC 3AFIA 3KJGA 3CLTD 4LE2A 1KERA 1ZY2A 5B5SA 4Z7QB 5MGNA 2GD6A 4FONA 1AS0A 1FNNA 1T1GA 1ULHA 5JRDS 1WXWA 4G5FA 1JVSA 2ZYIA 2PYDA 1WLYA 1YR3A 4P0TA 5SYNA 2E48A 1NBIA 3F6SA 2CLLB 4ME6A 2IYXA 4JBLA 1MFZA 1C7QA 1Z37A 2R8OA 4OHVA 5LCXA 2WHEA 3W06A 4MR8B 1EVKA 1Y42X 1VZ2A 1H1DA 5LXTB 1HOXA 3TN7A 3V7NA 1LTQA 4DKJA 3SC2B 2FPGB 3C6ZA 4II7A 2V59A 4UZFA 3LOQA 2HTFA 1HQKA 3U4CA 4CQMB 4B34A 1CJTC 3K5PA 5JS2A 1PR5A 5HQJA 4LF8B 3HP7A 1ID1A 1ISSA 2A88A 5LP6F 4ZTZB 1UDAA 3K0CA 1TUIA 5DXJA 2OGSA 3KU1A 3DB1A 1YJBA 1BVRA 3EG9B 1PRYA 1IOWA 1UMDA 2XODA 1BXRB 3FMVA 5JPIA 4UBIA 2CL6X 1U0TA 2ZUWA 4H59A 1Z5NA 1PHPA 4PN3A 4M0DA 1MA3A 1SXIA 1AMOA 4KKVA 3VDQA 1VLMA 2WUEA 3W34A 4GPIB 5EZ5A 4D6XA 1I2BA 1SXQA 1FDOA 2VT6A 3PQFA 4N82A 1W1UA 4H0FA 4J2OA 5JH7A 3T1YB 2JW5A 3QEMA 3VU0A 4ZOLB 2YN2A 1A7JA 3RYIA 4F21A 3A0RB 5HE8A 4J94A 3ASZA 2WF6A 2YHBA 4ZOQI 3G89A 1ZU5A 4PCAA 4URXR 5LQJA 2CL7X 2JJ2A 4U7TB 2ECPA 3I6QA 5FPTA 3ZUGA 4XWKA 4B0OA 3DLHA 1DEOA 2FWPA 3K8QA 3U37A 2QL6A 3MK31 2X19A 4AZSA 3MLAA 1IUKA 3PJRA 1SXPA 1R5BA 2R3SA 4L6AA 1G7RA 3B3QA 1NC3A 1DXQA 3JQEA 1WETA 1Z34A 1ZJ5A 3LCCA 3D4IA 1FFYA 1KU6A 4IVRA 2XNDA 2OFOA 3UK0A 3HUTA 4DSOA 1T1EA 5FOSA 4EG1A 3B78A 3PGMA 5C52B 3ACDA 2C3UA 4HZIA 2YHSA 4OQZA 5F33A 5DHUA 2XCOA 4EPYA 7MDHA 1L5HB 1FC0A 3ITEA 3I8XA 3UIEA 1DPFA 1THZA 3HMKA 1GL6A 2B2NA 3MOGA 4G37A 3AEYA 4C9BA 1HLPA 3C6XA 4EB6B 1QOQB 1OASA 4ZVKA 3AF1A 4IG9A 5B3KA 1JXMA 4KPYA 4ZOCA 4QOFA 1AUXA 3WOHA 3R9XB 2PRIA 4C08A 3PD7A 2QN9A 3HP1A 6LDHA 2X3FA 3L7YA 5EOVA 3ZCPA 2NU6A 3DP9A 4GZ5A 4B6QA 5A1TA 2X5KO 4BLRA 5AUOB 2V3CC 4KNYA 1Z6XA 3FE2A 3ST7A 2VHJA 3G8DA 1RYZA 4ALMA 4CMAA 3DVQX 1JF8A 3I62A 1IN7A 3WNBA 2QTFA 3K09C 2IY7A 2CBZA 4GNRA 2J87A 3OQMA 3SQOA 1BWSA 3MN1A 4JZKA 2PZJA 4M4SA 4HT3B 4Q7EA 1EB9A 4F7WA 3Q15C 3AL0C 3EC1A 4B6FA 3WGVA 1YZQA 3H75A 4AU1A 4DLKA 2Q1TA 2V7BA 3DHWC 1RBQA 3IHLA 3R0VA 4EYEA 4RTMA 1CJUC 1LTKA 1A82A 3C3MA 3C3CA 3G7SA 4C0BA 2A7XA 3E3NA 3D8TA 1RPZA 4WGGA 3S4YA 4J0JA 3H05A 1GPWB 2HBYA 4B33A 1BJKA 3BXFA 4CF3A 1K08A 3HI6A 3DL2A 1CUSA 3R40A 1XVLA 4A6PA 1D5WA 5TR9A 1YQQA 2A5DA 5KOYA 3PG5A 4PLCA 3HJUA 2CNNA 3PWKA 3LX4A 4P4UA 3HJTA 3S3TA 3TRHA 1PQUA 1WZUA 1XD9A 1H2RS 1E2FA 2P41A 1Z2AA 2FR8C 2QSZA 3EEYA 3GRUA 4UQOA 3VH3A 1WSWA 2F90A 2PKEA 4B80A 5EWLB 5DCYA 5BW8A 2V5AA 1P0PA 1RTKA 5I3ZA 1I6MA 2VUHB 2D2EA 2JFQA 1MEJA 3K1JA 3R5HA 4AS3A 4IINA 3ORRA 1I1HA 3IT3A 3N8HA 3QVLA 1X0VA 1STOA 5BY2A 1C8VB 1Q7CA 1QGUA 2HX1A 4EW6A 3D6NB 4BB9A 1Z5OA 2H0RA 3D2LA 5IABA 1ZVVA 4CUJA 3W77A 3GQVA 3V9AA 2OM6A 3AY0A 3RBZA 3T1QA 4H15A 1TUBB 3JVIA 2IXBA 3GYGA 4X8LA 1L8XA 5IJWA 2H3EA 5GP1A 2PKXA 1Y34E 3G0DA 2JJ2D 3NH6A 2J9FA 2IZZA 3RVNA 1KGSA 1PZHA 2XBUA 4BVHA 3M89A 4DIUA 3USZA 3U39A 1Z4LA 4QGSA 3X2EA 2H1RA 5DU2A 1IAVA 1AJEA 3GJ6A 4ZC8A 2W4IA 1SBNE 3H99A 1MF7A 2PBZA 2GEUA 1ZA1A 2R6DA 3EVZA 5AKGA 1AKTA 3BGIA 4B5KA 4HNUA 4ENRA 5FOQA 5AJVB 1H2EA 3VNQA 4TOIA 2BFBB 1O9HA 3ILSA 2AD1A 2WAMA 1SZCA 1V96A 1VKRA 1QH9A 1ZO8A 4J9VA 3QVKA 2GSWA 1O87A 2VWHA 2W58A 1YD7A 4JASB 5EPOA 4RNDB 5EAIA 1XPRA 4GXNA 1FJGB 3ZD8A 1W8IA 1R7RA 1H4TA 4PNZA 3WFIA 1YMUA 4D8UA 3H0CA 4Z4GA 3JQRA 1FLDA 2ZBGA 3FTEA 3RTCA 3Q7IA 4TXHA 3ZGNA 1VYHA 3LFTA 3K1ZA 4IIVA 2EDCA 1T9KA 3R3HA 4G3XA 4NCHA 4R5MA 2IY8A 2QW1A 1QG6A 1FZQA 1CNFA 1V39A 3BGDA 3RFTA 2VI5A 3QM1A 4HXYA 2PT5A 2Y1EA 5KYUA 5I9BA 5P21A 5K3FA 1NAHA 3NDPA 4PE5B 3ZIUA 4LJLA 1JR4A 4A36A 1LX7A 1K5HA 5NULA 1C9KA 2JCXA 3AJAA 4JC8A 2HA2A 3PJEA 2WSLA 5FHRA 4Q16A 3T1TA 5KOJA 3OLWA 2SICE 4PHCA 2P4HX 5HMMA 3CRRA 4JXZA 4CCSA 4BKQA 2CYAA 4MW9A 