1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords SERINE PROTEASE PB92
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
3ZXXA 2PWBA 4J94A 3F49S 5JXJA 3VYVA 4CFYA 3EDYA 3AFGA 4H6VA 3EE6A 1GA6A 1KDZA 1AH2A 2QTWB 1EGQA 4DWWA 3QFHA 1SUBA 2WUVA 1SN7A 1SIBE 1YU6A 1SUEA 3A3OA 4CFZA 1VSBA 1OYVA 3GCXA 1THMA 1UBNA 5ARDA 5JXGA 2Z2XA 2IY9A 1Q5PA 3AJ9A 3A3PA 3CNQS 3SICE 1LW6E 1SPBS 2G4VA 2Z2ZA 1R0RE 2ZRQA 5B1DA 5I9SA 1BE6A 5AQEA 1SBNE 3DVQX 2GKOA 1SCDA 4OMCA 2WV7A 1AF4A 2ST1A 1SCJA 1P8JA 5FFNA 4B5LA 1Y4DE 1CNMA 3WHIA 5JXIA 3DE0X 5CW1A 1Y1KE 3LPAA 3VTAA 1V6CA 3DE5X 5AVJA 1WMDA 2SICE 1GNVA 5ARBA 1C9MA 1WVMA 2ID8A 3SQOA 2SBTA 1BFUA 1SUPA 3WIUA 1HT3A 5ARCA 4C3VA 3GCWA 3I30X 1ZVJA 2B6NA 1IC6A 3WIVA 3VV3A 3Q40A 2HPZA 3PRKE 1PEKE 1PJ8A 4WOBA 4MZDA 4NE9A 4OMDA 1IAVA 2PWAA 2IXTA 1NDUA 1SCNE 2XRMA 1P7WA 1AU9A 1YJAA 4AKTA 2PRKA 4DJ5X 1ZVKA 3D9QX 1DBIA 3DE1X 1TMGE 1OT5A 1P7VA 3GT3A 1Y34E 3H42B 1SBIA 3PTLA 1GA1A 1SIOA 3DE3X 3VHQA 2WUWE 5AVKA 2W2MA 1KDYA 3TI7A 1WMFA 4GI3A 4NMXB 4LVNA 4M1ZA 3VV2A 4WOCA 2DUJA 4BWGA 1TM4E 2ID4A 1NLUA 3I34X 2TECE 1S2NA 1R64A 3DYBA 1ST2A 1SUAA 4AKSA 3TI9A 3BGOS 1BH6A 1Y3DE 5SICE 2E1PA 4Z2AA 2WWTA 4HVLA 2W2OA 3T41A 4NE7A 1PFGA 1C3LA 3ZXYA 3L1KA 1YJCA 4LVOA 4H6XA 1T1IA 3DE6X 1GA4A 4YN3A 1XF1A 2HD4A 1SUCA 1KE1A 1EA7A 1C9NA 2DQKA 2ZWPA 1R6VA 5FBZA 1GTJ1 1T1EA 4H6WA 1GTG1 1BFKA 1BE8A 2Z58A 1GT91 2Z30A 2Z56A 1CSEE 4C3UA 3LPCA 1MPTA 2SECE 2PKCA 1V5IA 3CO0S 1Y3CE 1AK9A 3DW1X 3Q5GA 1SBCA 1ST3A 4JP8A 1TM1E 1AQNA 3AJ8A 5AMXA 1Y48E 4I0WB 1SCBA 1SBTA 1KE2A 3D43A 4HX2A 1KDVA 2PQ2A 1NDQA 1SCAA 1TM5E 1Y3BE 1Y3FE 3BX1A 4OV6B 3DVSX 3GT4A 4RYDA 3HJRA 2V8BA 2W2QA 3F7MA 1S02A 1WMEA 1OYOA 1MEEA 1Y4AE 3DDZX 4ZOQI 3I2YX 5B1EA 1BJRE 1GNSA 3DVRX 1T1GA 3DE7X 2PYZA 3BPSA 5JMOA 2X8JA 2Z2YA 2W2PA 2SNIE 3DWEX 4DZTA 2XTJA 1TO1E 3DE4X 3F7OA 1SBHA 3WQBA 1S01A 4ZARA 1DUIA 2X8JB 3DW3X 2ZWOA 1A2QA 3I37X 1Y9ZA 1Y33E 2W2NA 1GTL1 4CG0A 3DE2X 1GCIA 1C9JA 1SIUA 1YJBA 1WSDA 1TO2E 4KPGA 2P4EA 1SVNA 5FAXA 3TECE 2DP4E 5JXHA 1SELA 1TM3E 1SUDA 1TM7E 2Z57A 4K8RB 1AVTA 3QTLA 3VSBA 2PMWB 1TK2A 3LXUX 1TECE 1AV7A 3P5BA 3LPDA 1JEAA 5K7SA 4FONA 4KB5A 3A3NA 3UNXA 3OSZA 4KG7A 3QMPA 1SH7A 1PTKA 3EIFA
chains in the Genus database with same CATH superfamily
3NBZC 4J9VA 2GERA 4PPGA 2HOQA 1BKSB 3FWKA 1AIPA 3BH0A 4HUTA 2LVBA 2GAOA 1NRIA 2NAFA 2X3YA 5HOQA 2DECA 2IIBA 3KOXA 3T5PA 1EVLA 2FHPA 3LVQE 2X4GA 3T7DA 3G88A 3TAXA 1C9DB 2UDPA 3AIMA 3D6FA 3S99A 3OETA 4MA0A 1U8XX 4RHEA 3G0DA 1Q83A 3LY9A 2O4UX 5CX1B 5KJEA 2VHZA 1KDZA 1IXRC 2O7SA 5DU2A 2V5UA 1ZZGA 3KSMA 2LCQA 1AM4D 4JLNA 4C6TA 1CVLA 3C3CA 3SZGA 3QIAA 2OV2A 2Y05A 1KK2A 4N0DA 3RSOA 3E53A 2ONCA 1OWMA 4M1SA 4XGQA 5ELMA 2RI1A 1G0OA 3TE6A 4MPRA 3B36A 5CXXA 4B85A 1JR3E 3DEZA 1I2ZA 4GLJA 3T0GA 4EFLA 1AS0A 3IAM1 5A05A 1YU6A 1ZR4A 1NKTA 1WUTA 4LF9B 3ZHUA 3V1KA 4RMGA 2J6CA 5EMLA 3O3OB 1NW7A 3P2MA 4EX7A 5KSWB 3GWZA 1ZNWA 1WZUA 2XNSA 1ZUD1 1LQUA 3P2OA 4W5WA 4ZIRB 4JELA 2WPNA 1UCFA 3DT9A 4NCJA 3RIYA 4HI0E 1NTRA 4DR1B 3LUJA 2HF7A 2BF7A 2DH5A 4JU9A 2F67A 1FX1A 1LW7A 3EG5A 3O38A 4Y2YA 1IN8A 4A26A 5M04A 3HJGA 3K73O 1Z6XA 3KSAC 1SQ0A 1FLAA 4AI6A 3KOMA 3OQJA 2FH5B 2SHKA 3O4RA 3KSBC 4B35A 1ZM4A 4ZGWA 3TQHA 3ZLVA 4X84A 2OQRA 4IXWA 4MS3B 5GOZA 5AK0A 4NL4H 4OMFG 3HGQA 4RSMA 1GDTA 3EIOA 4HEHA 1HPLA 2CJYA 4TQUS 1VP3A 2QX9A 1A5SB 1I3MA 1E1CB 1KY5A 2F00A 1FFDA 2VHVA 2X8LA 4RXTA 1L2TA 2ZYRA 3LE8A 1IY8A 3IVGA 3T0IA 1DCKA 1PFUA 3NGLA 2PQ6A 5HVNA 1R8JA 4YAJA 2XXAB 3IKLA 3ILYA 2JK1A 1QG4A 2ZJBA 3B20A 2PGDA 5L9AA 4C43A 4RCZA 2VTDA 4WNAA 1CZOA 4K6FA 2C3PA 5FFNA 9LDBA 2BIFA 4M0KA 4DDVA 2BF4A 3DE0X 4JS0A 4ZT2A 5JXIA 1Q3TA 3I28A 3PPYA 3ENVA 4AZVA 2ZM6B 8LDHA 1NI4B 1TJ5A 2Q5CA 2WM3A 3NH6A 4RF3A 4QLAA 3VTAA 3BHJA 4GUAA 4RZ2A 1XZLA 1K7SN 3ORRA 1SK8A 2H1RA 2Q1SA 2V9CA 2WAOA 4S2UA 1QZXA 5C5IA 3RRJA 1JIQA 3RSQA 1KDOA 1L1EA 4EJ0A 1EGAA 1YH3A 2IVFA 3R0IA 4B3BA 1BVRA 3IJ5A 1N5OX 3SHVA 5K5EA 3M6IA 3DUFB 1LZLA 1GUAA 1E79A 4YUAA 1NVBA 3IUYA 1BFUA 2OCGA 2RDMA 1U90A 2GAIA 3KX2A 4AY3A 1QHIA 2CUTA 1HQKA 3M82A 3A2MA 4JBYA 1MXFA 4RELA 3D2BA 3UJBA 2QD1A 4RXMA 4RFLA 3MT0A 1OHHD 4HPWA 3HVKA 2C57A 4O29A 1R5OA 1RHUA 4DIDA 2XGJA 3OJLA 1RYFA 3FLBA 4ZKDA 4CETA 4U2KA 2OFWA 2RHBA 3HL4A 4KUGA 3MGKA 2Y1DA 2OBYA 1OV6A 2AE2A 3PI6A 4P3PA 3DQPA 4I8XA 1EUDB 3SLKA 4UUQA 4AMVA 1GQRA 5AIAA 3LNCA 5E4YA 2I7XA 3UG6A 4IHJF 1G19A 3EEYA 1Q0PA 1JQKA 2WLSA 2C1ZA 4FDVA 4FYMA 4M0LA 4YYEA 2EJWA 4Q7QA 3IMKA 1KWGA 1R1DA 1YFJA 4LDRA 4IS2A 3U5ZB 2CJPA 2PCLA 3ODGA 2EFGA 2FN8A 4RTLA 2CJXA 4KE6A 3TRHA 3RAJA 3L0DA 2EZ8A 4LZPA 3H5VA 2AN5A 4R2XA 1L3CA 3QFRA 4A4DA 3C24A 1TU4A 3I23A 3QJYA 4QKQA 2WIKA 3BJIC 2NQ2C 2NZVG 4GZ6A 1ML4A 1T9AA 1E99A 1K4KA 4IDOA 1YSCA 2OTCA 2P9FA 4I99A 1XK7A 1YK1A 4BMVA 4CQMA 1NBOA 1C4OA 3VYTB 4X92A 2O4CA 3BJZA 1GZ4A 2B69A 4ETWA 1FDUA 1GPAA 4E30A 5BWLA 2X22A 4CLDA 4Y6OA 2FPIA 1TMGE 1WNTA 2VYNA 3CJRA 3GNLA 3ILSA 3QA3E 4ZVPA 1OIXA 3QWFA 4A0QA 1IEQA 3FPBA 5I9TA 3SSNA 4HWRA 4CKCA 4R1UA 3PCRB 1JEJA 2GKSA 2AR7A 1KJNA 1VG1A 1F6WA 3LXRA 3A36A 3A3YA 1PWYE 