1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE PB92
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Serine protease
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
1SBIA 1SCJA 1SPBS 1GNVA 4ZOQI 1IC6A 3F7OA 3VV3A 5AVKA 2SICE 1GA4A 5JXHA 3VV2A 2Z2YA 1SCAA 5AVJA 2ZRQA 2SECE 1GCIA 3ZXXA 3AJ9A 1AF4A 1TO1E 3DYBA 5B1EA 5AQEA 3PRKE 4LVNA 1GTJ1 1TMGE 3LPDA 1OYOA 3I2YX 3F49S 4AKSA 1SVNA 3F7MA 4KB5A 3TECE 4DZTA 1V6CA 1YJCA 1AV7A 4OMDA 1Y3DE 1KE2A 5JXGA 2Z58A 2P4EA 1PJ8A 3EE6A 2B6NA 2ST1A 1DUIA 2WUVA 4YN3A 1KDVA 3Q40A 1TM5E 2V8BA 2W2OA 1S01A 3DE2X 3D9QX 1SUCA 1PEKE 2SBTA 4MZDA 1P8JA 2W2MA 1EGQA 2SNIE 1LW6E 1P7VA 2DUJA 2HPZA 1Y3BE 3DVSX 4FONA 3CO0S 1MPTA 1BE6A 3SQOA 2Z2ZA 4DWWA 1SUPA 1C9JA 4LVOA 3EDYA 4OV6B 1TECE 3DVRX 4NE7A 1THMA 1KDYA 2IXTA 1T1IA 3QTLA 2GKOA 5B1DA 1IAVA 1TO2E 5I9SA 3DDZX 4WOCA 5FFNA 1SH7A 1SUDA 1C9MA 3CNQS 2W2NA 1SCBA 1KDZA 2PRKA 4C3VA 1GTG1 4H6XA 4CG0A 4B5LA 3AJ8A 1DBIA 1WVMA 1BFUA 1TM1E 2Z57A 1Y33E 3I34X 4BWGA 2XRMA 3HJRA 2PWAA 1SIBE 1SUEA 1TM4E 3DWEX 3H42B 2IY9A 5AMXA 3TI7A 1ST3A 1ST2A 5FAXA 1YJAA 1SBCA 2ZWOA 3VTAA 3LPCA 2WV7A 1WMEA 1GA1A 1SUBA 3T41A 4NMXB 3AFGA 1SUAA 2PWBA 1BFKA 2Z30A 4CFZA 4OMCA 1GTL1 1NLUA 4WOBA 1YU6A 1Y9ZA 1ZVKA 3GCXA 1SBTA 1AVTA 5ARCA 5JXJA 3TI9A 4HX2A 2PKCA 4C3UA 5ARBA 1VSBA 2DP4E 1HT3A 1Y4DE 3L1KA 1P7WA 4I0WB 3DE7X 4J94A 3WIUA 1TK2A 1A2QA 1Y1KE 1T1EA 3P5BA 5FBZA 5ARDA 2WWTA 1BE8A 2PYZA 2X8JB 2W2QA 3I30X 1Y34E 1CSEE 4CFYA 3DE3X 3GT3A 1NDQA 1Q5PA 1SELA 3DW3X 3GCWA 5JMOA 3WHIA 3DE1X 3QFHA 5SICE 1AQNA 1TM3E 1C3LA 1OYVA 1SIUA 1WSDA 1SCNE 2XTJA 3A3PA 1Y4AE 3BPSA 4HVLA 1XF1A 4NE9A 1SIOA 1SCDA 1WMFA 1PTKA 2ID4A 4KG7A 5JXIA 1R64A 1AK9A 3EIFA 1EA7A 2PQ2A 4K8RB 3VYVA 4KPGA 1SN7A 3LPAA 3SICE 1SBHA 4Z2AA 1Y3FE 3DE0X 1WMDA 1PFGA 1S2NA 1TM7E 1GA6A 1UBNA 2ID8A 3QMPA 2X8JA 3LXUX 1ZVJA 3VHQA 3PTLA 3DVQX 4M1ZA 3I37X 2HD4A 3DE6X 4H6VA 4DJ5X 3BX1A 2ZWPA 1CNMA 2PMWB 5CW1A 3Q5GA 3D43A 4JP8A 1YJBA 3OSZA 2Z56A 1C9NA 4H6WA 1S02A 1KE1A 1R0RE 3WQBA 1BH6A 2G4VA 1AH2A 3DW1X 1GT91 3BGOS 3ZXYA 4GI3A 1OT5A 1MEEA 3A3OA 3DE4X 3VSBA 1V5IA 4ZARA 3UNXA 2Z2XA 1R6VA 1BJRE 2WUWE 2QTWB 2TECE 1Y48E 3A3NA 2W2PA 3WIVA 1NDUA 4AKTA 2DQKA 4RYDA 1Y3CE 3DE5X 1GNSA 1SBNE 1T1GA 1JEAA 1AU9A 3GT4A 5K7SA 2E1PA
chains in the Genus database with same CATH superfamily
3GHYA 2J59A 2VHZA 2DKFA 3B7WA 4FGLA 1I2BA 1G6KA 1A97A 2ORWA 3KRTA 3OIGA 4HMQA 4HH0A 4PGHA 2P9GA 4Z9XA 1LFAA 2ZW9A 2V45A 5FUMA 1V39A 2IY7A 4X8LA 3VV3A 5H9WA 1PV4A 4W5NA 1GAJA 3EIXA 4Y6RA 4ZRMA 5H9VA 1NWHA 3URKA 1P72A 4KAFA 1W4LA 3ZDQA 1JEQB 2Z2YA 1AK1A 5CNIA 2K2WA 1FSFA 1KAEA 2XDQA 4YA6A 3D02A 5TF0A 5JXWA 1G41A 3ACBA 5AVJA 3MCZA 3E15A 2ID7A 2W9XA 4QODA 2ZATA 5AWFC 3VVBA 4YFYA 2H06A 1STOA 1B00A 3VHXA 2HMUA 3PPYA 1L7DA 2CLMB 3GF4A 1YR3A 2Y1OA 1QCDA 2XIJA 4KFRA 2LNDA 3HDTA 4RUKA 3IAEA 3P9RA 1PFYA 4LVUA 1K3TA 1K08A 2X5NA 4DIDA 3A1EA 3DOUA 4KMOA 5AQEA 1JX6A 1NE2A 1R74A 2OYRA 2C03A 3TXYA 3WYCA 5KINB 3L8EA 1KNQA 5I7UA 1KYTA 1CZUA 3AHCA 1HC7A 3IRUA 1P8AA 1WXXA 3A27A 4QIHA 3PXCX 3W7BA 4F4CA 1PEDA 1T3HA 3CX4A 3DEZA 1S5PA 3I2YX 3L7OA 1D7OA 1UINA 4JY7A 5E2BA 3NT2A 4RHXA 4V1CA 1SVNA 1JDNA 4OHMA 4S1VA 4YAUA 4OXYA 4ZYWA 1MTZA 1P4RA 3L7LA 4KBYA 5GPBA 3HPQA 3L8CA 3SSOA 3ZE8A 1AGNA 3DNFA 1AV7A 3O1JC 3HZHA 4GI5A 3EDCA 1EUDB 1R0LA 2GNOA 4A3SA 4OLBA 1PJ3A 1W581 4MS1B 2QBYB 3VGJA 3I1JA 4ILEA 4MP8A 2HWWA 1ZGGA 4CTNA 4QM7A 4YEDA 1P9LA 3FUUA 2HC9A 4PZAA 5J2TF 1ULHA 4E15A 4YRIA 4OUKX 1FX0A 5JVDF 2F8SA 2NZJA 1OA1A 2CLFB 3IHLA 1YH3A 3A1DA 3JYPA 3M81A 4OHWA 3PEWA 4FZVA 3A8TA 3AY7A 3D3JA 4FS8A 4EBBA 5KJFA 4YN3A 5HP4A 1NUAA 1LPBB 4PZEA 1QU3A 5G0VA 3S0JA 2CNOA 3EZ7A 5CLGA 5DMHA 521PA 3A36A 3WLPA 2FETA 1RT9A 4U7JA 3CE6A 2FQYA 2ZDQA 3ESQA 1JHRA 3K2QA 2I76A 4J07A 1XN4A 3K2BA 1P2TA 3CWCA 3NUGA 2EZ9A 4GNRA 4DC1A 4YACA 2FEXA 2CV1A 3DE2X 2PUTA 5TR9A 2XNJA 4IDPA 1K5DA 1P2DA 2ZRKA 2WZBA 2FSPA 4ICIA 2VLBA 1HSOA 3LKBA 3MUEA 3PGXA 4Z6KA 3DEJA 2D4HA 2YFKA 3FD8A 4EG8A 4DT1B 2GX6A 2ZRFA 4I9HA 4FYWA 3SXUA 1T8WA 2O8EA 3NXKA 3Q7PA 4FEGA 1MHPA 4JLBA 4GO1A 3CM0A 3P2IA 5FLXA 4RU1A 1R88A 2WK1A 5J63A 2QN1A 1KEKA 2Q4EA 1ZM9A 4ER7A 4CL0A 6GPBA 3ZBPA 1F0YA 4QD3A 4S1TA 1YQEA 3UBTA 3ISVA 5A7FA 3PJGA 5EIOA 1MUUA 1U8TA 3PKJA 2WUDA 3K70C 3CLHA 3VC3A 2ZB2A 3GOQA 4W82A 5GZ1A 4R8MA 2PUGA 2W6ID 3TSAA 2GPWA 5J4VA 2B1QA 4FHCA 5H16A 4B8ZA 3G5UA 4DA8A 5E8RA 3QPCA 1BD3A 4WJLA 1WD5A 1X0VA 4PYOA 1YZHA 3UC5A 5F78A 2O9JA 4P2BA 3I92A 2Q3FA 3CS3A 1RBQA 1I01A 1YSCA 4NE7A 4OHOA 3WMRA 3LPMA 4CMEC 1S3SA 4OK3A 4FFSA 2IEDA 1UBHS 1BRTA 2JLRA 3BL5A 1V95A 4O0LA 1DCFA 1HA3A 3LT1A 4HATA 4P31A 3W1VA 1MW8X 2GAIA 4QDXA 4A6XA 2SKEA 3PFWO 2RBEA 3OURA 3EHDA 4E5NA 1TUBB 4CGYA 2DPMA 4GLOA 3ZU5A 5BR4A 5F98A 1Z8DA 2VNHA 1W4BA 4I8IA 5LFAA 4JQSA 1X80B 4I1UA 1LY1A 2YYAA 4GQBA 5L3ZA 4DOMA 2X5OA 2H63A 4ZU6X 1EYZA 4KZKA 4GXQA 2FPOA 1IATA 4IJMA 3KJNA 1DB3A 2OHJA 1VCMA 2JLCA 2CE2X 5KJEA 2QJOA 3CLTD 3THWA 4AUKA 4KVAA 1FP4A 2B30A 3NVAA 3OLXA 4JLUA 3T4EA 5CA1B 2AK2A 1EGVB 2XMSA 3ND9A 4GQIA 1NVVR 3B5IA 4C4RA 4HDSB 3CZRA 4EY3A 3HBMA 4IY1A 