2I1LA 3BT7A 2QZ9A 2OG1A 3N0VA 4ZVUA 3TLJA 4CLRA 4BX2A 2ZEJA 5JXHA 3AYXB 1WY5A 3WNCA 1IJEA 1DC3A 4IOLA 3BK1A 1U0FA 2J41A 4JLJA 4JWKA 3WK6A 3TGWA 3N0TA 2MIIA 2BEJA 1UFRA 3DFKA 1O0CA 4YQYA 5BUSA 4M88A 3DOCA 2ZB7A 3ROKA 3VKVA 4HV4A 1JHRA 2G5PA 3P2YA 4CL3A 5DNEA 4HC4A 1BXGB 1Q1GA 3CE9A 3OQ6A 4II2A 2F1OA 1CZRA 1VIVA 1Y63A 3IEPA 2C7BA 4XYMA 1YHZA 2OMEA 4HAYA 3WA7A 1CZLA 3DVAA 4OHPA 1O5TA 4MR9B 3DEAA 1IN1A 1ZK0A 2XUZA 1U0JA 3JWJA 4Q1AA 3QF4B 3O73A 2COUA 3O8LA 3FAZA 2IW3A 2PUFA 5C7LO 4FNMA 5HKLA 4RD2A 3DTVD 2YW2A 1SQFA 1PDOA 3PHBE 1DMSA 4IJ5A 4W8HA 4Z54A 3A6LA 3DUFB 5AT1A 5F3WB 4UE6A 2HFJA 4FR2A 4AMVA 2NXEA 4OATA 1YRBA 1XZQA 1L7EA 2P8JA 2PR7A 2XHZA 2NO0A 3K6JA 3KSRA 3O3OB 4HWOA 1U28C 1OAAA 4FHZA 4IIXA 1F0KA 3DE2X 3IMFA 5CCEA 3SM3A 3O3NB 2WUFA 2Y2UA 3SLGA 4WCFA 3VOSA 4I6GA 2YZNA 1ABBA 3AIIA 3ND7A 1YOVB 1T2UA 4LJ7A 5EMKA 4UUAA 1GG2A 5BQ3A 2VSQA 3HKBB 2BKEA 2GDZA 2WWGA 4FD2A 1DADA 3CIFA 1QONA 3RVQA 3HACA 3B1JA 4LI0A 4G36A 5JSZB 3KBOA 4EABA 1PR0A 1XQ9A 3BE6A 3SC6A 2ZBUA 4FPXA 4NK5A 5EHIA 5A3VA 2I5PO 4S12A 2ZJBA 1YB7A 5B53A 1Q0TA 3PITA 2DRIA 3AETB 3MUOA 4QARA 4KUEA 1MORA 4JELA 3ZH2A 4B3CA 1C0LA 5FUQA 1HC7A 1G8JA 3P9NA 4K9OA 1GOTA 2WTAA 2GQ0A 5F12A 3GMTA 4XPIA 4HVCA 1OI7A 2EZUA 1ESZA 1X3LA 3BL5A 1E1CA 3BMOA 2FPUA 1ZISA 1WSBA 1P2FA 3ZGYA 4JL6A 4GT1A 4FWBA 4OUKX 1CZUA 1GNTA 1O8CA 1PWEA 2VPXA 2GT1A 4UEJA 2ZFUA 4PQGA 3WJ1A 4O1MA 1H1LB 3NTXA 1SVMA 2M1XA 4C7VA 4Q24A 2BMJA 3F6EX 3N2EA 3HXQA 1PFYA 3NFRA 4ZV7A 3VVBA 3CZMA 1OLUB 2CXQA 5KO2A 1GA6A 1KIAA 1B1CA 3HP4A 4L9AA 2QI9C 5DM0A 4JBGA 3SE7A 2H9AA 5EC8A 4PG5A 1OH5A 1VCOA 1D09A 4E88A 4W82A 5K3BA 5GIOE 1I5EA 2QRJA 1PR4A 4URWR 3T7RA 4GMFA 2ZBEA 1UJ4A 5EGSA 1X1DA 1SXGA 5HTOA 1SUCA 1BQ4A 1JH8A 2O2DA 4LTNA 5CCBA 4MK4A 3K32A 4I9UA 4TTPA 1M5UA 1J6UA 4OX9B 3G2NA 2NZWA 3LWBA 4HO1X 2Q6OA 2FZGA 3O90A 4RH3A 4RY8A 1WD5A 3ZZ1A 1U9IC 3C4JA 1MHTA 2QRQA 2OHVA 3AY6A 4ZCSA 1NUHA 5HJ2A 3CO5A 1DQZA 2LW7A 3TLEA 2ECKA 1JQ5A 1VHTA 2JFYA 3LA6A 3W8DA 2QI9F 2ZPUA 4CM5A 2D1YA 2HF2A 1KFKB 1RLUA 3W8NA 3LU1A 2BI4A 1J0AA 2ID7A 2IU4A 1ZRHA 1IEVA 4K6HA 2H1HA 2ZIEA 1CQZA 1JSLA 2C97A 3FOCA 3O2QB 3HXOA 4H7HA 3EXEA 4LFAB 4HNSA 3BTSA 4KRYA 2JVKA 1GUZA 3A1NA 3M4YA 4G41A 1LSUA 3PZRA 3K94A 2Z4TA 4OG2A 3KWFA 4NZZA 1VMIA 3MWGA 4IUDS 2BR5A 3WQSB 4J75A 4WZ6A 3K9BA 1G6OA 3PDIA 3A04A 4FC6A 3R77A 3W4IA 4Z3OA 4ND8B 4KE6A 5K0FA 2QR2A 2UAGA 2JAPA 3B3GA 3JRXA 1AQIA 3A6GA 3QX8A 1F6DA 1CUVA 4J43A 4UUBA 4X71A 3THOA 1Q14A 1M2FA 2I33A 1D2GA 2OO5A 5BO5A 5BR7A 4J0IA 1PYOA 2IIBA 3LC1O 4AIRA 4KWCA 1W2WB 1XNJA 3NT5A 2WKQA 4L95C 5GM1A 1Y3AA 3PNPA 3SC4A 3L8YA 2P6NA 4EEKA 1GZ7A 3TLZA 2CSUA 1K7CA 3PX3A 2OCBA 4LQDA 3ZTYA 4BJHB 1VDMA 3RVSA 1PE0A 1FXWF 2VHYA 4O4JB 2EJBA 3SU8A 1VGQA 2C0QA 2ACEA 4LJAA 4QHTA 2O8FB 5GV8A 1FP4B 2IUFA 3NDRA 1EAYA 4M9CA 3TTYA 1C0IA 2BCEA 3AU9A 3KJXA 3M6IA 3M2TA 4R3WA 1I1NA 1P1CA 3SJCA 2GM5A 3MWDA 3OT1A 5ICFA 3WBFA 1DCMA 2JIPA 2HPHA 3PEYA 1GZ4A 2YIVX 2OV8A 1IWOA 3EZ9A 2BGLA 3R41A 4GI7A 4OHOA 5FNVB 4OXNA 4L7QA 1AXGA 4A5OA 1JBEA 4ZIRB 4DUZB 3MJDA 1ULAA 2RI6A 2ACWA 3BHMA 1HDIA 2W93A 5KX5A 1ND5A 3ZHBA 4B3FX 3EPPA 2CLHB 1YDGA 4IIDA 1M1UA 1J8QA 2M9MA 4YT5A 3QBDA 1NVTA 2NYUA 4MIYA 2MDTA 1P19A 5BSVA 4EITA 1F8GA 3INYA 2OXIA 1A9XB 1LS6A 2Q4EA 1II8B 3MA0A 5DLEA 4EG0A 1C4OA 1V1JA 3RWBA 5HM6A 3LT0A 2HSEA 2E37A 5AFSA 3ZC3A 1SQSA 4YREA 4HQFA 4MUYA 2R60A 1Q1AA 3PDJA 4Z3DA 1PU2A 3CPHA 4PG7A 3GEGA 4UHFA 2JHPA 1JQAA 3B3JA 4CVNA 5JALA 3D8NA 1HYBA 3I1JA 2EWWA 1FNCA 1ZDMA 2CFTA 2X0KA 3F98A 5DM1A 4ZVSA 3TZKA 3WAJA 4GWGA 4F0JA 1PFUA 1QHFA 