4HNTA 1QU3A 1EVYA 2JGMA 1W4CA 2ZYTX 3OD5A 5DWDA 3WWCA 3CINA 2IQIA 3ST7A 3FMFA 4M83A 2NZJA 2NUTA 1E5QA 2XZDA 4QEZA 4FMBB 4XPZA 1Y82A 4JX9A 2DFDA 1DO8A 1M1XB 2ORVA 3DV0B 4M3NA 3ZZNA 4INOA 4RJTA 1KHHA 3RVNA 1VSTA 2LRHA 2QKYA 4DV0B 4EF6A 1Y6GA 4G26A 1CEXA 4ALJA 3RS7A 4B75A 4EJSC 1MVOA 3BL6A 5K0EA 2BMDA 5ES4B 1HNXB 1SKQA 4HXGA 4CF3A 4GI3A 3DDSA 3OC6A 1CC1S 2JIQA 3ENWA 4YXWD 4ZTUB 3NM4A 3U09A 1L1QA 3KDPA 2Q6TA 1E4EB 3RCBA 5I45A 2XNDD 3KVYA 1B6TA 1IY2A 1P2GA 4J1NA 4WE3A 4EB8A 1JKXA 1JHAA 4YPVA 5JCOC 3EPHA 4MVJP 2B99A 2CD9A 3KKKA 2G9NA 3RJMA 5IHPA 1H0RA 1UODA 1E7RA 4WCDA 5DHFA 4G0PA 3BWBA 1FFYA 5LA6B 1EBUA 1GZDA 2DWPA 4LOAA 1OIWA 3BA6A 4YT2A 1NAHA 4BMXA 2YXLA 4ZVSA 4PRKA 2VTBA 3T4XA 5E4JA 4DMKA 2Z8ZA 5KVAA 1UM9B 4P7GA 3L7BA 3MAAC 4D92A 4CIYA 2P4UA 3LZDA 4ZAXA 2ADMA 4C4OA 3NFYA 2DG2A 4FMCB 4FZ5A 1ID8A 4P7KA 1WMSA 4NZPA 1RKXA 3BB1A 5FWXA 4DOMA 1WXWA 3O3NB 4QDUA 1U0TA 1Y3DE 3ETHA 2Q2WA 4RS3A 1RD4A 3NHBA 2R44A 2BGNA 5GV7A 4H7PA 2J0UB 2DRIA 1UKBA 1SC9A 3CEPB 3GH1A 2VQ3A 2A7XA 4JGGA 1ZUIA 3REFA 4DM3A 3VU9B 2LXNA 1HEYA 3A31A 4OQYA 1ZIDA 1EFCA 3IO5A 2C42A 4JHXA 3SE0A 4FFRA 2YY5A 4O2AA 1D1PA 2FUG1 5AUQA 3UW3A 2V1XA 2I3DA 1G55A 2DBYA 2NXNA 4GSYA 5IZCA 1Z7GA 1T1IA 3VPFA 5CEFA 5ER9A 5IH7A 3WDLA 1P80A 2O06A 2DH6A 4RD3A 4YROA 5FUMA 3FZEA 4WLEA 1NQVA 4ZV4A 1D03A 3R9KA 1QF7A 5KTKA 1EGMB 1SUCA 1ZSVA 2O57A 2YZKA 3C5WP 2C9MA 1BC5A 2WWWA 3B3AA 4TV9F 2BTQA 4PLYA 3R6LA 1T8RA 3ETGA 2J5BA 4IUCS 4W8GA 3PGMA 2Q4DA 2PYDA 1OROA 4FGWA 4QXMA 2OORC 4UBNA 2YXNA 4TQGA 4MQFB 3U3OA 3VR2D 2JAUA 3CEMA 1U0RA 3NGMA 1W8IA 4GG1A 2P6OA 2GF9A 4FBLA 3ZHOA 1CZLA 2ECKA 3H6HA 3D3EA 4FYYA 3Q1LA 3RVOA 3PXEA 4B48A 4TMWA 4HDQB 3HYNA 2F3UA 1HMPA 1Y80A 4MI9A 1ZOPA 1WQ3A 2BY4A 5A04A 5HF8A 5AK6A 4JOBA 3KD2A 4D46A 4DCVA 4ZGGA 3HBFA 4W1RA 1GT91 4OATA 1XTQA 2ZJ8A 3QLEA 4B34A 4WX2B 2QU8A 3FNHA 1K6MA 2R4TA 2WKSA 3TLYA 4C3ZA 4TM7A 5BYKA 2RC5A 3USCS 1HNZB 1QDEA 1B41A 1TYEB 3IOYA 3O4FA 1DJQA 4D4HA 1M54A 1IN1A 1XXHE 4KFTA 1I4OA 4GI1A 4BZXA 3FG9A 1IEWA 4TSFA 4XVRA 3SBOA 1HDRA 2HSEA 3V6LA 3CO0S 2ZUUA 4IOKA 1GPMA 1QLWA 2HM7A 4JL5A 3EBPA 1YR6A 4Q7KA 4E5SA 1BW9B 2RB4A 3QELB 5I5GA 3MRSA 4PNHA 5AIBA 3O8CA 4PZ9A 2JG3A 3HLKA 2OZKA 3W2IA 1KR2A 1VDZA 2CZGA 5C0OE 4OGGA 4PSUA 2XGSA 4M9RA 3S55A 3W2EA 4GHWA 1BHO1 1GPDG 1Q7EA 2PRIA 3F8SA 2HGZA 5JQGF 5IM4F 5C1DA 2P0AA 3C4QA 3TIVA 2JFHA 4CRWB 3VPSA 1GY8A 2EV9A 2CGEA 2CLOB 4IV5A 3X2FA 1T2EA 1ZC3A 3GEPA 3OQBA 4JEIA 5JNVA 5HG0A 2FEMA 2F7SA 1UWKA 2FFAA 3M34A 2A0UA 3Q7RA 1V7PC 1E6EA 1XROA 2D0PB 1EPUA 4TTTS 1DARA 4HX9A 2OPHA 4C7OB 1KYWA 2AG5A 2HQRA 4B87A 5KNBA 1H2RS 1FVFA 1NW5A 4AG5A 1WW8A 4X7PA 2FQYA 1TM5E 1Y7HA 1U2GC 3OPNA 4PF1A 1ZNXA 4ZRMA 3PDHA 4RETA 4DSTA 1T15A 3ZOKA 3BXGA 1XC7A 3CZAA 1MC4A 2HUPA 2YWBA 1X1QA 4JLWA 3OJOA 1NMYA 2WD9A 2OP1A 4MV0A 3RQSA 3TS1A 4A6DA 4OV6B 4MWEA 4WLVA 4X6LA 4YT8A 5IYZB 4HWKA 5M7EA 2P2DA 3GPCA 1L4UA 4H2DA 4KQKA 3NEJA 4GIBA 3TXXA 3VISA 1B2LA 1T1SA 4GR5A 2OAQ1 4OX9B 1OYYA 1SB8A 1XCGB 2D3WA 2RHDA 2W2QA 4IWXA 1PVOA 4BXOA 3N5KA 2YZNA 1G42A 3LK7A 3UM9A 3TAHA 4ZJPA 2FPLA 1NU8A 3T4PA 2QP9X 2M6SA 4ZOQI 3L8MA 3PNQA 3WSWA 5IJZA 1XD2A 4X00A 1FYFA 1XNGA 2HNKA 3PR3A 2PNJA 2ZUFA 3RT9A 2AW3A 4RENA 3CG4A 3CEAA 5C5DA 4HH1A 2ZJFA 4Q48A 2B78A 2JEYA 5JMOA 3FZNA 1RRGA 4MAAA 2ZSFA 2RHMA 4QQRA 4DL9A 2MYTA 5ICSA 5IFKA 5LQJA 3K5PA 3VR3A 5SZHB 4IUBS 4Y1GA 1UBEA 4A8JC 3AKZA 1BQ3A 3GJ3A 4RKFA 1QP4A 2JIZA 2CXNA 5DX1A 5EIEA 2XF8A 3CZCA 2A8YA 3KB2A 3LC7O 3U62A 4ARZB 1E9VA 1O94D 3SZLA 5K0JA 2XUAA 4P2BA 3FI9A 4YIKA 1CW2B 1V3TA 4CKBB 1HMYA 4HRVA 4BCDA 3M9WA 2VZLA 3CLUD 4R1MA 4R2LA 4YI3A 5F77A 4OLBA 5EE9A 2G1JA 3D8TA 3DPSA 1NUPA 2OGSA 4B83A 5KWSA 2AG8A 2CLMB 2HMWA 3BULA 1T2NA 1DC7A 1Z7BA 4OJKA 5ALHA 1G8MA 1BA2A 1BMDA 2Z04A 4QREA 4X61A 5D84A 3QQ5A 4EHBA 5JFGA 2PUBA 4LY9A 5JWRA 2HZ7A 4F0JA 3I6IA 1J0EA 4ZI7A 1AXGA 3KQLA 3WGYA 2CB9A 4B3HA 3DZIA 4LFCB 3RBZA 5K0TA 1ONPA 1NXQA 1PE0A 2NO4A 3DAFA 2O0MA 4ZQBA 4ZP1A 3UWDA 5TJ9A 3S27A 1CY1A 1HKHA 2O5VA 1L5YA 1K5PA 4NOJA 5E2AA 3UWKA 1BWQA 2E49A 3CRW1 3OQPA 3QPWA 3ZH9B 1SZCA 3GRFA 4BWVA 3EX7C 1F20A 1XBTA 2AFIB 3A3KA 4TTVA 5CAEB 3S2UA 1QRTA 5EZSA 1XAIA 3AM5A 2WC1A 2WPDD 4GUDA 2QQEA 1W36C 5PNTA 4NCBA 2I3BA 4D8WA 3UJ8A 4BVLA 5LMUB 2OZLB 1AURA 3RBXA 5T6BA 3NJ8A 1KYIA 2QWXA 2QVLA 3TQQA 4AECA 3DA8A 5J2UB 4DZRA 1QGOA 1BO6A 1WTAA 2OK8A 3LPMA 4DA0A 4ZI3A 1G3UA 4INJA 2BRUC 3L3BA 4WOPA 3U31A 3MHTA 5TPWB 1KPGA 2QDKA 3GDGA 4NICA 4QQFA 3QG5A 1IHDA 5K3FB 3UB2A 3LUFA 4XRRA 1QKJA 3LG2A 4N7BA 3ZY4A 3K9HA 1RCUA 1IPHA 4IIFA 2PLWA 4PFQA 4N82A 3JTMA 2IYSA 1P74A 1Y4SA 2H48A 4FK8A 3CUWA 4Q4AA 5H3CA 3FHJA 1GGEA 1LJLA 1QIJA 1UBJS 4OYRA 4LHEA 1UK8A 2NWQA 3KELA 2XD4A 3EWAA 1IBKB 2C61A 3RKUA 4BZZA 2BE7A 1W85B 4H0CA 2BFFB 4WESA 5DV9A 3N1UA 3IDFA 4L75A 2XMRA 5EWJB 2QX4A 1N92A 3OSZA 2L69A 5EHXA 4OFBA 3RTBA 1SH7A 3X2SA 1K89A 3OFSA 3X43A 3MMPA 4OGKA 2HU5A 1MCZA 2QM3A 3DZHA 3EIFA 3H8SA 3JZFA 3SYKA 3DZDA 4O2BF 4TV8B 3TKYA 1JFFB 3BQ9A 4UAUA 4FI3C 3L2OB 4MNTA 3FXAA 3KTDA 2O6LA 1JU9A 1R12A 3FZGA 1QZ3A 4CKYA 4DKJA 4QYIB 2K7FA 1RCFA 