2EL7A 3D3EA 4M1TA 3K8ZA 5B55A 2OCAA 4FB4A 2CBXA 3KD2A 3I34X 5KQGA 2C7PA 1MX1A 3G0DA 1OILA 5IM4A 2E0IA 4NZPA 3UOAB 4A23A 4UTZA 4MWDA 4F1JA 5DRYA 2GSDA 2OHGA 1EZ4A 3L0CA 5I9NA 3R0XA 4DPMA 1XHEA 1RRCA 2G67A 3AVUA 3LY5A 1P4HA 2Q2QA 1EBUA 3B6JA 3TQTA 5HJ7A 1JLLB 1DRUA 2JHPA 5HCNA 4B09A 3GPBA 2FWBA 3H84A 5A3VA 2PIAA 3ULKA 4B85A 5DVZA 4F5ZA 2ZUFA 3U4QA 4O5OA 2PUEA 2ZIFA 3VPFA 3CVUA 1THTA 4B6JA 1G5TA 1UOEA 4LRSB 1JUDA 4CDNA 3TM5A 3CPEA 4B3TB 2VT3A 1LNSA 1O6BA 1YJAA 2F1KA 1FU7A 5E1OA 3WL7A 2IJGX 4B3SB 1UXGA 4IZOA 1E0DA 4MULA 1DKQA 4NJMB 3V9PA 3I72A 3TBKA 2GCGA 3V1KA 3YASA 5DW0A 2NXWA 4EY6A 1VOTA 4P3PA 4ZJYA 1UC8A 4EG3A 4EYGA 4A26A 3KD3A 4LJLA 4ZOLF 5TT1A 2NUTB 3P0IA 3FTDA 4GBGA 4LXGA 2BM8A 4UULA 2AC2A 2VPQA 1BFKA 4E22A 5KC9A 2O5EA 3D4NA 1FFYA 3DF9A 4QOIA 4HOYA 1RHUA 4GZ6A 2ODTX 3AF3A 2JFBA 4A8TA 1EAYA 3KKEA 1P74A 4IVQA 2PJRA 3A2KA 1ZJZA 3SEAA 3VR0A 4L9WA 4RPCA 1WY7A 4P54A 4V0MA 4QOHA 1NBEA 3CN7A 3WRYC 1FU8A 421PA 1ZVQA 1EX6A 3B1FA 4GWKA 4JJ7A 2H2DA 1SC1A 5KNDH 1ZC4A 5SYNA 1DKPA 2WJIA 3FWPA 1BE0A 1HTBA 1BEUB 1F6DA 3AUAA 3DV9A 4O25A 5JD4A 5JW6A 1DBVO 4L9SA 3EY4A 3FLBA 2I6XA 2XMGA 3OM8A 3FYUC 4Q21A 2J9XB 2CVOA 4HZUA 4FQ5A 3ZKWA 3KFXA 1YNOA 1H6BA 4PO8A 2G3YA 2L17A 4O4IA 3JAKB 4US1R 4MKGA 1SKBA 1G66A 5I9LA 2NUPA 5C5IA 3BMQB 1DP4A 1TIBA 4N54A 4U63A 2BEUB 1NULA 2TRSB 3EASA 3EW7A 4Y2UA 2ZPUA 3DF7A 2ZJ6A 2ZVJA 5CXQA 3PTAA 1Q74A 1CUEA 3CR7A 2QUAA 1LPSA 2Z3WA 2WDPA 2P2ZA 4OJQA 3OQPA 2XNDA 1M2JA 2QD5A 3AZPA 5K0CA 1IBKB 4IAOA 3VJRA 1N9GA 4L74A 3Q0EA 3V8QA 3ZNPA 5ELXA 4K9LA 2QMZA 3U39A 1U4SA 2JJQA 1IHPA 1GPLA 1TQDA 5C31A 1YI0A 3L1KA 3O94A 1LBIA 3JTEA 2FF5A 5LUBA 2SKDA 4YJ2A 3L6RA 3THXB 3H0EA 3F90A 1V71A 3FF4A 3HBJA 1K97A 3HVUA 2BMWA 1F2TB 4HNGA 4JWTA 4YY3B 2KM1A 1HG0A 3NFYA 3O8NA 4BGUA 1KK2A 4AI6A 4LSMA 3Q8WA 4RTQA 1BG6A 2Y68A 3W6UA 5IYZA 5LDDC 1QOZA 2QENA 4I66A 1BW9B 2GHTA 1E59A 1IHDA 2TMGA 4HPJB 1OFVA 3RQSA 4NZ9A 1G291 1KXZA 2I4LA 1OI4A 2RAUA 3F6RA 2C00A 2WHPB 1EVKA 3P5BA 5AK4A 1GL6A 3TLBA 1UJ2A 2ZCUA 1GEEA 1UEIA 4RH0A 4FBLA 3GFGA 4WN9B 3TAUA 1FSGA 5LOVF 3GEMA 3GFTA 5FBWB 1LCIA 1W94A 4XVHA 1KZHA 1E1RA 4MUNA 5TXGA 4E4YA 5CM9C 4MVCA 1L4UA 4KPFC 4R7GA 2VCYA 1CUXA 5K8VA 3DEYX 4OQZA 2V7XA 3D7SA 3AU9A 3C6MA 1AUOA 2QQ5A 1OASA 4PGGA 4TLDA 5SZJA 3GFBA 3IMKA 1NC3A 4NYMQ 3T3GA 4A91A 4ARBA 3ZIUA 2VT2A 3EDRA 5C0OE 3TBFA 1FNCA 2IYLD 3UYKA 3VMFA 5G1OA 2QYHA 2PXHA 4E2ZA 2HLHA 3DW3X 2WFMA 1HT1E 2FSHA 2Q49A 3ADPA 2ONZA 3I9FA 5BN1A 3CRMA 5JCZA 1FFXA 4A6EA 4X54A 2FW0A 3SN6A 2MSLA 4LV6A 3E7FA 3K09A 4F04A 2QUJA 4DV2B 1CU1A 1F20A 3LBAA 4LYFA 3BFJA 3UUFA 2VDVE 5BRJA 1UT8A 5TVKA 1SZDA 3FTCA 1CY1A 3RNLA 4XPIB 4WY8A 3O03A 5FKJA 3BWVA 1D0IA 1XHLA 2WEKA 4YIHA 3QGMA 5ISMA 3DLPX 4NE9A 1RAEA 1C9KA 5DEOA 5K3FB 5CFMA 5JD6A 3AVWA 2HDOA 2X5KO 3RJ5A 2AW3A 4E7OA 4CLHA 4PZCA 5KBYA 5LNK6 3EDMA 1QP7A 3WKEA 4KG7A 2QJRA 4QXQA 3JATB 1K1EA 3DZIA 2ZSKA 1KYZA 2DPHA 2G8NA 3G8AA 1H3NA 4Y2HA 3OCWA 3HKBB 5KVSA 4GS5A 1XG5A 1PU2A 1VIDA 2EBHX 2YIJA 4UUOA 4NDNE 1YAJA 4BO0A 2JCYA 5A3RA 4NCJA 1HT2E 3UC9A 4HEQA 1Z5PA 2AOTA 3L1UA 1UK7A 4F91B 3QXHA 4UE6A 1MO3A 1SVIA 3IS3A 1YA4A 3IAFA 3BA6A 4ZV9A 1RRFA 4Q48A 1EWKA 3IHKA 5IMBA 1X1TA 2CZGA 3AM5A 4E51A 1CR6A 1VA4A 1HBJA 1QTNA 3SQLA 5K0JA 2ESRA 3K6JA 4IXDA 4OB7A 1KWKA 3TOXA 2PLWA 5AM1A 2IXAA 2NVUB 2AZMA 1RQRA 3BZBA 4CIWA 2YYZA 1MQ8B 5G4LA 1J2RA 1MVLA 1M2NA 4L73A 5GMOA 3LVFO 3CX7A 3IC5A 3REFA 4RDXA 3GFPA 3IQFA 2QN8A 1J2EA 1NBME 2XNDD 4YP1A 4CCYB 2J9FB 3DNPA 6Q21A 4LMBA 5CAEB 2H3HA 2JGDA 5CT5A 4G9BA 4FE4A 3NCHA 4URXR 1L5ZA 4M9ZA 4GU5A 5AKZA 4W5RA 3RRFA 2YRWA 3CN9A 4V0SA 2A0KA 3D0OA 1HKUA 1IYZA 1WCV1 4PFKA 3ZDYB 2OE2A 3H1BA 3BK2A 2BFPA 1PVDA 2I3DA 3M2PA 4KDEA 4G0QA 4IIHA 3GP5A 4M36A 5KTYA 1AQUA 4HX5A 5CVVA 1X1SA 1ZK0A 5ILQA 1XQYA 3L43A 2EAUA 4IMIB 3ZW9A 1CY2A 1H0KA 2QT1A 2QUKA 2ZBDA 3BX1A 1WV1A 3I3OA 3PEUA 4TLEA 3ZJTA 3DCNA 3RS9A 1QG2A 2J45A 4DCMA 2ZYRA 2XGGA 4BRUA 1OLSB 1DDIA 4HNAB 5FOVA 3JQ8A 3ZR4B 2I91A 2REBA 1BYUA 3ZW7A 5JMPA 3I0ZA 4DA0A 1ZH6A 3Q41A 1U3VA 3M8KA 4UZEA 1ADYA 4RNCA 1FP6A 2J0VA 1R0KA 1KJNA 1W5SA 3IOEA 4H7FA 3PL1A 4PYNA 4ENTA 5C35A 3HA3A 4I9GA 1ZO8A 4KV9A 4Q3LA 1GCOA 5IEJA 1E1RD 1NVFA 2N1BA 1KEZA 1FVXA 4MGIR 1WTAA 3CO5A 5FD8A 5DNYB 2F3PA 2ORYA 3RBVA 2VK2A 3HMQA 5EKXA 1XEFA 1EZZA 2V5UA 3JALA 1LPAB 3IP1A 3ZE1B 3IR6A 2FEOA 2JRLA 3KSDO 4IQ4A 3OQIA 2V6BA 1IXSB 2CC2A 3NP9A 4GOMD 1JV2B 2F8TA 3V1NA 4NF2A 2N0SA 1UXOA 4H6PA 3LHSA 4MUEA 4TL7A 3UV7A 1RYYA 3ZI0A 4NOMA 4D9BA 3MFQA 3I3SR 4R41A 3R3SA 4WI1A 2QMHA 3ZV4A 4FMCF 1PT7A 2Y4NA 2PXXA 4KLNA 4KXUA 4QGHA 1HGXA 2W2PA 3I6ZA 4WUTA 4ZTZB 3NTOA 1F4VA 1OV6A 4DHEA 4NZZA 4FNAA 3MT9A 1IEXA 1P2UA 1R3UA 3TL2A 3GZTB 3GX1A 1Q16A 4AKTA 4GF5A 3H5LA 3Q9LA 1M6VA 5JH7F 2A9RA 2I29A 3FCYA 1DKLA 2QV7A 5E6UB 1GZVA 1G8PA 1MD9A 5FWDA 3TSWA 3N0RA 4HR7A 5FTNA 4DV0B 1GSIA 3QJYA 1Z4MA 3NBQA 3W7VA 4XYMA 3DUWA 4E5DA 4B3IA 1Z82A 1FYEA 2H7YA 2WABA 4OGKA 4M21A 4DMCA 3F4KA 3HBLA 3PC4A 1Z7GA 5KVVA 3Q7QA 2P2SA 2ZB3A 2IE0A 4ND2A 2Q8NA 2H2HA 5BVHB 1GGEA 3E53A 1TJ3A 4EG6A 2EJTA 2SICE 3L8FA 1ECFA 1LLQA 