1W4BA 3P0JA 5IKPA 1BXZA 1DEKA 1NW6A 1Y8RB 3CHYA 4J90A 4PIPA 4TKZA 5ERXA 1ORHA 3W5AA 1ZNXA 2R11A 3ITDA 4IHKA 5M04A 3IX7A 4ETIA 4KITB 2LV8A 3HKEA 4Y2QA 2ZRAA 1K75A 4WUTA 3FNEA 3JAMA 4P36A 4Q0MA 5K4HA 2RGWA 2JLZA 3NBMA 4PYRA 4YV1A 1M75A 5L8VA 3T06B 2ZYRA 1GGHA 3NXSA 4QOJA 5FLKA 2PUGA 1BVUA 1HDRA 1N92A 4DPMA 1PNRA 3BDAA 5BNFA 3SEFA 4CKWA 2QRKA 2WV7A 3BIFA 3ZHOA 5EIEA 1JEQB 3WGQA 4W5RA 2WJIA 4TKVB 3SVZA 1UBLS 1RVV1 1TYAE 2VJYA 3AVOA 1F2UB 2F3PA 3L5KA 1XL1A 5GJWC 4L5AA 4MQMA 1G20B 2EG5A 3GLHE 3GLUA 5AUPB 1S2GA 1GA4A 4N7BA 1Y3BE 4HNGA 1CWUA 2AL7A 3PNQA 4P4SB 1CUHA 2EEZA 4P4LA 4EKGA 3N6XA 3OZEA 4IVQA 1UM8A 1VSQA 4K6FA 8OHMA 3FPHA 5B1SA 1QRAA 3RUHA 4Q93A 1HR0B 1NJ6A 1XCGB 3HRIA 2IODA 2PT7A 3MNFA 1EYZA 1G6KA 1DCKA 2VTBB 1OLOA 4Y3UA 4F9TA 5KWJA 4QPNA 2RJOA 2CXUA 3OA2A 2GERA 5DULA 2EW1A 2GLTA 4M9SA 3H1BA 2O8BA 1C0PA 4QGGA 4ZVLA 2VN8A 2L18A 3FNQA 5FWYB 4NNPA 2HNAA 4RZQA 2QRLA 3E5NA 2C7OA 1M7HA 2AG6A 3AVYA 1DQSA 2DWQA 4PR0A 2HCJB 2JD1A 4UOZA 4FYHA 1QLWA 4HPXB 2PV0A 1JT2A 3P71T 1P9RA 4FKZA 3DEJA 4IGEA 4X3CA 3HSYA 4DM4A 1FLVA 3LY7A 3HE3A 4BMSA 4UOEA 1QTNA 5JAZA 4CEJB 1T0IA 2AN3A 1Z7WA 2AE1A 3L01A 5DT9A 2J4DA 4GPBA 4YO7A 2DFTA 3K70D 4Q48A 3U49A 3IURA 2AK2A 1UFKA 1D04A 1YK0A 2FK8A 2PK3A 3SOZA 4AYWA 2I62A 5ESDA 2J48A 4B3HA 2QX7A 3E03A 4DQDA 4L9WA 4F56A 1PTJA 4Y0AA 4R1NA 2CJFA 1PG2A 5D2CA 4LWQA 4P3XA 4R81A 2O0HA 2FG7C 3U1TA 2G9ZA 1ZW1A 3UJPA 1EE2A 2QORA 3T7DA 4Q3KA 3WC4A 3UENA 1X3SA 1BDBA 1MDFA 3OIWA 5DEOA 3HCFA 1T9BA 4QVKA 3FCCA 2DM6A 4UNNA 2B78A 3WIUA 1U65A 1VYUA 1NV9A 4E31A 2D5CA 4J3JA 4Y1RA 1U2ZA 1O94D 2IYSA 3C15C 3HVIA 4RD6A 5D5PA 1UKEA 1TE2A 3M4XA 3E15A 2J33A 3NB0A 3W8EA 1NVKA 3ZQ6A 5IVIA 3DOFA 5CA0A 3RQSA 1C3EA 1Y33E 3QWFA 4H4DA 1W36C 1AX9A 4EPRA 1ZW6A 2FW1A 1YKSA 3IDOA 3A10A 4NE2A 4TS4A 1KY4A 5B2FA 3K0HA 3ILYA 3K2IA 4UTOA 1KI1A 4JDUA 4ZO9A 4LPSA 5H8WA 1B0PA 1ENYA 2F8LA 5DNAA 3OKFA 1H5UA 4R98A 2YX1A 4B81A 3GLFE 4ZODA 3BJMA 4RMNA 5AJYA 4UEQA 3TXYA 4UTZA 5CVTA 3PX7A 3OPNA 2JBHA 2YJZA 2ZIXA 4R9VA 3QFCA 3KTDA 1G59A 3O94A 4WI1A 2RJ3A 1R00A 5EJMA 4YMHA 2CNWA 2OQRA 1BWPA 3LGSA 5BOSB 1ISRA 3VNSA 3IKVA 4YJGA 4RH1A 3WNQA 4XCXA 1PF7E 3M34A 1YBAA 1VJRA 2EKBA 2PA0A 1SFRA 5FTJA 3N59A 5F3RA 1RQNA 4NBRA 4CEHB 1G5HA 5B6IA 4G8CA 1DHRA 3F7TA 4M98A 4PAQA 1LRLA 1QF9A 3F49S 1E3SA 1K89A 4HDCA 4Q7KA 1YNOA 2VEOA 1IXYA 2GRAA 4ZXFA 4D8XA 1ADGA 4X9XA 5EA2A 1NVVQ 3KAQA 3MB5A 4K81B 1RU3A 4LHXA 2CMGA 2D5AA 2Z0MA 1LLDA 1V9CA 3CJRA 2HWXA 3O4VA 2PD3A 1V25A 4E1BA 4N40A 3P9QA 1A9TA 3EQ8A 3AUUA 2Q1SA 2NG1A 3D3JA 3ORSA 3TFWA 1K6JA 4GYJA 4CHTA 4QJ4A 3T38A 3W6PA 4CM1A 5JUWA 4PYKA 3HZRA 2WIFA 1NBME 3OCYA 4F12A 2W71A 1RYFA 3ES9A 2PKYX 1U8TA 4Q18A 4KVGA 5DI3B 5JCJA 1CUAA 1PIWA 2C5HA 2FV8A 3MBOA 3COWA 4V2UA 1VL1A 4A1OA 2G40A 3OH8A 5AJXA 4Z3KA 1L3CA 1IONA 1COWD 5KB3A 3TNYA 2Q9AA 1N33B 3ZPXA 5DNDA 4BGIA 1KK3A 1XXHA 1DX9A 3PUJA 4QPJC 5KQMA 3UKJA 5E2IA 4P58A 5G0UA 3UMSA 5ENDA 1ESEA 4ZJPA 4PZEA 5FBKA 3VSEA 3HO6A 5HF8A 2WBLC 4RF3A 2G1AA 5F7OA 2V3VA 3PC7A 1QP0A 5HNKA 5DTJA 3H8JA 4GX1A 4CQLB 4KI0A 4BMNA 2YMQA 1HH4A 1LWNA 3DEHA 3RK1A 3I6BA 4GGMX 5JCPA 1PVDA 2HU8A 2WW8A 1H94A 1M9NA 5JSKA 4UU0A 1JPJA 4BO1A 2FDRA 1C8LA 3CUTA 4MWOA 2J3EA 4TT3D 3HR4A 4NJOA 3Q5DA 3MSXA 3QFFA 4NABA 1XQ6A 2CJYA 3AFNA 2EXXA 1CF9A 1SRQA 2VOEA 4I0WB 4BP9A 1VIYA 1GEEA 1UDXA 5IK2D 3QMPA 4EW3A 3H9BA 3EHEA 1D2CA 3IVXA 4HDSA 5TMBA 2P6OA 1WOYA 4MZDA 2Z1NA 4B7UA 4GM4A 2OCKA 4YUZA 3H2YA 1SHLA 3I8SA 1IQUA 2ATEA 3B6EA 5TF4A 4CLOB 3AR9A 5JZOA 1OKKD 3FNRA 5DI3A 1ZVQA 3PJGA 3U3ZA 4ALNA 2KBFA 4HH3C 