1ZJYA 3L7YA 4JY7A 1Q1BA 3TMYA 4OREX 1YS7A 1EHCA 5HGJA 3U4QA 4ZTBA 4DB2A 2OK7A 4WK6A 5FBKA 4D9IA 3HCNA 4KQGA 3D7NA 4G6ZA 2IXGA 1WCWA 5J40A 2M9MA 3GPIA 1J07A 2HA0A 4ZDKA 3HO1A 5JRZA 1TQ2A 2F4NA 3ZY6A 2RGYA 4DLUA 1G5RA 3PXAA 2OUIA 1D1SA 5EPEA 2R65A 2WG1A 2V7EA 3T95A 3ZS8A 3VZBA 4BFYA 4BOYA 4HSEA 4WACA 3AR8A 3LDAA 1SHZA 3L7DA 3A10A 1MX1A 1V16B 5G0VA 5AW7A 2QRZA 5C53B 1F7UA 3DUWA 4P7JA 5BW8A 2O0HA 4YR7A 4ZAYA 3MT9A 1RYZA 3R09A 4QVIA 4Y2TA 2GPBA 1TLTA 1ULHA 4MR7A 5A6VA 4NMMA 1UIRA 4RFVA 3G0BA 4WWHA 1T8SA 3IT2A 2HR1A 5B55A 4B6SA 1F8UA 1Q7CA 3U6BA 3II6X 4G24A 5FRDA 3MNFA 3Q7EA 2N1BA 5JPIA 3QPDA 4Q15A 1NVFA 2AF4C 1QR2A 2WAMA 4BO6A 5IVKA 3GLGE 2CLHB 2I3ZA 1OB5A 1DQPA 2PT7A 4EY6A 4P54A 1KZ6A 3B9QA 3IESA 3EEFA 3LDGA 1WP4A 3MERA 1RZRD 1TTPB 1KRXA 4HQFA 5DX0A 2WM8A 5AO9A 2AQIA 2GBLC 4CV3A 4XQGA 1Q5PA 2O20A 4DVJA 4E5KA 5I01A 1AQ6A 5D5HA 3C15C 3TUIC 3EEOA 3IVAA 4FYHA 4L7QA 3I83A 4PS1A 4RBNA 1NJ2A 2BJHA 3AFOA 3P0IA 3WADA 4BLWA 1W19A 3VOBA 1UR5A 3TQOA 2CZCA 1Z2PX 2W6JD 3A1WA 3CZMA 4KDCA 3W8DA 2K7ZA 1QK5A 3BTOA 1UFOA 1J8VA 1K27A 2GBFA 4HYYA 4DWOA 4EA6A 4U3JA 1EG2A 4OMCA 2N42A 5IEBA 3RTGA 4CR8A 1A8HA 4ZOLA 5H5JA 5K0BA 3GRPA 2GWRA 1C1XB 2H54A 3FHLA 2YICA 3HPRA 4DYDA 5I51A 2IGTA 4L28A 4UQLA 4O4HF 1CHDA 1CY7A 2NYVA 1WF6A 2O3JA 3F6SA 5L3VA 2O8BB 5JOQA 2QUAA 4PSKA 4JT9A 1JLLA 1E4VA 2HRCA 3OPVA 1BYIA 4QATA 5AP9A 2PFGA 5HYVA 1M5TA 3PDIB 1VJ5A 3AFIA 4HFRA 5EMKA 3ZIAD 1L9XA 4AT1A 1PFVA 4AG3A 1Q2XA 4HLQB 2COUA 2X0IA 2YHIB 4PC1A 1GR1A 2V03A 4FR2A 4G07A 4Q1EA 5AVWA 3OPYB 1R50A 3TZCA 3DQZA 3F5QA 1VI2A 1U7DA 4EGCB 3JWJA 3G9QA 3GGOA 2DBZA 3GYBA 3O0TA 4L3OA 4M1EA 3TXAA 2BGGA 1JI0A 3AHGA 4DGSA 2XZOA 2G82A 2NP6A 1E5LA 1P6XA 3D8BA 3DAOA 5HR5A 2ID8A 1SKAA 4IGAA 1O94C 2GJ9A 4U2EA 1Q6ZA 2DY1A 2EW2A 4ER7A 3FYUC 3DZGA 2IXEA 3UJ7A 3WYGA 1C8KA 1N0VC 1K5DA 2AWNA 4HWSA 5A9RA 1KC1A 1ZEJA 2XCQA 3CLUC 3GCWA 3QU4A 1EFHA 5KCMA 1ORRA 2RE8A 2O59A 2I80A 1UEJA 3HUTA 4PXAA 2Z43A 1M7GA 1QV6A 3RROA 1MD9A 3OJXA 5TGZA 4E2FA 1T2DA 1FMTA 3OO0A 3AFHA 5J2TB 4YRAA 1Z63A 2PM8A 4F4FA 2VDWB 2PUJA 3EZXA 3RVQA 1Z75A 2BC9A 3H1GA 3QYJA 4HDCA 3SEZA 2AFRA 2HSJA 2IKQA 3PK0A 3PRKE 1XUOA 2AZTA 2OC4A 3AEKA 4G1VA 3ZQUA 4N03A 1HOXA 2QMEA 4M88A 2EDCA 2GWHA 2ZUTA 2WAYA 2QZZA 4YRZA 3L6EA 5ITWA 4W5RA 3KSRA 4X63A 3WZ2A 4J7CA 2FR0A 2C7GA 2XJ9A 3H05A 5BV8A 1XTJA 2GVNA 3VJLA 1T9GS 3AVXA 2GDJA 4MVJM 4EHDA 1E20A 2G6TA 4EL5A 2V3VA 4LY3A 1LV7A 2PRYA 2ZSIA 4ITVA 5AICA 4DDKA 5SYMA 3BXFA 5HKKD 3P9ZA 4IRUB 1TYBE 3STWA 3WMXA 4DNPA 3RYIB 4BKUA 2PSFA 3BRCA 4FE4A 3FGPA 3FDJA 2XQGA 2R751 3L7NA 3DNFA 2CFSA 2BFWA 1MF7A 5DHTA 2HA3A 4MA5A 5C1IA 3R0QA 1E3WB 3UUFA 1CUXA 4KQ1A 5CDTA 1Y6JA 3H11B 5B4VA 3U9TA 2Z3VA 1G5PA 1P7VA 3Q9UA 3NW9A 3UEOA 1KSFX 1RJ9B 3GLHE 4NZZA 1WSBA 3AXSA 2MINB 2YCBA 1Y9JA 2GCOA 1T6YA 3MUOA 3OHSX 1YAHA 3ESQA 4TLEA 5DGCA 5E6UB 5FWDA 3CM0A 3ETDA 5BNIA 4RDHA 4H77A 1QXSA 4ZT6A 4MQUA 4QWWA 2FGKA 1LEHA 1TW2A 1J90A 1GL6A 4MUHA 3CUSA 3D4NA 3HKEB 4F3RA 3CO5A 2Q5EA 4C14A 3BGWA 3H5RA 2E5WA 2WBLC 2DTEA 2Q41A 2RK4A 5JPCA 3TJRA 4BY9E 2XDAA 1QDLB 3JQCA 4HEA6 4QTUB 2QR5A 3NH9A 1G291 3MSXA 4BJHB 2XUJA 4HB4A 2WRZA 2FEAA 4H08A 1PWXA 4DBLE 3EGOA 4DPMA 5LJLA 4MHTA 1MO6A 3JW8A 4EA9A 4MUEA 1WKBA 4ND8B 2ID4A 2ZCUA 1M8FA 3EAGA 2JLSA 5T3YA 5CA0F 3QVOA 2HEIA 2N9UA 3AHIA 4QFCA 1YRWA 4DEYA 5CFLA 4M0DA 1R64A 4IIGA 5CTAA 1JYSA 4QODA 1J0BA 5ALZA 3A4LA 4HXFB 2JZNA 4J07A 2R96A 3B1FA 3ROEA 1CG6A 1QRSA 3K09C 2P7IA 1F2UB 4HGPA 5L3RA 1BDJA 2BM9A 4AKSA 1HR0B 4HDSB 3DDHA 4FWTA 4F06A 1SR8A 4YRPA 3IJPA 5TY0A 2Q3CA 5D87A 3KL4A 1BH6A 1PEAA 4FR5A 4MW6A 1CQZA 1HQDA 1UMBB 3RS0A 2Q6KA 4FHDA 4EKYA 3HYSA 3VKGA 3P2IA 4EELA 1QHHB 2IYTA 3E9NA 3G8DA 4FDMA 3WGLA 4K0KB 1DV2A 1CE8A 1THZA 3IP8A 3OZXA 3KJXA 2AUTA 1QIHA 2MSNA 1F0YA 2QN9A 2P8JA 1E1KA 3K9NA 2QRPA 1BU5A 4DIUA 3A11A 2YV1A 2HJHA 4UHDA 3ITDA 1BA3A 1YJCA 4WLFA 3EHDA 4KQIA 5BT9A 5A4KA 3UMCA 5CDFE 1D5WA 3NWOA 3VOAA 4BEWA 3DZ8A 3DVAB 3L41A 1G3QA 1KEPA 1CIPA 1R6BX 2H0QA 2ACVA 2PUTA 3DMNA 2VKTA 2BSAA 3NKFA 1M1YA 4ZO4A 3TB4A 4E1AA 2BD0A 1TJYA 2E7ZA 4NY1A 1OA0A 2UUBB 1W87A 5GGXA 5JI3E 2JH3A 1P9NA 1TCAA 2FEWB 4OM7A 2FSIA 2PGOA 4DNOA 3FLEA 5CVTA 1YOBA 4NYJR 4BO3A 1QQTA 5EWLB 3QKUA 2VJPA 3X1ZA 1CP2A 4FHGA 1J39A 4KQ2A 5FBZA 1Z8FA 3H04A 2GESA 1FTYA 3C5CA 3ROTA 2O8FA 3DTTA 4K6MA 1EWTA 4MVJE 4PC6A 4E21A 2NPIA 4OU5A 3C43A 3CZRA 3DHVA 3LAWA 2JGIA 3QXSA 3PWKA 3MCZA 4EQ6B 3BE6A 1DGQA 2FEPA 1BFKA 4H3VA 1L5NA 3LKVA 4LGVA 1WS6A 1WZEA 2DWUA 2YVKA 3L7CA 3PQ3A 2Q3BA 2XD9A 3NTUA 4J0FA 4ETNA 4K8OA 2ZKIA 2Z30A 2J3MA 4MGZR 7ABPA 5JISA 1I7QB 3ZD6A 3IHWA 2J7PA 4XFKA 2YJ5A 4EG3A 3JVDA 4HOYA 3WMGA 1DFHA 4M55A 1XKLA 4OXRA 4MHOA 4K9NA 1YI1A 4PWYA 3CR8A 3GG2A 4E6PA 2RHCA 1P1JA 2NZXA 2QTHA 3WWDA 2JKVA 3SHTA 2AOUA 2GOYA 2I91A 1E1QD 4JT4A 1S3SA 1X1DA 3DONA 1DQYA 5B7PA 3I04A 1GG8A 1G6KA 5F5NA 3TYXA 3L4JA 2AN3A 3G9TA 1T6NA 2OXIA 4RCYA 3V4LA 2PKYX 3QOWA 2VPYA 1D2CA 1UF9A 2BM8A 5IDWA 2PUAA 3ENQA 4EEXA 4J8PA 3F1LA 5HDBB 3RU3A 1FXUA 2YV5A 3ZDEA 5HIMA 2Z9CA 4WXEA 3LLMA 1H2HA 3FMGA 3N76A 5FLKA 5H7XA 3AZOA 