1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE PB92
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Serine protease
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
4KPGA 1PJ8A 1SBHA 3PTLA 1IAVA 1SCAA 1GA6A 3VTAA 3D9QX 3VV2A 1SUEA 1KDZA 3LXUX 1WSDA 1TM5E 1HT3A 3H42B 1TO1E 1GA1A 3VV3A 1SBNE 2P4EA 1C9MA 1Q5PA 1TMGE 3A3NA 4OV6B 2WUWE 3CNQS 1S2NA 2SBTA 2ST1A 1YJBA 1PFGA 3LPAA 1ZVJA 2ID8A 2WWTA 5AVKA 5JMOA 3DE4X 5ARCA 1SBCA 1TECE 1Y34E 1SELA 2Z56A 1IC6A 3SICE 1Y33E 1S01A 2WV7A 1Y4DE 3T41A 1DBIA 3I37X 1GNVA 4I0WB 1C3LA 1LW6E 1YU6A 2XTJA 4MZDA 3DE0X 4H6WA 2W2QA 1JEAA 4AKSA 4CFZA 5FAXA 2PMWB 3DW1X 4JP8A 4CFYA 4J94A 1GT91 3QFHA 2DP4E 2Z2ZA 3DWEX 1SCJA 1ZVKA 5SICE 1KDVA 1NDUA 3HJRA 1YJCA 1KE1A 3GT4A 1SUDA 5ARDA 1V5IA 1T1IA 1ST3A 3I34X 1V6CA 5JXGA 4HVLA 4RYDA 3ZXXA 1BE8A 3TI7A 2PWBA 1DUIA 1TM4E 1NLUA 1SN7A 3WIUA 1VSBA 1P7WA 5ARBA 1SUAA 1AV7A 4K8RB 3OSZA 4LVOA 5I9SA 4NMXB 1CSEE 1AU9A 3DE2X 1WVMA 1T1EA 3Q40A 1Y3DE 1Y3FE 1THMA 1SIUA 3DE5X 5JXHA 3VYVA 3ZXYA 2W2MA 1C9JA 1SIOA 4B5LA 1GTL1 4H6VA 2QTWB 1R0RE 3BGOS 1XF1A 3GT3A 3DVSX 1C9NA 3TI9A 4KG7A 1SUCA 3VHQA 1GA4A 3DDZX 2IXTA 1S02A 2SNIE 1OYVA 5AQEA 1Y3BE 3Q5GA 2V8BA 2PRKA 3I2YX 4YN3A 3F7OA 1Y4AE 1NDQA 1OT5A 3DW3X 2Z2XA 2X8JB 1MPTA 1PTKA 1SIBE 5JXIA 3I30X 1OYOA 2Z2YA 2G4VA 1TM1E 5CW1A 3BPSA 3AJ9A 4DWWA 2HPZA 3GCWA 1YJAA 2DQKA 4NE7A 5AMXA 2IY9A 1R64A 3LPDA 3P5BA 3A3OA 1T1GA 3UNXA 3WQBA 4BWGA 1AK9A 1SCNE 2Z58A 1WMFA 1SVNA 1BH6A 3CO0S 1TM3E 2SICE 3LPCA 1SCDA 4WOBA 1BFUA 3PRKE 5JXJA 3GCXA 3DE7X 3QMPA 4HX2A 1BE6A 1Y9ZA 1GTJ1 1PEKE 4OMCA 1AVTA 1AH2A 1KDYA 1WMDA 2E1PA 1CNMA 1SPBS 2B6NA 1GNSA 1SBIA 4OMDA 4KB5A 1GCIA 2X8JA 3WHIA 1SBTA 2W2OA 3DVQX 1TM7E 4DJ5X 4ZOQI 1EGQA 1MEEA 4C3VA 2PKCA 1R6VA 1Y1KE 4ZARA 1A2QA 4GI3A 3SQOA 4Z2AA 4CG0A 3D43A 4H6XA 1SH7A 3DVRX 2DUJA 4WOCA 1BFKA 2Z57A 3A3PA 2PYZA 3BX1A 3QTLA 2ZWOA 4FONA 4DZTA 2ZRQA 1AQNA 3L1KA 1BJRE 3TECE 5B1DA 5FFNA 2W2PA 2SECE 1ST2A 1Y3CE 1EA7A 2PWAA 3EE6A 1AF4A 1SUPA 1TO2E 1KE2A 3F49S 3AFGA 2WUVA 1GTG1 3EIFA 5B1EA 5FBZA 3DE3X 1SUBA 1WMEA 2PQ2A 2ZWPA 1TK2A 2TECE 3DYBA 3DE6X 2GKOA 2Z30A 3VSBA 3F7MA 1SCBA 3WIVA 1UBNA 2HD4A 1P8JA 2XRMA 4M1ZA 2W2NA 1P7VA 3DE1X 5K7SA 2ID4A 4C3UA 4NE9A 3AJ8A 1Y48E 4LVNA 3EDYA 4AKTA 5AVJA
chains in the Genus database with same CATH superfamily
3K5WA 4PINA 3EBPA 1G20E 4BMYA 1BEUB 1W5SA 3EYAA 4KBFA 1K8QA 1N77A 2O7RA 4DVJA 3O8CA 3NTRA 2CMGA 4KI0A 4PRLA 5B7PA 3AO0B 4TQUS 2PWPA 4M0MA 4IICA 4D5GA 1GKYA 1EUQA 2F17A 4BGUA 3ZC3A 4CU5A 4Y1RA 1PO7A 1N1MA 2BCGY 5KQSA 3OE7A 4ZGBA 1RLJA 4MB6A 2Y6VA 3TBHA 3Q1LA 5KZMB 1N9GA 3OICA 5LZ5A 4F5WA 2R8OA 7REQA 4BZPA 2FSIA 3DMHA 2VH5R 4N0QA 4QE3A 1H85A 1RM0A 2A4MA 3L7NA 1I33A 3ET4A 4RPLA 1FFEA 4OYLA 4HAXA 1W93A 1YBHA 4EG1A 2D7DA 5AHRA 4AJ1A 4C7BA 4IJMA 1B76A 5DK6A 4DDWA 1HA3A 4MWZA 5F3RA 3RYCA 4TYPA 1H1LA 3W5SA 1JBKA 4FYVA 4LQ4A 4ZQGA 3V6LA 5IJAA 1GNQA 2JK1A 3SSMA 1KZGB 4NR0A 1Y5NA 4K40A 2VAPA 5ESXA 1W49A 3FPBA 5BVHB 1VP3A 1LPBB 5ALZA 4FDLA 1F8YA 2WJZB 2IZ1A 2PXHA 3FPAA 4HLCA 3A1FA 3EMBA 1OIXA 1RI5A 3UUEA 2CXRA 4LXQA 1JH9A 3W9YA 2B9VA 8AT1A 5D3MA 3WGQA 2ZETA 3ZNNA 4YLGA 5JQGA 4FE7A 1T24A 1XO1A 4OQPA 3GVHA 3G68A 4AL4A 5C9ZA 1V45E 4F85A 3GJ3A 2Z6UA 4O2AF 1E6EA 3KIPA 1UBLS 4Q24A 4FKMA 4F2WA 1RWVA 1IEQA 3M0EA 1OBOA 3DL4A 5JDIA 4WW0A 2CXQA 2YXEA 4RPCA 2XCQA 2AJDA 1U0JA 4FQ8A 3NWJA 2LRHA 4DCOA 3IJRA 4D9FA 2OWEA 4UUBA 1JDUA 1Y1LA 1CDDA 2V7EA 4EITA 1IVYA 2PKQO 3DBRA 2ZIAA 4R1MA 4A8PA 4J6FA 2DECA 3IQXA 4PN7A 4U7TB 2BFAA 1ZD5A 2QSJA 3IE2A 2BGUA 4JODA 4LBWA 4E22A 4G5SA 3QBVA 4KRFA 5CLJA 4HNRA 1S1CA 4H6PA 2ZBDA 3FBTA 4GKKB 4ITUA 1UXOA 1TF5A 4WUVA 2W8BA 4KAXA 1J42A 3HUTA 4UM7A 3CLRD 4OHZA 7REQB 2V0NA 3WLJA 5BR8B 1ZISA 2JFUA 2QPAA 3T41A 1CLEA 1QDUA 2GPSA 1EZ1A 1AS2A 3R5KA 1W47A 3U13A 2X4GA 2CLLB 3DOHA 4BNFA 4F91B 1ULBA 4H17A 1C3LA 1SVMA 3MMZA 5JMPA 3VMMA 1R74A 1Y82A 2C4UA 3EOAI 2C4WA 4CM4B 4WFQA 3AEQB 5BSKA 1KVSA 1T3LA 3QQ5A 2UZ4A 1JEAA 1ENZA 2DG2A 4RTKA 3ZZTA 2F2TA 3O95A 3W8EA 4MS3B 3FBWA 3JU3A 4MWEA 2PTHA 3TW8A 4XUDA 4IS2A 1NBEA 4LJ7A 2DRIA 4OAPA 3T1VA 3HKEB 1DTWA 1R6XA 2WVAA 3OZFA 5HILA 1K6JA 1YO6A 1DAFA 4UE3S 5HUHA 3HB5X 3T3IA 5M29A 1N2CA 3E0QA 4DUZB 3GOHA 1SCJA 2GJAA 3O1LA 4Q1EA 2C1XA 1NDUA 5FDFA 1T8RA 2WZCA 3UC5A 3PXUA 1FFXA 3EVGA 1UKBA 4FWBA 5GZ1A 4LV6A 4E2FA 2X2OA 4EY8A 4AKIA 2FWPA 4PCAA 4QGGA 5KOJA 4D9NA 3G2HA 1YR7A 3P94A 2GB4A 4LRYA 4X60A 1ZMTA 5CVTA 1ECCA 3IHWA 4UM9B 5CA1B 4CEIB 3VSAA 4B44A 4G5HA 3RVPA 2IIBA 3EVAA 5ITWA 3NTOA 5LN1A 2VSNA 2IK8A 3DAGA 3KS9A 2XDQB 3MWEA 1BHJA 1HE1C 5DSXA 4QAJA 2VZ8A 3WB9A 2PQ6A 5ALIA 1EFLA 2NU7B 2ZIUB 4R2LA 5JYEA 4Z4QA 3W04A 2AQ8A 4IXTA 4JZYA 1OKKD 3IXLA 1Q74A 3O2QB 2ODQA 1ZD2P 4HX5A 2Q6LA 3JYNA 1K6IA 1U3VA 4GI1A 3BGSA 2AG1A 5JJLA 3LD9A 2RDMA 4PU0A 2NO9A 2Q9UA 4N0MA 3I32A 1ODSA 1RJEA 1TQ2A 4RHYA 1XLTC 4D4LA 1NBHA 4DG9A 4RY0A 1H3EA 1P2FA 1I1QB 3I8XA 1F1JA 1F0PA 2JA2A 1GPNA 3N5CA 4ZC1A 2WOJA 3W9SA 3EOZA 1VCHA 1IBMB 2X6TA 3QHPA 1VOTA 4A2QA 1FUIA 2P9QA 3F6YA 3F9CA 3JD1A 1G17A 3RABA 2LP4Y 1E3JA 5JC1A 1JG7A 1IXSB 5CFQA 