4E14A 1AUPA 2HCFA 3GBSA 4YP0A 1H9BA 1WU7A 3UQYS 1T2CA 2ONKA 2QN3A 4S24A 4ENQA 2RG7A 4QEDA 4Y2HA 1ODIA 1QRTA 1II9A 2QP4A 1G5QA 3NW9A 4H1HA 1BS2A 4BFLA 5BNTA 1H0HA 2WSYB 1GRQA 2WA1A 4ZP1A 2VDVE 3AR3A 3ZIDA 3RVOA 1TJ3A 4E5MA 1QE5A 3C7TA 3QEMB 1YZ3A 1BKYA 3A6EA 5JZVA 2NU7B 1JW9B 1QQTA 1YQWA 3BAFA 2LR0A 1X7XA 3DP7A 4LSGA 4B3BA 4Q12A 4RKFA 5DH9A 2GR9A 1BCSA 2WSIA 4WK4B 4ZAYA 5FFNA 2LCIA 2KE5A 2TRSB 2YN0A 1XCOA 4M60A 4F45A 3FETA 1C9NA 1ZXBA 3O2SB 2VVTA 5KMGA 1MR3F 2GN8A 2Q6KA 4XB6B 5H5JA 1OWNA 3LQ1A 4BNLA 1OLXA 1Z4QA 1XVIA 4YCMA 1XDWA 1Z0DA 2QTLA 3IO5A 4HOYA 4PGMA 1A2QA 1GFSA 2VYVD 3Q11A 4BX3A 2X7HA 4RPGA 3R7WA 3OX2A 4L0QA 4EYGA 1UJ2A 1GYPA 5H81A 2WUVA 2WU8A 4TXLA 2UXCB 2BM8A 2OD2A 3MJVA 3ZU3A 4DGSA 4MKZA 1S3GA 4M46A 4MCAA 2IUSA 1EHIA 5DHRA 5H9VA 4EWLA 1TA4A 1S1MA 1V8OA 3ZHXA 5H1YA 3CRQA 1KP9A 4I4TF 4LXIA 5AIBA 1F9EA 5L3SB 1G8FA 5K9ZA 1Q3KA 1A7KA 2BZGA 2WWXA 3KR2A 4HF7A 1F20A 5LDGA 2J3MA 3FFXA 3L46A 1HA3A 5TJHA 3I9V1 3H11A 4LC0A 4UTVA 2ZXEA 3DDOA 3ZYZA 3CN7A 3TZHA 2H18A 4N12A 2NU6B 1SQ6A 4XIFA 5BT8A 1HDEA 2JFFA 1TZKA 1FY2A 3PXDA 4QAQA 4F1JA 4ZZ2A 3WGJA 1G4AE 4PBTA 4RTRA 2HBZA 1LVGA 1OREA 3S29A 3L79A 4Z9AA 3SPXA 4UM9D 1P0IA 1QTRA 5BV8A 1W47A 2JJQA 3LAWA 2X6QA 2I1WA 1BMFD 4CCWA 2CXNA 2PKRA 1B4DA 4CI0B 2Q3MA 4R16A 2BH9A 3D7LA 3E9ZA 2NZJA 2XB9A 1AUVA 2IPMA 2EFJA 2XAAA 3IQFA 3DQPA 4LXXA 2DLNA 2G0TA 3AHDA 5D51S 1JHOA 3BIOA 4ZMBA 3MMSA 5K3DA 4NHEA 3E7WA 1N0IA 3E2MA 1X19A 1IHYA 2OHGA 1X1EA 2AC2A 4HX5A 1TJ4A 4L5IA 3DBOB 4FJ2A 4UM7A 5CT9A 4D81A 4JYZA 1BJRE 1Y1LA 2H7YA 1QR2A 3MF4A 4PPGA 2MINB 3MCWA 2I3ZA 4D8TA 4ARUA 3NVKI 5CIWA 3AJ9A 1QIJA 4WZBB 4KQKA 5KDDA 2IPAB 1PJSA 4P53A 4F8YA 1OI4A 1E2QA 4QDKA 5ALWA 1K3FA 1T9GR 4JL8A 4IJWA 1VJDA 2C4MA 4HEJA 3FNIA 5BMVB 4UFOA 1AZWA 1DJLA 1RAHA 4WADA 1Y7IA 3C1UA 1C1DA 3CBQA 1QNLA 3VO9A 1XZGA 2UDPA 3NALA 4FFRA 4K87A 4NG5A 4TUYB 5FOUA 1Z45A 1G8PA 3GCWA 1YVUA 2ZM5A 4UTNA 2ZW9A 4D02A 1L9XA 5LYJF 1S96A 1ZIYA 4H7DA 2REOA 1NNI1 4ITRC 5LQDA 2VDNB 4UDNA 4D3FA 2VWPA 3PQ7A 2AEFA 1AB5A 2RKBA 1JR2A 1UBFA 4PIVA 5D3MA 1BX1A 4FFWA 3KFVA 3TKYA 4ADSG 3ENNA 3AR7A 4FYJA 1EUCA 4PVDA 1QIKA 4JEMA 4ZT5A 1K8XB 4EGCB 1L7AA 2VFAA 1SCBA 3FX2A 4RWEA 4G56A 2Y0EA 1S2LA 3QBEA 1AF4A 2WT4A 1HKUA 4HP8A 2P9TA 3HCNA 4KO2S 4BBAA 1U1DA 2HRRA 2Z1DA 3DB2A 1FDWA 4HN2A 4MH0R 3ZLTA 4Q1EA 2BMAA 1UM9B 5CDSA 1Z13A 4PX2A 3DYIA 4INPA 5T3UA 4D79A 5DE3A 5BNIA 4KIWA 1QVRA 1EZ1A 1DBSA 4HH0A 1RLIA 2IA5A 4E51A 2H1VA 2ZR0A 3FHCB 1WF3A 3PFNA 3NOQA 3ANTA 3T5CA 1X9HA 1P7WA 2Q3CA 2XX3A 3E4CA 2QSYA 3G6KA 1BHQ1 3GLIB 5TSDA 3OF2A 5IDXA 3GB9A 1YUMA 3KFXA 5JLAA 5C8XA 5BSMA 4R9SA 4IS2A 4JC0A 3WB9A 3RS4A 1XZ8A 5J5VA 2R8XA 2QRVA 1YTUA 1KFCB 3LPNA 3OA0A 3K6SA 1EWKA 4LFBB 1ECPA 2CJXA 4JYPA 2OHOA 4FCVA 4LJ9A 4R7GA 1O96B 3RHTA 1D03A 3TXAA 3VU9A 4D0NA 2ORIA 4D45A 4J4HA 1N3IA 1L7XA 3AW8A 4RFLA 5J5CA 2DQZA 2WAOA 3SYLA 1H4SA 1B23P 5KTTA 1TZCA 4QKQA 3GHHA 3RVBA 2SECE 1NOJA 1B6GA 1V1RB 3IQXA 4MVJH 4PGGA 3VISA 2HRQA 2WHRA 3LYLA 3OX4A 3AUAA 4IRUB 3UG6A 2FQYA 1BGXT 4BPRA 1CUZA 1PHRA 2QP3A 1T1JA 1TZMA 1NNSA 1SIBE 1CTQA 2Q46A 4ZYTA 1VCMA 2I87A 4GOND 4WZZA 5HYVA 2HD4A 4F3TA 3CZRA 2C4VA 3D6MA 2J4FA 4AJ2A 1WZCA 2DECA 4WGFA 3EVGA 3X1DA 3QHQA 4X7BA 4YAJA 4UAUA 4YUXA 3DEYX 3G2JA 3KT6A 2WU3A 1P81A 3MPOA 3R5XA 4GPD1 4HGRA 4XWGA 1JVBA 2UVDA 2IS2A 3AFHA 2Y76A 4DNFA 4AD8A 5JAOA 2XVYA 4PEVA 1F8UA 5HKOA 5GADl 3H6KA 2XWPA 3DFFA 4FGKA 5G0VA 3UWPA 1Y5NA 5DBIA 4BKRA 3RU3A 1TQ2A 2WSSA 2AHRA 2O05A 3ZTTA 2G4CA 1KFEB 3LLSA 1P7ZA 2NO5A 2Q3EA 5F5NA 4R31A 3O4FA 4C01A 3K1AB 3M5DA 5JDIA 