1AH2A

Serine protease pb92 from bacillus alcalophilus, nmr, 18 structures
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPNAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of serine protease PB92 from Bacillus alcalophilus presents a rigid fold with a flexible substrate-binding site.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Serine protease
molecule keywords SERINE PROTEASE PB92
total genus 45
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ah2A00
4OV6B 2Z57A 3DE2X 1C3LA 2IY9A 3CNQS 2TECE 1Y33E 4RYDA 2SICE 3DW1X 1IC6A 3EDYA 5ARDA 3DE4X 1SVNA 3EE6A 3I37X 1OYOA 3LPAA 1GTJ1 3DWEX 2ZRQA 1AF4A 3DE7X 5JMOA 1DUIA 1SBNE 1AQNA 5SICE 1AU9A 2Z2ZA 4GI3A 1PJ8A 1TECE 3DW3X 3DYBA 3DVRX 4MZDA 2E1PA 2PQ2A 3WQBA 3A3OA 1PTKA 1SUDA 4C3UA 4DZTA 3VV3A 5JXJA 1SCBA 3A3NA 3BPSA 4WOCA 2PWBA 2Z2XA 3TI7A 4NMXB 5K7SA 1Y3FE 4CG0A 3AJ9A 1EGQA 1IAVA 1MEEA 1SUAA 2PMWB 2WUWE 4JP8A 4CFZA 1YJCA 3H42B 1XF1A 4H6VA 1BE8A 5I9SA 1AV7A 3I34X 1AH2A 1R64A 1BJRE 1SCNE 1EA7A 2IXTA 3EIFA 1SBHA 3D43A 1KE1A 1KE2A 2ZWOA 3Q5GA 1SCJA 1T1GA 2HD4A 3TI9A 1SUPA 1BFKA 2PRKA 1Y34E 2ZWPA 3PRKE 4C3VA 4FONA 1KDZA 3GCWA 2WWTA 4AKTA 1SCAA 3WHIA 5AQEA 1WVMA 3SICE 3UNXA 1SELA 5JXGA 1C9NA 2X8JA 2QTWB 3F7OA 2P4EA 1SBTA 2DQKA 3D9QX 2ST1A 4H6WA 1SIUA 1SIOA 2Z2YA 5FFNA 1TO1E 1SBCA 1P8JA 2Z30A 3Q40A 2Z58A 5AVKA 4Z2AA 1OYVA 3PTLA 1V6CA 1CNMA 1S2NA 3BGOS 1GA6A 3GT3A 1UBNA 3DE6X 1S02A 3ZXYA 3DVSX 1TM3E 2PWAA 4M1ZA 1SBIA 1TM1E 4OMCA 2DUJA 1R6VA 1GT91 2W2QA 1V5IA 3OSZA 1PFGA 1AK9A 3VHQA 1TM7E 4BWGA 5FAXA 3DDZX 5AMXA 3DE1X 3CO0S 3I30X 4CFYA 3F49S 1GA1A 1LW6E 1TM5E 1Y9ZA 1C9MA 2DP4E 2W2OA 2SECE 3GT4A 4KPGA 1DBIA 1Y3DE 1BE6A 5ARCA 5FBZA 3DE5X 4ZOQI 1Y3BE 2PYZA 5ARBA 1TO2E 2PKCA 1CSEE 2X8JB 3BX1A 3LXUX 2W2PA 1GTG1 1ZVKA 2G4VA 1ZVJA 1PEKE 4NE7A 1SN7A 4HVLA 2W2MA 1GCIA 2XRMA 1A2QA 3ZXXA 1Y1KE 1NLUA 3VTAA 1S01A 2ID4A 5CW1A 1Y3CE 3P5BA 1Y4DE 1VSBA 2B6NA 3LPDA 3F7MA 1YJBA 1KDYA 3AJ8A 4HX2A 1GNVA 1WMDA 1ST2A 1OT5A 3QFHA 1JEAA 1YU6A 1Y4AE 3A3PA 2ID8A 3AFGA 3DE0X 1GTL1 3QTLA 1NDUA 1YJAA 1KDVA 1TMGE 1AVTA 1WMFA 1P7WA 1T1IA 4I0WB 1SUEA 1BH6A 1BFUA 1WMEA 1SIBE 