4ZKEA 2JFYA 4TMTA 2I22A 5I9SA 2R1VB 4EY5A 1YQUA 1T9GR 2C84A 4N65A 5U4QA 5C5CA 3JRNA 3JRWA 4BRSA 2ZJ8A 3MS7A 3RE1A 4EABA 3HUUA 3BE5A 3DZHA 2C0QA 3NORA 1ZH0A 4JU9A 1JBQA 4PZLA 1K98A 2EG5A 2RK3A 2OZLB 5FR2A 4G8CA 5H4HA 3CCBA 2SCUB 4TM8A 2ZDQA 5HFJA 4REOA 1QQ5A 1TD9A 1OLSB 2AL7A 5KOJB 5FNZA 3SC6A 3CJQA 5G3YA 1I30A 2QL7A 3I2HA 3SBOA 2DEUA 2N46A 2YFYA 1JEQA 1UPCA 3ETHA 1K7XB 1B41A 2C7BA 5LYYA 2CNLA 3WJ7A 4DAEA 3U2QA 1Y8AA 1XQ1A 2HL6A 1TQDA 1Y98A 1WP9A 3MWEB 5JSFA 3BB4A 2J6BA 5L4LA 3BK7A 4D46A 2EQ5A 3DC2A 4QARA 3SOPA 4J0EA 1CR2A 2RGUA 4KREA 4YHBA 1IPEA 3KQTA 4GPIB 1OBVA 2O50A 4WY8A 3PVCA 1F6BA 5TSDA 3LFTA 1LBHA 3FB1A 4Z99A 1XB2A 3QKUA 2JIRA 1WU8A 3T1TA 1ZAYA 2ZAYA 4YAWA 1NVDA 1ZMOA 1AGPA 4OGFA 3WV4A 1IB0A 3FRIA 4B3MB 1ORRA 1GT6A 3FH0A 5JQWA 3C1OA 1U7TA 1QE0A 3LF1A 1GV1A 1EU1A 3EG9A 1G8JA 2GPNA 1MX3A 1F0NA 4DEYA 3ENNA 4UUOA 4Q4DA 3PJGA 5KSYA 1S02A 1CZRA 4CJXA 4EFLA 1KU6A 3W5JA 1WF6A 4UTRA 3NJ8A 1SQ6A 2Q9CA 3L7OA 4WLFA 1Y3BE 1CE8A 3DZCA 3QWHA 2JAQA 3IDOA 4J2OA 5BQ5A 5JH7F 1XZQA 4L5BA 4NYJR 5FA6A 4HDCA 1Y3HA 3G0BA 2XV1A 4DJDC 3RVNA 1YCFA 4EVSA 2ZSUA 3N8KA 1QIEA 3A0UA 4XARA 1EVJA 4MDFA 3IPXA 4Z7OB 3RJMA 1SXJD 3GIDA 5LIPA 2CLFB 1OA0A 3AOGA 4G1CA 4PPQA 1O4VA 1U2PA 1FP6A 2ZGVA 3M3PA 5IAAA 3S2SA 5LP1A 4JYCA 4YP5A 1P81A 1XV5A 5EEHA 4QLAA 5BMVA 5J43A 5KNBH 2GM9A 5FO1A 2O4CA 2O3JA 5K3SA 1T9KA 1YMVA 2DGDA 3O31A 5CVUA 5LMNB 1KMMA 3E7XA 1KDPA 4B32A 2MWMA 4TKUA 3U17A 5AUNB 1E6MA 1MP0A 2AMYA 2XE8A 1SOAA 3PSAA 1H2FA 2O5EA 1AY0A 3DDOA 4YP7A 1BW9A 1RRGA 1T3TA 2WNIA 4C43A 4FMBB 1CEQA 1I7NA 4MROA 2I7VA 2CY0A 2C7VA 2ONCA 3BYZA 4QOGA 4KPEC 3UAGA 5EL0A 2L19A 1BA3A 1ONBA 4ZZ3A 3UNXA 2IF2A 1E79A 3C6BA 4Z0NA 1P7YA 1NMXA 4MQEA 2C7OA 4C0SA 2QIOA 1J25A 4OX9B 3BKXA 3M89A 3GI1A 1S2IA 1D2NA 1X15A 1TTHA 4BVEA 2V6BA 3RUCA 3Q8XB 2JKVA 1KEEB 4NCIA 1EVYA 3ZWPA 1R0SA 4V0KA 4EG5A 4NDAA 4CM1A 2BZ1A 1RJGA 1VG9B 2SICE 3Q8LA 1XEXB 2DWOA 2PKYX 3E22A 2Z9DA 1W4CA 4PYNA 5AKJA 1SWVA 4WKBA 2OOSA 1KRXA 1NBMA 1QRDA 3ED1A 4TL6A 2O0HA 2XUZA 3MUEA 3CJRA 3VR2A 3QF4A 3L1VA 4HRXA 3FYSA 4B6RA 1QP4A 2JARA 3OI7A 1OH5A 1R4NA 1Z6GA 4O8CA 5AW2A 1PEAA 1E2JA 2RGNA 4K9KA 3MGAA 2KB0A 4Q82A 3HJBA 2EWWA 2JIZA 5C8VA 1UUFA 2DWPA 1UKVY 1KKUA 2ES4A 1TTPB 1RS0A 4KRXA 4TS4A 3EGDB 3H2SA 2G71A 1CEXA 1Q20A 2ZJYA 3EIHA 3H97A 2IXGA 3LJKA 4I1OA 1XEWY 4KFUA 1DRKA 2RHDA 4HWPA 1POWA 4L07A 1U9IC 4O4IA 3WIDA 1RBYA 4TKUB 5JANA 3NCHA 5D01A 3TLMA 1FYWA 1CS4C 5LJIA 3HRHA 2V58A 4IOKA 3FMGA 5DNDA 4K6HA 5K1ZA 1NI5A 2H2FA 4BLTA 2B5OA 3U4DA 3W5BA 3CZPA 2VPQA 4NMHA 1W88B 3WYDA 1ZUNA 1GNSA 4OG2A 3ZBUA 3NHMA 3U44A 4HAUA 4BNHA 9GPBA 3ULKA 3GV0A 3DTNA 1N7GA 1WOMA 4LXTA 4OHCA 4JZKA 1K89A 4H3VA 1HDYA 5JXWA 1EK1A 4IBOA 1D1QA 1FB5A 3H8VA 3MMXA 3IUYA 4RY8A 1XR3A 2EKPA 3T61A 2HWKA 3UM9A 1MB0A 1FDUA 4UNIA 1IBKB 4HQNA 4OYHA 1JU3A 3E35A 3LHFA 4L5AA 4XKJA 2PNJA 4ERNA 2ECQA 2Q3BA 1J00A 3IDSA 1LPOA 4M1EA 3NGMA 2I71A 3TMYA 1OASA 1XCBA 1YBVA 1F9AA 2AJBA 2MU1A 4AJJA 1SHUX 3QNMA 1R4AA 3I1FA 3MM4A 4W1RA 4C0AC 1BCSA 4BNLA 4XWKA 1V95A 1I3OA 4F72A 5HJ5A 5JYBA 4DF3A 3GLRA 1BGWA 1AB5A 2BGNA 4WFKA 4Z0HO 4BL5A 5DKFA 4ER3A 5LIRA 2ISSD 1HDIA 3HR7A 2JJYA 3KZCA 1JDVA 2HQOA 3RUFA 3TRHA 2OFOA 3VJMA 3PP8A 5TPWB 3SYKA 3WLAA 3ZX4A 1QYIA 1WMBA 3CW8X 1WOYA 4FCVA 1GU0A 2QY6A 4URFA 3NM6B 4MWOA 1LX6A 4WXMA 4CIAA 4Y6RA 5J4LA 5K8TA 4NI5A 2G40A 4LV8B 2W58A 3UGTA 3V32A 4LBVA 4O4IB 2AGVA 1FMTA 5EWMA 3H9QA 3OBBA 3VO9A 4C6TB 4X62B 2G4LA 4N0DA 2XKAA 1GP2A 1PQYA 3JQPA 5IMBA 5JSZA 3U4GA 3PHBE 1I3NA 1MORA 2HBZA 3NHUA 3EN0A 2QIPA 4KVAA 3VM6A 4X95A 3UANA 3DYVA 4ZU1X 1ZUNB 3VNQA 3I23A 2Q5LA 3U3MA 1VG1A 4GX5A 4UXIA 1FS5A 2NUAA 1IQUA 1CP2A 2HQBA 1ADYA 2Q6TA 3UXMA 5DTQA 1XN4A 1CY8A 3IBGA 1NYLA 3WMGA 6Q21A 3ADDA 1EH5A 2QRKA 5JAZA 2WR8A 4LWOA 3T7SA 3ZS8A 5CFLA 1JFFA 2OAEA 1X70A 5SYMA 3RC8A 2MCFA 1GZHB 4HAIA 1W0KD 1PR9A 1PR6A 2G67A 1KE2A 1GAJA 5HXAA 2DUWA 5LP6A 1IZYA 3R1IA 4QBGB 4C0WA 1CUBA 1Q21A 3WK4A 5B1EA 4C08A 3M4YA 2Y05A 1N5KA 4CF7A 4B8ZA 1DCMA 1MGOA 4QAQA 4ABYA 3OQMA 5I4IA 1BCSB 1UJ6A 3FROA 3SBDA 4IXNA 4PEVA 2I8LA 1FU7A 1MJ5A 1VSVA 2PHZA 4W6ZA 1UDXA 2XSZA 4L6AA 3SK0A 2O59A 4RTQA 2OL4A 1G6HA 1KO5A 3DNPA 1J4AA 3CLUC 4JASB 3KETA 2I4MA 1H93A 2CN1A 3EG5A 3K53A 4DC0A 2DPMA 4X1IA 2FWIA 5DMHA 5CH8A 2PL5A 4QRIA 4RHTA 1OIVA 3L02A 3OLWA 2ZATA 4Y0NA 1C29B 5C7YA 4BNDA 5J4KA 2GEFA 1H8ED 2PL9A 4OXIA 1P7PA 3FJYA 4I55F 4WK6A 3GN2A 3PGLA 4CQJA 3V8PA 2DFDA 4NJOA 1CIPA 5JSZB 5K05A 3E05A 3SF8A 2P6RA 3N7AA 1UADA 2BR5A 3AR6A 3ISVA 4HPWA 2RH5A 4C7JA 1L4EA 4QODA 5AKHA 1YGYA 2NUAB 4KWIA 5JC8A 1XD2B 4N01A 5JNSA 4M1WA 1X0VA 2C2HA 3GRKA 1RZVA 5BWLA 2OKGA 1D6JA 1UFKA 3WJAA 2ADFA 5AT1A 4ACBA 3GVXA 1X8XA 2YOFA 4LXYA 1TEHA 4LJAA 4F96A 4TVBA 3HP4A 1CUIA 3EXHC 4JLAA 2YL2A 4HI0E 3TOVA 2I99A 3BBPA 3EXG1 1WG8A 3EDQA 4MAAA 4KPGA 4P3KA 3ZZ0A 4NDNE 2I4NA 3F71A 4D43A 4YMTA 1P5RA 2J3QA 3KDSE 1U9CA 2GJ8A 1I4OA 3EC1A 4KAJA 4N3BA 5K3AA 4Q6WA 5JASA 3VR4D 4XRGA 3IUBA 3ZYCA 3W1VA 4ZI7B 3GCDA 3SJBA 3FZNA 1ZBQA 2GXUA 2PBZA 3EPPA 3AR5A 3I28A 3J7TA 3A37A 3ISJA 2CF6A 3GFOA 4KQWA 4UNQA 5KJEA 