3EOZA 2CLSA 2CGEA 3DE4X 4HGYA 4DDUA 4G1EB 4EY5A 4V38A 1RC8A 4U9UA 1SWWA 5LYYA 4TXMA 4EX7A 5IWCA 3ERCA 4W1PA 5I5GA 1TADA 5EWLA 1LVHA 2XWSA 1SBHA 4BQSA 4KBFA 3ZW8A 3O8QA 4MGHA 1IYZA 1UFVA 3UJHA 1XWWA 3DBLA 3JQFC 3OFND 1U2RA 1CY0A 1OXVA 4AJ1A 2VZ8A 3NQ41 1FFHA 2CB9A 3DW3X 3UC5A 1XZLA 2C1ZA 4F38A 3QXCA 4I4TA 4BMXA 3R76A 2F43A 3LLMA 1ORWA 4FYWA 5DV9A 4J6EA 4ZANA 1AV7A 3CU5A 4UPVA 3NP9A 3Q8XB 4UW9A 3T99A 3C3DA 1DO8A 4KFUA 5CHEA 4G25A 1KZ1A 1GGJA 2SKDA 4P3OA 5DXFA 5AM2A 1YBFA 2ON6A 3N0XA 1MH9A 3A28A 2EGGA 4W4TA 1EFTA 4IQ4A 2C0CA 3KTAA 4G0NA 5KDLA 1UWCA 4Z9YA 3ND9A 3F73A 3RSQA 3E1KA 4IEFB 1AE1A 3C7KA 2ZUSA 3LPMA 1XRMA 2BI8A 4WNAA 1JWBB 7GPBA 3VPAA 1S4MA 1YDEA 4OHUA 4Y0VA 5DGTA 2X5XA 1UBNA 1UBKS 5L3QB 1Z2CA 3FPKA 4US0R 3AZOA 4B6RA 4FZ3A 3D7KA 1T13A 1G5IA 3A3NA 3LVQE 3O21A 1Z26A 3IAUA 3PF9A 1Y5LA 4I4CA 4L4SA 4LRWA 3THSA 2P6RA 4HPWA 3Q8KA 3HPQA 1XN1A 4KI7A 4OUDA 1A3CA 4POAA 1J20A 3TS1A 1N5DA 4BAUA 5JW6A 4XWWA 1VCIA 3K92A 3JR7A 1QH0A 4ZVNA 4QYXA 3DAGA 7REQA 1O8BA 3GZ4A 1P3JA 1U5AA 1LDMA 2ORVA 4NS1A 1WQ3A 1D2RA 1U02A 4ZQEA 3R7NA 3O82A 4WD3A 10MHA 4JI4B 1GPNA 2LGJA 2CLKB 3CA8A 5BRAA 4F91B 3GQBB 4QXOA 3DHNA 5T4BA 2VR1A 1UPTA 2WWYA 4IIFA 3VVMA 2DQKA 5I7VA 2WZBA 3H9EO 1N2OA 3LUBA 3LH5A 4KPFC 4TWIA 4W9NC 1R66A 3IKJA 1L5LA 3T12A 2XB2A 4Y8VA 1F6WA 1W4CA 2YOFA 3J81A 1HEUA 1DRVA 2ZRMA 3DBHA 3T3GA 3AHGA 1HGXA 1EK2A 1MJ5A 1ONNA 5JBNA 4YPOA 2XUGA 3JQPA 4UXIA 5A4AA 1NC1A 3W2HA 3RBAA 1IY1A 1XE3A 4A8JB 1YRWA 3I39X 2Y77A 1OPRA 3JD3A 5EKXA 1GCGA 4JI1B 2REBA 4DLUA 1FQWA 2HDWA 1EBFA 1HTWA 2QGNA 1QORA 1XJWA 3IA7A 3O83A 4O02B 3CG0A 3U9SA 4AC9A 2O8CA 2HA6A 4N0EA 4QQFA 1QUFA 2C1EA 5F98A 1RRPA 3AXTA 2G08A 1G63A 1UOEA 3BK7A 4RKYA 1SQ5A 4HZGA 4OBEA 3IP7A 4UKDA 5EERA 4OMFG 4V0MA 1F2UA 1U1GA 4ZAVA 3V3KA 3W5VA 1O6BA 3VYRB 3EZFA 2VJOA 3GUUA 3D3NA 3PDIB 4CIAA 1X38A 3V00A 3MXOA 1T4GA 4DM3A 1VXRA 1QZTA 4LRUA 1G19A 1HMPA 1WD7A 4MOWA 4MVJI 4Q4DA 3TTVA 2FN8A 3NC0C 1LH0A 3CWZA 2CYCA 2RI0A 4RTKA 3O8NA 1FYEA 1TTHA 5CD1A 2D54A 3MLEA 1EGHA 4OJKA 4BTVA 1P7PA 1E4YA 1MOPA 3UAWA 2V7EA 5AVYA 2VH1A 3ETHA 4GBJA 2AKAB 2D5BA 4YO8A 1FP7A 5C46F 5DYYA 3LVFO 5J2TA 3EGOA 3UMCA 4QT0A 2FEXA 2XA1A 2LIVA 3CT4A 3DVAB 2RGUA 3S1LA 2QYSA 1DU4A 2Z2ZA 4JYAB 4C4ZA 1J0DA 2XJ4A 1TJNA 4YRJA 4JEIA 1RLOA 4ILKA 3AUYA 5A4DA 2SKEA 3PTLA 4S1PA 3MWDB 3OT1B 4ZQGA 2W6MA 1YCGA 3IXMA 1KYIA 2BMVA 2ZG6A 3ESDA 5D00A 4INOA 3IIIA 4G0QA 4JLWA 1SVIA 2BIFA 2FP4A 3LC2O 2MCFA 2GBIA 4D5EA 3OQPA 1U0RA 2IPXA 3M1LA 3MWLA 2PLRA 4K8OA 2PRKA 2ARKA 4KUGA 1TDJA 1CUYA 1GARA 2FGKA 2JFVA 1Z6ZA 2ISSD 3PE4A 3CONA 3LUHA 5FPPA 3CMCO 3LKBA 1MVLA 4HTFB 4JJ7A 4Q4JA 4YN3A 1A9XA 4L28A 4GMGA 3I42A 1B00A 5AH0A 1M34B 2A1IA 1JIKA 4JKOA 2CF5A 4M49A 4IL5A 1VGRA 4F96A 2Y8EA 1TMGE 1PJ4A 3O7MA 5CFQA 2NAPA 3G17A 2PT9A 4HLQB 3EYWA 4GZMA 4F4HA 2R96A 2PQ0A 2OZLB 1M2HA 1RJDA 2B6NA 2VF5X 3F5FA 3ZQKA 3KYDA 1EVEA 4F5WA 5JSZA 2HLDD 3TD6A 3TLXA 1JAYA 4NNOA 5EIOA 4MWGA 4PHHA 1R50A 5JG7A 2UUPA 1U8UA 4I14A 4EUNA 3UGQA 5H4HA 5DM60 4DCTA 3UUGA 3X2SA 4NEGA 3EPKA 1TU3A 4KK4A 4NMWA 3F5MA 2I67A 1GKKA 2P9ZA 3GLQA 4GWKA 4NVRA 5TGDA 5JRZA 5IM5A 3TOVA 1PS0A 4BNDB 3D0QA 1R0BA 1IEWA 2GKGA 2HJVA 1FNMA 5T4FA 3VMFA 3L7LA 1VBNA 3KZOA 2G8LA 2R1UA 5JNUA 3CEPB 1DRKA 1EWYA 2XMGA 1RRCA 2ZBVA 5EFOA 4DLTA 2EKLA 3EZ7A 4CKWB 3TVDA 4DXDA 2HYIC 4J2HA 5F51A 3VUEA 4UHEA 3GWZA 2WHQA 5D85A 1LWOA 3RVRA 1FLNA 3AUSA 3ABZA 1UC4B 2FHSA 4WKPA 3A2NA 1FFDA 4ND2A 1N78A 2HA5A 1TKCA 4U5XA 5EQTA 1X14A 4BC0A 1UAGA 3CSSA 1NBOA 3VHQA 3DHVA 1XEFA 2VC2B 1Y9ZA 4ZT4A 3PUWA 1SCQA 2GF0A 