1TK2A 2V8BA 3L1KA 1SUCA 4KB5A 4LVNA 4WOBA 4AKSA 1Y48E 2W2NA 3VV2A 3VSBA 1NDQA 1P7VA 1C9JA 2Z56A 3DVQX 5JXIA 3TECE 3HJRA 3QMPA 3WIVA 1HT3A 1WSDA 4KG7A 4K8RB 3WIUA 1GNSA 3SQOA 5AVJA 3T41A 1Q5PA 2SBTA 1TM4E 2WV7A 4LVOA 4NE9A 3I2YX 4DJ5X 5B1EA 4OMDA 4DWWA 1R0RE 3GCXA 5B1DA 1GA4A 1MPTA 1ST3A 4H6XA 4B5LA 1SH7A 2HPZA 4J94A 2WUVA 4ZARA 2XTJA 3LPCA 3VYVA 1SUBA 5JXHA 2SNIE 4YN3A 1THMA 2GKOA 1T1EA 1SCDA 1SPBS 3DE3X
chains in the Genus database with same CATH superfamily
2QTNA 3U4IA 5A4AA 1OFGA 2CDNA 2CXOA 2RMKA 3O3OB 3PYLA 4LZAA 4DUZB 3NZEA 3ITKA 1K6EA 2QUJA 3KQWA 4TZKA 3QLTA 5CJ2A 1B8OA 2FN4A 5AM4A 4TMFA 4D45A 1TJNA 3UUWA 1UBRS 4QQKA 2BGLA 4DV4B 5FNZA 1YONA 1ENZA 2JIQA 4H3HB 3F96A 4KXXA 3UEOA 1IPFA 5G02A 3GFRA 4U7DA 3GQVA 2BZ0A 4Q3CA 1UZLA 3OF2A 4W9MC 1IY9A 2LXNA 2B83A 2ONYA 2OZVA 4QL3A 4ER0A 2GETA 6YASA 3BL5A 5LU9A 3IUPA 1JHPA 3E9YA 2WRZA 1HLDA 4ZT4A 1NVGA 1YAJA 4MR7B 2UUBB 1AH2A 1SCNE 1AE1A 2Z3ZA 3U9LA 5HRAA 1JVNA 4IX1A 1MIOA 4MV4A 2DG2A 1CEEA 5K8TA 1Y3HA 2YJGA 3IIEA 2H08A 4J1SA 2JW5A 4MMZB 4EZIA 1LDMA 3DS8A 4NS4A 2PUJA 3OMLA 4KWEA 3VSAA 4BE7B 1RRKA 3KDPA 4LCJA 1XD8A 2R5WA 3GPCA 4QELA 1YXMA 3UG6A 1Y0BA 2AXEA 3V2GA 5BV0A 2OBNA 3EEFA 4URVR 1ICIA 4OSEA 5IARA 3HCPA 1OGIA 1CEQA 1UMBB 1BS1A 1QLHA 4X0EA 1I1HA 1KOJA 4YCNA 1J5PA 1Y8RB 3NATA 4L9AA 3GLRA 3EGEA 4OH7A 4HN9A 3HJCA 1II9A 3I9FA 2XVXA 2CB9A 1M0TA 5T3YA 1Z0ZA 1V3UA 3CNOA 2F64A 1AK9A 1V3QE 1Z0DA 2OV8A 3L9XA 3P52A 5DEOA 5IC4A 1LX6A 3CBQA 3QKSA 3LP8A 5MN6A 1E5XA 1XRMA 4JROA 3HP1A 5BMVB 1G1MA 1C50A 1F8FA 2B7LA 3E5MA 2Y1GA 1SVLA 4ZHQF 1CUZA 3Q9UA 4FT4A 1WKBA 1S2LA 2NZVG 4DLVA 3IVAA 1UZAA 2FB9A 1BWSA 2BL4A 2DB3A 4FEYA 4K81B 3RFFA 3AM3A 4FOLA 2FLWA 4ROSA 1DINA 2A5GA 3HCBA 3MWDA 3N0XA 3SY8A 1ABEA 3Q9NA 8ADHA 2C5BA 4HNVA 4M1EA 1HOXA 4WH0A 5J5VA 1CJVC 2O3RA 4OP3A 1OD6A 3Q3HA 4UTRA 5AW9A 1O94A 4ER7A 4D0NA 2QRNA 1A9XB 4YRGA 1FFGA 1VG9B 1R0XA 3H9CA 4I9HA 4AJ2A 4XWOA 3LUDA 4GSLA 4KO2S 4RIHA 4I0WB 5CLJA 4ZCQA 3AM1A 3ZHXA 4CW7A 2YICA 3JU3A 2FKNA 4DSOA 1XJ5A 5E7IA 2QJTA 2XOXA 3EXIB 3GD5A 4I4CA 4MW7A 3BSWA 4LHXA 4YRQA 3CNLA 3RODA 1M8FA 4IPTA 1FFBA 5AKXA 3WK4A 5JNRA 2QENA 2WE7A 