1QFMA 3LX8A 2QSZA 5CPFA 5ER6A 4BMDA 1NSYA 1ZCBA 3GC6A 1AKWA 1J2TA 4I1IA 3UF0A 3T5AA 2GILA 3Q9SA 1VM6A 4B3JA 1P0IA 1D3AA 3G0GA 4IQFA 1VL2A 4W7HA 1MO4A 3UW3A 3WB0A 5J2UF 1VLMA 1X38A 1CQJA 2C2YA 2VH1A 3DLCA 2PYDA 3WDMA 1K4MA 3KKOA 2ZJ1A 3R7LA 4TROA 1DG9A 2WMOB 2IOFA 4YREA 2VPZA 1NRIA 4RA9A 1QDEA 4G1VA 2VP0A 3CE9A 1Q1NA 3WDKA 5J2TB 3EXEA 1R4ZA 2Q6TA 3DKVA 3EDQA 3JVUA 1FLAA 3P9IA 5AI9A 1YHYA 5K5EA 2IZ6A 3K1YA 1IMOA 1Z4QA 4OQYA 2R00C 4OLFA 1Q50A 2CWDA 4PFQA 1XELA 4FNGA 2RAFA 4H4CA 5D3QA 1UJ6A 1W47A 1GZHB 3N1UA 4MWZA 4RQUA 4DLYA 1DWUA 3OE5A 4ND4A 4MIEA 1RP1A 2NZUG 2V7WA 3BH7A 4EY4A 2P6PA 4HXEB 4DR2B 4TYWA 4MEAA 3NHMA 4PZPA 1JR3E 3MRSA 2O5RA 3CZCA 5HIJA 4E5KA 4PWYA 4GR4A 1SXJA 3V8BA 4EW6A 1M2VB 1I3LA 1P29A 1R4NB 2O3UA 2YMQA 3B6EA 4OMDA 4WKOA 5CDTA 2VSYA 3E8XA 3ZVRA 1KRXA 1E6EA 3G0BA 3FWHA 3VSDA 4BMZA 1LUAA 2CJWA 4DEXA 3OZCA 4RIGA 1E6WA 4CKEA 4DABA 1JHDA 3HJUA 1XYVA 1BGVA 1QH8A 1K8YB 1PEYA 2OVBA 2QQ0A 2WSLA 2CVPA 2BBSA 4GGOA 4WA7A 3VKUA 1KU0A 1QO0A 3SEZA 3ML1A 1YJXA 3G8DA 2A5GA 3EWSA 5CVDA 5F5NA 4UTPA 1T3SA 1DUIA 3QF4A 1TAQA 3RJTA 4XE5A 1OAOC 2V1UA 3WLTA 4HWKA 2OXRA 3FJOA 3IAM1 3ICWA 4HGRA 2I4NA 3RWMB 1RPTA 2WTXA 3H3FA 4RF4A 9ATCA 4IDQA 2QJFA 1IBLB 5DHUA 3DJFA 1YGYA 2TYSB 3TNYA 4QBHA 4CV2A 3KEFA 3WGVA 3PGA1 3A4YA 2VHUA 2OC4A 1A27A 2AW5A 2HJGA 4OYYA 5ITZB 3RRYA 4G65A 3HZZA 1PEKE 1PGOA 3GNLA 5COBA 2G6BA 4KU4A 3IHWA 2V7EA 3OX2A 1O0CA 1L4EA 5BSKA 3ANNA 1N6OA 1J70A 1UBOS 4NEQA 4WLEA 1JXQA 2UZ3A 3ZEAA 3U7GA 3WYNA 3O3MB 1JEQA 3UFBA 1FXWF 5HCUA 4OXIA 1P7VA 1EFHA 3OT4A 1SUFA 2AS0A 2VH5R 1A77A 2V98A 4RPGA 4HDNB 5AVXA 1TW2A 2RARA 4FKZA 4PY2A 5HKAA 3DVSX 3PLAE 1GKKA 2O1SA 3VYRB 2VNSA 1D9ZA 2DU8A 1YUBA 1RC0A 2KWIA 3O4FA 4B3DA 2HCJB 3CF4G 3C87A 3GEDA 1DFIA 1SUPA 1C9JA 1UH5A 5ALDA 4LVOA 3VTZA 3HBAA 2QXUA 3GLQA 3I9LA 2BBWA 2BGRA 4KR2A 3ES9A 5BQ5A 3L77A 3F9IA 1MEOA 1GZUA 4NCIA 1KGDA 1R6AA 2QRLA 2H7VA 2IKQA 2VFAA 1JHZA 3MWFA 3QOXA 4JP1A 2F1HA 3VZQA 1UXHA 2DFDA 2R3SA 4WNIA 1CQZA 4QOFA 4RLSA 5C5EA 1IN1A 1ISPA 2QT9A 4HNHA 3O9MA 3ZWVA 1MC8A 3I83A 4UJ5A 3KZXA 4XEHA 1D4AA 4IUBS 1G5RA 5I51A 1Y3AA 1EUZA 3R40A 3U9SA 1EUDA 1S7GA 2CHGA 4U02A 3B7PA 4A8PA 5JZSA 1YFZA 2ORVA 4Q7JB 3QVOA 1ARZA 4A8HA 1H2AS 2WU1A 4MS1A 4UE2A 2QBYA 2DOKA 1WPRA 4ZPXA 1C3EA 5HIKA 3PL5A 3ITKA 2EF0A 2JFHA 4IUYA 4JSYA 3NVKI 1I3NA 2ZU6A 3BGIA 5DP1A 5FPQA 3EMDA 2W2NA 1P19A 2CVHA 1J7JA 5C8VA 1WKVA 2PRKA 5BP7A 2EW2A 1K7XB 2ZM5A 2PUHA 1KZ7B 3GA5A 3B70A 1OSNA 4KDCA 3H87A 4CG0A 1CLUA 1KI1A 3CRRA 1Q0UA 1J23A 1AMNA 2W4IA 1GOTA 3VMMA 2GNPA 2R8EA 2GBGA 4IHQA 4ZOLB 2RGGA 1JG7A 2HRDA 1YMVA 3MHPA 1RU3A 4UVIA 1FFEA 2ZRGA 3HHEA 4TLAA 1CY4A 2WMNB 1Z68A 4AMBA 1F1JA 1EQUA 1SXJD 3GVCA 3TE7A 5FHQA 4ZOBA 4W1QA 1H94A 1N6LA 5CB4B 1RM3A 2OZEA 3COYA 1EFLA 4FMDF 2AH5A 2NVBA 4A15A 1IM2A 4D3SA 3OCYA 4DT1A 2VUSA 2JVJA 3OOEA 2OLKA 4HDAA 3NNNA 4FJ0A 3W9YA 4OU5A 5E0OA 3IAS1 2BUAA 1XDDA 4ETWA 1P31A 3D4LA 1KR2A 1QO0D 1ZGBA 2EJVA 3PQ3A 5F52A 3NJ8A 4GNKA 3TOZA 2GAFA 2PTHA 2ZBRA 3P9CA 2AJDA 3V6LA 1T2CA 3MJRA 5D85A 5HF8A 4AKEA 4YXFA 2CHVA 3HXQA 1O0BA 4L0QA 3HWSA 1Q22A 3UXHA 2Y0BA 5FTWA 2HBYA 2JEOA 3UMFA 4WKCA 5K0FA 3O75A 1SOAA 2AXEA 4GZMA 1EJ2A 1Z2EA 3Q6MA 2GESA 2ZRAA 3SNHA 4BRZA 4L16A 3OIFA 2D13A 1WSAA 4M9XA 4CEIB 2F7SA 5CH8A 5LB4A 5AI5A 3PD0A 2QW8A 5FUWA 4YUYA 2WSIA 3IA7A 3BK1A 1M34A 3R41A 2HWXA 2BFAA 1I4WA 1FDOA 5AUNB 4A36A 1UJCA 1XZAA 3AR5A 1Z0AA 4OHKA 4QQRA 3GLTA 1S6YA 4JSTA 1TUBA 1GSOA 3GYBA 4ZQEA 4KFTA 4B71A 1U8ZA 1MVOA 5EMNA 2D7JA 1RVV1 3TRDA 1X80A 4QL3A 5JS1A 4J0QA 2JAXA 4WJKB 2FG6C 3GGJA 3QWBA 5DT9A 3KB6A 2JHGA 2R6AA 1EHCA 2QM3A 5DO9A 4UBLA 5AESA 2B78A 5L51A 4I4LA 3H2YA 3GLFE 3S1AA 1YU6A 1Z17A 1AXRA 2B8WA 2L19A 3I12A 1WCXA 4IJKA 3WKDA 3OTWA 5CA1A 3HVJA 3O31A 1LGYA 4J6EA 4CIAA 1R9JA 4HDSA 4EM6A 5FA8A 3AETB 3B89A 1MKYA 3PNSA 3PR2B 2KW5A 1ADGA 3DMNA 4PC1A 3VPHA 2YINC 3TRIA 3KKQA 3N39C 4B6PA 4F6RB 4Y2GA 5G4KA 5HE8A 2P3SA 5TRTA 2PKCA 3INTA 1PFVA 3KDSE 1QIIA 3AUFA 1I0IA 5AKEA 1DAOA 1J9GA 2BVNA 2C8KA 3SC3A 2OESA 2MMCA 3JQGB 4Q16A 1NN1A 1OIVA 1CJKC 5K3DA 1N2SA 2Z8YM 4YUWA 3PG5A 4P82A 4MJXA 4IP0A 2YJNA 5KDLA 4C1NA 3IXQA 3KOUA 1JLLA 4ZAVA 4C5CA 4DM3A 5ALWA 4UZFA 5HRAA 3NDJA 4K2AA 4BS9A 4J0CA 2INGX 1DEHA 1X7DA 1CDOA 2VPIA 4HD8A 2I6UA 1PDVA 3EWAA 1ORTA 1ZA2A 4HNRA 1XJ0A 2QUIA 3RS2A 1QHGA 1X39A 1XQWA 2BTOA 4DUPA 4B6QA 2VTDA 2CVFA 1TA4A 3OY7A 3QUSA 4NJMA 1SHJA 1ZEMA 1JQKA 3U3JA 1ZM4A 2FRDC 2RJOA 3VR6H 2QAGC 5I7FA 1F8UA 4H1WA 1JEEA 3ZGLA 4YRPA 3T3IA 1HUQA 1D5WA 1SXIA 4FU0A 2JLQA 4H0CA 2A30A 2X6TA 1A5AB 1J21A 1KI9A 1P77A 2GTHA 2NUTA 1X7YB 1ZIDA 2VCEA 3P4YA 1DHTA 3CRVA 4NLLA 5LWQA 4BXOA 3JSAA 3MN1A 3HH8A 2I2BA 3QYFA 3SSMA 4DLXA 1QIHA 3BZUA 2C8JA 2C29D 2VP3A 3SDBA 1XMQB 4R2KA 4CM1A 4D99A 2NPOA 4Z9BA 2O48X 4LNAA 4TTJA 3USCS 1SBZA 5AVYA 3DTVB 1NP3A 5CK4A 2IZ1A 1NUQA 4OHXA 1XRJA 4D25A 4KNVA 4OL9A 2HFKA 2C98A 4UDYX 5GJWC 3R75A 1YVRA 3EF1A 3I1FA 3RIMA 3F9RA 4F5EA 1AS2A 5JQGF 2N47A 1A8QA 4CZ2A 4JUFA 1R0XA 3OCZA 1J0DA 4TT3A 2D1RA 1E2MA 1FDUA 5HFJA 4DW8A 2I03A 3ZJ5A 2GEKA 2ZJ4A 1QYCA 3M1IA 4ZV4A 3VPCA 3OC0A 