2AX4A 2WQZA 3FYDA 3PFHA 3NX4A 2PUWA 3B3FA 5BSTA 5C34B 3VVMA 4CMCA 1FUKA 1WZIA 5IH7A 1E5XA 1URPA 1DELA 1JIJA 1ZWLA 4N7MA 2VHZA 1LC0A 1CF4A 1QGZA 1P91A 1V1JA 4EQZA 1ESDA 5A05A 2FPGA 2JHAA 4BLUA 4PSVA 1GGVA 3OZBA 4Q15A 4BNDB 4O6VA 1FP7A 2EP8A 3GK3A 2BR4A 2QLBA 1XWFA 3DZKA 3RCBA 3RYHA 2QRQA 1RT9A 1YUNA 1WR8A 4MA4A 3VV3A 4OAQA 4RVOA 3QX7A 1DCKA 3KEFA 1C9MA 2QXUA 3I9KA 1MV8A 1LGYA 3DLPX 3OO1A 4RTNA 3W7BA 4JVOA 4RV9A 3VNAA 2BM8A 5IHXA 5IKXA 4ER7A 3H7IA 4G8BA 1XF9A 4AYTA 4U6SA 1GUAA 1N1EA 1U65A 2UZAA 3HXMA 1YQXA 3ITEA 1KFCB 3HYTA 1JHOA 3MJTA 1PS8A 1ZCFA 2QNRA 5IK2D 2RHTA 1Y7HA 1JQ3A 1ZSNA 2VHVA 4PLZA 3VX4A 2W2KA 4TYMA 1HYHA 2BEVA 3V00A 3U7HB 4P84A 1Z25A 5CM8B 4YJFB 3UJ9A 4M8SA 2K6GA 1YQEA 1N92A 4QJ4A 3ESYA 3EULA 2J5KA 3H5LA 1O95C 3QE2A 4ITVA 3S2FA 4L85A 4XIJA 4Q7EA 5EKXA 2X1MA 1TI7A 4ZI2A 5JT1A 3CF0A 3U7FB 1EHCA 1TMKA 1E5QA 4IYRA 3RS5A 2FUG1 3KVOA 3SNKA 4KH1A 4I1PA 1CR4A 1EE1A 4KZPA 2CBZA 1LV7A 3WNCA 1C30B 2IEZA 1FPMA 3ILSA 4R01A 4J3NA 1WUJS 1TAUA 2EX1A 1CK4A 3EGXA 3TS1A 3GEBA 3WLTA 3COZA 3X1DA 5INTA 1NL3A 2OVBA 3N86A 4GUAA 2X5XA 4WQMA 5HS6A 4D45A 4EX6A 4LMPA 1KP2A 4PAGA 5FUXA 3LC7O 4BX3A 5E3HA 1M2WA 1DBIA 2AR0A 4KE7A 3TRDA 4KLZA 5BXYA 3ZCPA 3A4YA 5GZ6A 1FW8A 2VT7A 5FPKA 4O3MA 1H0KA 3PUVA 4JHLA 3V8RA 2P30A 1AGNA 2JGDA 3ONVA 5NULA 3TE6A 1PFQA 2I65A 5AM2A 5EPOA 5JALA 4NOJA 4R5MA 1WY7A 4EJSB 1PRYA 4TS1A 2FV8A 5FTWA 1VMIA 2AN9A 4MI6A 3JYOA 1Z62A 2YINC 4RK0A 1JLHA 1JLSA 1Z33A 1NQ5A 1QWSA 1W8DA 5AVTA 1ZRHA 3I04M 1KJWA 2QM3A 3ZDYB 4CN9A 2O5CA 2JGRA 4YAUA 3VSCA 2Y1FA 1UZAA 4M7RA 5H70A 1ZVKA 1XJ0A 4OQ4A 3L46A 2BBOA 3EQ8A 2DBZA 1CPYA 1GOTA 3NVDA 2BEVB 4MYTA 4NYMR 4BQNA 4E4RA 2W6QA 3B38A 2PIDA 2ZKIA 4G9EA 1PCXA 1WLYA 4RM2A 4Z51A 2AMLA 4QGBA 4HXYA 3PKJA 1BDJA 4PVDA 2QRVA 3CZ4A 4HTAA 4CHTA 4NBTA 4GOXA 1DL5A 2XWQA 2G1UA 4NV3A 4KXUA 1QOZA 3IAEA 4QUBA 2P8JA 2B0JA 1I1OA 4ITRC 4ZQCB 4CM8A 2O52A 3IA7A 3KOUA 1KH1A 3EEYA 3EGIA 3EZ2A 1RHMA 3VKGA 5C2JB 1PZEA 1NVEA 3WHKA 2WSIA 4Q9LA 1MKYA 3Q88A 1U0GA 1J09A 2ZSIA 1XOIA 3N2LA 4DV7B 3V55A 4D0LB 4X0EA 3I61A 1T2AA 4YO7A 4RJLA 2JEZA 4B40A 4F2PA 2MSDB 1UBFA 5FPYA 3QUQA 2BFPA 5WRFA 3UJPA 1ZGZA 4HFNA 1FTSA 4QULA 1FVFA 3RRMA 5K2OA 1VIAA 5D3QA 3A1NA 4UVIA 3QELB 3RAJA 4WSOA 4AIIA 1EPUA 1NVBA 4FS3A 2OAGA 2TMKA 2QTVA 4MVJA 4FK8A 4Z4IA 4F6LA 3K2BA 4KZKA 5C53B 3CZAA 1NZDA 1XKQA 2NXWA 4DR6B 3T7CA 3AR4A 3MCZA 4MV0A 1ZU5A 3FFTA 4ZJPA 3M6VA 1EVZA 2JHFA 3Q98A 3P2KA 4U2EA 4D41A 3OOHA 4JAVC 4RKFA 3WBFA 1OOEA 5IVDA 2ZTUA 3DC7A 1Y6FA 3LHIA 4CKWB 4DNQA 3L1UA 4XWWA 3E9YA 3LZCA 1LTHR 4W7IA 3AFOA 4X45A 4JV5B 1E1RD 1V35A 3ZKAA 1E9BA 2AV6A 4MOWA 2NAPA 4G0NA 1SBYA 1UBTS 1YS9A 1P8AA 2HK6A 1XXHA 1YR3A 3HL0A 4DA6A 2YHIB 1GEEA 3FM9A 4M7PA 3CRMA 1CRPA 2QRVB 4TWZA 1EQUA 3GRZA 3O1IC 4LKOA 4H27A 2O20A 4XYBA 1DBQA 1GZDA 2KJQA 1Z2OX 4NV1A 1T4MA 1LSJA 5AICA 5IEBA 1DT5A 1CUXA 4OK5A 4QDTA 4YUVA 5B3JC 5BUQA 3MG9A 1BFDA 1XZLA 4K6MA 4RJKA 4NTZA 5KVAA 4G1BA 2V6GA 4YALA 3H5TA 4RMIA 3OZDA 1R0RE 3IAS6 3IS3A 4JBLA 4QHYA 4EJ0A 3JQDA 3MTGA 3BK2A 4DSOA 4XTCS 2JLCA 4AJKA 2RGXA 3AF6A 5ICSA 3F5MA 3SEZA 1UKZA 1YHYA 1LPAB 3H17A 3M34A 1XAIA 3H6HA 5ALTA 5KTPA 1N2EA 2XZTA 3K1JA 3DVSX 2YQ4A 1E1NA 3BDAA 1MQAA 4PQYA 1IIRA 3AKDA 5BWMA 1SPXA 5DHPA 1P2UA 1XA3A 4LE1A 1MX9A 3VU9A 1ZJ6A 5DFAA 4H1TA 2E1RA 2BBSA 3TW0A 4UUAA 4CLRA 1Q1EA 4KFSA 2ZBFA 2X9VA 5FBHA 1P1BA 3LKVA 4MKXA 1R88A 2QTVB 3KUXA 3OO0A 4GZ5A 4K6KA 4TL8A 4OJTA 4TLCA 4AUKA 2PGXA 3L6EA 3ILHA 1I6WA 1A5SB 1CIVA 3OEHD 3KWMA 3OU7A 3MRSA 1FYVA 5DHRA 3MS4A 3ZWQA 3ABRB 4DLYA 4AY5A 3PGKA 3PR3A 3V4FA 4CPDA 3IVXA 5KDLA 2C2ZA 1CQWA 4IZ6A 2AZTA 2UUCB 5AQEA 2XUOA 1P5HA 5JCJD 2OR3A 4V2UA 2HTEA 1BDHA 4ZA2A 2F4VB 3I2YX 4XWYA 3GRCA 4JKIA 3NHZA 4ZAZA 4IY1A 3WDMA 3AKZA 4UDOA 1ANKA 2GBIA 1Y4AE 3W2IA 4L1KA 1DG1G 3ZHTA 4DQLA 2QL9A 4GO1A 3NS7A 1YACA 3CWCA 4XYGA 4GC5A 3FKSA 1OJLA 4PQEA 3WAKA 1HE2A 5KOHA 5K99A 1T0BA 1UKCA 1Z88A 2IC5A 2R62A 1PL0A 5HJ2A 1QFXA 2Y1XA 2Z8YM 1K27A 4M2LA 5CW1A 1NYTA 2VJMA 3LW7A 5KNDA 4R41A 1SXHA 3C39A 4X20B 4ZK6A 2HSDA 1DDGA 4UUMA 1NNUA 5CIWA 3QPVA 1B6SA 4BVGA 5JJIA 1JQDA 2A9RA 3GCWA 4W5RA 1G3QA 2VHCA 2E5FA 3NHBA 1QVVA 1E1YA 2FZKA 4Q6BA 4RL6A 4DLTA 5ALVA 4I5FA 4P0QB 4FHCA 4I08A 4M46A 5TGDA 2X0FA 1CUJA 1E1LA 2JZOA 2G5TA 4XQEA 4E5VA 4ABTA 1MO6A 4CLRB 4R84A 1ECBA 5A2QA 3VU1A 5L4NA 3LC2O 1G2QA 4BKRA 5KWVA 5CDGA 2VRCD 2C3YA 3R7NA 2PGDA 4YRQA 1LRLA 4BP8A 3OX2A 4I4CA 3PB3A 3TXAA 3VC3A 3U5ZB 3T1OA 1SVNA 4E09A 4EHDA 4I36A 4MRSA 2OCKA 2HADA 3HU2A 1KU0A 3VZCA 1WLSA 2BKLA 3KJHA 3CLUD 4IS3A 4C6SA 3KZNA 5JRZA 3WISA 3CGWA 2HY7A 3G5LA 3FI0A 4YJGA 4F12A 2WB2A 2QHXA 1LRKA 1A7JA 1JJFA 2DT5A 4Y2TA 3UT5B 2IYPA 4MPJA 1VL1A 3R0ZA 5JS2A 4JI4B 1UEIA 5D00A 1GQ2A 1U2DC 5FUBA 3DBLA 2I0FA 2VP0A 1L4FA 3HDVA 4GBGA 3N59A 4PO9A 1ATZA 1WY5A 3T95A 4CMIA 1NXOA 2AN5A 3HA7A 3C7KA 4H15A 5F2OA 5A3RA 1H8EA 5EE3A 1YC5A 4MPTA 1UBHS 2G77B 3I76A 4QTYA 5J47A 4ZN6A 5KOHB 2ZI9A 5IAEA 5BNIA 2ZIXB 4O1HA 5FD8A 1JRLA 1LLFA 1Z3CA 3NTUA 3F3MA 2IU0A 2O8VA 3D6JA 1ISRA 1YK0A 2V4MA 4F4FA 3OIFA 2AZXA 4B3GA 1V1MA 4YP6A 4UBIA 1AH2A 1PYDA 