3O82A 5ALGA 1L5VA 1JE0A 2NOAA 2ZJ1A 4AL4A 5H3HA 2QXUA 3SXUA 2XUIA 2FDRA 1M83A 3U7QA 2GFQA 1YS6A 2DH6A 3HSKA 1QV9A 2NTJA 1GA4A 5KWVA 3DA8A 3SKYA 1J1UA 2C7OA 3E4CA 1V39A 1YS1X 1BEUB 1MLDA 2B5VA 4IIGA 1YZVA 4NFYA 4ZMRA 1IBMB 4L76A 1NHGA 1X9IA 2JA1A 3AUFA 1TQDA 1UXHA 4B6JA 2NZXA 4XH9B 5LZ7A 3WO1A 3I37X 2ZB4A 2BBOA 2E89A 2VJMA 2REOA 1AF4A 2GTIA 3K9NA 3L7AA 1ZM7A 4IUBS 2HHJA 2I3BA 1UFQA 4G89A 4JEHA 4X61A 1QQ5A 3TRIA 1JQ3A 5KYYB 2FDXA 1WLYA 1Z39A 2VUSA 1HDCA 2G07A 3T0FA 1RIFA 4YT8A 2CHVA 4OTZA 1XYVA 3BPSA 4LBYA 4ND3A 3V33A 5H8WA 4GWKA 4NPCA 4QGGA 2AL7A 1G16A 3ZU2A 4UEJA 3W0LB 4ESHA 1WAMA 4DCSA 2H52A 3Q0EA 5GONA 3ZCXA 3PNSA 1MQSA 3RT7A 3WB1A 1T5LA 1I80A 3T61A 4P7BA 1T1GA 5FTMA 3RIEA 3ZHCA 4L07A 1N7IA 3A4TA 1K2WA 3H19A 1MOQA 4J0DA 5AOVA 3PITA 3SC2A 3W4KA 1CXZA 3UOAB 1LUAA 1FSZA 3H9BA 4KXWA 4WINA 1J23A 2HQRA 3SICE 3SJUA 4E0BA 4K40A 3JR3A 3A7DA 2W2XA 1DG3A 3CH6A 4C14A 4YRKA 6CHYA 4E3WA 1SVKA 5KYGA 5H16A 3RC1A 4R16A 2FP4B 2AVDA 1P8JA 3CMCO 1KP3A 2JI7A 2AUTA 1Z15A 4QU9A 1ZR4A 4YMVA 4LI3X 3GPDG 5MN5A 2BKLA 1FF9A 1RR6A 4GPIB 2MYTA 4DABA 4M76B 1W4BA 1SC6A 3DBLB 1T4MA 3T9FA 3IMFA 4TN1A 2MSNA 4YRMA 3CY6A 5ILQA 4R1PA 4UHJA 4CCYB 3ROQA 3CF2A 5LKRA 2WB4A 3VJMA 4K6KA 2G6TA 5HIAA 2EBUA 2X6QA 4M0MA 1PGQA 2UYCA 2ONZA 1QPZA 4E1BA 1JG7A 3RWOA 2QZSA 3DMNA 4G56A 4CBVA 1HC7A 2YVAA 1Y1SA 4ZCRA 2YR0A 4YVFA 1OF1A 2I66A 2XKAA 3EWAA 4OYHA 3R7BA 4E5MA 2ZUFA 2IXFA 1JHYA 3B6IA 5AOBA 1TMOA 2VRNA 3OI7A 4ZODA 4IV5A 4RF4A 4YCCA 2ZULA 3IMGA 2B20A 4JQYA 2RK3A 3PYXA 3QNMA 3FGPA 5AI8A 2ISSD 5DISB 4Y2XA 2ZM6B 5J2UA 2QR3A 1QOQB 4RXUA 3DXXA 1CIPA 4V0NA 2PSSA 1DJPA 3AY7A 2CZCA 4Z3OA 4A1OA 3W78A 1V95A 1Z74A 3WGKA 2VPPA 2Z9DA 2I8CA 1OH5A 1NLMA 4IIXA 4GH5A 4XM0A 2MMCA 2WU4A 3GDHA 1BCRB 4HB2A 4UREA 2OGZA 2QPTA 3X2FA 2XMGA 1DC7A 2GJKA 3DR3A 1HO3A 3EG9A 4ZAGA 1D4AA 1GQQA 3NIGB 4DR5B 3IURA 1X1QA 3N5KA 1F0PA 1N2SA 1T1JA 4I4TF 2NNWB 3FLMA 2AQHA 1JAIA 4RH3A 3IXMA 1E2PA 2X2OA 1JQEA 4CLOA 4R1TA 4ZP1A 4E5KA 1QR2A 1V1RB 2W6JD 3JATB 1AHIA 5EWMB 2O8FB 1KAMA 3R3JA 3T7SA 5GJBA 2QA5A 4N3AA 1MN6A 3TZQA 1LI7A 1NJ2A 1ZIXA 3AF3A 5I5EA 3AFIA 3CEMA 4YP5A 2X7XA 2P9JA 1EGAA 2VWGA 