3CMMA 4LQLA 4AXXA 2RB4A 1TC1A 4RJTA 3SSMA 2A0WA 3ZBQA 4BRZA 1KMHA 4O2AA 4PX9A 2AN9A 3L7OA 1EJ6A 1ZINA 1P5HA 1W49A 2KHZA 3QWAA 1H6AA 2FW7A 2OL4A 4M3NA 4MICA 2PMCA 3OOHA 4CM8B 1NQTA 2PXXA 2JH3A 4TL6A 1KBZA 1XV5A 5E6RA 1E2KA 1EPUA 4Y30A 3KXPA 3M9LA 3ND6A 4B85A 1RQLA 2CBXA 2I2FA 1SU4A 1T5TA 2YCBA 1CJSA 1ZC4A 3PEEA 1THMA 1NP7A 2J67A 3RPEA 1YE5A 1IFXA 2A1UB 4NBUA 1I7PA 3G0OA 4OFZA 3L05A 4MTLA 4YAFA 4YGXB 4LYFA 1IIBA 4IDDA 3TLKA 4DV5B 1F9AA 2OORA 4L8LA 4RF5A 2AD5A 3FWHA 2ODPA 2IJGX 1DTWB 2BFPA 5C5IA 2G17A 2QTVB 4EY3A 1GV0A 1MEEA 2EJUA 4FI3F 1SXJB 3TL6A 1NHWA 1XRQA 4AKIA 3A1VA 4QFMA 3K7EA 3JASA 4MIKA 5MDHA 4D82A 4ZYLA 1K3UB 3A1SA 4ZOLA 3D64A 4J0QA 4YAKA 5JJCA 3CF0A 2GPAA 5GZ6A 2WWHA 1D4FA 3A3KA 2Z43A 1AT1A 3ETJA 4U2DA 1YZKA 2O9JA 3TR0A 2CJWA 1EXVA 2PZFA 4YMGA 4YCNA 1Z5PA 2ZIZA 1TW2A 4ND4A 5CG2A 3BCHA 4R0MA 5F21A 1MO4A 4LV6A 3PKJA 3TSOA 1CDDA 1NMYA 3NGLA 5JQGF 2A9QA 1RWNA 3A6KA 1JEAA 1W0JD 4CBVA 2GK3A 2L82A 2EW8A 4ZU6X 2X22A 3WKBA 4Y6SA 3OIFA 1TFRA 5EFZA 5KSPA 1S89A 621PA 2YMPA 3S68A 1QYCA 5A7FA 4X7PA 1Y4SA 2RHDA 3WGYA 3KKPA 2O1EA 1SXJD 2GJ8A 3VVCA 3F7NA 2NUPB 1NPDA 1QTIA 4KE8A 4QUAA 2HXYA 4XGKA 4YJ3F 2JHGA 1QIIA 3FPCA 2EF1A 2P27A 4YXFA 4F4FA 5K01A 1CUJA 2JI7A 3SXUB 2B8EA 2C9DA 4MRMA 1O08A 1RP1A 4MPDA 1C3OA 2VCEA 5BYKA 1O77A 2D8MA 3KJNA 3FCUB 3DKVA 1T24A 1DBVO 1SG6A 4IH1A 3Q2OA 2G8NA 2CXTA 4DREA 1XJQA 4JLAA 5KQLA 3FHTA 3OP4A 3QQPA 3PDHA 5EKDA 3UJ9A 5EHNA 2D5LA 2XZDA 4FLEA 4RK7A 2VT2A 2HQRA 1TM2A 1IK6A 2C2YA 5KMGB 3GNLA 2BJVA 1J0EA 1USGA 1U2TA 2XSZA 1HNNA 2FZVA 3D0RA 4IIBA 3OZIA 2X4GA 4CM9D 5MFZA 4RE6A 3UXMA 4WT7A 2Q2QA 1I3KA 1NUQA 2ICAA 3GVPA 3KYCA 5EZ6B 3I9MA 4ZT7A 3R7WB 3CR7A 4DV0B 3ZEIA 2PSHA 1VSBA 3KR0A 2ENWA 4NQZA 1D2AA 1R9GA 3CTPA 3UT5B 2IOFA 2ZSAA 4D8WA 3BMQB 4X64B 5BXQC 4QVIA 4IR7A 1N5RA 1ICIA 4G0PA 3L8EA 4HRYA 4A5SA 2UZ1B 4QATA 3Q5GA 2EC5A 4QLBA 4BJ6A 1NIPA 2VF8A 2QSUA 3K0AA 4CG1A 1DXHA 5IDYA 3LYAA 5I7SA 2H59A 1PQYA 3L41A 3CXUA 3IJRA 4BLUA 7ABPA 3F7OA 4L3WA 4ZYVA 1XPOA 1YVEI 1ML4A 2WT8A 4X1YA 1QGUB 2XR1A 4JX9A 5C1BA 5DMXA 3THXB 5GVSA 1QWOA 1JN0A 1RFLA 1KJNA 4ZEWA 1KOJA 4MWZA 4Z0NA 2IQ5A 2I71A 3RIXA 3WLPA 3M33A 1JTEA 1TRKA 3FCEA 3G8YA 2J5XA 4L4RA 4GPEA 4LWZA 5FQNA 1AQJA 1M2JA 1NL3A 4RZXA 4DEXA 1LBIA 1R0XA 2G09A 1URPA 3LQQA 5T64A 5EUBA 2EU8A 2DMRA 3WLRA 4P4SA 1VHJA 2EJCA 1B8PA 1RAAA 2GM9A 2ZZKA 4JUAA 2PQ2A 5JHHB 1FRNA 1U8ZA 3PJFA 2MSKA 4KXXA 1ACMA 2P90A 4UFPA 3DM5A 4JJ8A 1L1EA 3OKCA 5ECYA 4HDRA 2EFCB 3AFMA 3RC9A 3D2AA 4TVBA 4IV8A 4W7SA 1WPRA 3BWBA 2OM2A 4Q1FA 3N6VA 4JA2A 4EY4A 3ZJUA 5I8WA 1F2VA 2AJTA 2ZBDA 1G6HA 2RDMA 3NEPX 4TS9A 3UT5A 1T4MA 1UPCA 2EF0A 5A4IS 2F1IA 2GXAA 2FN7A 2V7XA 4LJSA 2FPKA 4TWAA 3QEAZ 1KBQA 4RFSA 4LXYA 1MNQA 3TGLA 2O23A 3TIXB 4CLOA 3CUEF 4EA9A 5H83A 1BDMA 2G1KA 5AQ1A 1ZOSA 1KEWA 2AA3A 3CX7A 1QAMA 2ZQYA 4TMKA 4TN1A 3C48A 4LX0A 3ULKA 3Q3EA 2G6TA 5F4BA 2PZLA 1F60A 3N6RA 4KN8A 2OBNA 2B3DA 2G72A 4PS1A 4E33A 1U99A 1QKKA 1JZTA 1CY1A 1W34A 1YJCA 2PGLA 2WSSD 3MS2A 3QGMA 3SYNA 4R9NA 5DLDA 5LXTF 1SG0A 2QY6A 2P8SA 4KXYA 3C3AA 5LUBA 1PSZA 2XXAA 3K9NA 3DYBA 4ENTA 3COJA 4IDGA 1CRZA 1U3WA 2C84A 1S7CA 4FOLA 4BBPA 3FZNA 2IUYA 3FTDA 4Q1DA 3E48A 5KEIA 4WERA 2YV5A 5A5GA 3G13A 3HU5A 3L1UA 1EE9A 4HAVA 1WB6A 5JEEA 3CYFA 3N8KA 3FTQA 2HBQA 2JIMA 1BG6A 4GYKA 4DT1B 3VBCA 3PC8A 3KKOA 3WHLA 1RYHA 3I04A 3P9KA 3LYHA 3O1HB 1UT6A 1QIMA 2BGIA 3WZMA 5CA0B 3ZWAA 3K0KA 2QTZA 4MRRA 3ZU6A 3ZJTA 5BRJA 3AF4A 3GVIA 3DXYA 1ST3A 2FLWA 2XIQA 2X9LA 1Q3HA 2R87A 1CQWA 2ECFA 3BULA 2A3NA 3U7GA 1BX3A 4LKRA 1K4MA 4XAQA 3NUGA 3R6TA 