3SXPA 3A9UA 5IC4A 1VL0A 1SHTX 1IG0A 1IN8A 2XVYA 5L7YA 3DFZA 1KEZA 4YT4A 1D1PA 5KAMA 2ODAA 2Q7OE 1HQYE 4JT4A 3WAJA 3IB6A 1DUVG 3RIYA 2J3DA 2K5UA 5TGZA 2GF2A 1UPAA 2B6NA 2B4KA 4JYMA 3RVRA 3MJVA 3GJ5A 4LY0A 2H07A 1BXGB 1GPMA 2NQ8A 4KB5A 4CETA 1RHRA 1M0TA 1V2GA 1COWD 2ECOA 3C3JA 1KI9A 5EVCA 4DSNA 1QZUA 2C77A 4E12A 3P2EA 2GLUA 4B75A 3RADC 5I7AA 2WJPA 3PQEA 4TTIA 1ISMA 4X3PA 3H0CA 4QBTA 2CFOA 5JHGB 1DEHA 3CH6A 2EFCB 2P1ZA 3PFWO 1JWLA 3KSUA 3MXOA 1EGQA 3NP9A 1EVKA 2K7FA 3CW2A 2OHHA 1MO2A 5DGHA 3AETA 4YWHA 5T41A 1CUVA 1SBQA 2W93A 4UEWA 3SQLA 3D7MA 4YJGB 3S1AA 4ZVKA 4E6PA 1NUQA 3LMKA 2LXNA 3GLFA 4LYEA 3JWJA 4F92B 5IZCA 3EVFA 1TQ8A 2D5LA 1JJIA 5DXJA 2DHDA 4OP3A 5HZGA 5LQSA 1WM1A 4ZANA 4PF1A 5ED0A 2JCSA 2GR9A 4WJLA 1RM4A 5GOTA 2WU3A 2C4MA 1UQRA 4DAOA 4IMIB 1QRUA 1FSPA 4H7EA 3ICEA 4BO0A 2B8TA 1FOEB 5AESA 2JCBA 1XVTA 2NIPA 2P0AA 2P9CA 3BX1A 1X7ZA 4IV5A 4P7GA 4UUQA 3TYXA 3UCXA 2JKYA 1M2OA 3NALA 4OQXA 2ZRQA 2GD1O 3IOCA 1IE3A 3CPJB 2NZXA 1S89A 1YI8A 1VKJA 1I2CA 1FK8A 2G07A 3UWKA 5FV7A 5IK2A 3ZD8A 4Q7KA 3DCIA 3X0DA 3T3PB 1J8MF 4DARA 4EW2A 4YJ2B 1QR6A 3QG5A 1O95D 4W1SA 4RJTA 2H65A 4NFYA 2GPYA 1Z29A 2HEGA 4R7TA 1Y3CE 3KT0A 5FLEX 1HDRA 1RCTE 1M73E 1YC2A 4BGVA 4I6EA 2A94A 2HU2A 1LRJA 2BHNA 2FPLA 3ANYB 3MWGA 1M1XB 2P9EA 3OJXA 4REMA 3DEFA 3ZIAD 4A27A 2PZMA 3LPLA 3RSGA 2BFMA 1Z8FA 2RAPA 4NDZA 2DULA 2QX8A 1ODLA 4J43A 4AU1A 1A9RA 1H6BA 4YC7A 4JENA 5IPFA 1GSHA 2PLAA 3A06A 4JX9A 4TMWA 3T9FA 2NVUB 5JNRA 2JASA 3RF7A 1V26A 1NW4A 3VQTA 4G5QA 3Q8MA 1G41A 2FDCA 2F8SA 1WKBA 3BD7A 3O5AA 2FQXA 2KPOA 1XRNA 1OIWA 4XB1A 1NAIA 2YJTD 5FJJA 1GQQA 4FZ3A 3GZTB 4AJ2A 4KPYA 3D8UA 3O0DA 3OURA 3TRKA 1ZM9A 3V46A 1ZYUA 1BDIA 1ZC4A 2D8AA 3CR7A 3PNYA 3K0CA 1AT1A 3GIWA 1SURA 5EPEA 4YT8A 2G06A 1PR4A 5AHXA 4DLXA 3KD2A 1GTMA 1X7ZB 1MUUA 2CLSA 3B12A 1KJIA 3A28A 3AY0A 4RPHA 1J5PA 3BTOA 4XA8A 4L9WA 1K7YA 2IGBA 5DHTA 4RA9A 3PIIA 3R9IA 3D0QA 1I4EB 3SIXA 1JG3A 2ODPA 2R47A 3GGPA 3ANNA 2VTEA 4DA4A 5FKJA 4HWSA 2HYDA 3HJGA 2GKSA 4FGUA 1U3WA 4GOOD 3QUCA 1NF2A 3DEAA 3QW2A 2FTKE 3NWPA 4MWCA 1CETA 3P0JA 2QWXA 2JFWA 3H6KA 2NV6A 3SBXA 4F21A 1VYVA 1O6CA 4DCJA 3INNA 1RWNA 2ZJBA 3A6PC 2MHCA 5F73A 3IEMA 2PMCA 3WO0A 2AKAB 3UFBA 1JU4A 1AA6A 1R12A 3D0KA 4LZNA 4KC0A 2QQEA 1DKUA 2Q3FA 1PTJC 1ZO8A 2BI7A 2VPIA 2ZR9A 3H9BA 1FXWF 1NATA 1SULA 1XAGA 2ZJ1A 3OKCA 4X85A 4XOUA 2D2FA 5D5QA 4CLOB 2H63A 3BE8A 3DMFA 3NHAA 5A6SB 4WLNA 1JR4A 5DI3B 3JARB 4Q39A 2IS1A 2FHPA 1JWAB 3IUMA 2WZQA 4R9NA 3S81A 1KFBB 3MJSA 3INGA 1XXLA 1LY1A 2PT6A 2JLBA 1NKVA 1QH8B 1TAGA 1ECGA 1XIVA 4QDXA 4AQ7A 1TT7A 2ETVA 3D9QX 3B60A 4IKPA 1ABFA 3UJAA 2FPSA 1D7OA 1PJCA 5B58T 1CULC 3RNLA 1Z4LA 3UA4A 1WCYA 6CHYA 3KJFA 1ZN7A 4FEGA 1H2EA 4XQ0A 4UM9D 1HT3A 2Y9PB 2XVMA 4IDBA 3GLKA 4NBLA 3DAPA 4NULA 2CKDA 4PSDA 5SY9A 3U7RA 2AVNA 3O2JA 1WBBA 1W4LA 4YIKA 3E1SA 5E95A 4RA9B 3CVVA 1XVIA 1HYGA 2WLTA 1G6KA 3IA2A 4HJRA 5GVRA 5GZ3A 2C5BA 1Q1ZA 4LF8B 3TZ6A 1U9ZA 3TG8A 3COJA 1C0KA 1ZY2A 2D3WA 3BSFA 3IT2A 3LX8A 1E1RA 2WDPA 4FYIA 5ICFA 2QSZA 3TKAA 5JMWA 5ALOA 1F4PA 4GQBA 3RKRA 2XJ4A 3FCSB 3I6IA 3E53A 3JQ9C 4X00A 4F5DA 2VK8A 2VDRB 2Z2KA 2R5NA 2ZYVX 4PY2A 3WBBA 3R7FA 2DUNA 8GPBA 4DW8A 1MB9A 2AN1A 4Z8XA 1ISPA 2BDTA 5LNK6 1ZVQA 5ALKA 3M2PA 1U94A 4XE5A 4HNVA 2F62A 5BXQC 4ZAGA 1L7QA 5JISA 4L73A 2Q1UA 4PCLA 3FYTA 4IF6A 4YO8A 4LAFA 3O74A 3HUEA 1GUYA 3UN1A 4U7WA 4LYDA 1FX1A 4U7DA 1B2LA 3AFHA 3L1HA 4O1IA 2RMKA 1XTTA 3MJ4A 3TWOA 3UAVA 1G7TA 5EFZA 4CODB 1E3SA 4UPVA 2IDZA 4XUEA 3BRSA 1IC6A 2FQYA 4MGHA 2C3MA 2QW8A 3UAWA 4Q7QA 2D5IA 4B74A 4JQSA 2O1XA 5KINB 2QU7A 1JE1A 3IO3A 4GLJA 3I9JA 4OBBA 2FMIA 2JD0A 2O2DA 3LCRA 4MK4A 1GPH1 1PEDA 3QVTA 5KQRA 4PPFA 2CVHA 2W6OA 3UK1A 1I6KA 4M53A 1U2GA 5I9NA 1GAQA 4FQ5A 3LT1A 2ILVA 1U3TA 4ZVOA 4BNKA 1IEXA 2ZPTX 2VJCA 3BFPA 4LMBA 5ESDA 2I4TA 2EF0A 2LGJA 4N8EA 1P31A 3V2IA 3GHYA 2CVFA 3DMRA 3Q8KA 1UXHA 4UZSA 5CDTA 3IOBA 3H99A 3RT9A 1CZOA 1OFHA 3B1JA 4ENUA 2XXAB 5A6VA 1QANA 2HEIA 4JIGA 4ADSG 2D4AA 5FO0A 1K9VF 2HA5A 1S1MA 3ROGA 2QZJA 2NP7A 1T0UA 1FRVA 3ANSA 4L4SA 2LDBA 3RYIA 1V8PA 3CE9A 1HK7A 1O94C 1YD7A 1OROA 4O2BA 1PGQA 1V8ZA 3WLEA 4GPEA 4DV4B 2RGCA 4GOMD 2DSNA 3BRWD 5EP1A 4YRGA 5A4MS 5AVOA 3GWZA 3M9LA 4RETA 3ZN2A 3F47A 3LK6A 4BFSA 1A5BB 1K7FB 4LISA 3TCKA 3HP7A 4DFDA 4JOSA 4QPNA 1H3FA 3ZY5A 1QHYA 2X3UA 3AC0A 2I29A 4Q3AA 1Y1PA 5ENZA 4JI2B 1A4IA 3AL3A 2YDXA 3HU3A 5HIJA 3B51X 4EUFA 5ARDA 3NANA 3DFUA 1Z2NX 2NU6B 4UE2A 4QYIA 1FJGB 2ZZNA 3L7JA 5C18A 1E2IA 1BX0A 1UBJS 3GLHE 5BVGA 3EA0A 4YYEA 1ELOA 2C98A 4L5YA 4G86A 1DC3A 4AW9A 1PN3A 4HH0A 3R77A 3HM9A 3KHTA 1ZINA 3D6HA 3C85A 3HMQA 3MZ0A 4UTOA 4EKNB 2QTFA 5CJ2A 1WV0A 2V0CA 3GP5A 3H16A 3NUZA 4B6QA 2VFAA 4V1CA 4CM6A 4QU9A 2J3HA 4C3OB 1NOIA 5C5EA 1IBCA 1TM4E 2UU9B 4COKA 2IYWA 5ADHA 4PLPA 2ZS8A 1BMFD 3WKAA 4DSTA 2GZDA 1VC2A 3T9DA 2UUOA 2DC1A 4MH0R 4UAUA 1E2HA 1X1AA 2O05A 1QVWA 3W5IA 3H2GA 2I2AA 5A5DA 2JGMA 2AT1A 3T5TA 2BAGA 3JWHA 4LIPD 4FW9A 1USWA 3DEIA 4MW5A 4JCCA 4ZI3A 1AU9A 5IKPA 5KHAA 1L8AA 1Z7YA 3U4AA 3CEMA 2O8CA 5F23A 3H1FA 5H59A 1KYWA 3PVSA 2XOEA 4NYIQ 4OHKA 1IDN1 4ZIRB 