3PDJA 3GLFB 3VPHA 3CW8X 3BS4A 1CUEA 3DWGA 1Z2OX 2ZLBA 4FWIB 3CX7A 3RRMA 1QFMA 1IOZA 2ZUWA 4MKXA 3SQDA 4DT1B 3TQQA 1W96A 1YBAA 1S8AA 3GRUA 5EXEA 5GVRA 5CA1A 3PT9A 4QTYA 2WJVA 1AQNA 2ONKA 2ZRGA 4EECA 1UBKS 3VMMA 3I9MA 4KW7A 4RIIA 1DCFA 1XCJA 3C41J 4UEQA 2ZUTA 1NWHA 4HWTA 2GNPA 1VCNA 3CF4A 5ESRA 4ME6A 3GVCA 2RGCA 3SS7X 4ZOLB 1IAVA 5EZQA 3H4MA 4BN5A 4F5ZA 1CS4C 3EMDA 4MYTA 1QYDA 2PH5A 2IPMA 2AOVA 4N3NA 5K8JB 1I4WA 1YRHA 3B6JA 4PM4A 4X45A 4QDJA 3ZZUA 3JQBC 4DMKA 3AEQB 4MITA 3VKGA 2IZ0A 2Z6VA 4WA7A 2PFSA 4F2PA 3WTBA 3WYCA 2YQ4A 2DLCX 4C20A 5ITZB 1KRXA 3ETEA 4A2CA 2WIGA 4B34A 2R87A 1JB9A 4DM7A 5KVCA 2IH2A 1SC9A 1TYAE 3D7MA 4EY8A 3H1FA 5T6MA 2B8JA 2EZ4A 1Q0QA 2NO1A 3IAS6 3IEUA 3K1TA 3MWKA 1EHCA 1XUOA 2A5LA 4OM8A 4OXYA 4PAOA 2V6GA 4UNSA 2HSWA 2AKAB 4A6EA 2WUFA 3FKSD 2FPUA 1NMSA 1QOPB 3DE6X 3HPQA 2C1XA 2CXSA 1TM3E 2V7WA 4JWTA 1BGXT 3BQ9A 1OU4A 3PUYA 4F71A 1TCUA 4RSRA 4TQ9A 3IR7A 3JCZA 2CSUA 2ZR8A 4DMRA 1CFJA 1TT5A 3OWXA 4FEEA 3G6WA 1LDBA 3NM5A 4BV8A 5JC1A 1C1XB 5FORA 3F6PA 3CUTA 5LXTF 2YJ6A 2ZJ2A 3MTQA 4PG7A 4QGAA 4EJ0A 2UZAA 5DI3A 1P9WA 1XVLA 3LC7O 4MW9A 3W3AH 2H63A 1JLHA 2WHYA 4BZWA 4EKYA 1WHTB 1LSUA 1JNYA 3TVTA 4ZDKA 1WXGA 3L0YA 4W82A 1XMSA 2Y4NA 1IBCA 2YS7A 3PNLA 2A67A 3OEWA 3S68A 4KBGA 4ETWA 1FOEB 1GITA 5JZBA 1K5PA 3ZHQA 1QC5B 3IUMA 3L1HA 5ALTA 3RVDA 4YAWA 1XO1A 3U19A 2FPXA 2H5JA 4TVBA 3FMIA 1XTPA 1ZISA 3CH5A 2Y71A 3FPGA 3HNPA 3KKQA 3PD7A 2XECA 1O8BA 1NQOA 2EATA 3EN0A 1X1SA 1Y7IA 3AJEA 4WRRA 2KS6A 4WJZA 3HCRA 3ZQ6A 1K97A 1WRBA 3KYCB 2JGFA 3FFBA 2PD6A 1U4SA 1SM4A 4FHZA 1I6WA 2F3QA 4BZZA 4C4RA 1N6PA 1J8DA 2V9ZA 2XYGA 2Z2IA 4RGQA 5A6SB 1BHSA 1ECFA 2CXRA 1FVXA 2P90A 2QMYA 3LC2O 4CDGA 4LYDA 5C1IA 1UBSB 2ACKA 1N7JA 2JD1A 1VXOA 5E6UA 3I61A 1D09A 4H0CA 4JJGA 3L4BC 1K89A 4QT0A 4X66B 1VIDA 1L7XA 3KU1A 5CITA 5IKPA 1M2VA 1W88A 2AOUB 2HFKA 3NT5A 3D31A 5L3SB 1TYBE 3AINA 5LQMA 2DHEA 4OM7A 3L7LA 4ND6A 3L0CA 3ZW9A 1UBOS 4IM7A 5B53A 4BMOB 3F6YA 3FUXA 5EEHA 3GMIA 2EJBA 4MW2A 5KYTA 1R8QA 1BH2A 4CUZA 4EPTA 5SICE 3ZBTA 1TZBA 3JARB 3PXEA 4MRSA 1K5GA 3C4QA 2ZUVA 3L7IA 1JQKA 1KMIY 4JLAA 1XEFA 1XKLA 4YECA 1QBGA 2BEKA 3LNTA 4J2OA 