2QU7A 3T7JA 3THRA 2XNKA 3OHSX 2QA5A 3R5KA 1KMNA 3MW8A 1WSBA 1I6KA 5LZ8A 4UNRA 5GIOE 3FDIA 2ACKA 3JAKA 4PYMA 4DXHA 4RHYA 2JG3A 4KN6A 1F14A 4I50F 3BMQA 1AQ6A 1NW6A 4Y2YA 1VKJA 4EJ2A 3ZJVA 2BEUA 3B9BA 3OPYB 4AN0A 4LOLA 3E2MA 2M1ZA 2PY6A 3DZ8A 4D9JA 2QP3A 2ZZKA 1GQ2A 2YVLA 5I5EA 2UXDB 2X7JA 3RF6A 2B5OA 4XIFA 1S8FA 3UJ6A 1IUNA 2VQDA 5JJBA 4UNQA 2OBMA 2QRNA 3DFMA 1SZPA 5IHPA 4BBJA 3TMKA 3V1LA 2ZYUX 3GLIE 1N33B 4OQXA 4N6NA 1H85A 4ODIA 5HGXA 1NL3A 2XGMA 1X7ZB 1EVIA 2PZ8A 3KKPA 3THXA 5J23A 1F2TA 2ZXEA 5EWLB 4UCQA 2DPGA 5A1JA 2FUEA 1IBSA 3HXLA 5C2JB 3T1QA 2IS2A 4QELA 1M33A 4F8EA 5HQ3B 2A92A 3SBEA 4BWYA 4G0VA 4OK5A 1BW9A 3PGMA 4II2A 3Q0TA 1E1YA 4TSRA 2J31A 5C3UA 5P8WA 3CSDA 5BN4A 4D8VA 2ODWA 1BX1A 4IRUB 1XD2B 4I2VA 3B2EA 1HFEL 1WZUA 4OHBA 4Y7CA 4ZZ1A 2WHPA 2DB3A 2IHZA 1E2FA 5BV8A 4GSLA 1IDN1 1GA6A 3KXDA 3NWJA 4R8KA 1NT2A 4RLQA 2N9UA 4B6GA 4GOLD 4WN9A 3VR1A 4X84A 2ZWAA 1QHFA 5DOZA 2XOEA 4A4DA 5K6RA 5JI2E 2VUIB 2XWSA 2PH1A 1UKAA 3II6X 3N7TA 5I8PA 1UFVA 1FYWA 3ELUA 3BHNA 4FW9A 1KAMA 5FL7A 2C8LA 3IFSA 1PJCA 4F2WA 3A1TA 3DPUA 3ONDA 5FI1B 1FMCA 4X8OA 4OMFG 5HVNA 1EXMA 3F8TA 5FUYA 1EFPB 4Y98A 3RBAA 5IH7A 4ETMA 5GM1A 4ZDWA 2C9MA 5E7QA 3H2ZA 2JATA 3PUYA 2XYPA 4FIZA 1PL7A 3WNDA 4BAGA 3INRA 2ZSUA 1REQB 1VLQA 2HPVA 1NG1A 2O7NA 2WVJA 1QV6A 4DBVO 4GPTA 4XPIA 3WGYA 3CWQA 2GLTA 4DY4A 5EERA 1RACA 2IYVA 4RZ3A 2FW1A 3DZKA 4DCOA 2OBNA 2YWEA 1XZKA 1M0TA 2OQRA 5K3FA 3RK1A 4B73A 4C2TA 1FMFA 1KS2A 3O8DA 5G40A 2IK8A 3GUUA 3N5KA 2Z4RA 4QQ8A 5DNAA 4EG1A 4OSPA 2H1RA 4OHVA 1IN6A 3ETLA 3JATA 5JH7B 2HEGA 3N8IA 1ISHA 1UM9B 1MRZA 2DMRA 3FDFA 1GT91 4HN9A 4C21A 3HKBA 1PNOA 2XEXA 4NNJA 4BO8A 3KLBA 2HF2A 3O5AA 1EAMA 1XFDA 1MEEA 3M5CA 1JJAA 4HB0A 4TT3D 4W8HA 4Y2VA 4EPRA 1L5OA 5ALYA 2BCJQ 4QPJC 2ZAOA 4L2IB 3Q88A 1Z2PX 2FN9A 2ZFUA 3IIJA 1MAAA 3OTGA 3SE7A 3SYMA 4KAJA 5AJTA 2N42A 3UNXA 4D46A 2F8LA 4LZJA 4EGFA 3AKYA 3WLNA 4E2FA 4ZQIA 3M34A 2GEJA 4P3NA 4LZPA 3X1MA 5I9IA 3L41A 2LCQA 2VF7A 4Y0VA 2O3SA 1ZGJA 8AT1A 2G07A 3GP8A 4BPBA 2IZ7A 2I4OA 3U7RA 4DIFA 1COZA 3N70A 1G0OA 4YMTA 4XWYA 1CQIB 5DSZA 4W6QA 2NVUA 3QYJA 3ZE2B 1O95C 4JAVC 5AW6A 3DB1A 5E7JA 1GT6A 5J2UB 3FUTA 1I6MA 4CCYA 4NOLA 2J9FA 2QN3A 2X15A 4NNPA 5CAEA 4K9QA 2NQ8A 5K0LA 1CZKA 4R5MA 4QGAA 1QK4A 1RAIA 1WW8A 3CZ9A 3EEIA 4L0CA 5HK8A 3F96A 2OG2A 1E9DA 3JVVA 2NSLA 2PX5A 3IQDB 4IXWA 2XMPA 5D5HA 3RUIA 5KNBA 1X3LA 3LC2O 3L4KA 2B4QA 2IDKA 5HXAA 4ZAFA 2Y76A 2W37A 3H9JA 1ZZGA 1NLMA 4KWEA 5K01A 4AKIA 1LF0A 4ADSG 1GRVA 4CDRA 5TIIA 1RAGA 1YFJA 1IC6A 2Y92A 4CCWA 3TOSA 4EITA 3QLJA 3BFPA 5EXXA 4YJFA 4HNTA 1CVIA 3FSGA 3KO8A 1OLSA 4CM5A 2WD9A 4HNAA 3WE7A 4BZZA 3ROTA 1L3IA 3DLTA 3RSFA 4RKYA 3D3QA 5CFNA 3WWYA 1YB6A 2D1FA 1ISMA 2CFIA 1G16A 1GAQA 2HXGA 2QIPA 4XSGA 3EA0A 1NI4B 4G1UC 2HMTA 5AYVA 2PFGA 4HNVA 1GYQA 3ASUA 2EBWA 3FAKA 5TJHA 3AKCA 4UHJA 4OU4A 3PJRA 1QDUA 1EDOA 2DY1A 1GILA 1V37A 5I5GA 1W19A 3D0QA 5J59A 1ENOA 4W99A 3EAGA 5DV9A 3UG6A 1E2LA 2YBEA 4CF6A 1XCJA 4DQUA 5C32A 3ZH2A 2I8CA 1RW4A 2W0SA 3CUSA 3EFEA 1XP8A 4LHYA 2W2KA 1AV6A 4R0NA 5FL7D 3BXFA 1OH7A 3Q12A 4RTMA 1VL6A 1DEKA 2FWJA 3C6YA 1GPMA 1W9MA 3HN2A 4L9AA 1SQ0A 4MQLA 4I5DA 2JW5A 5EQTA 5J1TB 3HCEA 4NPHA 3CH5A 3CY6A 2PUFA 1B6RA 4FFBB 1SB8A 4E32A 3G0CA 4HQ0A 5AO9A 2BONA 2IOYA 1ISFA 3KIPA 5FULA 1B1AA 3S2EA 1HNWB 2G17A 3SKVA 5H82A 5EPUA 5KKAA 2QRKA 2QY9A 2HEIA 5JXGA 3BTSA 4ZU1X 3U49A 2HIHA 1ZSYA 1SG9A 3IDZA 4OVKA 5D1NA 3IUYA 2EZUA 2FR0A 2YJ5A 3HYTA 4FFMA 4LJSA 4M98A 3WSTA 4NYJR 2Q8PA 3EE6A 2NO9A 3MT0A 2GPYA 1PK8A 1C0PA 3I9V1 1ATIA 4EELA 2CW5A 1IQPA 1ORRA 2F3RA 5DM2A 5E4FA 1PWZA 3QA9A 3IT2A 4LMAA 4YUZA 5J4HA 1FTSA 2X4DA 2CNDA 1RRGA 1PDOA 2FWIA 2H1WA 4N40A 5E6UA 1TQ4A 2WUVA 4PXSA 5EZSA 5K8JB 3GLFB 4FFDA 1ISJA 2CT8A 1CFZA 3K0HA 3PD7A 2RHGB 3QLEA 2JNWA 4PBSA 5HILA 3U1TA 4XOUA 4ZAGA 3ETJA 2QLNA 2YZ7A 3GMSA 5LB2A 5IZCA 5AM5A 3CUKA 4G5HA 1CS0B 3RUAA 4GMDA 4CMGA 1U2QA 3IJRA 4QDOA 2HF9A 3D9QX 3EZ6A 1N9ZA 2AZDA 2F62A 1OWPA 3GJRA 3G2HA 3HC7A 1MIHA 2JFPA 1SUCA 4KJXA 2L18A 5B3AA 2LUOA 3H2GA 2YMLA 4D96A 3DHNA 2HRCA 3JZFA 4JD5A 3FYHA 3NYIA 3RV4A 3JWEA 4Q18A 3AEUB 2CUTA 5AJVB 2FGKA 3RVJA 1AHNA 3ROZA 2YUIA 5EIEA 5I4IA 5LD2C 1GSHA 2BV3A 3EF0A 1XZLA 1LDYA 1NI3A 5FNVB 3LFTA 2P5UA 3N2IA 1JWAB 5JD3A 3RFFA 2ZR0A 1KS9A 1QKKA 2FK8A 1OROA 3D8SA 5TDHA 3HDQA 2PV0A 4X65B 5T4FA 2DKNA 3MJDA 4R40A 1TEVA 3FFXA 2PX4A 1B7GO 2LKDA 4MLDA 4Q3EA 5J2TA 2C7RA 3LHIA 1FZTA 3GFQA 2EERA 2YIVX 4LGMA 4D79A 3FF1A 1WZCA 1XTRA 4JOCA 1CJUC 5KNBD 5FTKA 1KYXA 2OHVA 2WF7A 3MERA 2PBRA 1RMTA 1KSHA 3UN1A 3EEQA 3NUQA 2YDXA 2AFRA 4LF6B 1E69A 4H7HA 5A9SB 2PSSA 2A5LA 1FL9A 5EIFA 1MGPA 2PH7A 2GZHA 2FG7C 1O87A 3FSGD 2ZE7A 3GT7A 1LVGA 1ZK3A 3OLQA 3MM4A 4MITA 5FLYA 1RJGA 4OP2A 1M2VA 1R4NA 2WF5A 2LBPA 1NOKA 4R9VA 4FMDB 5C34B 5BQ3A 2BSQA 2ZB4A 4K8OA 3ONNA 1EUYA 2B7CA 1L4MA 4P6VF 4WADA 2EYUA 3IVCA 1U2GA 2V9CA 4LJ8A 4OFBA 2IVFA 1JKMA 3VX3A 3IP6A 3EX7C 4IR7A 4U00A 1APBA 3WKCA 4OBEA 5CB8A 2H4YA 2SCUB 4I55F 4KX3A 3SC6A 2ZQYA 5CG1A 3IESA 1GTRA 3QFSA 2CYBA 4K46A 4DWJA 1COWA 3LUKA 1VJ0A 4F93B 4BB6A 2F9MA 3O4VA 5DNUA 5IC5A 