3I42A 3KBOA 3AVQA 3F6RA 1PJBA 2IQ5A 1J42A 3CJTA 4CCSA 5L95A 1R0CA 4U2FA 1XI2A 2HMSA 1LK7A 2YIDA 3IAM6 1TM1E 5G3YA 4EUKA 3B7PA 3FJ1A 4WA7A 1O6CA 5SY9A 5COAA 4Q4JA 2F48A 2VR1A 4WZAE 4UPVA 3AUXA 1Y48E 4W7IA 5JMPA 2AYYA 1U1IA 3T1HB 3RF7A 4OLAA 4QQ8A 1VPTA 3ZU5A 4XDHA 3RFXA 1N1DA 1Q0QA 4WZ6A 3OM1A 4BLUA 2AYZA 5F9HA 4PIMA 3SEQA 3ZKAA 3PR1A 2J0QA 3GA7A 4IMRA 1XB2A 4TZKA 2OWDA 1W75A 5T8KA 3V4VB 2NMVA 2VDLB 5LXTB 4E5DA 2D2FA 1ZU5A 3F4KA 3WTCA 2H5LA 5KINB 1SK9A 5ABPA 5BQ3A 5ALRA 1HDZA 5E9JA 1UBRS 1HKUA 1MC1A 1BWPA 1FFBA 2JVKA 3DMYA 3KWFA 4N6NA 3VFDA 1Z62A 2PGJA 4NZMA 5GY7A 2OD7A 2EWVA 5KI6A 3DAYA 3M6UA 4HCJA 3FN4A 1NW6A 1PGPA 5FA8A 4ESEA 1ZZEA 2NO0A 3CUYA 1XVAA 3FDFA 2IU6A 4R2JA 4KMMA 1IOVA 2OHFA 1P4GA 4YJHB 2AOTA 2HO4A 3KSZO 2D0OB 2HLDD 2JL1A 1RAAA 3HJHA 1Z4KA 2GAFA 4YYZA 1PJSA 1R0YA 2I8AA 1HFKA 3JATA 2VZEA 2OHHA 4IDPA 1HY3A 2CF5A 4DABA 5J58A 3OU6A 4KE7A 3UV7A 4DDTA 4X8MA 3HCEA 1TF7A 2QN8A 2WSSD 3PIDA 4C4ZA 2P9BA 2YNMD 1VSVA 5FR1A 2CK3D 1F48A 2O2SA 1NA5A 2QF7A 4FUQA 3VO9A 4BBZA 2O2HA 5HQ3B 1YTUA 2AX4A 3V48A 3BTVA 4S35A 5AJUA 1E69A 1YVUA 3IAXA 1ID1A 3UA4A 4G81A 3ZEIA 4MV9A 2PKWA 3HJCA 3ICWA 4UOQA 4NAUA 8ABPA 3FA2A 1DKUA 2ZR0A 3N75A 2W9XA 3WMRA 4IIJF 1XVIA 1L5QA 4YJ3A 4MX8A 3OKAA 5EHZA 1N6KA 3ZCSA 3N6RA 2REQA 3KYBA 1PDOA 1QVVA 4OQNA 4RLSA 4TWJA 2PKQP 5TARA 5K3OA 5LKRA 2HB6A 4BCBA 3R5SA 1F2TA 3R5KA 4HAOA 2UXBB 3BGVA 5FPTA 2GZRA 4LC0A 1SUWA 3S28A 2PH5A 3GA0A 2D5BA 1VMAA 4XPIA 3SJAA 2A9JA 4NABA 3MK31 4FIZA 5ITSA 1X7XB 2EKBA 3C6YA 1RQGA 3OQIB 4TS4A 1G6Q1 1RXUA 4PLFA 4V0RA 3I62A 1XDWA 3H86A 3MCWA 4LXHA 4UNPA 4IVPA 1OXSC 3A4NA 5M2QA 4AO7A 3ZWBA 3PPXA 4PPQA 3A9SA 2OCIA 1R8YA 2BR3A 2FPGA 3AHDA 4CTKA 3FPKA 4JJZA 2FRDC 3NUGA 2W5UA 4FZRA 1GGJA 5AM4A 4RPJA 5KIAA 1IB6A 2QUIA 2X9NA 1TO2E 2Y0EA 1D2HA 1U5CA 1X92A 4FFWA 3E9EA 5JEEA 3HNPA 3P4UA 3GD7A 6YASA 1JJAA 4C2UA 5EMNA 1OTYA 1VE5A 4DBZA 2NT4A 4ZCIA 3VXKA 4BB0A 1OPRA 4IY1A 4LYEA 5DLDA 3HU2A 2ENWA 3GEEA 1TM3E 2WA1A 3LYAA 4RGYA 5IJWA 1BU8A 2VNHA 5E1OA 1DC5A 1USWA 2Z57A 4K8RB 4X0EA 1GAXA 2AG1A 3UT5B 5REQB 3QTLA 2ZBDA 3A9TA 2RGNA 1KVUA 4M1OA 1TK2A 4URHA 3QLTA 1A8PA 2WAAA 4DXDA 4PLPA 4CM8A 2C4KA 3NYRA 1SC1A 4CT0A 2C4NA 4AKHA 3FKSD 1PD1A 3KKQA 4R51A 3H9BA 4FSHA 4H1VA 3BRWA 3OIDA 4M0CA 3NCHA 2HPVA 5IF3A 2VWHA 1ZM3A 3KJFA 2ZIEA 1H2WA 2ADOA 4IEIA 4PAGA 4R9NA 4QECA 4YMWA 3TL2A 3IFSA 3QYAA 2MOKA 4KG7A 4JENA 4PY2A 1XEWY 3IERA 2XUIA 4NFSA 1BCRA 1L3IA 1OXVA 3QNWA 2VTVA 3D2LA 4Q9LA 2V7PA 4XX0B 3I52A 1R8QA 4EITA 1A1SA 2D4AA 4ZCQA 3CNBA 3LOUA 4GC5A 2UZ0A 4IM7A 4R2HA 2I2XB 2G6BA 4GMKA 3TD6A 3QX7A 3IEVA 3K4PA 1ISGA 2QLLA 3I09A 4N18A 1UDBA 1JHRA 2ZXEA 3ROZA 2OV3A 3SR0A 3E7WA 4PYNA 1U28C 3AP1A 2G70A 3IBSA 4IOLA 3HJFA 4BCCA 1T10A 5AVYA 4NBVA 2WHQA 3BGSA 1Q0SA 4HAXA 4K6KA 4UEJA 3B1XA 3UUEA 1NNSA 3ONVA 4MWSA 2Q8NA 4IYRA 2CL7X 3CEJA 1V5FA 2BFEB 2BE9A 2F90A 1ZD8A 2FNAA 5BWBA 1IJKA 2LTAA 4WW0A 2MMGA 3NRBA 3PLNA 2N0SA 4BJ6A 2QG6A 4PAMA 3MLAA 1GT6A 3FWZA 2YXDA 4LF6B 2JH8A 2P79A 4Y6PA 4GOXA 4CEIB 4F96A 1CYEA 4POOA 5G3ZA 3HEAA 3AL3A 3LECA 3TL6A 4CM9D 4DR6B 4KR7A 3FKJA 3WK4A 1C3JA 1JEYA 3K1YA 2E4UA 4EW6A 4YPOA 4DEXA 1Z22A 1KMCA 1IAQA 2FSPA 3PFGA 4NJMB 5J5VA 1MEJA 1PL6A 5DLPA 4U0JA 1NIJA 2EDAA 1ODTC 3F6PA 5K8CA 2Z8YA 1LGYA 5BSKA 1P0MA 3ZNOA 3PNOA 5L7YA 3RVRA 3ADPA 2ODEA 4GXQA 5C34B 2QTRA 1I36A 3CUEF 1AN9A 1AKTA 1G1MA 3I05A 5J2UF 2QB5A 3OCWA 3JARA 3REOA 3GRKA 1TGVA 1IBLB 2P5UA 2PZLA 2FUG6 1N7IA 3MWDA 3SYMA 3UK1A 5K0NA 1GPYA 3B53X 1KP2A 4BMPB 1XN1A 4NEGA 3Q2OA 2VT2A 4UJ5A 4Q0MA 4TL8A 4M46A 2Y76A 2Q3FA 2HPAA 2YHUA 1FXWF 3A9RA 3WBKA 2QQFA 2J5RA 4ZEVA 1QYWA 4EEZA 5BPHA 5ALPA 2IJGX 1XEFA 3P52A 4ER6A 3HWX1 5ERGB 3TLGB 3N87A 1CZKA 2QZ9A 3QWIA 2VP9A 4UKDA 2R6JA 4OHZA 5E7QA 2AUNA 4L0DA 2WJ6A 3ONFA 4LFAB 1JU3A 2WNSA 5D7BA 4CUZA 2GJKA 5C5EA 3B3JA 3DBRA 3N74A 2DBRA 2QX7A 3NIWA 4BAUA 1LC3A 3UOWA 1SBYA 1NP6A 2WIAA 1PBNA 1XLTC 3AF4A 2IYUA 2O1WA 1GSHA 4WH0A 1RPAA 1U3UA 4I1IA 3RH0A 1JFLA 2GPJA 5LBUA 2WI8A 5DCWA 1NQWA 3OLWA 1T6ZA 2VJNA 4LDJA 3KV1A 2YXBA 3THWA 3BOSA 2HJ9A 3OTGA 1RYHA 1WVMA 1U65A 1ESDA 1Z7WA 2I1QA 3CF6R 4D7AA 1I7SB 1SXHA 1YQQA 2R6AA 5KWVA 3EISA 1YHYA 2NADA 4UTXA 4X6XA 5EMJA 3EEIA 3TBHA 5BP7A 2AJTA 3URMA 2XPCA 2VYVD 2KI5A 4XSHA 4P4UA 5ARCA 2JBWA 3HKCB 1I0IA 4QRDA 2IUUA 5B3KA 4FFNA 3I30X 4Q9HA 3EA0A 3NEYA 5KNCA 3CVXA 1U98A 2AZXA 4R7TA 3MINB 2ZYVX 3IBGA 2Y2UA 4JZYA 1DFIA 1M1NA 4CMJA 2PK3A 4MYDA 1FP4A 2XH8A 3A1CA 3L07A 3ZGNA 3T3OA 3UMYA 3KETA 3AK4A 4XYLA 1DTWB 3Q12A 2H9YA 1OWLA 2QV7A 3KG2A 3HBLA 1U7HA 4J4TA 3ISJA 4MPTA 3GP5A 2PZJA 2R6FA 3K0CC 2C5LA 2XIJA 1MR3F 2HLNA 1HTTA 2DUNA 4B80A 1YA6A 2GXAA 3JWIA 1ZJ4A 3RC2A 1XEXB 3L8CA 1LC0A 2VP0A 2PLFA 4W1QA 4W7SA 5AYVA 4HZGA 1I7NA 1W5AA 1TAGA 3Q2IA 4ZV9A 3P20A 3ZI7A 2G5TA 2D6FA 2D54A 1EFKA 5FOXA 4DQUA 2XKBA 5H4GA 2ZRIA 4XM0A 1QE0A 1TEHA 1WSWA 2K2WA 1QAMA 2BI8A 5LB4A 3K05A 3D0KA 3DM9B 3QVXA 5B3JA 4RTKA 3D9QX 3RTEA 3RHZA 1J99A 1M7BA 2Y67A 4IOJA 4G63A 4LYFA 2CHFA 5G0WA 4H7HA 4G2TA 1QO0D 3EZNA 3X1JA 1FVOA 3PGXA 4G67A 5ALMA 1MB9A 1FLNA 1OLOA 2NM0A 4OBBA 3FPFA 