2ONYA 5IBPA 1A9QA 2HWKA 3A4IA 2C5SA 4I55A 1XTTA 4JUFA 2Y66A 4PBRA 3SY8A 5CDFE 2BT4A 2PS3A 3PPIA 3EJWA 3L7KA 1T1RA 4JB2A 1L8OA 1SEPA 2XKKA 2WVAA 3SF0A 3THWA 4B48A 4ACBA 1WHSB 2C1XA 2ZCJA 2WJHA 2PKQP 4CGYA 2ZDHA 2O8DB 4LJ4A 1V41E 1D7OA 3E18A 4B3RB 1GA1A 2CNWD 3UOGA 3QOWA 1OD6A 2NPIA 3SCZA 4NYMR 2BHRA 4D9IA 1QPBA 5MF6A 1CZOA 5TGTA 3EARA 3DUWA 4UD6A 3Q10A 1A27A 5K0ZA 3MMPA 3BKWA 1A96A 2JIZA 3IV7A 5BV2P 3ZWMA 4CEIB 3WK8A 5IP5A 2ZSFA 5E8JA 5DF1A 4JX8A 1EGQA 3GWGA 3K20A 3LT1A 3ROZA 3LOPA 2C57A 4ILEA 1EHYA 1YC2A 4TLDA 5KWVA 1QHHB 1T3ZA 2I03A 3GGDA 1VPVA 1YC5A 3R8CA 2MSDB 1UJNA 5IJZA 2XUQA 4ZYWA 5HUJA 1EX9A 1OCEA 3KDSE 3OLVA 4C7KA 2Q5QA 3FVWA 4IFIA 4MV8A 4KLAA 1NQ5A 1V7ZA 2JBAA 4JCCA 1H6DA 4XVUA 5LZ2A 1WJGA 2CDCA 1OXBB 3HY3A 4L6IA 4GBMA 3HM2A 3Q6IA 4B4KA 4KJXA 3BYZA 4WBNF 1ZL2A 4K2AA 3PCXA 4CIXA 3COSA 5I9TA 5KYGA 2FW9A 1JG2A 2Z2KA 4D3XA 1H66A 1LF5A 2QS9A 5KTNA 1ORVA 1TCCA 3JQ9A 1FS4A 1KJZA 3I52A 1ZWLA 1M2VA 1NRWA 3MRVA 4ROSA 4X1KB 2WINI 1D2EA 2WU1A 1NN3A 4LSWA 3UMGA 5BSFA 4XDZA 1P2VA 2Q1YA 3TLAA 1T35A 2AG5A 2PEYA 4HDMB 4PLZA 4NENB 4RD4A 1IRXA 5EKTA 4RD3A 1C1DB 4YP6A 3GP5A 2Q7OE 1GZHB 1WZNA 2D06A 3O4HA 4C6TB 1GNQA 1K8ZB 3I1FA 3T8YA 5I45A 1XTPA 4FBLA 4XGIA 1RNLA 5J43A 2J9FB 2VTDA 4ND5A 2R7AA 3UJAA 1FFAA 2JPDA 2W8BB 2XQVA 3GXOA 2DQSA 3HCPA 1NVAA 2PSFA 3IHKA 2IYVA 3LECA 2QDXA 3P96A 4I5GA 1Y6RA 3WSWA 4G23A 2OHJA 2B37A 3TTXA 1F5NA 5JEDA 3I2GA 4UMDA 2AUMA 1GPLA 2FPLA 1Y8AA 2I3GA 3VH1A 3AFOA 3FWZA 2EBFX 4W6QA 4YLYA 3FYUB 1XWIA 1J2YA 1ZK2A 2NYVA 2OZKA 1WZEA 3EVCA 4KXWA 5HEKA 2C42A 3SHTA 4WEOA 1NRJB 5CB0A 1SUAA 4J4BA 1OWOA 1I0IA 3BD9A 2PWBA 5GJCA 3N7UA 5GAJA 3VPFA 4QUEA 2HJSA 4BWGA 1ZLYA 3EA5A 4URYR 1JHPA 3SG0A 4L27A 4MLPA 4O6VA 2IYYA 3NXKA 4L0CA 4UXJA 1R74A 1QYDA 4ZVPA 1PW7A 1CQJA 5CA1A 1K5DA 3A1CA 3CNOA 2ORWA 4MVJG 5A03A 5D01A 1JLRA 1AKNA 4AZTA 3KPUA 1PT9A 2NADA 4BVJA 1ZJZA 4HB3A 1UBOS 4CUZA 4EW1A 4E5KA 3A4YA 4Q9KA 2PR2A 3PL1A 1KMIY 1FVXA 1KO7A 4FFOA 5L7WA 2MYNA 3CISA 3RC3A 4CG3A 4UTPA 3VZSA 3DW1X 2D0DA 1HYHA 4QU0A 4TLLB 1U0OC 3KT8A 3IP1A 4XYGA 2TMDA 3BWVA 1HLFA 2ZJFA 2OHIA 5IJ0A 5TQVA 2C7VA 1KEVA 3NOXA 1Z6QA 4EY8A 2C3OA 2ZRDA 4L8GA 4UJ5A 1XB2A 5AMXA 4ERXA 4CWAA 2FZWA 1XQXA 3CH7A 2PKQO 4QPPA 1MABA 5K1ZA 1UT8A 1A1SA 4R68A 4RCVA 2QRHA 2YYSA 1UBTS 3H5LA 4TM8A 2QD5A 3KZNA 3O0DA 1UBHS 2OR3A 4NHOA 1G7SA 5FPKA 2BJHA 3B9PA 3FNHA 4KN5A 4Y6GB 2PUTA 4DB4A 5EE5B 1YK1A 5LLDA 1J22A 4QSMA 3H5TA 4LGYA 5TEWA 3ZY3A 1J2TA 4V3CA 1NP3A 2QM0A 4RTQA 3IE1A 1RMTA 4RY2A 3BORA 1VG1A 3BSYA 1KZHA 5CUQA 1IQ0A 3KPJA 4L4YA 3EIXA 4DR2B 1TXGA 4JNCA 4K9PA 5A9SB 2I6SA 4YCCA 3Q3HA 1YF3A 2ENUA 3Q4GA 3MCUA 2UXBB 1J97A 1K8QA 4O4JA 1FDTA 2ASVA 2O8FA 5A0VA 2XYVA 5I4IA 3PE3A 1JDPA 2QQFA 4IKOA 2UYGA 1BVHA 3STTA 1AM4D 1GADO 4N3NA 3U3RA 2CYBA 4B6SA 2JF0A 3ZBPA 1UH5A 2FMTA 4NJMB 2DWOA 2ZJ2A 1AKRA 2CB0A 2MHCA 2YH2A 3TQOA 3F6BX 3SM9A 4L4ZA 1GSHA 1Q7EA 1PQPA 1PZFA 1XELA 4LRTB 4OB6A 5AXAA 1KEUA 3RUDA 3KLOA 3QBVA 4KE9A 3RO7A 3ZV7A 1JU4A 3R6LA 4S0XA 1J33A 1NM5C 1FU8A 2FWRA 2ZBPA 4QXAA 4RU1A 1ZG3A 4QD3A 1GM5A 2CHQA 5B4UA 2Q27A 2ZTLA 3TLCA 1FA9A 2AI2A 2GFHA 3TNJA 4ZDKA 3GELA 4QT4A 3AEXA 3UB2A 4GUDA 1YVDA 4IO0A 2BBWA 3HKBA 4FE7A 4BX0A 2B2CA 2X4DA 1J24A 4EA8A 1CB0A 2WT9A 1QGZA 3H2IA 4U8GA 4I9HA 5J9FA 4MP6A 4ZKDA 4C07A 3O4GA 3IBFA 2NXCA 2YQ4A 3HGTA 2JRLA 1Z56C 3LFUA 1O58A 2H5JA 2HSGA 2Z6QA 5D6NA 3FCXA 3ZWYA 3F9RA 3A2LA 1FPMA 4JN6B 1AK9A 3T5PA 2NLOA 1NXTA 1NPYA 3PI6A 1ZN7A 2GVNA 3OZVA 4HZUB 5H80A 3MAAC 4U2BA 1Y3DE 3UFBA 2OLJA 4Q9JA 2XGGA 5BWMA 4DIOA 4GVXA 1QGED 1X6VA 