5HKOA 3EXHB 5JADA 2R65A 4C2BA 5B5SA 4LZLA 3U13A 5ADUS 2GZ3A 3AVPA 4FPXA 1YZUA 4RKWA 3DWIA 4EK9A 1XPUA 3ZXSA 1YDEA 4K40A 3T0GA 2QVCA 1X1EA 4YRDA 4B34A 3CUEF 1V48A 1YDGA 5DMXA 2OHHA 1E7QA 2XRMA 1QCZA 3KOMA 2WWGA 2VPYA 2YQ4A 2HSDA 3CGWA 1FYVA 3I28A 2VNIA 3NH6A 5ITZA 2P69A 5DHTA 3U9TA 4B43A 4H0FA 3IEVA 5G1PA 2JI6A 4A73A 2OD9A 4RHFA 4Q9IA 5EIBD 2JBWA 1YMQA 3ESDA 4O2BB 1KY2A 4QEKA 1KZ6A 3SIXA 5FXMA 5JS2A 1RKXA 1TM4E 1RKUA 4U8HA 1CJCA 1JJVA 1AHPA 2BFDB 2X8BA 2OPHA 3KSBC 1KKMA 4CMKA 2G5PA 5A4IS 1IJKA 3GLIB 1ST2A 2V96A 1DTWB 3TDKA 4HDNA 5DCUA 1EX1A 4X1OA 4TKMA 3OIDA 3Q7RA 2A1UB 3LPCA 3R1IA 1VMKA 13PKA 1JDBB 1QWOA 2O0KA 1E4EB 2H9YA 3GG2A 4R8SA 3BIJA 2H0RA 1L2TA 1KY4A 1MAVA 1DBPA 1WJGA 2J0QA 3STUA 4QPNA 2HSGA 3M4NA 1U7OA 2CNWA 3MTBA 2OAGA 3F5SA 4HHEA 5FPHA 2JIMA 3AY0A 3ZHOA 3PNOA 5JY1A 5ALJA 3G59A 2PQMA 3ASZA 4PSCA 1HMYA 2JBHA 1YDFA 4YS6A 3U3KA 4WKPA 2JJ1A 1NDHA 2I1VB 4JR2A 1GD1O 2CJFA 5AD1A 1YQWA 4KUGA 3Q8LA 2V3CC 4GVLA 5DT2A 2ALJA 2K4MA 4X97A 4D8WA 1Z35A 4JMPA 3I2JA 3NVDA 4G09A 1ZX1A 1Y8QB 1G5FA 4M8SA 1ADBA 3MWKA 5DKFA 3O6VA 4ETNA 1LI7A 4BUCA 2C2BA 2BFOA 5L9AA 1GTL1 3ETDA 1HV8A 4GPIB 3RTAA 4DVGA 4BBZA 3QSYA 1ZVKA 1Z6GA 2P2NA 2AWNA 2UAGA 5DM4A 1E5TA 1SR8A 3B1KA 2AD1A 2AF4C 3A0UA 2HK9A 4LQCA 1NNI1 1J9EA 1ICIA 2F9FA 3PUHA 3UXYA 4JI4B 1VGQA 1Q21A 4BNXA 5THQA 4EMSA 4ZOLA 4C3UA 4RZXA 3HU1A 5IUJC 3GI1A 2C9DA 3P19A 2DGDA 2E48A 2F90A 5ARBA 1RAHA 3AYZB 3JQQA 3K92A 3QA3E 3GYGA 1EWTA 1QH1B 2VF4X 3U4HA 1DKRA 1P1KA 2P68A 1DOAA 2O0JA 4HAVA 1G3RA 1G17A 1XZHA 3RVNA 2BZ1A 4JNCA 1M7HA 4HH4A 4PN3A 1HYQA 3NDPA 4X90A 1H93A 2GM4A 3A9VA 3HADA 4KSYA 1Q14A 1ZDMA 4AX4A 1E4YA 4I0WB 3QHAA 4LYGA 1YQTA 1H0HA 3AM3A 4P33A 4RD2A 5D84A 5JQGB 4LFBB 1NJ8A 5A1TA 3L4BC 3CH7A 3D3KA 2QRPA 4LS3A 4EO9A 1I4LD 2Z1NA 1I6LA 4PBTA 1W52X 4EGJA 1JWLA 1PG0A 3I01A 4ZO9A 5FQNA 3NW9A 3GJ3A 4Q01A 5JWOA 4JBHA 3WWEA 1NFRA 1COWD 4DWVA 1N2JA 2O4CA 3LK6A 4B6RA 3LQRA 4RETA 4RVOA 4JUAA 4RK6A 3UJ9A 4DQXA 4ZD6A 2FQWA 4NABA 4B0PA 1T1EA 5BUSA 5ADWA 2IEYA 2IGTA 1GGHA 1OFUA 1VRVA 4U2BA 2WWTA 4TLLB 2A5JA 3MRXA 4CEIA 1S96A 3GDWA 4I50B 4ZPJA 4EKDA 1E1QA 4NCNA 1IN8A 1V5WA 1CX9B 4CU5A 4CMCA 1UBLS 2EU8A 4QAJA 1UWKA 1FF9A 3UK7A 4IYRA 4C5AA 2WR8A 1ECPA 5K0BA 3TD6A 1NBMA 2XKAA 4AX8A 3PSHA 4HLDA 2AV6A 3MMSA 1KBZA 1SU6A 2Q1UA 3HY4A 4QU8A 3IA2A 3G5MA 2CVZA 2PZJA 3ND7A 4WXPA 2D0PB 1PRYA 4LE0A 1G8HA 2WT9A 1S3FA 1XRSB 4M83A 3REOA 1Q95A 2IEIA 2IXBA 3B9RA 4DAOA 2JAQA 2HAEA 4M1WA 1R0WA 1IWBB 4JA2A 4HGPA 1JHOA 1S9HA 4W5OA 3ZGZA 1QRRA 4U1RA 4EW2A 1RXVA 3PV0A 1RP7A 3HQ4O 3QNUA 4OAOA 4TXJA 4UTNA 4KQCA 2QMEA 4EEZA 1JB1A 1Q2UA 2X3UA 2BOVA 2CNWD 3AETA 3C98A 3ZS8A 2DH6A 1U7PA 3TAXA 1PJRA 4QOJA 3AP3A 3RSQA 3IAM6 2HTFA 4F6RA 1D2HA 5FOSA 1Z6PA 4OF4A 2ZXFA 2OEPA 2JJ1D 4P3XA 1YXMA 2GA8A 3P96A 4B75A 3AT1A 3COSA 1Y7PA 2BRUA 4GE0A 3JQGA 4F6CA 1A9YA 1XNGA 2Y1WA 1BCRB 1JLRA 4TL9A 2P27A 2RGNC 3QVSA 2RHLA 4UUQA 5HMLA 3TEFA 5A5DA 4FTWA 3SDSA 1JYSA 2PRJA 4N65A 5F4ZA 1QGOA 3PVSA 3HB0A 1M2EA 1NMEA 3LVRE 3K73O 4ON9A 4TMYA 4TZ0A 1KFBB 4KPGA 3AO0B 2A67A 3VRHA 4ZJZA 4DDHA 1TMYA 4BKMA 2QX6A 4ZV7A 5EJEA 4G24A 1XKLA 1BMFA 5EFOA 4BMVA 2H48A 3LC7O 4TUYF 4MVJP 2W83A 4R2LA 1X7YA 2PL9A 2QRJA 1R4MB 1A69A 2V0CA 1CJTC 3O9VA 3P0HA 5IX8A 4A2QA 1UJNA 2GM3A 1ORHA 2VJDA 3UB4A 3LXUX 3WISA 4HJRA 1MEJA 2G9NA 1ZEJA 1U8FO 2JL1A 3C5WP 2RK3A 3HJGA 4C08A 4IH4A 4QUAA 3ROKA 1OFUX 1PEAA 4TXHA 4D26A 3OA2A 1P0PA 3VI3B 4B7XA 1RHMA 4QAQA 1DT5A 1HURA 1HZZA 1Z5NA 2R6HA 1PNVA 1T1RA 3E7XA 3K20A 4ITRC 3JQ7B 1ZCAA 3LCCA 4PVCA 3RVBA 1EQ2A 1TT5B 3N6XA 2Q5FA 3H5IA 1W7AA 2IUSA 2YHAA 4M1QA 1SOWA 2FG5A 1C50A 1KJ9A 4RMHA 4BN5A 1JLHA 1P3DA 1UC9A 4M9CA 1LBQA 1W30A 3KQYA 3HVIA 5TMPA 5F73A 1MCZA 3PFGA 2X0IA 3ND6A 3ZD6A 1Z74A 5DCLA 1USVA 2Q1SA 2XZDA 3O1IC 3HCDA 3D2LA 3JVEA 3PX2A 4LBYA 4N8EA 1MIOB 4R1PA 2RBGA 4M9SA 4U6QA 4JI5B 1LC3A 3BD9A 1C3OB 4BLRA 3L7YA 3H9QA 2I3BA 4JI0B 4JK3A 5D6OA 4RJLA 2YVQA 3S4YA 2EOAA 1RZRA 1NBMD 3GNSA 5AIAA 1U5AA 2AHOA 3JD2A 1VJ5A 4KH0A 4RQBA 1JQBA 1QTQA 3TRFA 4HF7A 5U1PA 2L0XA 3QUQA 3BIOA 4ZI3A 1YZFA 2GJSA 4JC5A 3ZXYA 1U3CA 4UHEA 5ER9A 3B1VA 3L6EA 2A4MA 3K9FC 3A11A 2RB4A 4EJSC 4RVUA 4F4HA 2OLEA 1QNFA 1X7ZA 3N9IA 4KQ6A 2O2HA 2QGZA 4OEHA 2ZE6A 2CYCA 5EWLA 2BR3A 1ZYUA 1PAUA 3BEDA 3IAS6 2HZ7A 5C4MA 4TTAA 4PNHA 2FSIA 2E49A 4E2WA 5HQ3A 1MFZA 1UPTA 5G0WA 3WBBA 3KUXA 4R7ZA 2I7VA 1JR3A 3CYFA 1MV8A 2XKJE 3OH8A 4RXUA 1XD2A 4D57A 1S0UA 4D4MA 4C3OB 1D1TA 2NZ2A 2XQFA 3LUBA 3R3JA 2WJVA 3O0DA 4IZ6A 4L5YA 2HRBA 3EGOA 2P11A 4HGNA 4B47A 3TYXA 1RLTA 1F0NA 3HYSA 1X1RA 3FXAA 4W63A 1O4WA 5CCDA 5TT0A 1MHTA 3I9KA 1NPYA 4NNOA 4LZAA 2ZAIA 4RQTA 2HQ1A 4FD2A 2I4MA 4DPLA 5EJ8A 3OWXA 1HQYE 4LYDA 4BDTA 1WF3A 5DK4A 4D3DA 1WKBA 3FW1A 1D9XA 5U4QA 4KYVA 1UEXC 3F3KA 4RK0A 3RANA 3M6WA 3WLOA 2GUWA 2YN4A 3LUHA 2FA9A 1XU4A 4N5NA 3WL3A 1EFPA 1B2RA 4J8PA 4X94A 2LCIA 2AKYA 4E09A 5EG5A 5LYJF 3KYDB 4MO2A 4JLJA 4MICA 4BFYA 1XAGA 2PCJA 4ND8B 4BNKA 3RWBA 1AMOA 3OAAA 4GC5A 2R2AA 1NX9A 3GD7A 1REQA 3BRWA 4RMNA 1K3UB 3UBMA 1AHIA 3RG2A 2YBDA 4Q9HA 3JQCA 2VK8A 2DPXA 4UMVA 1FXUA 2XYRA 