1IE3A 4AJ2A 1AT1A 5F76A 4BMZA 1XWIA 1Y34E 2FYTA 1OU4A 2FWPA 4I14A 1T0JB 1RM0A 4QG3A 3ORQA 1D2EA 3BH6A 1KO7A 1ECGA 4M38A 3HSSA 2FPRA 1SU8A 2J09A 3ZG6A 4US2R 4NOMA 3OU7A 3GJYA 3L0ZA 2W70A 5DF1A 5C52B 4QDKA 5LP6B 4B7XA 4HVTA 4V0ME 3TW8B 4BPBA 2PMFA 4A1FA 1B3BA 1L5MA 3QMVA 4RL6A 3RC1A 3ZCQA 2I4RA 5M34A 4EH1A 4JIMA 4FGLA 3ELYA 3N53A 2L0XA 5CHYA 4NMXB 4I8DA 4LVNA 1GILA 3LK6A 3M4YA 1KMNA 1N3BA 1NFFA 1UBHS 1QGED 5K3AA 5P21A 1Z06A 2VAMA 4K87A 1D7OA 4S1OA 1FRQA 2RJOA 1R0SA 1T5LA 1QSGA 3NHUA 1TM4E 3S1LA 3TRJA 1EUQA 3NHLA 1JDVA 4FILA 2DUMA 1HYQA 3GGJA 1SVKA 4IV0A 3CURA 1S2NA 2CYBA 3BQMB 3LC0A 4JP2A 3ABQB 4G4IA 5EXSA 3ZK9A 1L7RA 2OLJA 2ZRNA 3IEUA 1T3SA 4ND5A 1FRFS 5JATA 3EGWA 3USES 4DRXB 2ZYWX 5H82A 2QVGA 2WKQA 4RTPA 4ZAVA 1B14A 2ZRLA 1ULZA 3HYTA 2B8JA 3R3VA 3QMWA 5KHLB 3LDHA 4F2DA 3ZZ0A 3NMUF 3A1SA 1OX4A 2YVQA 4IWYA 1JG6A 4TPKA 2V9PA 1EWKA 5HE9A 4JI2B 2XRYA 3AXTA 4H27A 5GJWC 4PZ0A 2H29A 5DLQC 4CDGA 5TQ0B 2JFZA 4BFUA 1NBEA 3D0OA 1TVKA 1GD1O 4HVLA 3L6OO 3H5LA 3VU0A 2OZPA 1Z2CA 4M1KA 1CF9A 4LV6A 2F9MA 1GKLA 5KX5F 5CT4A 4EUHA 1DIGA 1M2JA 3QKRB 4XJVA 3DTVD 2C1EA 1B23P 2QN1A 1Y1PA 1N57A 3S2FA 4FYXA 2JHAA 5F9FA 1GL9B 1KJQA 1ADFA 4R16A 3RSGA 1RPJA 5I9LA 5IHXA 5JH7B 3BE4A 3MD9A 4J43A 4TXMA 2C7QA 4W4TA 4R3WA 2IV2X 3WZLA 2HJRA 4RA6A 2A4MA 4LWPA 4M49A 1QCCA 1LBHA 3IAEA 1H8HA 3UWMA 5JV5A 2QMZA 1T26A 3TOSA 2BUBA 2ZWPA 5JNTA 4R83A 3V4RA 1TXGA 3WIOA 4EB6A 2X0EA 4AURA 2WFLB 1WD5A 3WLHA 4FC6A 3KFLA 1YRYE 1PJTA 2V74B 2WSIA 1FTSA 1LBSA 3DKPA 4BNZA 1QHYA 2RHGB 4YCLA 3L1JA 1GCAA 3H4IA 4DC1A 5IKEA 4ACBA 1J0DA 4ASUA 1V3UA 4OIFA 4E51A 1FLVA 4OP3A 4R7ZA 4PEVA 4G09A 3RIGA 5PGMA 3MWFA 1B8VA 3RK1A 4AMUA 1O1YA 4PGGA 1W94A 1X87A 5KTYA 2P3OA 2FR1A 1F51E 2ZATA 3KQQA 2IHVA 2Z56A 2ZVPX 4KLAA 1AQIA 4IG9A 4WT7A 3ANLA 1NX6A 4YA6A 2V96A 2FW9A 1EFVB 3EVDA 4RQTA 1FU8A 5IWCA 2VH5R 2FW1A 3PD7A 3SM9A 2HIMA 4D0NA 1YR8A 2I7DA 3EPRA 4JCOA 2OCBA 3AEQA 2A5DA 4KXLA 4RF5A 2GN4A 4M54A 2J3LA 3NHFA 3WK6A 4DMCA 2WYWA 4BV8A 2JIBA 4X95A 1YQTA 2OHGA 1UAYA 3K0BA 4GICA 1B6RA 4GEGA 1YRLA 1ULSA 4I9UA 1W96A 4BNJA 3L8YA 5A7GA 1ISMA 4CM4B 2ZS8A 4J1TA 4F3NA 1C7IA 3UAGA 5L3SB 3I2IA 1BQEA 3QKSB 2Y8EA 4F93B 4JI0B 4GT1A 2AN1A 2YJ4A 3ORSA 3R2JA 4QGFA 2XWJI 5FFFA 1AQNA 3ICOA 1RT9A 5E7IA 2Q7DA 2VQEB 4GNRA 3OZRA 4NMHA 4ZYTA 1NT2A 1DEOA 3P27A 3ELBA 1RTKA 1LLUA 2QQ5A 1PT6A 2JBAB 2F8MA 4BDSA 4KQHA 5HNKA 3PJRA 2CFRA 3EXG2 3W8NA 5FPSA 3RVPA 2GH1A 3WP0A 2V7QA 3CKKA 2G06A 3NGXA 1FW8A 2Q4EA 3SC2B 4OPMA 4CODB 5KPDA 1SCAA 4H3HB 1WUJS 1M0SA 2WJVA 4JJAA 4MUBA 4KK3A 4YFVA 5CHEA 4XYGA 4DM7A 1VCNA 5AKZA 3U40A 2YQ4A 3BX1A 4EA8A 1J6UA 3PKZA 3U0VA 4TKVA 3MBKA 4Z9BA 5EEGA 4F8YA 5B6JA 3GLTA 5HPYB 1HYGA 2C2MA 4DANA 4L4UA 3R8FA 2JLBA 5GV8A 1WMEA 2R25B 1YTLA 1OLUA 2D13A 4QBHA 1N2SA 4GH5A 1RLOA 3S29A 1MEEA 1YMVA 1Y4AE 1JHYA 3LX4A 2QPAA 4FJ1A 2B83A 1BJRE 1GNSA 1P2VA 3NANA 2W6NA 4ZT4A 5HTOA 2AKEA 3G9UA 5HQJA 1G20B 2ZYDA 4IWNA 1B6GA 1B0PA 1OKKD 4G9EA 4PG7A 4DMRA 3FDZB 2VBFA 2IBTA 2QD4A 1BCSB 4YP1A 3T6KA 5HW0A 2NZWA 1UFRA 3WS7A 3VZSA 2XMZA 4B3FX 3O9VA 3QU2A 4Y0AA 4JEHA 2OMKA 3L8DA 1JBKA 4LKRA 1I5EA 5CXQA 4L2IB 4XCQA 4M89A 4TRJA 1UPCA 1ZMRA 5FL7D 5KDLA 3UBTA 1IFXA 1NPYA 3Q3EA 4Y9DA 2R68A 1QH1A 1T0HB 3IPYA 3ANXA 3T38A 2EF1A 2NACA 3OF2A 4UNIA 4AC9A 4O2AF 1O96A 4ZWNA 5I7WA 3MN1A 3SVTA 3OWHA 2CXQA 4X7BA 5TEWA 3LUPA 1R16A 2X8JB 3JQ8B 4AULA 2E6KA 3LBHA 3NM6B 4LZJA 4KVAA 3OZWA 3ZDFA 5J5CA 3U3MA 2WNHA 1WO8A 3TR0A 1KYZA 1Z2NX 1L8OA 1Y9ZA 1US8A 4AQYB 1JXQA 3SZRA 3GEMA 2CHUA 2W2NA 1Y9EA 2ZUDA 4PFSA 2HHHB 3OT1A 1PQWA 3W7VA 2W6OA 4KGXA 3RS2A 1MC8A 4HNHA 4AUMA 1FP2A 4WXMA 1NULA 3FRIA 2WSYB 2HMTA 1YZHA 3KUUA 4HZUA 4OFXA 5FO0A 3THSA 1FW6A 2F4VB 5LMNB 1EB9A 4PICA 4WDQA 4KFRA 3C1TA 1ULUA 1G59A 2CN1A 2OVBA 1PZEA 1A7KA 1VIYA 1DKOA 4ZPXA 4ESVA 4MWGA 1G5TA 1XRJA 3C8HA 4O59O 1AN0A 3EQ7A 3X2EA 2OV4A 3VGPA 4A0FA 4QZVA 4MGKR 1GXSA 8OHMA 1NVWQ 3ILHA 1RAGA 3KRTA 1SWVA 2QHXA 3D81A 1IZ8A 5FAXA 3MJTA 2CY0A 4Y2RA 1R7RA 4LQCA 3N2KA 4FFOA 3IDSA 3DO8A 4X7MA 1KYQA 5C7IO 2DULA 1EXNA 3SLRA 5IN4A 4I5DA 5MGBA 1UEIA 2EYQA 2OOKA 5KOYA 2OR3A 2V65A 5EIBC 1V1RB 3ZZUA 1CDOA 4E1BA 4ZO8A 1DBRA 2ZPUA 3SAJA 3HE3A 4I9GA 4PVDA 4JVNA 1CRWG 5ALYA 2X6QA 2JLUA 4YACA 1TU0A 5G1OA 1IHYA 5DTMA 2ATXA 2C5GA 2DPXA 4MV8A 2I8LA 1AO3A 4B3RB 1XEAA 1NBME 3U7QB 1Z3IX 6Q21A 1R0ZA 1A4IA 2AMVA 3MUNA 1JR6A 1AKEA 4TGLA 4B7UA 1ECLA 4IKPA 3JR3A 4JC8A 2TMKA 4TYQA 1AS3A 1DO0A 3CZ4A 4K9MA 2VHJA 4MWBA 5AUPB 2QW0X 1K3TA 3PD0A 1KL7A 3HCRA 3LM8A 3CV3A 2C77A 3OBBA 3JD1A 4NPCA 4OCZA 3BS4A 3ZXXA 2QVZX 1LQTA 5KYVA 1FFWA 3MTEA 3MOGA 3UKOA 2XHEA 1R4MB 4HN4B 4NZ9A 1G8GA 2IYNA 4DA9A 2GCPA 1L4FA 3FWNA 1PR5A 5D5QA 3FFXA 3KQHA 1KP9A 3MJVA 1CQJB 2GZ3A 3U3ZA 1E92A 3HBNA 3WY9A 5EWMB 1YE8A 2VPXA 3JRWA 5EKDA 3AYZB 3U7EB 2I66A 2JHGA 2BTEA 1D8AA 3HCPA 1GA6A 4BNNA 1Y6RA 2AT1A 2HBQA 2O7VA 4ZIRA 1QZUA 1T9DA 3EVAA 1AH2A 1Z38A 1M2WA 1P81A 2CHVA 2IP1A 3CUKA 4R1NA 1EGQA 1M0EA 2GGSA 5JD5A 4ZMSA 3KKPA 3ET5A 3DBIA 4PHCA 1JDSA 4PBSA 3KR1A 4TROA 4BECA 1XN4A 2B30A 4PX2A 4X65B 4XWWA 1G9XA 2ODPA 1IDOA 3RASA 