3PT9A 2J9RA 4PG8A 2CXHA 3F6BX 2Z2JA 5AK4A 3PQ5A 1ESZA 4HXFB 5BWOA 2ZBUA 4ZPXA 5JOQA 3N58A 4J16C 2QRPA 1CY0A 3DM5A 3RUAA 2B30A 1EJ0A 2Z43A 1EGHA 1M34B 4WEQA 4RZ2A 1U3UA 1KEVA 2LKCA 1HRKA 4LHVA 4PQFA 4GRDA 1Z36A 3A7EA 1RTKA 3ZXUB 4HF7A 3OZSA 4MVJG 3ZXYA 2IEBA 1DAIA 2IPXA 4CTKA 3ROZA 2P6UA 3RT1A 3STVA 1USGA 2Q1TA 2R65A 1NVVR 1TJ4A 2CFCA 4LRXA 4AC9A 5JCZA 3ERCA 1MO3A 4UFPA 4L74A 4IRUB 4TXJA 2P6NA 4UOQA 1Z28A 3ICCA 4PRZA 4R68A 2FW6A 2ZTHA 3NBFA 1WNTA 4V1CB 3B1XA 1BC5A 1COWA 4HH1A 4A1OA 4NAHA 4WK4B 5K8IA 2QD1A 1U4NA 2XUDA 3F3YA 4MW7A 4MR7B 1N0UA 3LQYA 4DV6B 4HDKB 2JGAA 3N9IA 3FZYA 1NYQA 1DSSG 3N6VA 4UXJA 3CVJA 4F38A 5KJCA 3RUHA 1TJPB 4CKZA 1P6UA 2P5YA 2Y1OA 4HAOA 3OHMA 4DQXA 3U4CA 1MT0A 1T3ZA 1TK9A 2FWRA 1QHFA 5DIFA 3ZI0A 2VWHA 3G8CA 4JNCA 2ZRJA 1PQWA 3HN6A 2NTJA 4R1SA 4UBJA 2GTPA 4MQFB 1DCTA 1EIWA 1XZAA 3WYBA 2VT3A 4HYQA 3S5JA 4BRUA 1REQA 4TYWA 4UJ5A 2PX0A 1D9ZA 5DSTA 1N5RA 1WB4A 1VHLA 2CXTA 2O2CA 3MTEA 2O8CB 1F5NA 5KYXB 1ENYA 2Y0PA 3K6JA 2Q7XA 3IDAA 1NVUQ 3UHJA 3G88A 1JUDA 1Q2XA 5T7BA 2H4JA 1ZIXA 2JFGA 3RTBA 4BJ6A 3B2EA 4FMDB 3FGZA 4OB7A 3E3NA 3JX9A 4TX1A 3FGPA 3FWPA 2IOFK 2ZYSA 3EA4A 2I7XA 3GL9A 3I1YA 3AHHA 6REQB 1PGPA 1EVEA 5IAOA 1KL7A 1EFRD 1A8SA 3PC2A 3OOYA 4MINA 1OT5A 2WT9A 3GJRA 3L0IB 2C7PA 3FOAA 1DZIA 3G5AA 3L05A 4BGDA 3TBFA 4FC7A 3C4QA 4RHFA 3H1AA 2ZSHA 2WSMA 2Z2YA 5EZSA 4EF6A 4RBNA 4IJWA 1U0TA 4Q7LA 2GTIA 2NUPA 3TH5A 4D4HA 1TYDE 2OG1A 3O26A 5IWCA 1EFTA 2JHPA 1COZA 3IV7A 4FCWA 4NCKA 3UHAA 1KFKB 4V0ME 3UXYA 1L9KA 4LSWA 3RRFA 2I2BA 2OMKA 4D81A 1NJ2A 4FYKA 1I14A 4R1LA 3AHCA 3QKRA 4YQEA 3ZIAA 4CR7A 2IY9A 2JI4A 5EYPA 3ZE8A 4BV9A 3SJCA 1GRCA 1RHJA 1WQ3A 3G2LA 5CBPA 4WJKB 2XGOA 5EUCA 2CNBA 1VBNA 1IXYA 1E3LA 4TROA 4CTMA 2O0MA 2VP3A 2Z58A 2PJRA 4OB8A 2UUAB 3HDHA 3DONA 3W34A 3LBNA 3AP1A 3Q3CA 4M60A 4PM4A 3TOXA 4RZSA 5C37A 4UZEA 4RE6A 4LTMA 1REQB 3SWWA 2X5KO 1L5RA 1RJDA 1V7CA 4JJ6A 4PTLA 1J6UA 1UBMS 1NXXA 4JC5A 1SBZA 3IAXA 4EBBA 4NC9A 5EJ8A 5K6AA 2GD0A 3ZLTA 3CTMA 5CNJA 4OFZA 1J33A 5BN4A 4GM0A 2Y27A 1E3EA 2EWVA 4PYLA 5I8WA 5TMPA 3M6XA 5GGYA 2X9GA 3TNJA 3TUZC 2CWDA 2E5LB 1TCAA 2EARA 1HFJA 1MQ8B 2Q45A 2RI0A 3KLNA 3PCRB 4IQ4A 1A4RA 1VPTA 4FSDA 4MIKA 4BZQA 4RMNA 1AMOA 2BGMA 2IYNA 4FDVA 4BN4A 1O5OA 1WPXA 4W9MC 3PA6A 4C5CA 5IXJA 2C42A 1Y7LA 2JC3A 2C9DA 3FLBA 5IUKC 1JAIA 1EK2A 4YK7A 4FILA 4TYYA 3KOOA 1NT2A 1HRDA 2ZYRA 1INLA 2A2ZA 5A5GA 2G63A 1HV8A 4ROSA 1MG5A 3T3DA 4CMKA 5L9AA 3OLYA 1US8B 2O23A 1ICIA 5A5VA 4GEKA 3U16A 3BHMA 4REQA 4ZJYA 4KLCA 4DGSA 3QKRB 5EE5B 3WLFA 1WUHS 4CCWA 5CA0F 3MJDA 4OMDA 4R40A 2W2VA 1K06A 1FXSA 1M7HA 4KQGA 5CBPB 4ENSA 5CEFA 5IJ9B 1VBKA 4S12A 2PX6A 4Y6QA 2J6CA 2W2OA 5AKLA 3VO8A 2Y67A 1XFDA 1WQ1R 4CCSA 1DOAA 3ZY3A 1W29A 3AGPA 5HKOA 4M0PA 1DV2A 1VKRA 2B20A 5AW8A 2HDWA 1TM7E 3CNNA 1LU9A 1F0YA 4YRTA 1EUYA 1YZ3A 3DL7A 4LJ5A 4BCCA 3OEED 1MEEA 2QG9A 2Q3CA 4C3VA 1P77A 2BZSA 1KO7A 4MEAA 4YXWA 4A4DA 2OBFA 2QENA 4DCSA 2F3PA 4MVWA 4A9AA 1CUYA 1SUFA 4H7HA 1E89A 4I8IA 4JC4A 5BW8A 5IKMA 1DKRA 2CD9A 5JS8A 2IZ0A 4GMKA 4U9IS 4Q9JA 3GDHA 2HRCA 2Z0MA 1R7RA 2FZ5A 3RV3A 1JW9B 2ZI3A 3LO5A 1WABA 3KUDA 3JVUA 3G13A 3F1LA 4UBKA 1RYHA 1JR3A 1FNDA 1RXEA 2QN3A 3OZ7A 1F5SA 1ZRNA 5E8JA 2ZIFA 1L7VC 2PX2A 3Q7IA 1DEAA 1NUTA 4U7GA 4ETNA 2CFIA 4WESB 1SGWA 4S1VA 4CXMA 2ZR0A 2WLSA 1KK1A 5HKKD 5LMUB 5HA5A 3KTAB 2JS7A 4ONEA 1ESNA 3U3XA 3NVKI 1DKLA 3K9BA 1XMIA 3OPVA 4W7HA 4ZMRA 1ECPA 3H9CA 1SKAA 3ZWBA 3EQ2A 1CFJA 3FFXA 1JT2A 2BFFA 2Q3HA 1M6VA 2W2PA 4RMJA 2QMHA 2BFEB 1Q0ZA 3CLKA 1VJRA 5IP5A 2QTZA 4P0TA 5LA6F 4TQAA 3BTSA 1KDOA 1MU0A 3D8NA 3H1GA 2VIIA 4HNUA 4TL7A 1KJNA 5A3JA 1CQJA 2C4TA 2NQ2C 3NPAA 2HR1A 3LYAA 1Q15A 3N39C 2HCBA 3DZ8A 1Q1GA 2R96A 1OX6A 1L4KA 3OFJA 3QRWA 4KXLA 2XQKA 3BCSA 4KXFB 3T7AA 3GQVA 4O0MA 4IDNA 4OOEA 3ETEA 1I7LA 4JLKA 3U3JA 4CV2A 3EVNA 3IP1A 1C9KA 1WCV1 2CXOA 2P91A 3V6MA 5CXUA 3GFVA 1DBPA 3IIKA 4HMPA 4JWTA 2B3TA 1VLVA 3GEMA 3HYRA 4OSPA 1RKQA 2R6HA 3GZNB 3ECSA 2QD3A 3ZY2A 2IXFA 2LE0A 5HF6A 1YIDA 4UU8A 1TK2A 2F4NA 1DTSA 4EG7A 1U1EA 1AE1A 4RCYA 2YZ2A 3AESB 3PA8A 2XY4A 2Q0SA 2YV1A 3DYBA 4PPGA 2BZGA 2BVNA 1QGED 3A4NA 3H5RA 3H3JA 4TOIA 4WBXC 1HNZB 1RXCA 5TMEA 4EGSA 2AXEA 3A7DA 5AHOA 1JIKA 4QDZA 4C1NA 2DERA 4QC2A 2Q2QA 2QUJA 3F7TA 4FGJA 3B6IA 4HB4A 5LUAA 5DYWA 4P4SB 3KYDA 1J9GA 4CLEA 4LOKA 2PSHA 2XKJE 2XT6A 2H7YA 2OXCA 4IEFB 2CLCX 4ZAVA 5I4CA 2EL9A 2D4HA 2CHEA 2PFSA 1BD4A 1IH8A 3IEPA 4L5JA 3JCZA 4HAZA 4XDHA 3LK7A 4PZPA 4QXQA 1SO8A 4O0LA 1KP9A 1LDMA 2W2NA 4NMWA 3BRWA 1IM5A 4WNCA 2OCDA 3UZUA 3V2HA 1X39A 5EIHA 3MLEA 4HRAA 2GD2A 5L8VA 1AHPA 3I73A 3QENA 1T9GS 4GYKA 2BYTA 1LK0A 3PX7A 1NNEA 4Q34A 3TSYA 2ECKA 3T9BA 3WX0A 4TMZA 3ZK9A 3QEBZ 3H4IA 2K7ZA 3KXPA 1VI6A 4LHWA 1OB5A 1E9CA 1QZTA 1ULAA 3LL7A 3WFIA 1OJ7A 1ADGA 1ZICA 2IDKA 2AOVA 2J3EA 3SJUA 3PFKA 4D44A 2HV8A 1N3YA 2UVPB 2NYUA 1WPGA 3SVTA 2FOIA 3ROPA 1KEKA 4MKRA 3PFIA 4ZTBA 1BMFA 2VWPA 1DC7A 1RHQA 2XI4A 1SUEA 1TKCA 2C9MA 2WD8A 5FWDA 2W2XA 2XMZA 4HD8A 1SD1A 3S2IA 3A1UA 1AQLA 2AC7A 5M34A 1SK8A 4R81A 1F7VA 3HCBA 1E6LA 1ZGGA 2X6RA 3IUSA 4RC9A 1BGXT 3Q15C 4B17A 1FQJA 