3UPTA 4LDJA 1PE0A 1SO8A 3ICCA 4LXXA 1FJHA 3HSSA 5JJKA 1ZI6A 2L82A 1JAZA 4BNUA 3DYBA 1LQTA 3RRNA 3TKAA 1QANA 3DTVD 4YO7A 4KWTA 4AJ2A 3I42A 2HW8A 2C1ZA 2FSFA 3D5QA 3KL4A 2W0MA 5JH7A 2ZVDA 1E9CA 2DTXA 2FY8A 5LP6F 1UM9A 3BL8A 3BOSA 4LFAB 3P2EA 4RNDB 1BX0A 3TH5A 1P9OA 4RXMA 4GH5A 3LUCA 2QNIA 3PYLA 5LM3A 1Z5WA 5ICCA 3AR6A 3R74A 3DHYA 4OXRA 1Z4IA 4PC6A 3C43A 1A4RA 1CF9A 3A28A 3C4JA 4L2IA 1KF0A 4R05A 4X8HA 1F17A 4XLLA 3RVKA 3Q8MA 4B3GA 3ZGOA 2FPUA 2H92A 1GHTA 4KE9A 4DMFA 3QX3A 4FB5A 1C4XA 1V6CA 4Q3NA 2PX8A 2QROA 9ABPA 4KV7A 4M1YA 3RC7A 4DR3B 4ER3A 1XR3A 5EEHA 1J8FA 5KYKA 3JVIA 1GFZA 4UVGA 4F4DA 1OWLA 1GXSB 2JFOA 4DQ0A 4NYMR 4NXNB 4JKOA 1E3MA 4ONEA 3IVRA 4MOWA 4EI2A 3U09A 1NOIA 2OK8A 1HM5A 3SE0A 5KREA 1CQIA 3W7AA 4DJDC 5LZ9A 4FYXA 3ZDRA 2HJRA 4BX0A 1CYEA 2GK7A 3BSWA 2OCLA 3C8MA 3V42A 1RXUA 2NQTA 3K7EA 6CHYA 1QOPB 3L1IA 3O4JA 1M2HA 5J2UA 5CLJA 1JJFA 5EJ4A 4TWJA 1KRWA 4D2IA 1RADA 1YDMA 1NKVA 2HO4A 3ZWBA 4BDSA 2PN1A 4WXYB 1BVYF 2AQIA 2SHKA 3CCBA 4XX1A 1KDVA 1P6XA 3KTFA 3MBOA 4U8GA 5EHZA 2PVSA 3OZBA 1NN0A 4PG4A 2A35A 2EJBA 4PRKA 5JDCA 2QRGA 4LECA 3U4AA 2C4UA 2REOA 3PPXA 5EZ5A 2H7CA 3T34A 3W9SA 5I4CA 3TFOA 3I0NA 3IUPA 2WD7B 3IT0A 2JLYA 4JHLA 3LYHA 3ENQA 1VB5A 3R7WB 3OZIA 4BQOA 4ARIA 4FGSA 2EG5A 5TGTA 5HJEA 1AQYA 1BGWA 1U7HA 3KB2A 4HAOA 4WGFA 2RH4A 4YHBA 5IN5A 3V4VB 1Z63A 3FBGA 1JR3D 3PI7A 1E5LA 2B94A 4C89A 2A0XA 1MJGM 1BRMA 3DONA 3Q3IA 1WDTA 1XLTA 2PKRA 3GGOA 4C14A 2RI6A 1GYRA 1NBIA 2XCIA 3B36A 5ALRA 3OMLA 3NC1C 4KO8A 4CPDA 1SKYE 5FT9A 1DWOA 2ZJYA 1NI4A 2EV9A 1GPYA 1GGVA 1X8XA 1T6NA 4H9GA 3RJ9A 1P7PA 5JLJA 3IMGA 3VAYA 3CO0S 1RPZA 1Z9BA 3RUPA 5IAGA 5IHXA 3LF1A 1LXCA 3SAJA 1BNCA 3GU3A 4MWTA 5T41A 4OHPA 3T4XA 4AAYA 2IVZA 4I55B 2DTDA 3IBSA 1JA0A 2O05A 2RKOA 2X0KA 4NBTA 3W04A 1L7MA 3LL4A 1TK3A 5AI8A 2RI0A 3WMWA 5AM2A 4GOOD 4W8GA 4BMOB 2J30A 2JLAA 1R9GA 3DVRX 5DLEA 4QYTA 4ARAA 5JNUA 4B84A 3R20A 2GNAA 2IXTA 5DBFA 1NVWQ 4FFBA 2Y8EA 5FTLA 2EFHB 2YH2A 1AZTA 4EVRA 2H8GA 1TVKB 4HH3C 4F5YA 2X42A 3BRWD 3WV4A 4EW3A 2VA8A 3LHFA 3HA5A 4G84A 3SIWA 4QM6A 4MV0A 1XTQA 1HE2A 5BPFA 3JWGA 1XTJA 2ZIEA 1FXWA 4LNHA 1UBJS 4LJ6A 5AHKA 3F9CA 4BX3A 1G5IA 1OZ0A 5IXSA 4M7PA 1OXSC 2RBKA 4ZJPA 4C3VA 1H23A 3I9MA 4RJIA 4ER0A 1JTEA 2H1CA 3RAPR 4QSMA 2ADFA 4MA4A 1FQKA 1ZNXA 3DEKA 3IUMA 5FFMA 3GLFA 3EEYA 3RT1A 2VSFA 5AW0A 3TRJA 2NUBA 1WBDA 4FMPA 4Q1VA 1Z0ZA 2Z4SA 3IR7A 4BMCA 2FFAA 5EVJA 3ABIA 1A4UA 4JITA 1N5IA 5I7RA 1KTIA 3SMQA 3QPWA 4JWKA 3J7TA 4ZCQA 2GI4A 3UK0A 4Y67A 1CS0A 5UKDA 4L07A 5CXSA 1JILA 1YU9A 4G8JA 4D6XA 5C51B 5C1OA 1PJZA 3DDSA 2J3QA 1KH1A 1X1AA 3OJOA 3DM9B 2J5QA 3KPUA 2VJMB 1SFRA 1R50A 3HVHA 2HV9A 3T3OA 5KTMA 3CZ5A 1UXJA 4RFVA 1GQSA 2OO5C 1NRWA 2FV8A 2PH5A 3SXJA 3U44B 4UPVA 5DBEX 1RMYA 3HJTA 2GERA 4QBGB 3VM6A 3X3HA 2H2IA 5TARA 3D64A 3WLEA 2AFHE 3AEUA 1G98A 5EI5A 3B1YA 3H16A 3KE9A 3U16A 1QUEA 2QRUA 1T0JB 5EP3A 2Y99A 2WWXA 4UTOA 4L76A 4MKHA 3LX4A 5FNVA 3DHEA 2IELA 4NTZA 3R9XA 3P27A 2WF8A 4O4LF 1FX1A 2PS1A 4W5JA 4YJDA 1GFWA 5ITSA 2WV7A 5AVQA 2EIHA 1WB9A 2Q62A 4PPGA 4A0FA 4JXKA 5DHFA 3TNDA 3P71T 3IPAA 4TKVA 1NQ5A 3D8RA 4U4AA 3A6EA 3TM4A 1KAQA 2GRJA 1YR2A 1IY1A 3AFGA 4KQJA 3T3HA 4BWVA 4OIMA 2GBLC 3L0SA 2O57A 2AI2A 4LXQA 2XITA 4J03A 5IG2A 4B6SA 3FCAA 4KOAA 3ZK9A 4O8ZA 5J47A 3NJRA 1ZNYA 4KKVA 2QQEA 3MLEA 2OZKA 2WJ4A 3IQHX 1XZ8A 1QIFA 3JW8A 3MVEA 4KWIA 4X00A 1FQWA 3GLHE 3DP9A 4OOEA 4MS4B 4BVEA 2AOWA 4G0OA 1G1AA 1T0UA 4YBZA 1N34B 5JE8A 4EHNA 4L4ZA 2HDWA 1HQCA 2WWIA 5C5DA 3K96A 4P84A 4Q3CA 3BSSA 3BWBA 3JYLA 4QECA 5HJ2A 3WDLA 2Q6VA 3AUXA 4BGIA 3SM9A 1OKKA 7ADHA 3R6TA 1II0A 1PL0A 4S0ZA 2YXNA 3V7YA 3KR0A 3EGIA 1Y89A 3PXUA 4FDUA 1V3QE 2QRZA 1UKVY 2SCUA 3GFRA 4FOTA 4ZVOA 1PR1A 1MT0A 4NY1A 3AINA 3ZHSA 4F8JA 4J0DA 1W75A 2JGIA 4R1MA 1GPWB 1LI5A 6PFKA 4R8RA 1NRXA 3ECSA 3EXHA 4E03A 1KBQA 4DR7B 4F0JA 1PNTA 5DXAA 4HQRA 4K2HA 1JDUA 5DGTA 3U6KA 2C0QA 5ILGA 5FOTA 4JNKA 4NBWA 4BAZA 1EGHA 5FLEX 2CLKB 1H4TA 2ODNA 3WK4A 1KPGA 2JEYA 4JLMA 4WXHA 3FFWA 4O2BA 4OQDA 1JKXA 3EZFA 2W6OA 3IIIA 2BHSA 2D54A 5CX1B 5HA5A 4EJ0A 4ETIA 5KUTA 3Q1LA 1ZH2A 2C7BA 2BFDA 4CM3A 4L5JA 4D8YA 1I7QB 5GIPE 4QXRA 3ESXA 1SHUX 4XARA 4W9NA 5F23A 5JWRA 1J0CA 1YRYE 1Y9EA 3NGXA 1DTWA 3QEJA 4WK0B 3FYDA 3GLIA 2Q9CA 3F5FA 4WERA 3G2IA 1NU8A 2A1UA 2FVYA 4HSEA 4CNQA 2E18A 3BULA 3U1BA 1E4EA 4AS1A 2A9KA 1L4HA 2KYRA 2PCLA 2XCRB 1T8UA 2XMBA 3CKMA 5K6AA 2DR0A 4XRRA 2I62A 5ELMA 4AY5A 1JZTA 4NCKA 5JNRA 4ZEVA 3AUKA 1I9GA 3QLUA 2LVBA 2QS9A 2DSTA 4EF5A 1Y37A 1AUQA 1Y1TA 2EW8A 2X8JB 3FNQA 4NULA 4DQDA 3U3RA 2GFQA 2J3MA 4DQVA 3HFRA 1WXDA 1XLUA 3JQAB 4KRYA 3D6FA 1TPZA 2YY7A 4PYIA 1NXSA 1TYCA 2JLVA 3IKMB 2JD0A 2CXSA 3QU7A 3GCDA 1CG6A 2RHJA 3AEXA 3HO8A 5M34A 2BZGA 1C8VB 1Y8QA 2J33A 2FSUA 3GRUA 3UWKA 1YULA 2G1KA 4P53A 2R86A 3O3NB 2WJPA 1GPBA 1POXA 2G5GX 3M6VA 3UW1A 4DC9A 1ZK1A 4GEGA 4N7RA 4D9IA 1UL1X 4YP9A 3AUJB 4I6GA 1UT5A 1W5AA 3TD2A 1AQNA 3I9V6 3ONFA 4PLFA 3KQWA 3I32A 3DCJA 3O1HB 1T15A 1YUNA 3BE5A 3CKYA 3LY9A 2WKRA 1DOZA 1E3EA 4HKTA 4MRAA 3BPSA 1RI1A 1CLEA 3LHDA 3OZVA 4XUCA 4X1YB 3V97A 3T5MA 2BZSA 1CFJA 