5F51A 1NRXA 2BFBB 1AJEA 1YBMA 2A0WA 1CTQA 3C8HA 1N3BA 5K6AC 5JU6A 1RWQA 2B0CA 5GQSA 5AP9A 3TK1A 4MDFA 4IDQA 4TOIA 3B9QA 1P2UA 5FQOA 1Z7YA 2ZB8A 2QN2A 4HR7A 4XXHA 3OQ6A 2XADA 3EGWA 1R0LA 4NG4A 2A92A 2JGNA 2VP6A 2EF1A 4BC1A 4P0PB 5KJ6A 3S99A 1ZJ4A 1SD1A 2C31A 3PJFA 3R41A 4CLEA 4PLTA 1R18A 2GZMA 4ZQGA 5JV5A 1D3AA 3LF1A 3D8HA 2IEYA 4ZOEA 2IFTA 2QUKA 2PVPA 3OPMA 5FKJA 3L49A 1PJ2A 4LHYA 1QUEA 4BNFA 1FBNA 4KREA 4G5GA 2ONCA 4K1XA 1R8YA 1UXKA 1FTYA 1N5DA 3MINB 4GFDA 5HSGA 1TEXA 4UBIA 3WKDA 3AESB 4KSCA 4I1PA 1J9ZA 2OXEA 2C4UA 2GM5A 2O05A 1P77A 1W36B 4GOJA 4YGYA 3IA7A 2WZBA 3INNA 1H93A 4M0EA 2LDXA 5D6OA 2ZQ5A 3UH0A 3I1IA 4JASB 1UXIA 1KOGA 1EZZA 1TJ5A 4AIRA 1T3ZA 2PZLA 3B70A 1ZH8A 1XLUA 2XQJA 4GQAA 3IVMA 1QU3A 5CDFE 2WINI 2XNDA 3F97A 4BNGA 1I0LA 3O2JA 2PGJA 2EW1A 2OG1A 1WDMA 2PH7A 3CF4G 3KKEA 4MQUA 1GRRA 1SG6A 4CT0A 4PZPA 2CHQA 3N7TA 1C5KA 4MCIA 1DPFA 3K9GA 2FMIA 4RVUA 1GSHA 4N0EA 3I2FA 3WMFA 2PG3A 1ZD9A 1E79D 3U40A 6PFKA 1CVLA 1UJ5A 1JW9B 4NCKA 3NX4A 1KZ9A 3OBBA 1ZONA 2HYIC 4UMDA 2FW6A 2RJ3A 3B7GA 3M4NA 1T5DX 5H68A 3OFNA 1E1LA 4RMIA 4C0XA 5BSGA 4AJOA 5AM2A 3AEUA 4Z4IA 1I7PA 4IO0A 1S6YA 1B6TA 2BZSA 4QTZA 2FX5A 1NJ6A 2VUHB 5AD1A 2DWQA 4OIMA 3WSWA 1R3DA 4DGSA 4ECAA 5J2UF 1T4CB 3ONWA 3EVCA 5CGZA 1WPGA 1PVOA 2C3MA 1QF7A 3IXLA 3IESA 4BKUA 2EIXA 3D0KA 4E2FA 3WBKA 4MUFA 4ZEMA 5BSFA 5HF6A 2FHPA 3N8NA 2UYYA 2VT3A 3LAWA 5H82A 5IBQA 1QRUA 1TW2A 1POWA 3PUZA 4HLNA 3M6XA 4R2IA 4EH1A 4ACAA 1VGRA 1E4VA 1BWRA 3CNQS 3RASA 1L5LA 2P0AA 1OFUA 1RXCA 1NI4B 4RZ3A 5TXGA 8MHTA 2HXGA 3L0DA 5DV9A 5EXTA 1GL7A 2X0DA 4EI9A 5LNK6 2J46A 5JFTA 3KJEA 1NW4A 2C5EA 2CJWA 3FYDA 3RLIA 1HMPA 4U7WA 1K8RA 1ODTC 2IYAA 3C7TA 4ZN6A 1P0MA 3NNNA 3P5SA 2OK8A 3QVSA 4LV5B 4EFMA 5JQGA 2V6BA 4J43A 1RWNA 4IXDA 3ZNOA 5DE3A 1HR0B 4A36A 1L7BA 3FHCB 5TMEA 4CKCA 3S4YA 4KE7A 1Z6PA 4XQCA 3RKSA 4XI9A 2FI1A 1I5OA 4DKXA 1G55A 1MNQA 3NJRA 5F9FA 4ISCA 4FU0A 4PRZA 2P1DA 1E7SA 1E3WA 5J63A 2XOKA 1T5IA 1L5KA 4F84A 3T3NA 3FI0A 1PQPA 3GJ8A 2Q3MA 3WLJA 1SEPA 4EUHA 5BN4B 4EYGA 1U1IA 2H0AA 4Z9BA 4DV6B 1KRHA 3H7IA 3V4RA 4JQOA 1Z88A 1H5QA 2CKMA 4RQTA 1BDBA 1QKIA 1R12A 1RWKA 4LE0A 3UFXA 