3PFFA 3KZ1E 1Q1GA 4BVHA 2E21A 1XALA 5TT1A 3V4FA 2LCFA 1TTHA 1INLA 2RHLA 2JGKA 4YMVA 5C81A 4MS3A 5ELLA 2SKDA 1EB8A 2OY0A 3NHRA 1KZYC 1W29A 3IV7A 3OIGA 3WHLA 1MAHA 2X76A 5IULC 4F2PA 5DCYA 2C83A 3HWWA 4NXNB 4EPWA 1OXUA 1JILA 1K1EA 3Q9SA 4ZCPA 5LYJB 3CSDA 1X13A 1M8KA 3QPBA 4O0MA 4Z3DA 4ZCRA 4BASA 2XXAA 1PEDA 1QFMA 3H3XA 3S3TA 1VI6A 1DUVG 3U6KA 5DWVA 5TGTA 3IRUA 3DZBA 2YMLA 3LC2O 3DOIA 3QPCA 3HU1A 3PE4A 4ODIA 1RLIA 2CHEA 2ILVA 1ZNYA 3A3PA 4YXWA 1CERA 1Z13A 3LBIA 2I7CA 3SICE 1PX2A 3H13A 3UOAB 5LQAA 3HJAA 2GD0A 3ISVA 1CUYA 4ZQIA 2FWAA 3CH6A 2Q2VA 1NI4A 2UZ3A 1ZS9A 1V1MB 3O7MA 4IF6A 4S2EA 3NT4A 4QUEA 4L15A 2FWBA 3S6JA 5KDOA 4B73A 2QUBA 3MCVA 3UATA 3ZKWB 5DH9A 1FPMA 1W4LA 2VDVE 3BAZA 1EQAA 4MMYB 2IHNA 3NIGB 5A4JA 4CDNA 2BEVB 2PGXA 3DUFA 4HTFA 3V97A 2GK3A 2W7TA 3AL2A 4ZI7F 4QM7A 4X90A 4B31A 3NBUA 1N5LA 1EVJA 4XUCA 1JIVA 3PDWA 3GLIE 1I4DD 3P97A 4I5EA 3ZWMA 1W0JA 1XZCA 2CLDX 4KQXA 3LDFA 4LF8B 3AUJB 4ETIA 4S24A 4K1LA 4LNHA 1F1BA 4DARA 1MJ5A 2ILTA 2IEZA 3BSYA 4IMJB 4WL0A 1QH8B 4KFUA 1BGXT 5T4BA 2A88A 4IDCA 5LDGA 3VGJA 2F9LA 4RKYA 2BEUB 1PR3A 3NIBA 3T7AA 4J4BA 1QOZA 5A02A 4ZV7A 3CWCA 3PSAA 4LRUA 5ALSA 1GO2A 4P0TA 4P3YA 3SJZA 4YCSA 3PGLA 4IIVA 1LJUA 1EEXB 1K0UA 1YB6A 1YKSA 5K8VA 1KEEB 1RKBA 2H5IA 1PR9A 3EZ9A 3OEEA 1YZVA 3ETLA 2EG9A 5LUAA 1WOYA 2PGLA 2FR8C 5CLQA 4RSGA 2W8BB 2IPOA 1HETA 1YZQA 2VT6A 3R41A 1AX9A 1U0SY 3I04M 2JAPA 3WV5A 4AAYA 4ZVUA 4D9BA 1HDEA 2R6CA 4OHOA 4B3JA 2JNWA 3HFRA 5LR6A 4BX8A 1EX6A 3PBKA 4WY2A 1QBGA 4MQLA 2WVGA 2ZJZA 1CCWA 1JKJB 1PJ8A 2IHKA 1IATA 1XLUA 2JZCA 3HSYA 5DYNA 1WY7A 1F3OA 4TL6A 3KFXA 5AM5A 1N25A 4L74A 1IAVA 4W5HA 3EXIB 3TDMA 1U2TA 1HDIA 4TVBA 3I58A 5AI8A 3WYAA 4OQLA 1X1AA 1WW3A 5J43A 3TIFA 1OREA 1LUAA 1ZGBA 1S89A 1QGUB 2C59A 3CU5A 1QRAA 2C3OA 4OB7A 4QYSA 4TOIA 3WL3A 2ZWAA 1DCTA 4EYKA 2B2CA 1M74A 4YAGA 4QICA 3H2JA 1TCCA 4COKA 1P7ZA 2HYIC 2ZWIA 2UYCA 2PX0A 2YMMA 3UH0A 3VAZA 3DV0A 3W79A 2R11A 3WLJA 3T9BA 2QM8A 1DBIA 4GM1A 4BB9A 1YZFA 2PYIA 4MW4A 1JKFA 2AXPA 4HGNA 4C5AA 3F9IA 3P9IA 3WL5A 4ZVTA 3MF4A 5A6SB 4RVDA 1OLSB 4CE6A 4L8GA 2H4XA 4WNCA 5DWQA 3STUA 4LX0A 4LF7B 1N6HA 2VHWA 3T5AA 1E4EA 3P9SA 1KKMA 1PQUA 3QGMA 3W1VA 3TTWA 1PT9A 1OASA 3C41J 3RUFA 2IUSA 2F17A 4UHBA 4EKEA 1SU7A 5LA6A 1E2KA 2A9KA 2MR5A 2O9JA 4N0PA 4XB2A 5F5XA 4DCCA 4PC2A 5JZMA 2BPOA 2V4ZA 4NCNA 4YCMA 1XHLA 3C74A 4F3YA 3LA6A 4RK5A 4RK0A 1E4OA 3S1SA 3H2ZA 2FKAA 2R6GA 3N0XA 5IJAA 1PIWA 1UM9A 3JZMA 1KDYA 1JDBB 3JQAB 8GPBA 4G0UA 3IEXA 1RC8A 3S2SA 2KYRA 3OEHA 3RVDA 3BMXA 2HQOA 5CA1A 1U4OA 3T7SA 4KPEC 1R88A 3JQBA 1KEUA 4BYGA 1SULA 2A0KA 2NYAA 4JWKA 1VPDA 3SS8A 1OI2A 1GTMA 2V4UA 3KQTA 4F3CA 2O2YA 2XVZA 1YBVA 1H2BA 2INGX 3KXLA 4ARAA 3PPWA 1AUQA 3E7FA 3SY8A 4A6PA 4M87A 4ZYZA 1P9LA 2OXRA 4OL0A 3GD5A 1X0VA 2OBXA 4DY6A 3NDIA 5EKTA 2QRQA 1QS0B 3K94A 3FFBA 3TI9A 5ITZB 4YLYA 4AYXA 4ZOLF 4RIFA 4P4LA 1WDWB 4JOSA 1EP2B 3R3ZA 3OEWA 3I01M 3BMCA 3LBAA 1IWBB 2CHQA 1E3MA 4RZQA 3HB9A 3EY4A 4G1UC 1K6JA 5HJEA 3M3PA 3WQQA 4BFTA 3OLVA 3PNVA 2HTFA 3BCUA 4LZWA 2HA7A 2XUPA 5E38A 3ZV4A 2O5EA 2GBGA 4C4PA 1W5SA 1ZRSA 2YVAA 1JLSA 1MZPA 4F3KA 4QASA 3LHFA 3EDMA 1VYUA 3ONDA 1T25A 1P18A 1YVEI 3IXMA 1DPFA 4GR9A 4KDRA 4MQFA 1Y9DA 2IXAA 4PYQA 4GX5A 1BRTA 2RGBA 2G0TA 4XGNA 2HSZA 3MRTA 4YASA 1RRMA 3K1AA 6LDHA 4UE6A 2GLTA 2RJNA 2QQ0A 4WZAB 5D00A 3HCAA 4EGAA 1P45A 3AILA 4OQ4A 5IBQA 4MKIA 1QFXA 4UPDA 4XIYA 1E2EA 1SKMA 2Y0BA 1KE1A 5JARA 1EA7A 1P4JA 4D74A 2R1VB 5DTIA 2CXXA 3FCEA 3QEOA 1HEUA 1E98A 1ETHA 3SHFA 1N9KA 3FUCA 1GPLA 3IMEA 2XUKA 2HAEA 3TW6A 3IAAA 1T9GR 4KNWA 4F9EA 3K71B 1T43A 4AZ0B 4RZ3A 3P9QA 1D5CA 5BSVA 4L02A 2IRWA 2SCUB 3NEAA 1F9EA 4JA0A 4BFXA 3P0RA 2E4YA 1QRRA 2Z5VA 4LYYA 3ZWPA 2BM0A 3SQXA 1VJ0A 1NLMA 3RIEA 4F97A 4KX3A 4PN7A 2WFMA 2M1XA 1ODJA 1UANA 4LW8A 1E1LA 1RQ2A 4LY6A 3OM0A 1BE8A 5BV1A 3Q9NA 4U2BA 1CY2A 2Q4RA 3TX2A 5EE1A 3BM5A 3WYCA 2GO1A 1TT5A 2DR2A 1T0PA 3Q11A 2C7VA 5C4IA 1ISRA 3FUWA 3PE3A 1U6KA 4OSEA 2JGAA 1Z0IA 1Y8QB 4WXYB 3B5EA 4MR9B 2Y68A 1NY5A 3QWAA 2WWRA 1SU6A 3OZUA 2O14A 2Y27A 3ZDAA 1XIVA 5JJCA 1SVSA 1P1HA 1ZK1A 4HQOA 2CXSA 3DMHA 4KDFA 4RY2A 1L5LA 3JQAD 1YNOA 2AKYA 2J3JA 2IS1A 2QM0A 4CN8A 1VQ1A 1Z68A 3ZR4B 1VMIA 3GEIA 4PPFA 1Z8HA 2ROQA 2Q28A 2W0SA 4FINA 4LRSB 4C7OA 1YMUA 2X5NA 4QJBA 4X62B 1U3GA 1VXRA 4D25A 5IAGA 1OZHA 1X77A 4UNSA 4DCUA 1H1DA 3TBFA 4XDGA 1VTKA 2W6ID 3QY0A 1SQFA 5A7FA 1W4ZA 2ZIUB 3BWYA 3OUZA 2C2ZA 4IEEA 3AJ8A 4QX6A 2PGAA 3W2TA 4BEVA 3E61A 1NUQA 2GN9A 5IYZA 2ZQYA 1DV1A 5FD8A 4N8EA 3DGFC 1GHTA 3HPQA 3N2ZB 2JJYA 4CKWB 1XD9A 4JYCA 3PZBA 3E8MA 2GPSA 2GZHA 3IOBA 5D1NA 2QTMA 2Z1DA 3G1TA 3A27A 2XCSB 4Q7JB 4XFDA 2YVUA 3GV0A 1KERA 1S8OA 3PUHA 3U4MA 3N8GA 2XT6A 4MLDA 3SHQA 4BLRA 5IXSA 5MDHA 2JFOA 1XRSB 2ZUWA 1WNFA 4NQZA 1VSQA 1J9EA 3U13A 5HKLA 5ILQA 2QL5A 3TPZA 4BP9A 4JR2A 4DNQA 3UPDA 1YL7A 5LNK1 3DHYA 5AM3A 2FPWA 1QIIA 1SVOA 3B7WA 4R40A 1AA9A 4DAEA 3IUSA 1WPGA 3ZHBA 5KNDH 1FFHA 5BUSA 2HRRA 2WJJA 1VE9A 3QMMA 3WOHA 4X66B 1LPPA 2DWQA 2DT8A 2RHTA 4QL3A 4RVHA 3OQVA 2QL7A 3UY4A 3X0DA 2PMDA 3A26A 3N0VA 4N8DA 3RHSA 4ARZA 4TTRA 