3O3CA 1ML3A 2C2KA 4FKMA 4MPPA 1EFTA 1WHTB 5F12A 3W79A 1DAFA 5JFOA 2VWHA 5EHGA 5A2GA 1ZESA 1VMDA 1QH1A 4G5YA 4DM7A 2VSOA 4DTCA 2QD2A 1HNXB 1A9RA 1V9SA 1IEWA 4JX9A 1E0KA 1V45E 2ZE5A 4P7GA 4BAUA 2XA2A 3WGGA 5ERGB 3F71A 2OXTA 3VI4B 5ESXA 1JA9A 4L4UA 4K6MA 1OKKD 1RM4A 4D9KA 1NM5A 3GOHA 5JQGA 5CNJA 1OR8A 1EJBA 1K4KA 1W6UA 3L0DA 1M74A 4KE7A 4D5EA 4JBYA 1R8SA 3C3PA 3NG1A 3VYWA 1E3JA 2PUCA 3KM0A 2HK8A 3NXSA 4A1FA 2HU2A 1E2EA 1XJCA 2I8AA 1DKUA 3ORQA 2DPLA 3K72B 4LI0A 2BZ0A 3WWZA 3HDVA 1PFGA 4ZT7A 1E64A 4BLSA 4E3ZA 1FUIA 1S2NA 3GAMA 1SCIA 1Y1SA 2ECQA 2HJWA 2E37A 1YJ8A 3QEOA 4I50A 5I6DA 5DASA 3D2AA 3DLIA 3GDFA 4TS9A 2ASEA 1RJDA 2I65A 3BCHA 5EUBA 5JNTA 2FX2A 2R0QC 4NL4H 4EL0A 4YRZA 1SCKA 4IOMA 2W7TA 3RW9A 2PXCA 2X9LA 5G02A 4LSZA 4IGAA 2VQ6A 4TQUS 1O6FA 3RT7A 9GPBA 1GNLA 1Z33A 3OOYA 3DO5A 4KXXA 1Q7TA 5H3HA 2QTAA 3SFTA 3W2FA 3V4RA 4IXMA 1C1DB 1PHRA 3B5JA 3KL2A 3L6CA 3DPSA 3P94A 4MVXA 4DIKA 1CNMA 2XHZA 4ZVPA 3QPDA 2QGNA 1OI2A 3EZXA 3LFHA 4WOKA 1DRJA 1ZU5A 5TS3A 2C2GA 1OU0A 3TFWA 3BDVA 4M3NA 3PQEA 1PJTA 2OCKA 3SF8B 4BO7A 2AN9A 2Z6AA 4QYSA 5HF5A 5KU1A 5LQDA 4JU9A 1QRTA 1ORDA 2XF8A 4IPTA 5H3CA 4F97A 5EWMB 2R48A 4Y9DA 2D5IA 4DA7A 3SBDA 4F06A 3L7NA 3QUAA 3CPSA 4XM0A 2EARA 2YR0A 4QGSA 2IRWA 2OY0A 1PJ2A 1RI4A 4G01B 1GDHA 4HN4B 3QEAZ 3DBVO 5F1YA 1BCRA 4AFNA 2B92A 4GX2A 3C3CA 4LEIA 2YZ2A 2ZYVX 3DGEC 4G4IA 1X15A 2VNAA 3I1YA 3DEHA 2YC4C 4MVJI 3NKVA 4HYYA 1Q7EA 3JAWA 1PJSA 3FGNA 3EIOA 3SKXA 4EQZA 4QARA 1HLGA 1V5IA 3JYOA 2KE5A 2W6PA 4HC4A 2CNKA 2J5BA 2R6FA 2X1LA 4QJ5A 2H52A 2W22A 3NWOA 4L4XA 3RIYA 5IF3A 1M8GA 2O7VA 3C7AA 3LBYA 4MYSA 4P1ZA 4XSVA 4XQGA 1YHZA 4ZYVA 4S2EA 1Q1ZA 5AUPB 4IHJF 4ENSA 4B9EA 5ALQA 2PS9A 4HRAA 4G0WA 3HWWA 1P62B 3FPFA 4DV7B 2VAWA 1B73A 2FZ5A 3WMFA 3FA2A 3V1TC 3RIXA 3A1SA 4UEKA 2HDHA 4OQPA 2DHEA 2ZI9A 3HB7A 3RVSA 3PPIA 4ZYXA 4FEYA 5JYBA 1R4MA 2G83A 4DG5A 5DLPA 1M7GA 4I81A 2OV4A 4CLEA 3EIWA 3KQTA 3N75A 2JVKA 2VZ9A 1W88B 3MMXA 4KPEC 2X4IA 3TN7A 3W2IA 4DMRA 4KLZA 1A9XB 4B7ZA 1KZ4A 5IC6A 4JI3B 4DLLA 4DR1B 1C4KA 1N6NA 3DT9A 5FX2A 3UAOA 1K92A 2A2ZA 1U2RA 3GT4A 4FC7A 5LP6B 3ZOZA 5IRCD 1DBRA 2JCVA 1GGJA 4P3OA 3JQ7A 2V59A 3KZ1E 1YVUA 1Q1EA 1TT5A 1JYFA 3L6UA 4PV7A 4U9UA 3ZVLA 3DT6A 2O2GA 1R0ZA 2PFKA 3OLZA 4INOA 1S7CA 3W5SA 1BVHA 2QRVB 4KTTE 1U7ZA 1C2TA 1OGYA 4RJTA 3LTNC 1ZRNA 3MJCA 2QTLA 4BLOA 4FX2A 5IFLA 3VV2A 4H60A 1PJ4A 2H17A 1RWMA 2I34A 3OFKA 2VP6A 3E27A 4JJAA 4TQGA 4UM8B 4AN4A 4E5PA 5IZ4A 2CB0A 2UDPA 2P8SA 1I1HA 4YI5A 1MIOA 4BKRA 2C5LA 1C3OA 2VAPA 3P9YA 3PNBA 1KI4A 2Z3VA 4UDNA 4LTMA 5DYTA 2QMUA 5AKYA 2F8MA 2JIBA 3GELA 1CUWA 3NYRA 2Q7DA 2Q3LA 2DAPA 1S2OA 4KVGA 4OAQA 3NGMA 2GN2A 2R60A 4RELA 1L8LA 4F96A 2W93A 3UIEA 3QOWA 1J39A 1B8UA 2FR8C 2IW1A 3C14C 3EGCA 3EOAI 4WVFA 5HWSA 3LC1O 2RAPA 3FPEA 5CVCA 1N0UA 2QI9C 5C46F 2WYVA 3GFOA 4LBZA 2HGZA 4NU8X 4Y9UA 3FNHA 3P0EA 4DV1B 3NR2A 3HZOA 4TL6A 3ZLVA 5G0SA 5K45A 1GWNA 3L7KA 4QULA 4QU5A 4MW6A 5C1PA 2QR3A 4IMPA 4HN2A 4ZQFA 4A27A 4EH1A 5BUQA 2PSEA 4LJ9A 3MS7A 2O8VA 2PT5A 3ILSA 3KOOA 1N3YA 3AEZA 1NQAO 1I8TA 1R6UA 2H3EA 2Z1MA 3KPJA 3QPUA 4FT4A 4EMUA 3L4JA 4DB2A 4NC9A 4L50A 3ZCTA 5TS2A 5LDGA 1QNLA 1QMGA 3GLHB 2QUZA 1NVMB 5D5PA 1YZYA 5GOZA 3SJ7A 5EJAA 1LB1B 3UGTA 2ZCVA 1GUDA 2JZCA 2PLNA 4LTDA 3WRWA 5FV4A 5ALEA 3VYUB 3I5YA 4AO7A 4DQLA 3ZGYA 3AG5A 3KTOA 1Z4KA 4S3MA 221PA 4UCXA 4BYGA 3CEJA 2OKCA 3QFRA 1S4MA 4OTZA 5LLDA 1ZW6A 2VHTA 3EIQA 4ZZ2A 4ARSA 4RA6B 1B4DA 1DC3A 2WC1A 3FLMA 4FBGA 1W29A 1G9TA 4NYIQ 4Z49A 3J81k 3PI6A 4PGAA 2PKXA 3WJ1A 2XECA 4B4DA 2QMYA 4YJHB 1S2LA 3RVOA 5AW4A 4GLJA 1XRNA 1FOEB 2L42A 3VHRA 2DC1A 4AJKA 1DDOA 1I5EA 4AROA 1KP9A 4AZWA 3KYDA 4L4YA 4YLYA 4DR4B 1N2GA 1PYDA 1WXIA 2PZBA 2ZRHA 3G5TA 4YRCA 4ND8A 4EHAA 1VYUA 1ILWA 1EGQA 3QHPA 3ZJYA 4CDMA 3C85A 2ZYGA 4BKUA 2ZITA 1C9YA 5F35A 3AUYA 3IDOA 3NDBB 3F5DA 3HB4X 3LX5A 1KH2A 3AG6A 3QYAA 1Q1BA 1A5BB 3GAZA 4M7WA 5CM2Z 5EXTA 3W8FA 3GRRA 1KRHA 2MYPA 2ZRCA 3W9UA 2WE7A 4E1BA 2E4UA 1ADJA 4R2XA 1LRLA 4DYVA 3EGWA 4MAAA 4GOJA 1OZAA 4ID3A 5BYBA 4CMJA 4CMIB 3HEMA 3FWZA 3GRYA 3S81A 1QK3A 1UDCA 2F48A 3DEAA 2EVWX 3UAWA 3UCFA 3QTTA 1ZICA 4PC2A 1FJ2A 2R4UA 4PYKA 5HS4A 4YCNA 3DFUA 2DM6A 1CERA 1E20A 1JG6A 1KDTA 1LLUA 1IAVA 4IIXA 5LBIA 4LDAA 4XCXA 3TIGA 3ER9A 3EVTA 2BE9A 4QOGA 3PGLA 3QXJA 3U4MA 1VG8A 1QF9A 1GU1A 2VYNA 3EZ9A 3O95A 2ZWIA 4BWFB 1GXSA 3WGTA 1U98A 2JIZA 1Y98A 3BDAA 4ID9A 3REQB 5FLKA 2C2MA 4XM2A 2F4VB 3HJNA 3ISTA 4ZCIA 1Q84A 4MQMA 2C97A 2X7HA 1U04A 3IB3A 4DV6B 3BGSA 4JBXA 4DLVA 2QR5A 4PG6A 4JFRA 4I4TF 1WMSA 2H07A 1OE0A 2BPOA 1EJ6A 4HADA 4MWBA 4B8YA 3HEBA 2HT6A 3NOQA 4PYQA 2DFKB 3Q85A 1KKLA 3GJYA 4MUJA 1EWRA 3I6QA 1XI2A 3FZNA 2ZIAA 1AKQA 1FTWA 1KYQA 1NJ1A 2CKMA 3HCRA 5FBHA 4CR8A 2DULA 2WD7A 4V0QA 5E3IA 1ONPA 4PLGA 1X14A 1YTLA 2FFJA 3H3JA 4BVGA 1ZOPA 3AHHA 3MTGA 2FPGB 3QMWA 3VO9A 5KYYA 5FIUA 4BMNA 1LLDA 4HQOA 3MWEB 3UWDA 2WSMA 3EIEA 4MGKR 2WHYA 2ZIXB 1VKRA 1JPNA 2BELA 2I9PA 3CBQA 4P7KA 4HAUA 3GLGE 2J1LA 3G68A 1IXRC 3WLQA 4DUYB 1HXHA 2HUNA 3CF2A 2XEDA 3O7WA 4RS4A 3R7BA 3E82A 4ASUD 3R3VA 1QZUA 4G07A 1C4OA 4IDHA 3N7UA 4ROSA 