1CJTC 1FNSA 3DP9A 3C3BA 3H42B 1LNSA 1KC3A 2NO1A 3JASA 3H5OA 3P4XA 2YJ6A 1Z5GA 3FF4A 4TMYA 3DHYA 4XB2A 4YRJA 3PC4A 5TMBA 2H0RA 1EJ6A 4QOEA 1VQ1A 2HMYB 4HHEA 2YS7A 1PP4A 1NF3A 3VGPA 1EQAA 1MA3A 5J2TF 5AJUA 4ZODA 3R7WB 5I3ZA 2WJ6A 2VF4X 4UW9A 1U0OC 4E1AA 3C3CA 5E1DA 5B3KA 3GEDA 4JKOA 4YACA 1K3UB 5ITVA 1IOZA 4FFNA 1ZRSA 4UHHA 3WKEA 1ZOIA 1L3BA 1YJBA 1IY9A 4TKVA 2WT4A 2JLRA 3OP4A 1OLXA 1ZVJA 3C8UA 1Q3TA 4FX2A 4EMUA 1T8YA 2YHAA 4JELA 1FDRA 1ZA1A 3L8GA 2HPHA 2E9SA 3KOWA 3MJFA 2OGZA 1J2UA 5CVEA 4C7OB 2GEBA 2I67A 5DWQA 1YZUA 2LWIA 1SBCA 1D09A 1ZHFA 3LCMA 2DY0A 4IDPA 4JJGA 4ZCQA 1NA5A 2O1SA 2V5UA 4RD3A 4D0GA 2WP8J 4MWTA 3UV7A 2QN2A 2A5JA 4C7KA 4CDNA 4KEAA 1IQ0A 1W4ZA 3ZQKA 3U4QA 5KSPA 4CKEA 2H0AA 4IV8A 1CJMA 1I2MA 1MT3A 2INGX 4RELA 4DDKA 1S01A 4FDUA 3J7AC 5AD1A 4FYJA 3RW9A 3EFBA 1TTQB 3IFSA 1ZM7A 2JK0A 4K9OA 2DUMA 1TUGA 3BE6A 2QI9F 4P58A 3RK0A 3O3NB 3HBNA 3ZJTA 3U1VA 2H11A 4TUYF 1E20A 3L84A 3TUJC 1Z08A 2F1HA 3FGOA 5ECGC 5L3ZA 1OXVA 4KIGA 4D9JA 3JASB 1NVAA 3TTWA 4BJ3A 4KX5A 5FOQA 1L1QA 2WDZA 1OYYA 3AZQA 1YS7A 3H3XA 4F56A 2XF2A 2DFNA 5L3SA 1BD3A 3CLTD 2JGLA 1JI0A 1P4RA 5TEVA 4BLPA 2HN9A 3DM9B 5KTYA 4M76B 1QO9A 3ZHUA 3HHEA 5AXCA 2QTRA 3H3FA 3HACA 3UFXA 1J5XA 3M81A 5EZYF 5DGIA 1DKOA 2F00A 2JFOA 5E6RB 4N18A 4DY4A 1R5JA 4X63A 3GN1A 3TM5A 2QD5A 5FFMA 1KKMA 3T3MB 5E6UB 4QJIA 3IKTA 1AO3A 2VKQA 2Y1WA 3U49A 2WIJA 1E18A 3WZLA 4ZI5A 1NG9A 5CITA 1T5DX 2AOTB 2MIIA 2PKXA 2BGRA 3EK2A 3G79A 2PA3A 3O0TA 2G0TA 2HWWA 1N32B 1YL7A 3GQBA 2CB9A 4P08A 3ROTA 2BSQA 1UAYA 1GXSB 1VL6A 3BAFA 3GT4A 4RLQA 2HLHA 1JDJA 5JCOC 1RVDA 5FNVB 4IGIA 5HEKA 1IHDA 1IOVA 2Q5FA 1IG3A 1VHQA 3H86A 1SA0B 2ODWA 3OOJA 4J7UA 3KLPX 5F1KA 1PKXA 4ENVA 4P4NA 5BYAA 1XT6A 2FZGA 1UK6A 5IAJA 3QSGA 4B76A 1LBEA 3WL8A 4CKEB 3DPUA 2BKAA 4D9IA 2CWWA 3NO4A 2ZTMA 1QNFA 2A1UA 1DG9A 2VHQA 3GFRA 3MWDB 3I83A 5IM5A 3W1EA 1C9YA 5E8RA 1IJKA 3VOAA 2C99A 3Q10A 1ZP6A 2ZG6A 4ZTUB 1QH9A 1PR3A 3PK0A 3TL6A 1YBAA 3OIUA 2BI8A 5KC9A 3WDSA 2WAXA 3EPJA 1G5PA 2Z95A 5C1PA 2DQZA 5AI8A 2C20A 5AOBA 4GGMX 1QC5A 1FA9A 2MSEB 2Q07A 2PBFA 1NMSA 3AZOA 4OQNA 3GF4A 2OV1A 3K9LA 3T5MA 4LYFA 4F4IA 5IM4F 1NJ8A 5LWQA 3K09C 3SZRA 1YFKA 3BFXA 3LIPA 1J2EA 1DPGA 3B8HA 3UFXB 2C04A 4EUSA 4LNUB 5JWRA 2HF2A 2JZCA 4CW7A 4HVCA 2H5JA 4OO3A 2RJNA 4OKIA 5EKSA 4OQLA 4KPUB 3ZJYA 4D2IA 2CDCA 4DMLA 1QO0A 4KXQA 3VC2A 1EINA 1EGVB 1L7NA 3LGXA 3SKVA 2V4UA 3TB4A 4MCIA 2PUDA 4KK4A 1QPGA 4OP1A 5COBA 3G1UA 1P6XA 2BMVA 3B1KA 3H9JA 2KMLA 3HB0A 3IQHX 4C0QC 1C81A 2VPXA 1V5GA 3NOQA 4IDCA 3KYIB 4KRGA 4OHRA 5D51S 3THOA 5FL3A 3ZE7A 4CMBA 4EYQA 5J2UB 4HV4A 4ZFNA 1P9OA 4XLTA 3DYIA 1IEWA 2OCPA 2JIOA 1SIOA 4WEOA 4YV2A 1FU4A 4QU8A 1YKSA 2J6HA 2ZAIA 3HDYA 5GV7A 1I3MA 1C1XA 3Q7SA 5AJXA 1CHNA 4BBAA 5CG2A 3FAKA 2RGWA 2X3FA 4FYHA 1D2AA 3CKYA 1PUJA 3TLGA 3D4BA 2WPNA 3RWMB 3C3DA 3H13A 1E0AA 4KIJA 4OHXA 4DMHA 1OXKB 4JJ7A 2Q28A 4L7VA 4RU1A 5FX2A 4ER6A 1ONPA 2XNCA 3FCYA 1XF1A 2AXQA 1XLUA 3MERA 4H1HA 1UZLA 3OLZA 4TT3A 4WBNA 1GUBA 5KDOA 5FFFA 2EYQA 8ABPA 1K8YB 4TM7A 3T3HA 3PC6A 3TI9A 1OE0A 3ODPA 4HSEA 4RMHA 1C4KA 1P2DA 4QPDA 1QIMA 1YV9A 2JI6A 5CRIA 1MXFA 1QC5B 1PI3A 4Y6SA 1WX1A 3P9ZA 4LHEA 1JHVA 3PD7A 4ALIA 4COOA 3ZWMA 1BVYF 5ER9A 1UWLA 1J8FA 2H4YA 5LYJA 5AVQA 3EZ7A 1MVNA 2JGFA 2PUHA 3AVXA 4G0VA 3KQSA 1E58A 4M8LA 1AD2A 3SVZA 2AFIA 1G7CA 2OHOA 4FFWA 1EDOA 4E7OA 4B4KA 3KHSA 2EIHA 4S1WA 3M6MD 1HG1A 2V5VA 2VNKA 5ALYA 3ZHSA 4AYWA 2PRKA 3W8FA 4MITA 3PUJA 3IHLA 4YN3A 3F7OA 4L5IA 1U11A 4BQSA 1Q17A 3P7MA 2A1IA 3OQ6A 4IHJB 3LFUA 3P20A 3EEIA 3PR2B 3UHPA 3IIEA 4IINA 5H82A 5IJXA 4YMLA 2I34A 2P2DA 1PS9A 3JQ9A 4MARA 1TX4B 2ZANA 2CXPA 5HKLA 2IELA 3PEUA 1E3WA 2WTNA 3AY3A 2J4DA 3RTAA 4DTCA 1YTUA 2Q7DA 4P8RA 3IIJA 3I30X 3W2FA 4IILA 2HK9A 2X7HA 3AWDA 4M0FA 4NECA 3JQFA 1TM1E 2ZVPX 3PJEA 4IJ6A 3OPYI 1IHPA 3P2MA 1TLTA 1U4OA 4DWWA 4TN1A 1RE1A 3TLGB 4ZALA 5L3QA 2FMUA 3HWSA 3RG8A 1JALA 3AK4A 5DW3A 1EWTA 3O4GA 4U7HA 3KEGA 1ZR4A 2A1TS 5AMXA 2ZYTX 3ON5A 1K4MA 2ACEA 1L5HB 4IIFA 5EIWA 3UGQA 3P5BA 2Z4RA 4A8JB 2NTVA 4ARSA 1IMJA 3KSDO 1C8KA 1MPXA 1ZJZA 5SZIA 1PJQA 1NBWB 3HUFA 2L82A 4LCEA 5HRCA 1Q12A 4XTRA 4DNFA 2B8WA 2XWJI 4PLYA 2M32A 1AHIA 4BEWA 5EIOA 1N5MA 2H17A 3OKPA 5ALQA 1E32A 1HDOA 2ZJ4A 3L5KA 2VDOB 1Z2DA 1SD2A 3L41A 4MRVA 5A06A 2PZ8A 1H8HD 3MMSA 3PENA 3PUHA 1QFMA 3QNWA 4EUEA 1UP4A 2ZJZA 5LYJB 3S7TA 1B4DA 1WPRA 2NZJA 4IMJB 4RKQA 2DTXA 1N0WA 3ZI7A 4LPKA 1XDUA 1JAYA 1YA8A 3IDFA 3QUSA 2OFWA 1LS1A 2O8EB 2M2IA 3U3RA 1J2RA 1L7EA 3DDUA 2ZE5A 4BFLA 2IFTA 5IBCA 2BGWA 4FYMA 5T3YA 1I6LA 4XFDA 2B4QA 4CF6A 1A5ZA 1EZ4A 3I05A 3PPIA 2OPBA 4MUEA 4R8SA 4B7CA 3TZCA 1ZIDA 3MRVA 3PC8A 3DF7A 2Q3MA 5CR9A 4F4DA 2JPDA 2X4DA 3FTCA 4QRDA 5I9BA 3TQHA 1I7SB 1LUAA 4OSEA 5F2KA 1AZLA 3GNQA 3AYXB 1GTJ1 2FPXA 4MIOA 5HZHA 3TQSA 5FPPA 2P2GA 2ZYHA 4GXRA 1QNLA 4MKHA 3RSCA 4BTLA 4YAIA 3QKWA 4AY6A 1X1BA 2X0RA 3MT0A 2EJTA 4FNGA 4G0QA 1RP1A 5K3OA 5GJBA 3ILVA 4IHAA 5JLAA 1RP7A 1KWKA 1GQYA 4TZ0A 4Y6OA 2Q6IA 1NIJA 1DWQA 2WIDA 2Q3JA 3DT6A 5CDSA 4JEHA 5KQGA 2NSJA 1G8MA 4CFSA 3GBSA 2E1PA 3LL4A 4GR5A 2QK4A 3CRW1 4WX2B 