5AUPB 3OOEA 2FUEA 1WABA 3FZEA 2AR7A 5JAUA 1U3FA 1LC3A 4KQKA 4W63A 1NJSA 2G1PA 4C7BA 2GWRA 4FX5A 4GPEA 4MV5A 5HZGA 2VRWA 4PNZA 4O1HA 1V25A 2FPGA 3MRXA 3BAZA 1UCFA 3LQQA 4OHOA 4UUQA 2ZIXB 3KUDA 4EGFA 3PFFA 4WKOA 5AW4A 2HSGA 4O2AF 1PJBA 2H3HA 5EY5B 5LZ8A 3EC7A 5HHTA 2JC3A 3ESBA 3EGDA 2EG9A 3SLRA 3NP9A 4RS4A 4V1CB 2E85A 2HA6A 4J16C 3DM5A 5ECGC 1SXJE 3S2GA 1GA1A 3ESDA 2AXPA 2ZS7A 3HEMA 2Z3WA 3AB8A 4ALKA 5LQNA 2HAEA 2AFIA 2UV8A 3ZGZA 3DPUA 1RXVA 3FLEA 1IBRA 3RUAA 1XK6A 3PNBA 5T4BA 4WNAA 3DBRB 2EOAA 3EQ7A 3OIVA 3S2FA 2ODNA 3OIGA 3ZCVA 1T1SA 2WLSA 5CB6A 4DV1B 1GR1A 3FTFA 1JQAA 2CMGA 1ZH0A 3I9V6 1XZAA 2P7HA 3WLQA 2JIZA 2P9HA 2EZ8A 2XCQA 2HCFA 4PYLA 2HU7A 2JJ2D 5BPHA 3U80A 421PA 3FSRA 3K94A 4MKRA 3G8BA 3M9LA 2YVQA 3H05A 4R9VA 1LEHA 1IL0A 2IEDA 4RU1A 2R47A 4KQIA 1NLZA 2WJAA 5AR1A 1BH6A 1SIBE 5CTJA 1XTQA 1JDUA 4IIJA 3TAUA 3B9RA 4AWBA 1JFTA 1C9JA 2X7JA 4M1QA 1Z0IA 1T3HA 2X86A 4M98A 4URFA 4E32A 2CHUA 3COWA 1Z0SA 1XQYA 4K8RB 2G72A 2I6UA 2YDYA 3LYUA 1B0AA 1EX1A 1XTKA 2D00A 3UZUA 2AV6A 5FHRA 2INGX 1NT4A 3VH1A 3PIDA 2J3KA 4E12A 2WQ6A 4R4JA 1EDZA 4XARA 4R71A 1P1RA 1WDTA 3FSEA 3DZGA 2NAPA 3KD3A 2QBYB 2DKFA 1DQYA 4OQMA 1NXQA 1YRYE 1XOIA 2BFAA 4W1PA 5CYGA 4MW1A 5KQRA 3DOUA 3K2EA 1NIJA 4QNMA 1UFKA 1W34A 3SN6A 4TRMA 1OXVA 4R2JA 3PJDA 3OT1A 1RBZA 4F4JA 3RRJA 4J16A 3GELA 4CU2A 2B5OA 3D8BA 3WWDA 1E9VA 1ULZA 3D1LA 4COKA 5LVAA 4UBKA 1W4ZA 5I7EA 4M8KA 5K3OA 4GS5A 4ENUA 1N0UA 4IGEA 2CVHA 2FW9A 1XDGA 2ROQA 4OAQA 1M74A 3GFFA 4Q4CA 1NYTA 1EK1A 1MFZA 3H1GA 3LFUA 1EINA 2Q5FA 7REQA 4ND2A 3QHPA 2Q3JA 3SMQA 2VJAA 2QRLA 1TKCA 4QEDA 3FTCA 3PF9A 1LRKA 1RKBA 4MP6A 3P4XA 2Q3DA 1EP2B 3SMVA 3B1JA 4KC0A 1T9GR 1UKEA 3LV8A 3TSAA 3KJXA 1K98A 2OILA 4BGVA 1IWOA 1P73A 2IZOA 2CNDA 3CLRC 2VK2A 1P72A 1GVHA 3Q7TA 2IC5A 4ER6A 5EJ8A 1T5SA 1RJFA 1SKUA 3D6NB 1J25A 1UMCB 1GU1A 2I2FA 4H2DA 4QG3A 1SUPA 3BCHA 1B41A 2Q9BA 1SKBA 1ZI6A 2VKTA 3BJZA 5J4LA 2JFZA 3N3AC 3K05A 4FZRA 5AQEA 3UA4A 1L4UA 4KYVA 2AA3A 1DUVG 1YHZA 2OYSA 3IUSA 4ZI7A 3R7DA 2BFEB 2ZRIA 4HPXB 2HWXA 5A5GA 1Z82A 3M1LA 1ZIYA 3NAQA 2WPDA 4RF3A 4HNAA 4EHIA 4DQUA 2ERCA 5D3QA 4BNMA 4KFTA 5CK5A 3BFKA 2YQ5A 1Q11A 