4KWEA 3T4EA 5B1EA 4YJFB 1KJ9A 1GUBA 1NV8A 4CKBA 3DVRX 3MS2A 4KH0A 1JXAA 4L22A 2C5FA 1FMLA 1FC0A 2C0QA 1CF2O 2DKNA 3I2JA 3OCCA 2GEJA 1SU4A 1PEYA 3OOYA 3PNYA 4H7FA 4J2HA 5JSYA 2F3TA 1IWOA 2Z2YA 1CUHA 4U8HA 1PT7A 3U26A 3KB1A 4W5OA 2EF0A 2FN7A 3WLSA 2HEGA 4WINA 1RFGE 1E96A 2W11A 3B9BA 1L4HA 2BLLA 4KQEA 4QUHA 4EYGA 1XNRB 2GTHA 5LU8A 4WECA 4UCFA 5JDCA 4LYGA 4XX1A 4F6RB 1E3SA 1XMXA 3L1UA 4TKZA 5IP5A 1K97A 3ABSB 1N8NA 4KK4A 4XEHA 4B3IA 3MLBA 5I5EA 5G40A 3CE6A 2ARKA 4WTOA 3WQBA 4LNUA 3P9NA 4F56A 1YBMA 3BAFA 4H3KB 4MIKA 5LBIA 3SBXA 2QRVB 2OT3B 1EA5A 1ZM7A 2HSDA 1KARA 3U3JA 3QV1A 1M3SA 1PJCA 4M1WA 4KZKA 2DFLA 2IHYA 5CAEA 1AE1A 4GO1A 4LF5B 4IIDA 2EC5A 1UDWA 4C4SA 4EB3A 5A5FA 1EXDA 1GTL1 2OZLA 2XZLA 1FFXA 3A9WA 1MC5A 3CUTA 1LI4A 3DE2X 5J2UA 4FDAA 2QJFA 1JE0A 5BQOA 4PG8A 4U2CA 4M98A 5G0TA 2ZJ7A 3JQDA 2OO5A 4IPTA 5SZJA 5TPWA 4BN4A 5BQFA 2PUDA 2FN9A 5L4SA 1PQPA 5FI3A 2OP0A 1J23A 1YHNA 3LT1A 1Q20A 5K3FA 4YGXB 4AXXA 2P30A 3EAQA 4EMBA 1JHXA 1W35A 4ENRA 1XQVA 3AM3A 5EZ6B 3E05A 5DT2A 5C7LO 5GADl 2OQIA 2H65A 2WJIA 1PLJA 3SXPA 3AESB 3OQHA 4ZYYA 3MW8A 2PQ0A 4LN1A 3VYWA 3SR4A 2W6MA 3FETA 4RL4A 1FIUA 2CMKA 1A96A 1CDDA 2BFFA 2G67A 3CZ9A 1NUTA 3CBQA 2AR9A 1LI5A 1IN5A 1HYHA 3NNSA 4NATA 3B6IA 1S3FA 5ICFA 5EWJA 4BX3A 2Q4OA 3FOEC 5B12A 2Y92A 1OGJA 1IRXA 2ZBQA 3CMMA 1QUFA 4FCTA 4UUBA 4DJDC 1KI7A 1ZGZA 5TGDA 1KI3A 2PEYA 1PSDA 2NG1A 4KR9A 1A1VA 3K8YA 1Y8RB 3J7AC 1VLJA 1JFFA 1CVRA 2OKCA 1BN7A 4RV4A 1XCMA 4A2WA 3O26A 1CF4A 2GVZC 3ZHYA 3MQFA 1AV7A 2YWEA 3PQEA 1JEAA 3HK2A 5EY5B 2BP7B 3DEJA 4L50A 4Y2QA 1BWSA 2XOEA 2QRJA 1FF9A 4XGIA 2NSLA 1O6BA 1A9SA 1DAMA 4PN3A 3J80A 2GN1A 1ODIA 3GEHA 3PRHA 4WBSA 3W3AH 2WWXA 4TMTA 3VYRB 3IKVA 2RONA 1YFZA 4KYUA 3E81A 2RGCA 3LX5A 4QLOA 3PQ7A 4PX5A 4IUDS 4C3VA 3ICEA 1FVXA 5CFQA 1QYCA 3QVGB 4XWOA 2RBEA 2R4QA 1AC5A 1EDZA 3I1JA 3KKZA 1VG9B 4I1UA 3DYVA 1QIKA 2XXJA 1ABFA 2ZSDA 3C6BA 4K9DA 1Z16A 5IBRA 1X39A 1V16A 4I55B 4BP1A 2VQFB 4BZWA 5JXJA 5BN3B 1YQEA 3OQOA 3AHEA 3EJ6A 3GZ4A 4F12A 4KE8A 4YCAA 1OMOA 4P6VF 3QVSA 5D8DA 2P2NA 1KOLA 2EIXA 1Z5OA 4HGRA 2UV8A 3CLTD 4YDRA 3OQNA 4NYMQ 5DIFA 1YCHA 1B16A 1EVKA 4X8HA 1PU2A 1XQ1A 5C3MA 2GEKA 4U7GA 2PT5A 2B61A 1KH2A 2FTKE 4U6SA 5B58T 1SQSA 4CKXA 1NF2A 4HLUA 5K2OA 4IIYA 4TTIA 3MJFA 1RE0A 4GKJB 3LCRA 4LA4A 4PC3A 4NF2A 2ZT8A 1SIBE 4BYMA 1NYTA 3WMEA 4A8PA 1NVGA 4QQKA 1SBQA 4DA4A 1LQ2A 4J7XA 3RU2A 3SXUB 5IJ0A 5CITA 2VJKA 3PT9A 4JXJA 1XRLA 4JOCA 5EFOA 4O1HA 1T8YA 5CLGA 5AXCA 4HWTA 4J0GA 5DPMA 1UBTS 1I10A 3BZBA 5JHGB 3IQGX 1VSBA 1AK2A 2EKZA 1FMCA 1HFEL 2F1IA 2POCA 3ETNA 3IT1A 3S5JA 3TEMA 3QSGA 4QEKA 2H3EA 3U9SA 2OBBA 1DE0A 3O6VA 2AJCA 4MTLA 3VDMA 3COJA 1U1EA 4H4EA 5F1YA 4U7PB 1WCXA 2HJWA 3M5WA 2J41A 1AHPA 1C1XA 3H87A 4HB2A 1UPTA 3VZCA 1X7WB 3IQEA 4I9HA 1NRJB 2B4RO 4D79A 5JROA 4RTMA 3NDBB 2HHJA 1KI6B 3G2LA 3JSAA 3MM4A 3I45A 3QXHA 4E08A 2NU6B 5JO0A 4DV7B 2O8BA 4HKTA 1SXGA 3HG7A 3GRRA 3QVMA 5I6DA 3PDIA 2AK2A 5H9WA 4YJ3F 5JDCC 1APBA 2J0VA 2YHIA 3KPJA 4GPEA 3WJ7A 4YBRA 2WNIA 4B9EA 3OPYA 4NBKA 3DMTC 2Q46A 3PQ8A 2YMPA 4X3PA 1GKKA 1N5IA 3E3OA 5D3MA 1C81A 3AKDA 2XECA 3L7KA 3ZDRA 1B8NA 3KPWA 5LC1A 1YV9A 1EJBA 2K5UA 4MUAA 4ZEXA 1JU4A 4IKOA 3ABOB 3W2FA 4C6RA 3THXB 5KTNA 3GFOA 5J5AA 1ZH4A 1F9AA 4PIPA 4UXJA 5LLSA 2PANA 3NHAA 4UUMA 2V6MA 2RCNA 4AN4A 1CNMA 1UM8A 4Z9YA 3ZBQA 2FPUA 4C04A 2DJIA 3UKDA 3N2GB 3WRWA 4RD4A 1Y1KE 1ZOLA 4H17A 1AJEA 2WEKA 2DPMA 4WN9A 1U02A 2Z2IA 3LPAA 5D1HA 1XKTA 1Z6GA 2HNAA 4P4NA 4BTLA 4REOA 1Z15A 3B5IA 3JVEA 1LPNA 1FU4A 3TINA 5CXUA 1I7PA 4MRAA 5K0ZA 2C5BA 5ILOA 2WQ6A 4WA8A 4UU0A 3IQZA 3ABZA 5J2TA 1A5TA 2FF5A 3JWPA 3AKEA 3B3FA 4EFNA 3KTAB 3F9RA 4ML3A 2WKPA 3A9CA 3EIXA 4JMLA 1V71A 3H84A 4QXPA 3RB8A 1LV8A 4YXFA 1WP9A 3LI2A 1OILA 2H7YA 4G1MB 1KPHA 1QGZA 3F6CA 2HPHA 1PJ2A 1CRLA 3D6AA 4NPAA 1IZ0A 2PBZA 3C1OA 4CIVA 4HK4A 1IOZA 1HG1A 4JU8A 4UUOA 2ZZNA 1RWBA 5JS1A 4TTSA 4H15A 1CYDA 3D7MA 3IURA 3UIEA 2CSXA 3KEGA 1MTOA 1O4VA 5TR9A 3K1TA 3RRZA 4DY4A 2O8CB 4FFPA 4ZO7A 2DTXA 4HN9A 4B2PA 5L3QB 3WIVA 3K70B 3B78A 4NBRA 5U9CA 2WVJA 3VV3A 1SMKA 3RYIA 1NJ5A 2HK9A 5KQLA 3EF3A 3GAFA 4M9ZA 4C0KA 2G17A 2TMDA 4CG2A 4BVAA 1P2TA 4WOBA 3AUUA 3EFHA 3VYUB 3W77A 1XRQA 1E3WA 1P1IA 3WBBA 3WGTA 2GQ0A 1CUIA 1X1EA 3DS8A 3OY7A 4OQQA 3H11A 3R6DA 1NWHA 4UBMA 5EQTA 1NDUA 3KOUA 2RGWA 3WA7A 3TM5A 3FTNA 4G84A 1X38A 3C8ZA 2XRMA 1RJ9A 3GGPA 3GUVA 2MINA 3ETJA 4R8RA 5E8JA 3TOVA 4S04A 1QF6A 2NO6A 3B82A 4A0SA 2QL6A 3EIUA 2R7AA 5E6UA 4EIWA 1T1RA 4ID3A 2GM5A 1YQ9A 2XW6A 1NQOA 3GY0A 1AG9A 3HI6A 2OFOA 2WR8A 3ODPA 1JIJA 4UTNA 2P9EA 2WSMA 2WD7B 1N8TA 4IHJB 3AR6A 2D1FA 2DOKA 2ZRHA 3HKEA 4JGIA 1I4TD 3EXEB 1NUSA 4I36A 2FZCA 1T0UA 5AVSA 1Z47A 3DE1X 8ADHA 2VH2A 3QPAA 4P92A 3MAGA 1CT9A 5TPZD 2QXUA 5JSKA 1D0IA 1V8ZA 1PYGA 3QUBA 4ISBA 3FAZA 1DTEA 3M6AA 3VNSA 3K0AA 1X1CA 3FTPA 2VHXA 3GT3A 1S8NA 4FGUA 3VPDA 5A1JA 3EIWA 4JKIA 1WEHA 1VB3A 1SBIA 3FPJA 3IJRA 3QVLA 4AU1A 1ZSNA 4RDCA 1P75A 4UMEA 4I4CA 2HRQA 4ND8A 1J8QA 4OKSA 4HDRA 3KWLA 2BGIA 5AVQA 1WVGA 3QU5A 4AKGA 1JG2A 3K0SA 5KTRA 4LZLA 4BKOA 3F73A 4NFHA 2GVDC 4CFSA 4YCNA 