2I6XA 3VO2A 2C4VA 4RANA 1MW8X 1NP7A 4RVCA 3CEAA 2DFLA 2NLOA 2IH2A 3VHRA 2I2DA 3GPDG 1IWPB 1W4RA 4U6QA 1QQAA 1SBIA 3NWBA 3NVAA 1Q1QA 1UDBA 2Z9CA 3ZV7A 4QT4A 2V74B 3BCHA 3GGDA 2ZUSA 3GUVA 4UFNA 5BN3B 1WCWA 5KTOA 2D1FA 3THYA 4DMGA 1BQ4A 3M9WA 3N2EA 1GG8A 1VZ2A 4ZV4A 2AJCA 4FBLA 1XMQB 4GGPA 3GELA 1C4XA 3LBAA 3QVSA 3HMKA 3I0NA 2RGAA 3VDMA 2VJLA 4FSHA 3K9CA 3O8BA 3HVIA 4FD2A 2DWUA 4C6HA 1EFUA 2PSSA 1JF8A 1U0LA 3RASA 1KO1A 1DKNA 4KR2A 1M8PA 2DFVA 1HLFA 3A11A 3ETJA 4NNPA 4V3BA 1VL2A 3KV1A 3K4PA 2ZR7A 4WXPA 3TDMA 3TUIC 4YV1A 3DF9A 5DASA 4MV9A 5THKA 4DV2B 2QG6A 1VLMA 4EFKA 2Z1MA 3T34A 5JZ9A 2XMCA 3PI6A 3DFIA 1QBGA 3CUYA 3OJLA 2X8BA 2G5GX 1NE7A 2YZKA 3B1YA 5J9FA 1FFCA 4EMSA 1RJWA 1VIDA 3JYHA 1EK5A 5JS7A 1L2TA 1S8NA 2GX6A 2HO5A 3ND9A 2JI8A 4RHUA 3ZWKA 4EUNA 4G4SO 1D1TA 1ONNA 2WG0A 1UP7A 4YH1A 4QOJA 4I19A 4M22A 5KX5B 3T1YB 3ETNA 2PRSA 2QORA 5PGMA 3TEFA 1CU1A 2NSDA 5FYQA 3A9VA 4RCVA 5TB5A 2I3BA 5I9IA 1OLUA 2QG4A 1JIIA 3R74A 1MAHA 2HMVA 1W36D 4NZOA 3TPCA 3GNLA 3HCEA 1ZNQO 3LP6A 1NJSA 3ZE9A 5KCMA 4E1VA 1R50A 1JQ5A 1NMEA 2GZ2A 2YNMD 2XZPA 2G25A 4B5KA 4XPIB 5D87A 1OY1A 2D0OB 3BJRA 1JPNA 3A3YA 3IOEA 3MWLA 4HMOA 3U7QB 1U98A 5IKOA 2BFDA 4PHFA 1VE5A 1E4YA 3B52X 3VKFA 5BV7A 3BEDA 4FFBA 3JS5A 1CWUA 1HETA 3NJ4A 4ZHSA 1E6CA 5BSWA 3DBHA 2C94A 1F6DA 1QB8A 1AHHA 2DFTA 2NMVA 5AW9A 3GFGA 3HYSA 3RS2A 4DWVA 1RC8A 3F49S 2ZYDA 4DDTA 5FL7D 4AXXA 4C4PA 1E9AA 2BEUB 4MUFA 4GM4A 4DT1A 3EISA 4E4YA 5CT5A 2O8DB 1W8IA 2FG7C 1ZI6A 5U9CA 1H4TA 3MRTA 5DRYA 4EM6A 2HK8A 2JJ8A 1ZHOA 3O84A 4AROA 1OC4A 4U3JB 3CF2A 4UBMA 2GA8A 1K9SA 3UWDA 1ADFA 3JQ8A 3RT7A 3JR3A 1NJGA 2QAJA 3RO7A 2HLDA 2WVJA 1JFRA 2C9BA 1M6NA 3UMGA 1J9ZA 4IDHA 5KHOC 4TSFD 2EV9A 4KTTE 1G38A 3WMXA 1IBLB 1KJYA 2ZRAA 1A71A 3HYCA 5BSMA 1EFKA 4B9AA 4LZLA 5EXXA 4NXNB 3HKCA 3JQQA 3VSBA 4RPIA 1RKUA 3QIAA 4DA0A 1GCUA 5B2ZA 2FN3A 3CNHA 4G89A 2COKA 5FV4A 4ZP1A 5K6AC 1E2KA 1AZWA 3UIEA 5KYTA 1R37A 5HCUA 1JXAA 2UZ0A 3KOXA 4IJVA 3ZV3A 3LY9A 1IN7A 1B73A 4RVFA 5CYPA 1YWGO 3FTEA 1GZSA 1ZX1A 5J23A 2E4AA 1P7VA 4EKIA 3VPXA 2HKIA 1EX9A 1T5BA 4I4TB 1E5TA 3HB7A 2IPMA 1MD9A 1O96B 1ONSA 1F2UA 3EZ6A 2G83A 3G5UA 3QV2A 2WB4A 4CBVA 1LLUA 3LKBA 1B15A 3NFYA 4FFBB 2QA5A 1Y48E 2WFLB 3KJQA 4FHGA 4Q03A 1UMBB 4GU5A 5KYUA 5T8KA 3DBHB 5CJJA 3DLHA 1MQ9A 1YU9A 3S5UA 3S2GA 3RBVA 4B4OA 3W4JA 3R75A 1NOKA 1F12A 5AVUA 3LOPA 2CJXA 3MT7A 4JVMA 5JNTA 1M2EA 4LJ6A 5JO0A 1N0HA 2NGRA 4G9BA 1EBUA 1PUXA 2GEKA 3QE3A 4EAAA 3V7WA 2QZ9A 5D2CA 4RADA 4HDQB 4BKUA 2ZRIA 2XVXA 1N75A 3NHWA 1YE8A 3MJEA 1GA6A 1HTWA 3QU5A 4C76A 4XWOA 5F98A 3T5BA 1VJGA 1ZIYA 2GERA 1SUSA 2YHBA 2ZSDA 4XXHA 3LWDA 2FUEA 4ER0A 4DGQA 3IQFA 4JJAA 3ASVA 1UXKA 1YDFA 3IP3A 4Q01A 4DYHA 2J7PD 4G0OA 3HKCB 1V5EA 1B42A 1E6KA 1K4YA 4WZAA 3WZ2A 2YIJA 1D6NA 3ILXA 3VJKA 3CFYA 5KDDA 1P1HA 4UOEA 5HQ3A 2HWXA 2V54A 3EFOB 3MN1A 1KSJA 5F33A 2CUZA 3RC1A 2VYVA 2G88A 2G28A 2OORA 3B78A 4KDFA 4LUCA 4YUAA 4MHSA 1T6XA 4F4UA 3E23A 3PX2A 4N47A 3H04A 1Q5PA 1X87A 4J0CA 3G49A 1K75A 4G8JA 3FPJA 5FWYA 4N76A 1NXPA 2QP9X 5BN5B 3TNYA 1VZ3A 2WJWA 4LRWA 2P2YA 1PLKA 2WUWE 3CNQS 4EUKA 2IEAA 1NBIA 1EEXB 1H9BA 1TF7A 2VZ0A 2AJ8A 2G6TA 3I9NA 3KQVA 3L9XA 1FMJA 3QMMA 4L50A 3K20A 4OD0A 4TV8F 4JQYA 4TTVA 5T4HA 5DNUA 5JVDA 4RFSA 3D2BA 1DFHA 2WWTA 3GAZA 4FCTA 4QPPA 3RAGA 3HB9A 2J59A 2AI1A 4I50B 2OBMA 2AE1A 4DQDA 3V48A 4Z1MD 1J2TA 4MW0A 1B74A 4ND7A 2HU7A 4PG4A 2JBAB 4ZHQA 1X9IA 4F5ZA 1ZD9A 4Q3NA 4CUZA 5A9RA 1DEKA 3K5IA 2PO5A 1UOOA 2F43A 1PLJA 3A2NA 3C3AA 1K3TA 2DQSA 3PLNA 3BMOA 1ZEMA 4TLLB 3RRZA 4BQPA 2DU8A 4ZEWA 1IOWA 1CP3A 1E1CA 3JATA 1RBMA 4HGZA 4HMQA 2WM3A 2RCYA 3HKBA 1C5KA 5AOVA 5KNBD 4GSYA 5MN4A 5K0ZA 5E7QA 5MGBA 3SDZA 1NHGA 4KGZA 2OCLA 3KQMA 3ZU2A 3QVVA 3NMUF 2JGNA 1V9SA 4G8DA 5JRJA 1LW6E 1YU6A 3WQSB 3FPFA 3P9SA 5KYWB 3F6SA 3P26A 4O4HA 3INYA 1DAMA 2R6CA 1OWMA 4CFZA 5BWBA 2P78A 3GVPA 1E6UA 2I2FA 4RHEA 1A9TA 1AZSC 2AQHA 1G9XA 2Y2VA 3GXOA 3H5IA 3BGWA 5I7RA 4N4AA 3OH8A 3TGWA 1IY2A 3U9TA 2GPWA 4Y1GA 3UJ8A 3TLYA 2AXNA 2P0EA 5JBNA 3JYQA 1VMAA 1GFZA 4QLOA 2C8JA 5EIBC 1CDEA 1W19A 3HDQA 4R05A 4HFMA 3USCS 2PU7A 1IVSA 5JVDB 3HJRA 1YJCA 4A0GA 4C06A 4RFSB 1FSZA 3FZQA 4Q48A 1MB3A 3EJ6A 4FFRA 4K87A 1LDNA 2GHQA 2H7CA 4QXRA 1YI0A 1GZ6A 2GJSA 3H8JA 2XMSA 3KT3A 1Z47A 2IYFA 2RBKA 1M8JA 4HP8A 4DHWA 1FFDA 4IDGA 4ZJZA 5AVVA 1U7XA 3A70A 4GMGA 4C4AA 5D86A 1MLDA 1KI6A 4DCMA 5BY2A 2XPCA 3K2IA 1YR8A 3IMCA 4NYJQ 3WNVA 4NWIA 3IQEA 3H83A 1H5NA 1FVXA 2JGKA 2NZUG 2AF4C 4LYAA 1E1CB 4EB0A 1Z5UA 5KMGB 3KJXA 4B3SB 4RQBA 1O0CA 2I1VB 3ENWA 3RIHA 3V42A 2JBHA 2QT9A 4NS1A 4D3SA 5KS2A 3HKBB 4DS3A 2V7BA 3SGLA 4S2UA 4RTMA 1T1SA 2H1FA 2FHSA 2L69A 1SC1A 4DB2A 4QQRA 1TL7C 2HPVA 2ONZA 4OQFA 1AKTA 3OUUA 4YAOA 1U7WA 3QX3A 3WIUA 1R0YA 4TWBA 1H8HA 1P7WA 1WHSA 2IPNA 3AI2A 3DFKA 4KPFC 4AICA 4IQGA 5IYZB 3IJEB 2L18A 2ZI5A 5JARA 1QSGA 1W5AA 3B48A 4HLUC 1CZKA 4I9FA 1G42A 2F6RA 3OSZA 3E7PA 3I0MA 3PDIB 4PX2A 5BOSA 5FWXA 1KZ9A 3V7UA 1RWKA 4FOTA 3FOCA 2Y1CA 2GXSA 4B2LA 2W4IA 1D5WA 4DXHA 2IPLA 3ELYA 4XGKA 1XJQA 1SOMA 3GUHA 5EPUA 3NOOA 2I2WA 2HHLA 1WRBA 1ZM2A 5L95A 5BWNA 