1XZBA 4C0QC 3VKGA 1I7DA 1KERA 1X94A 1JHUA 2KI5A 3B52X 3MCUA 2E4XA 2QYTA 4KE6A 3ILXA 4ZHQF 2I2DA 4XDYA 5IAKA 4NZYA 1M8PA 4IICA 1WMEA 1X74A 2CUNA 2VA9A 2ONCA 2WWFA 4N6GA 4PFSA 1VMIA 3OLWA 3ITEA 4I55A 5T6MA 1UKBA 4CN8A 1M1ZA 1T2AA 4BKPA 1VP9A 1THZA 3BRCA 5IWAB 1SUAA 1C7ZA 1NR5A 5F9MA 4CT0A 5ESRA 2VSQA 4ECAA 4TMXA 2I7TA 2R8PA 3X1DA 1I10A 1LDBA 3UCEA 2JCXA 3KVNA 4DNPA 2Q0QA 1N2HA 1XDGA 4JCOA 1TVKA 2E6UX 1FSZA 1WU7A 4OP1A 3EB9A 1L3BA 1PZFA 2Q28A 3ABQB 4XB6B 3ICVA 3IPCA 3PUXA 3QKIA 4U9IS 4AQ7A 2DFLA 2AEMA 1NUPA 3LE8A 3NV9A 4FILA 4EVQA 1G4UR 5C8ZA 4FYPA 1BXGB 4YCAA 2PVCA 3OUZA 4N82A 1Z4LA 4OSEA 1KC3A 4WSOA 1TC2A 3KHTA 4UPDA 2H9IA 2JFZA 3GJ8A 3ADCA 3MS2A 3Q10A 1JFVA 2QZ9A 1T2FA 3R5HA 3WZLA 3DBIA 2AMYA 1B8PA 2VHEA 2JKZA 4C7KA 3EHEA 5AOBA 4BFZA 5CYFA 4CG3A 5KNCH 1KBOA 1WP4A 5ARCA 1JJBA 3BF8A 3CU5A 1UK6A 4JX8A 5HZMA 3UICA 5IDVA 2O06A 4I1VA 3OVMA 4S0XA 3IT3A 3HFJA 5CJJA 3X44A 3AP1A 2JHAA 4BO2A 1ECJA 5T8KC 4HX2A 3OWOA 4PLYA 3P26A 4JBWA 4K1XA 1B8NA 3CTMA 1K98A 1O7JA 3L9WA 1NVVQ 2O14A 3I6BA 4JJEA 3RCBA 1VLJA 3B78A 3DMDA 3S7TA 3GVPA 2VJMA 4N8DA 2NNLD 2I2XB 2RB5A 2VYND 3VR6A 3U44A 3E2IA 1TDJA 4INPA 1BN7A 4IRXA 2JIZD 2PSJA 3EY9A 5BSUA 3TLAA 5HUQA 3WL5A 2AN4A 2GN0A 3V1MA 5CRIA 2FZKA 4IDBA 3B6ZA 5DX8A 3KQPA 3MMPA 3PNYA 4NHEA 4D3XA 4IMJB 3FFAA 2CXHA 3WNQA 2Q3JA 4AM8A 3RLIA 1U81A 1ISGA 2POCA 5JRDS 1H6CA 2C4VA 1UAAA 2HMAA 4J94A 3NHYA 4IQ8A 3PQ5A 4ZHSA 2FF7A 1L4BA 3FCXA 1PT9A 2CLCX 3OKAA 3SC4A 1NVEA 1CB0A 1Z8FA 3AOGA 1T25A 2J32A 4HLUC 4DMLA 4RD3A 1SD1A 3PDUA 3BXPA 4BO6A 3VNUA 5FL3A 5IVPA 5HOQA 4RIEA 2PYZA 4E94A 4Q4CA 4X9XA 4TVOA 3MZ0A 3WYBA 1F0PA 1E0SA 1ZQ1A 4OPMA 4JSRA 1CRZA 1JVNA 1OX5A 3DOHA 4YQFA 1DVRA 1JHMA 2A33A 3VO1A 3EPHA 4GM4A 1IY0A 2C07A 2EX1A 2O2EA 2UYYA 4MS4A 5DRTA 3SIRA 3T54A 4AJHA 2Y6VA 3E5RA 4JIGA 3ZV6A 1PL6A 2Y0PA 1MDFA 1ML4A 1OC4A 3BCRA 3W2TA 1EU1A 2CBZA 4FT2A 4KQEA 2PUVA 2WPDA 3U61B 2DUMA 4YRNA 2WZQA 1CUIA 1Y8CA 3MAJA 2XRYA 4MW4A 2P40A 3G7NA 1O08A 3M6FA 1SKMA 1LLFA 5CVJA 3I04M 5HX7A 3HDHA 2XTJA 2OWEA 2C31A 2P79A 3C8HA 4LOKA 5FH9A 4MCHA 4HVLA 3S2IA 2VXCA 2P78A 4GEKA 2QLBA 4WH0A 4NX2A 2NPFA 3OUTA 4LJKA 1J1IA 1Z26A 4H1UA 4XUEA 4ES6A 5IJ9B 4G0YA 2R6ZA 1HRDA 5SZIA 2R11A 1Q3TA 3C24A 4E1AA 1L8OA 2MDTA 1Y7LA 4QGFA 4ZVQA 3QU4A 1T5BA 3U37A 1TJ4A 3FMPB 2NXJA 4IJ5A 3HSYA 2QVZX 3HSKA 4TLCA 3W3ZB 4C2AA 2L69A 1MB0A 1GPNA 4HRXA 2VPTA 3ME5A 4KQXA 1W4ZA 1GKYA 3OECA 3Q2KA 3SS9X 4B76A 2X7XA 2A9VA 1KDPA 4PCLA 1TCUA 3CLRD 3HP7A 2C2WA 2Q2NA 3TTTA 2VZ0A 3ZHTA 1YRAA 1KQPA 2UUOA 1EK2A 1C7RA 2TMYA 3AY3A 4NR0A 5H83A 1W0CA 3H65A 5LZ4A 1EE2A 3L6BA 3OJLA 5LPNA 3JARB 1J33A 1LDMA 1B1CA 3QLVA 5E1DA 2I3GA 4RZ2A 4BNGA 2CKDA 3TB6A 4A6DA 2LWIA 3IVMA 1NYQA 3NC0C 4GPBA 3RYTC 3WGKA 3NBUA 2PKQP 3F97A 1JP7A 3UB3A 2WOOA 3D1JA 4ZVNA 4B46A 1TB4A 4BFTA 1RPAA 1EJ0A 4BC1A 4NJOA 2GJ8A 3ORHA 1DLIA 2VJQA 4XRGA 1BQEA 1PSZA 2OHOA 2X8JA 3HI6A 5IU6A 3GB9A 1D8AA 1R6XA 1WXWA 4D4HA 4QFDA 4L22A 3VR6D 2RGRA 4AL4A 3O8LA 1ZVJA 4JELA 4FYJA 3JQAA 3RSLA 3IQIX 3D7MA 3Q5DA 4MP6A 2H2FA 3PS9A 1CULC 1QE3A 2P2GA 3PHHA 4R81A 1PTJA 5E2AA 1OF1A 2H1IA 2XMZA 4DDVA 5LLTA 2JI8A 1VFPA 2JLBA 1E9AA 2H5IA 3FVVA 1LFDB 3AONB 4M1ZA 1YUMA 3H5NA 4PLPA 4TRJA 5BQOA 3KT6A 1ZN7A 4HVTA 3SYRA 1KO5A 1L8AA 2CLHB 2C8VA 2IP2A 1NBHA 2OXEA 2HMVA 2XVZA 2P3LA 1NV9A 2IHTA 2ZBFA 4GG1A 3CR3C 3L01A 4LRUA 4RZIA 3V4LA 1DOHA 4OQNA 1N0VC 5CD9A 4MDYA 5I7OA 3S27A 4AYWA 4NPAA 5LIPA 4RVNA 1QK5A 2D3WA 3W78A 2Z2JA 2BI7A 1G2OA 3H4MA 3DWFA 4BNNA 5DFAA 4RD6A 1DQPA 2J41A 3W4IA 5HUHA 1WUKS 2GKSA 2R8BA 3C8DA 4IHJB 5CW1A 3BREA 3UJNA 3GIWA 4Q4HB 2P9HA 4MV9A 4HX9A 3K71B 3ZTYA 2VQSA 2W6MA 4JT9A 3ZTTA 3OSZA 3AOEC 2YNMC 3H1GA 4TTVA 4X1YA 3N2LA 1OBOA 2IYZA 4X6YA 5FI3A 1KTVA 1EFCA 1DRKA 4XSHA 2ZLBA 3WQBA 4YDQA 1NF9A 2C58A 3GZ4A 1PR4A 4CG1A 1E2DA 3GK3A 3RSZA 1BH6A 4REQB 1UPXA 5L6MB 1ZGCA 2WUFA 2YY5A 3D0KA 4XWGA 1G2PA 5D6NA 1QGYA 2QUHA 1Q77A 3QWFA 1JSZA 2V1XA 1I33A 4FR2A 3PCTA 2F3QA 2ZRLA 3GH1A 5J43A 2UYQA 2WPDD 5DWDA 2FDXA 3EVEA 4HK4A 3PC8C 1U1FA 4PTZA 4HUTA 2CV2A 1B76A 2B1JA 1M5RA 3KQNA 3L7JA 4I8XA 1TGYA 3KFLA 5FP0A 4RK7A 1LSJA 2CHQA 2NUAB 4BVFA 2RK6A 4FCCA 1EVZA 2PZKA 2QPTA 2FPKA 3UWPA 3VH1A 2IZ5A 4QUEA 2V7BA 3IPXA 1IXYA 2B61A 1H5NA 1Z2OX 3PEVA 3FZEA 3EPLA 3V4SA 2V4MA 3KJGA 1UPCA 1L6RA 1JXMA 1ZINA 3QVUA 4Q4AB 4X5OA 2Z8ZA 5DGCA 3WRXA 3FBTA 1EVYA 1OOEA 2R2GA 5HM6A 1M54A 3F3SA 1S4QA 4K7JA 1XWWA 1JU9A 3ZBTA 1YMUA 4N0PA 3L04A 3AVYA 1QZZA 1VHQA 4YUAA 2O19A 4U2EA 4ARZB 4CQNA 4KGXA 4EPXA 2W6NA 4F12A 2X0RA 4MEJA 4BJ3A 4XR4A 5JZVA 3I01M 3VOSA 4C4SA 4UOZA 2CMDA 1BWSA 5BT9A 1Z7YA 1KOGA 3C7CB 4OJNA 5DZSA 2GWHA 5G53C 3BZWA 3E3NA 3A04A 4D02A 1NTRA 3MCTA 1E66A 1RBYA 2IUFA 3ABZA 3R7NA 1RXCA 2MSKA 1IEVA 4XCQA 1AKYA 3E9ZA 1C1DA 3LJKA 4V03A 4ZQGA 4Q7EA 3BWCA 1J8DA 2NO0A 3IUBA 2KLHA 3IEKA 3SZ3A 4F4FA 1M0SA 1HYGA 3OJFA 3NP7A 1SU8A 4BCBA 1F6BA 1GPDG 2P6RA 3A6HA 2ERXA 4TTRA 4WFQA 4R51A 5CA0F 2GH1A 3SF8A 1M8JA 3FG9A 1Y1PA 3NOXA 4TSFA 2GXQA 1U2SA 3PVZA 5D51S 1GTSA 5F9FA 1J7KA 3NM4A 5IC4A 1UEJA 4OXXA 4NU6A 4F5DA 2ZEJA 5EWMA 4CL2A 3NASA 2JCSA 4FQ8A