3ACDA 3VFDA 4B47A 2R1TA 4XM1A 2PX6A 3V97A 2BC9A 3PQ3A 3HG7A 3ANXA 4XUCA 1JTVA 1U8CB 4PTZA 3GLQA 1KMMA 3A6ZA 5JOQA 3PA6A 3WTCA 3P0IA 4JITA 4ZEWA 5F1PA 3HDYA 1CRQA 3KAKA 4RFSB 4UDNA 5A7GA 1MOZA 1O0CA 3KT0A 1OTHA 5BQPA 2VH2A 1C30B 1EB9A 3PHHA 4M8LA 4OYRA 2Q3EA 3KCQA 1GPUA 4E3ZA 3DKIA 2ZZMA 5IMSA 2C7GA 3LMKA 4WXHA 4QYIB 3QE9Y 3BCRA 3JWJA 4FR5A 4PYQA 1FIUA 1KFCB 2OO3A 1D2AA 1F14A 1E3LA 2A3NA 4RPKA 3Q7EA 1K5HA 4FYHA 4RJIA 4C89A 4HDNB 4CV3A 4H9GA 4Z49A 3D6UA 2GXSA 2R79A 3SYRA 3U44A 1AGXA 3ONDA 1ZIPA 4ZOBA 3GUUA 5B2FA 1ZXLA 5AHRA 2QLNA 1R4AA 4FFWA 3EVZA 5K45A 1ORHA 2Z3VA 1KDTA 2CUZA 3VR4A 5CLHA 4TVSA 2RBKA 3JQDA 1GADO 5DGIA 4MW5A 1CLEA 1S1CA 5EHGA 5DM60 3I53A 2CNWA 3A4NA 1TM4E 4AY6A 2JIZD 5GP1A 5KJ1A 2O20A 4HTFB 1U0OC 3U6KA 5I47A 5BRNA 3U39A 4YMLA 2X41A 1F06A 1UFVA 2R00C 3BULA 5DDIP 5BN3B 4MS3B 1L5RA 5AKZA 3TZLA 1USUA 1SCUB 5LL6P 1TF7A 1GHTA 3JYQA 3O95A 3S5JA 4UM9D 4PHGA 1ZP6A 1T4GA 2LBPA 2AG0A 5J47A 4OJMX 1A8UA 2OWEA 1HDEA 1KXJA 1Q0PA 2ZJ8A 1RCTE 4MS1A 3VOSA 1CZNA 2C77A 1NI5A 4MUIA 5ADWA 2H7XA 5B6IA 2MOKA 4TKVA 4ZQIA 3SOPA 2NQ8A 3OQPA 1E1MA 3T94A 3OF3A 4ODIA 1NPDA 2C5GA 2PX0A 1O4VA 4F0JA 3LA8A 3UJCA 1XPRA 3UGKA 1EVKA 4UQOA 4DLKA 1CX9B 1WR8A 3TGPA 2OV2A 2IHKA 3O03A 2WNIA 4N18A 3KQNA 1G8JA 1J00A 1HBJA 1KSHA 2IU3A 1JSLA 4MTCA 1QPBA 4JDPA 4KE9A 1ZGBA 2KLHA 4RSMA 3WNCA 4R9UC 2XYPA 3X1MA 4BLOA 3CVUA 1GSAA 5B2EA 5DCUA 3H2GA 4L0MA 4UHHA 5EIFA 2EKPA 4HAWA 5EIBD 2Y3IA 4K26A 3VKFA 1R6TA 3P71T 2QJFA 3R3WA 1WOMA 4GICA 2PL9A 2VDNB 4OSPA 3TTUA 4OVKA 5FEUA 3AXTA 1B2LA 1K5DA 3KV3O 2HHCA 3BJRA 4MR9B 1ZMXA 2HDOA 2DU8A 3DFUA 5BSUA 1UFOA 2RDMA 1EFVA 3HYNA 1DI0A 2JH3A 3O0DA 1JRLA 4H6WA 4MS4A 4IIVA 1V2HE 2WJ6A 2WVHA 4L3WA 4NNPA 4FJ0A 1YQXA 4LQCA 4CF5A 2J5BA 3MS4A 1FFCA 3MERA 4XWYA 2C9OA 4DMGA 2EU8A 4FWBA 4AECA 3MIIA 4KQFA 3D7SA 5FL7A 4W8GA 1XD2B 4UOZA 3WRXA 3SBXA 3WLOA 3X44A 3TZ6A 2G40A 4B1FA 3KEGA 4A0GA 1XVIA 2P3LA 1GLGA 4N5MA 3VX4A 2ENWA 4B2LA 1RP1A 5FWNA 3WL4A 4XTRA 5E7QA 4ZT5A 3G9XA 1OVGA 4IF4A 4IOJA 4YC7A 4MJ7A 4CFYA 1XP5A 4XFJA 5KHOC 1OA1A 1Z07A 2WVGA 2H11A 4S1TA 1KAHA 1KR2A 1J6UA 1QAMA 4OJNA 1TO2E 3MQ4A 1CSEE 1Y98A 1MO3A 