4QT0A 4QOHA 5F3WB 3PPWA 4LN1A 4RMGA 5AYVA 4RIHA 3D5QA 2XDWA 1DAPA 4L16A 4N7JA 3IDQA 1Z5PA 4UEQA 3LXMA 5DT2A 3PWTA 2ORWA 2H4ZA 3AF3A 3KQQA 3K1AB 3QXJA 4L9SA 5BQPA 5KEIA 5L6MB 2ZUFA 4BNWA 4IKOA 1H65A 2GCOB 3ESBA 4XCQA 4DIKA 3ZWCA 3GHHA 4IOMA 5GVSA 1ISHA 1RRFA 4KACA 1PNVA 1VL8A 9ABPA 4TVOA 4Q9KA 1NXWA 4Q1VA 4YUXA 5K3EA 1U8TA 4FFMA 2ACWA 1RI1A 3GFQA 3UAXA 2AW3A 2FQ1A 1QS0A 2JEOA 3CRNA 3I3SR 3R44A 4IUBS 4LQLA 5CYGA 1NDHA 2EX0A 3FPSA 3HB4X 4JXZA 1II0A 2KYRA 4FB4A 5LQAA 2ZAMA 2V7PA 5KYYA 2PXXA 1WW8A 3N53A 1M1YB 4HQ6A 5FJIA 1NXQA 4MGEA 4LCJA 3SYNA 2PZFA 4ALJA 1TZBA 1UJNA 2BZ0A 3WMFA 4AMUA 1BA2A 4US0R 1WHSB 4RULA 1YZHA 4L08A 5BUCA 1G18A 2ZB8A 2ZRHA 5CXXA 1B3BA 1JKJA 4Y0VA 5FI0B 1NQAO 2C96A 5AI5A 3LQ2A 3OQBA 4OSOA 3V9AA 1RJFA 3DDZX 3RC2A 3ZR4B 1YR1A 1I24A 4EFDA 3THWA 1T6BY 3OJOA 3ICQB 1II9A 3ZYZA 1PHRA 4PAQA 4PYKA 3AKCA 4F3TA 4ILKA 1NZJA 2VS1A 3UB2A 1GPUA 4CMEA 1A8IA 1PDVA 1QCCA 2IKQA 3KKNA 4MGYR 1HE8B 1AF7A 3CZRA 4LFAB 1P72A 1SQ5A 4HB0A 3BFJA 3VR1A 1YXMA 4G63A 4C9BA 4ZPJA 5GMOA 1XTUA 2NXCA 1WXHA 5HMMA 4IDOA 2QN7A 5GIOE 2PH1A 1WTAA 3LNCA 1VSQA 3QOYA 4O5OA 1UDWA 5DIZA 4U7JA 1NX9A 4H7FA 1C50A 4EKDA 1MA0A 2OV6A 1GR1A 1B00A 2R1TA 5IAKA 1WW2A 2EW1A 4IO0A 1PTKA 2M1XA 3T5DA 1SIBE 5C4MA 2VH2A 2YNMA 3AVYA 4Y1FA 1N4AA 2Y6UA 5A02A 1QS0B 4Q19A 4V02A 3WA6A 3AOEC 1JG2A 1M76A 2C8KA 4J90A 1XN1A 4RGYA 1RD4A 4BFXA 2CV0A 4YCSA 1SXQA 4KVZA 3BTUA 5FI1B 3UCEA 1CVIA 5JE8A 4DIOA 4EBFA 1G5HA 2DQKA 1YRQA 4MWDA 3WICA 5K2MA 2Q2VA 2W4MA 3GRPA 1C2TA 5CT9A 3ZDEA 1ULUA 2GCEA 1L4YA 3E18A 3HWRA 2G72A 3JTEA 3L77A 5DP1A 4DLSA 4ZYXA 2JCYA 3QBTA 3K8OE 2G9VA 3CF4A 3H1TA 1AZTA 4ZEVA 1NN1A 3V34A 4UARA 2R6JA 3IEKA 5DLYA 1XWWA 2FZVA 1AKRA 2GI4A 2RHCA 3Q41A 3A6ZA 4X92A 4ARIA 4F04A 4RD6A 1EMDA 3THXA 3PF9A 4XB6B 1SVSA 4BY9E 3QE4A 2PUJA 5HFAA 2O3UA 4KBGA 1SCDA 3GZJA 1RYYA 1HMYA 4FZRA 3WYEA 1QJ4A 4JLSA 2C1EA 4MUIA 2EAUA 5F51A 1U7UA 2ICAA 5C52B 3LAWA 3DO5A 4O2AA 2QB5A 2EZUA 3B1FA 3GCXA 5AR1A 3WSTA 4B46A 4Z7QB 3DE7X 3SM3A 3UHFA 1U5BA 3C5CA 3VR5A 4EDHA 1B93A 2GK3A 3MOGA 1XCPA 4KXNA 4AAYA 4IFIA 3MWKA 3UK2A 1W46A 2ZRPA 3D2LA 5L6LB 3DCNA 3TFQA 4A8JC 5C46F 3HCPA 1GZ3A 1S7CA 3QU4A 4QQKA 2ANCA 3N0RA 2OHJA 4KQCA 4AZ0B 1VJ5A 2CCKA 3R40A 2O3SA 2CBXA 4UREA 1YR6A 5EHQA 1T15A 4BDTA 2P68A 1WMDA 3E4DA 2OFFA 2LKDA 1FLAA 3P19A 5F9MA 1HI9A 2Q0HA 2R25B 3HA2A 4Y7CA 3TIFA 4GZ3A 1P39A 5BUSA 3HLYA 4EPYA 4UVGA 1TD1A 3LSYA 2ONYA 2GBPA 5GJVC 1U6IA 3DLBA 4H7IA 3H2IA 1V9LA 4B7AA 5MN5A 1EXWA 3IMFA 2AW5A 2H1LA 1ZLXA 3THRA 3I2JA 3IR5A 2JH9A 2IUEA 3ONEA 2X0NA 3CIOA 4UEOA 4RV5A 3B36A 3JRXA 4B34A 1T36A 2XYGA 2JLWA 1PT9A 4HSGA 1PDWA 1YJQA 3ELBA 3FYUB 3LLMA 3NBXX 5AJTA 3URKA 1FP4A 3KEQA 3O8LA 1AUVA 2RK6A 4HS4A 4FHEA 2Z98A 5DBFA 2YCBA 1QP7A 3ECAA 1BTOA 2C5SA 2Y1DA 1M34E 5ES3A 3UWPA 5KO2A 2DFKB 4RXMA 5G2OA 5JDCC 4WTOA 4P33A 1KPGA 2IUTA 3E1KA 1BXRA 2B34A 3EXAA 3FMVA 4MWBA 1NQOA 1QKKA 4CR8A 5H1YA 5EHZA 4EP1A 4DM3A 3SFZA 1SH7A 4H7KA 3KO8A 1CS0A 1S7GA 3UENA 2FEAA 4GP7A 2OHFA 4OI1A 4R71A 5LR6A 2PWZA 4E08A 3DHEA 4U02A 2CV1A 1VMDA 4FDMA 5FADA 1PW5A 4RM3A 1IJFA 4EHJA 3GLSA 1VCIA 1ZH4A 2PYZA 2CT8A 3AM1A 2OEPA 3SX4A 3HFRA 4FONA 4GNKA 4A5OA 3IBFA 4DZTA 4IGEA 5GP1A 5LZ8A 1FNBA 3G2QA 1DHRA 2PM8A 2IGTA 3KOYA 1X7HA 2I9PA 5IDXA 3R9XB 1WZCA 1M83A 5B1DA 3PEVA 1E92A 4EGJA 1DJNA 4ZC8A 4R5HA 3I5YA 2HW8A 1E69A 2QVZX 4N03A 3DFMA 1D6MA 4PSKA 3VJLA 1E1DA 2HF7A 3H84A 1TU3A 2GYYA 2CK3D 2ZJAA 3C6XA 4MV7A 1H2HA 3NBUA 3UXEA 3C3MA 3GWGA 3AR8A 1AX9A 1NKTA 2HBQA 3HCWA 4GS5A 1AHNA 1JILA 4J0QA 1UK8A 1MBZA 3OT1A 3KV3O 5DBOA 1ID1A 4CV1A 1EDZA 3FUVA 1H4QA 3PRHA 1CFZA 3JAKB 4U0JA 5FOUA 2J0VA 3PDWA 5BSGA 2PH7A 2QZZA 1FP4B 1B43A 1I13A 1MH9A 2FQQA 1E3QA 1W2WB 1Z8DA 1R27A 2BE7A 2W11A 1JHYA 4BVKA 1U0BB 3TKYA 3D6FA 3M4JA 4MHOA 2D7JA 1N2HA 1NRJB 1ZJJA 1G5FA 2ID9A 4KKXB 3R7DA 2PLFA 4B7UA 4E11A 5CCEA 2XD9A 5HS4A 3HN7A 1XRRA 2WTXA 3DUFA 5DTJA 1RLTA 4DLLA 1J06A 5DEIA 3RD5A 1GTZA 3EZNA 5AJYA 3BL5A 3QUAA 1JPJA 2H9AA 4KQHA 1ZXBA 4RORA 5EEGA 2DQYA 4HWTA 3RYFA 3TSWA 1TLFA 2QGFA 3OF5A 1H2ZA 5E0OA 4A6PA 5CA1F 2X1LA 4C2TA 2X23A 3DQPA 4FT2A 3B3JA 2XUQA 5D6OA 3SNHA 4FFVA 1U1IA 2BMAA 1U5AA 4Z86A 4BMOB 4C1BA 2Q4DA 2HD4A 1AN9A 3TD2A 3E2PA 1KBOA 1G1MA 1KQPA 1VB3A 1DJQA 2V3VA 3K0BA 5EIBD 3TE7A 2WTAA 2PUEA 3C6KA 2GDJA 3NXKA 4MGKR 1ULTA 5EMMA 5LBTA 4X1YA 3T38A 2F1OA 2NSYA 4M7WA 2CXXA 4QBKA 3FXAA 4YQFA 5CFZA 5CCXA 3RVDA 4EB3A 4BJ5A 5AW4A 1G5QA 1USIA 3WWEA 3OMXA 2NACA 1A8PA 1GVHA 1ML4A 1PNRA 1V71A 4JJKA 1I5OA 1RMYA 1PR5A 2J5RA 3D4NA 4IAOA 4LGMA 4ILEA 3UOGA 4J91A 3T1QA 3MFQA 3LT5A 1MENA 1PW7A 3A9CA 4WFJA 4WXHA 2XCIA 5B2EA 2V1XA 4HEA6 4ZU6X 4ZCPA 4YRNA 5IDWA 1ZOLA 1VE9A 3EB9A 2HT6A 4EFMA 4YCLA 4NZPA 1X7WA 4RSGA 4L15A 3TQFA 4DY6A 3U1TA 4HPJB 3M6UA 2GF9A 4G5XA 4PG7A 4QYSA 3UAOA 1RRPA 3MLAA 5AJWA 3UJBA 2W42A 2L2QA 4DRXA 1TZCA 2ZITA 3Q5DA 2GRAA 3BS4A 1DADA 1UJBA 3UOWA 1B23P 1WULS 1RXIA 2O1WA 2LNDA 4B9EA 5JH7A 5K5EA 1P0CA 3MCWA 2XB2A 4GOND 2FB9A 1BVUA 1DINA 5L45A 4QUJA 3OLXA 1I01A 4XVCA 2CVQA 2VPPA 3K8YA 4PS1A 4ZD6A 3R23A 3KSAC 2YVAA 4A92A 5EJIA 1NNI1 1GLVA