4QBTA 2ZI5A 4BHTA 2B7LA 1IIBA 2Y6VA 4FDLA 5E6RB 1BEUB 1F2UA 1HBJA 2ETXA 3G1UA 4FHZA 4BRSA 5KEIA 4HDSA 2ZB7A 1FZQA 4TX1A 1HK7A 2AJDA 3U49A 2WJ3A 2FOIA 2G8LA 4WGGA 3J81k 1UMBA 1VKRA 4S3MA 1JFVA 1O6ZA 2QTVA 4HDNB 4LG1A 4BVGA 4CLOB 1PSWA 5JZSA 3T3PB 4GLBA 1L5FA 1XF9A 3HGMA 4RZHA 1F3LA 4QGBA 4JR1A 1RVV1 4DMFA 5BYAA 1HF3A 3DLAA 5FAKA 2OVFA 3NXKA 1KQ3A 4FGKA 5AW9A 3HA5A 3MWGA 4X91A 5G2OA 3JQEA 5G1PA 3RANA 3IYLW 3LC1O 1T2VA 3W5DA 3K0EA 1U0NA 1KYTA 221PA 3G2MA 4PQRA 4KXYA 5AM1A 4D5GA 1VHJA 2HWXA 3V8BA 3R24A 3H8VA 3FNGA 2X4LA 3GRVA 4GXNA 5I4KA 1UDCA 2HH9A 4UJ3A 1WRBA 3NI2A 3FRHA 1FDRA 1HE5A 1UC8A 3D8SA 3DVAA 3O2JA 4N39A 3W5UA 1XA3A 2NVUA 3STHA 2IXBA 2PZ8A 4EYQA 4ZT3A 5CVEA 1JJVA 2H1FA 5F23A 1CRPA 1GSOA 4YQFA 1POWA 1Q3KA 3KLOA 1QQ7A 2FPXA 4BNIA 5BSWA 3K70D 4F2WA 2J67A 4NE7A 4ZU1X 4CBVA 2CK3A 4LMBA 3NONA 4C0LA 2IF2A 1W48A 2W2KB 3OVMA 1VB5A 4NCXA 1QPGA 1R9JA 3FBWA 5BQXA 3Q1KA 4Z7JA 1H65A 1Z39A 2GEUA 3DEYX 3OE7D 4FQ5A 4YY3B 4COOA 1XZIA 1G4UR 2BFDB 2FF7A 4TXJA 3DVLA 3O4JA 1C80A 1D09A 4L9AA 1E3EA 4PQEA 1KF0A 1V26A 4OHRA 2DY0A 4ZHQA 1ZVMA 2NQTA 3AUYA 4YN3A 2D8MA 4US1R 3PNPA 2BFMA 3VSDA 4EDHA 5E4FA 2ORYA 4KVZA 4B6RA 3RS3A 4WASA 1WMAA 1CNEA 1X74A 2CUKA 6CHYA 4KLCA 5KVQA 5KYWB 1N8KA 3FBGA 3TO5A 4Q7MB 1S4MA 1UBUS 3COZA 1JWAB 2P1DA 4KIWA 4DDUA 4QUBA 2HCJB 4YJ2B 5FFMA 1DC8A 2E9SA 1J8DA 4GWKA 1WZNA 1QVZA 1KMMA 2ZVDA 1OX6A 1YKGA 4KRXA 1NXOA 3IPCA 1O97D 1NU6A 1CUVA 3T1NA 4AJ4A 4FLMA 4JNCA 1OXKB 5AFSA 2XCUA 2WMYA 3ZHXA 1ZY2A 3AKCA 4YV0A 2FOLA 2BJVA 4BX2A 3JQ9A 4TV9B 4TXLA 3EOAI 2QG4A 3G2IA 4MJ3A 3KZVA 1BNCA 1JT9A 3UB4A 4V1CI 2QN3A 3H8WA 2QTGA 4RC9A 1LK0A 1RI3A 2RGDA 3IKMB 3VH4A 3HDTA 1R00A 3LPCA 4P2GA 2PWPA 3FNBA 5DMXA 2EXXA 1WHTB 1Z12A 3A1EA 2J6IA 1E1RA 2PKCA 4XB1A 4BQOA 2GXQA 2CWWA 1T5SA 3HU3A 5JS7A 5I7SA 4YB8A 4UAVA 4IKEA 3G0GA 2F3SA 3SF8A 1Z6QA 3ZWQA 4D6YA 1I4EB 2F55A 2CCKA 4RF2A 2H4YA 4HSGA 3WLIA 5C8YB 1QX4A 2CNNA 1XTIA 3AIOA 5CH8A 4HLNA 3GNSA 5EI5A 5KJCA 1L5VA 1DX6A 2A1UB 4DZZA 1M2VB 3K7EA 4FGSA 1IY9A 1YQDA 4GE0A 2HK7A 1ZJWA 2QTCA 3K9QO 1EZZA 1F5SA 1FSGA 3FKSA 2Y0DA 3Q5GA 5LXTA 4LJ9A 2XYHA 3FY4A 3JASA 3SHOA 5JI2E 4BRZA 3TUZC 2FMTA 2ZE5A 3BD8A 1A50B 3FZQA 4L6IA 1X8LA 1NJ8A 2C82A 2O2DA 2ONJA 3UO8B 4EI7A 2AE1A 1Q0HA 4YRGA 1Q0ZA 3K1JA 4H7IA 5AMXA 5J4HA 3EARA 4ZZ1A 3V33A 3G2HA 1W2GA 1NP3A 3JX9A 1GQOA 3JPWA 1Y1LA 4JI4B 4B45A 5F21A 5D3QA 4OYLA 4YJHA 2PPVA 4QM6A 3LRXA 3F74A 4K6GA 3OURA 4MI3A 1E6MA 3EVBA 3AR2A 3EB9A 1N2BA 4HJRA 5JQGB 1GEEA 1UBOS 1XL0A 1MB0A 1ZCJA 2Q3MA 3HP4A 3JQFC 4U2DA 4Z4CA 3PXBA 3OX2A 4YAKA 1AB5A 3EVZA 2QPLA 5HQ3A 2J4DA 3LT4A 3ZE0B 3EF0A 3CGWA 4RM2A 1TUIA 5ENZA 3GUHA 2EQ5A 1GUZA 2R8PA 4DCPA 1QV9A 2OEPA 1DG1G 4A0RA 2EGHA 2KWIA 1P1BA 5KYUB 3IE1A 3NVAA 4YBZA 3ECSA 3VR5D 1S4QA 2FRVA 3BPSA 3MJCA 3UJ9A 3ESZA 1O95A 4DG8A 3NHYA 3K9BA 2GCNA 3O95A 1G9TA 2CVOA 1J21A 1VFPA 1Z4LA 1ACLA 2XX3A 2I2CA 2ZULA 4NYIR 2F1JA 3WO0A 3ZGVA 5HZKA 1L5KA 1NFRA 2PRZA 2VJQA 3LT2A 3DFIA 1U0BB 2XLCA 4I50B 2IOQA 2WF9A 2X1MA 2J3IA 3OQIA 3SSMA 3V46A 4YONB 3MOSA 2JJ2D 3NALA 4R1SA 3KUDA 2CJFA 4HGOA 4QTTB 5BYJA 2YRFA 5EP3A 4NVRA 4D57A 1S01A 2B2NA 2IPAB 2VPWA 3VJRA 2G1PA 5KUTA 1DUIA 3B3GA 4R9RA 4X6UA 3Q8LA 3A06A 3STXA 4N5IX 1DQNA 2BBWA 2TS1A 2PGNA 5TIIA 1GNPA 1JR3A 2Y93A 4AYWA 3KT8A 3QBJA 3D8NA 3OE5A 3C7CB 2Q8PA 4KQJA 5DISB 2O1XA 2XHZA 3BWCA 3TOXA 3W8RA 5L6MB 2GDZA 2B9EA 1N0WA 2GILA 3F5MA 5HBRA 1AHNA 4TWBA 1I80A 1K7YA 1Z0AA 3PZRA 4TQAA 2J9XB 2QY6A 4JP3A 2ZE8A 1KO1A 1Q0RA 2DFKB 4LV8B 5FWNA 3FOFC 2BGRA 3AX6A 3TB6A 3UK7A 5HQTA 2RK3A 4OQMA 1KU0A 4URUR 1RI2A 2JCGA 4QDXA 4EUSA 3VVMA 2G63A 4K9QA 3L1HA 2OV1A 4KXWA 1JEQB 2BFCA 3LP5A 5JRJA 1BQ4A 3FVWA 1EK6A 3D1JA 4OHFA 4DC0A 1QWOA 2RAFA 1VMKA 3LUGA 1WBBA 1IOWA 3R74A 5F1OA 4R71A 1KSHA 5JJLA 2Q3EA 3A6HA 2XQVA 5IDQA 4K9OA 3L0SA 2V4MA 1C3OB 3LXXA 4OLHA 4XM2A 5AXAA 3THRA 4C0AC 4UTVA 2QLMA 1THTA 1SUIA 2FVYA 4PQFA 5F3WB 2JAWA 2YR0A 4ZXPA 4XX0A 5HE8A 3KE8A 3LQ2A 4G5OA 4ZC8A 2XTNA 4DG9A 1QWSA 4LOKA 5JDIC 3WLNA 2Q45A 1K5HA 4M0FA 3S2IA 2YUTA 4R0VA 3IJEB 1I2BA 4JBWA 2O19A 4LOLA 4DCSA 4ZCSA 3OP1A 3P5BA 2J6HA 3D4LA 3RSCA 1E64A 2A9QA 2X5KO 4L3VA 2BZGA 4N8SA 3SQMA 1W5EA 1SHJA 3IIKA 3OJEA 1JT2A 4B4KA 1JJFA 2ODAA 5TS3A 3B1VA 1EWYA 4ZFNA 1TE2A 3K8OE 4AZSA 3KLNA 1F0PA 2A5YB 1UBKS 4G4SP 1Q84A 4G0WA 2VDNB 3CYFA 4ENSA 5KTPA 5SY4A 2AHRA 4BUJA 4EB0A 4IDBA 4OF4A 5CJPA 3PV0A 4KL8S 5DP2A 3IUBA 2ZU6A 1O97C 1QE3A 3L79A 2AW5A 4IXNA 1R6UA 3EZ7A 3E5HA 2WFAA 1ULAA 1A9XB 3EEQA 1Y0BA 3IAS1 1T3LA 1XCLA 5ECWA 3UMSA 1E89A 4BMYA 4F1WA 4IO1A 4J94A 2DU8A 1YZKA 1MT3A 3QP9A 5D01A 4LVCA 1OY1A 4CEIA 1O4WA 3H9UA 1YVPA 3K6RA 3HEBA 3S2ZA 4LRYA 1RXEA 5L7TA 4OQFA 4JJ6A 3PJEA 4TMXA 1ZNQO 3IAUA 4MRPA 1YC5A 5CB0A 1L5RA 3KZKA 1XRPA 3GLIB 1U9IC 3WGVA 2XVXA 2YS7A 4XIGS 4PGHA 4JUAA 2I62A 1GQFA 2FHSA 4JNKA 1CR1A 3AEZA 4EVSA 4RTQA 5F2NA 1CIJA 1YJ5A 1LU9A 4EJFA 4PZDA 1TFRA 3ACCA 1ECJA 1NQUA 3ZDXB 2G08A 4IBOA 4XD7A 4U63A 2UZ4A 1QO0A 1E2IA 1UJ4A 1QDUA 1D7AA 4HC4A 3UN1A 3FPCA 2FXIA 2OQ2A 1EAMA 4DCGA 4DR2B 2A59A 4FOSA 3ZU3A 3ZXSA 3RC9A 2AEEA 4O4JA 4R0MA