3A4TA 3QYJA 4NJMA 4JVSB 4DCMA 2CHEA 5KVAA 4BAGA 1DAHA 3F8WA 3H16A 5IAKA 4C0HA 4EJSA 4L07A 3ZV5A 5KNCD 4FQ7A 1JR3E 4UUNA 3DFIA 4IWXA 3DBVO 1KNQA 3NV9A 4RUKA 2K2WA 3WMGA 1ISIA 4P34A 1I9CA 1XP8A 3JCZA 1DBQA 4DMLA 1H3FA 2XMCA 3OJEA 1YZYA 1SVWA 3MUEA 4S1WA 1QHNA 3M6FA 4UC0A 4YCAA 1BHO1 4I1YA 4P3PA 3ZYCA 2G3YA 3I09A 3UA4A 1LX6A 4RA6B 3VNVA 3JQ9C 4D9EA 4OXQA 1SCDA 3LF2A 2H1CA 5K8UA 3VZQA 1WKVA 1OXMA 2AN4A 3TXXA 4FCWA 3ICVA 3I92A 4X92A 3EZYA 2DR0A 4ZA2A 4YQEA 4DYHA 5KUTA 2I0FA 3TTUA 4BLVA 3KPVA 4ID9A 4WXHA 5G40A 4AKHA 2JCBA 4ZI2A 3MIZA 3CLTC 1T0BA 1ZX1A 1Y9EA 1NQVA 1T8WA 2XTZA 1J7JA 2O4UX 2YXEA 1L1FA 3E5MA 3B9QA 4MVJM 1YQEA 3QFSA 5H3HA 2ID4A 4RHXA 4EENA 4EHKA 1WWKA 4QPZA 2PUAA 2Z83A 2XT0A 2JNWA 1DE0A 3DVRX 2Z6AA 1V16A 2XNKA 3FCSB 1F4LA 4IYJA 4UHJA 4C4AA 2MMCA 2WZDA 3PRYA 3ZE1B 4IH9A 2ZZMA 1ARZA 3GEIA 1I4OA 4MR7B 4QO8A 3D59A 3EXEB 4MVJE 3PHCA 2ZTHA 3AR2A 2QXUA 3DUFA 2I8LA 2ZI7A 3LBIA 4NYIQ 2BSXA 3ETEA 2FSFA 3NKFA 1PR6A 3BGSA 3C3BA 2I7TA 4KQEA 2FMIA 1E2MA 4AY5A 5FLXA 1EWRA 3EDQA 3PIDA 4WOBA 3CX6A 1XI2A 3T3EA 5CEJA 1F3LA 1OPXA 3I12A 3DV0A 4MQLA 5D5HA 2ESRA 2W2PA 1DWOA 3FMOB 3M6VA 3Q6NA 3CKMA 4J1SA 2NWQA 1BGVA 3RV4A 4ALJA 3TQCA 5JAIA 3U4AA 5CK5A 4B2YA 3DFUA 1VKJA 4BQNA 5IDWA 2YRXA 2XDYA 3KZVA 4MUEA 3IAS1 1V47A 4U7WA 5DOVA 4JY7A 1NTRA 2QXYA 3EVDA 1U80A 2HBRA 3MTQA 3WRVA 2C78A 1E6EA 3NPMA 5JR3A 4WSOA 2I7DA 1RXEA 4KIJA 2R8ZA 1SBYA 3NU1A 5DHPA 3IQDB 4RVOA 5C7IO 2DPMA 2A78A 1R9JA 3PBKA 3E9DA 2JFWA 4NAVA 3M3PA 3RTBA 3DEFA 1C4XA 3KU4A 3OZDA 3DNFA 4I1IA 4NF2A 1L5RA 1SEVA 5HRUA 3ZU5A 3FIUA 5LNK1 2CWWA 2HPZA 4MV7A 4DLPA 3F4LA 3QKRB 4C7BA 1LSJA 4HUQB 2P0YA 5HK9A 3LK6A 2VQEB 2C04A 1BFUA 3DDZX 1WKCA 2HLHA 1AXEA 4KFCA 3AEKB 3OLXA 1EK1A 2CUTA 2F3QA 3IIJA 4HG2A 4BU1A 1J5XA 4GEGA 1TX4B 5CLHA 2YY6A 2PUDA 2WFMA 5DTQA 2C95A 1TEXA 2PFSA 1X0XA 4TWRA 4TMZA 4FS3A 3A4MA 2AZ4A 3L07A 4NZOA 2VJCA 2GBLA 4X8MA 2VHTA 2JAQA 3W9SA 4AJHA 3O2NA 2QPOA 1W73A 4MVJA 2YFQA 5ADVA 2B25A 1L4HA 2B1QA 1FRQA 2RFLA 2ZUBA 4K0RA 3L7NA 2G07A 2DTXA 3PC6A 1NRXA 3BRWA 4R41A 1Z0FA 2RKWA 1JHUA 2VDPB 4I5FA 2JAHA 4O4JF 1II0A 2VEDA 3NHAA 1KY5A 3PT5A 3JVEA 3LFHA 2VBFA 4AO6A 2BEWA 5CTAA 4WA7A 2ZPAA 1C14A 5B3LA 4N18A 1P45A 5BSGA 1I30A 4XCQA 1Z4JA 2C5EA 5E4FA 1E9RA 4GECA 1Z5WA 4QDJA 5B1DA 4CU5A 4QECA 4L76A 3KG2A 1E3EA 4MA5A 1HBJA 2Q2VA 4CNQA 4D57A 2HRCA 1D1PA 2QQ0A 1AK2A 1G8SA 3C6BA 4JT4A 2CEAA 2VK8A 3FPFA 2Q6TA 4AYTA 3GDFA 3L0BA 1E3JA 1YRLA 1JJIA 2I4OA 4F7DA 1L5VA 2W2TA 4KAFA 2FWBA 1TFUA 2VJAA 4R1MA 5EWMB 3ZY6A 1OH7A 2ZYSA 4KR6A 2O8VA 3A1UA 3HWSA 4XX0B 5TY0A 1OWMA 2BFCB 5LJLA 1Q5PA 5A4KA 1KDOA 2ZB4A 4H3KB 4O0LA 4ZYYA 1A2OA 1GNPA 3DDUA 4M1KA 2OXFA 1ZCZA 3OQHA 5JXWA 2ZT7A 1N0HA 2QG6A 3KKQA 3A3YA 2A9PA 3VSDA 3EISA 1IY9A 2W37A 1EBUA 3UCXA 4Q1CA 1A1VA 5A0TA 2V9ZA 2UU9B 5BSTA 4RENA 3TWOA 1WPQA 2MYUA 2YDYA 4ZREA 5K8LA 2IPLA 4I66A 5KTSA 1TZBA 2CNDA 2YWFA 1OH8A 3V1UA 1AUOA 3F90A 4OHYA 2B61A 2I99A 2O7SA 2R2GA 3A8TA 5CNJA 5L95A 1EHCA 3B20A 2C2GA 4AUKA 3A6FA 1VGVA 3E3MA 2VRBA 3O8OB 4DPKA 2PX5A 1Z18A 2X2PA 2HADA 4RPIA 2ZVQX 3WBBA 1XLTC 5LQSA 4A2PA 3EWSA 5AO9A 3AV0B 4HSEA 5FPSA 3WV5A 1M2OB 3K15A 4EHAA 4ZK2A 1CUCA 1QE0A 4I5EA 4Z5XA 2AEEA 1K06A 1XAIA 3NTOA 3G0BA 3STYA 4RKQA 1UDBA 2VRWA 3VDXA 4F6CA 3JAWB 1HDXA 4MHOA 1MB4A 1T43A 2R44A 1RKXA 3T9AA 4FMBB 2QKYA 5IDVA 1AURA 3F97A 2H2WA 3TRFA 3U31A 3DD5A 6ADHA 5EIXA 1F7VA 2QAGB 5FWNA 1RAGA 5HP4A 4JKIA 3THXA 4D4KA 2NUTB 3MTDA 2QTVA 4QLAA 3NHPA 4DSTA 5IJXA 3NIGB 2A3RA 1QHSA 2F62A 2Q4BA 3NJ8A 1TMYA 4MQFA 1CJMA 2GAJA 2F4VB 3ONFA 5GY7A 4DUPA 4L50A