1F9EA 5H9VA 3Q2KA 3T5AA 1HFJA 3GNLA 3ERCA 2FVXA 4CEJB 5TB5A 4OUKX 4G0MA 3PF8A 3GIWA 1XZHA 2F43B 2ZJ6A 2GCEA 3PPIA 4JS0A 2FRXA 5ETJA 3Q9LA 2IHZA 4RORA 3RJ5A 16PKA 2E4UA 4YP6A 4AICA 3QUAA 2KLBA 2FJPA 1SU6A 3IDSA 1FJXA 3QFHA 2FPSA 4REQB 4UE3S 3IBTA 4DIFA 2FW7A 1FYXA 5LYYA 1P8AA 3NDPA 2WHRA 1ZGHA 2NO4A 3A2LA 4BATA 2PBLA 5AHXA 1YULA 3QU4A 3AFMA 3HDHA 3H6HA 1QIKA 3IDAA 3BRWD 2C3PA 3CXUA 5BQOA 3HYLA 1HQYE 2EQBA 4Q7MB 3CKLA 1HT3A 1EBBA 1S2GA 1J5XA 3FKSA 5EMNA 3BKXA 3SQOA 3QP9A 3VUEA 9GPBA 5JFGA 4UBNA 3G8YA 4JXKA 1KTIA 4IYRA 1JU4A 1YSCA 3UMJA 1U2DA 2IL1A 1HEYA 5K9ZA 3KTOA 5F3RA 4LJRA 4JT9A 1J24A 3QBEA 3PUWA 4JBXA 3U7RA 4KFSA 5JXHA 4GP7A 1RKQA 3MGGA 4U2KA 2A86A 4BU1A 4CDNA 5DWVA 3KAJA 4DR1B 3K2IA 1KQGA 2WBLC 2EJVA 1Z0AA 3KTAB 1QYVA 5JVDF 5JJLA 2G77B 2VRCD 2FE4A 3PXXA 4LFCB 3K6SA 1DQRA 2VP4A 1W76A 3R77A 4BCCA 3P2MA 2H1CA 3PQ7A 3QI2A 4JDUA 1Z13A 1NSYA 1KY5A 4N9QA 4P3NA 3G2KA 3D3QA 2O1WA 3W5UA 2OXCA 2QT0A 5KNDA 3SKXA 1RI5A 2CXXA 3AWDA 2PZJA 4OD0A 1R9GA 4DZTA 1EUZA 4URZR 4D4IA 1U3TA 3OLZA 3MHTA 1PK9A 4Y9SA 4ZVRA 5EJ2A 1DBSA 2G9UA 2ZBQA 3FIJA 4IH9A 2RGUA 3QKWA 3QWAA 1TD9A 3A9WA 1WVIA 4E22A 3A58B 3W34A 3H9EO 4HPJB 3GVHA 1RABA 4EX6A 5KU7A 1Y6QA 3OE7D 2BBWA 1O89A 3RRBA 5L45A 3EG9B 3QV1A 3C1OA 2LCIA 1R8SA 5B3JC 1OHHD 5DFAA 4MV7A 2AFIB 2XI4A 4R8VA 3ZI7A 4P2BA 4PPNA 4PZZA 4DB4A 2P2LA 5DSTA 1LF5A 1IY0A 3QLVC 2GPJA 1MVLA 4HFNA 3JQAA 1VI2A 3IT3A 2Z5GA 4YFYA 4EZEA 4UDXX 4NI5A 5JNUA 2OYCA 2DHRA 3O94A 1RI3A 4K8OA 4BQOA 4QWWA 3PNYA 4M53A 1FX0A 3RTGA 1YDEA 4HEQA 4ER5A 5I7UA 5DHAA 3OA0A 1N75A 1E6MA 2WIFA 1F8XA 2FRVA 1EVJA 3JZFA 4AG5A 4QJ3A 5JSHA 5IMBA 1TIKA 2FG5A 2H2HA 4PYMA 1V7QA 4UQLA 1ZRMA 1UPUA 2NV0A 3E4DA 4OK5A 3N53A 1P6XA 4RCYA 3RGWS 1KO8A 4FFSA 4LRXA 4PQFA 5D3MB 1N6IA 2HNKA 3OIFA 2EQ5A 1LC0A 1J21A 3P9ZA 4I3FA 1H4TA 2F8LA 2LV8A 1ECGA 4ZAXA 4CLHA 1BKYA 1H2XA 3B3JA 5ALLA 1XXHA 4EABA 2EV9A 2J7PD 3VC2A 3IELA 4UQPA 4DCNA 4F85A 2F3SA 4QFCA 5C37A 4LVCA 2GZAA 4MO9A 1RHMA 2HRRA 1AN9A 2QD4A 2WUDA 3D7NA 1AIPA 5FHQA 5LOVA 5IBRA 1ZAKA 1G3IA 1LSSA 2E82A 1UOPA 3PGA1 3QTLA 1YZUA 3ASYA 1WHSB 3AJAA 4L5YA 4MI9A 1U2EA 2EIHA 4IZIA 4LVNA 5JZOA 2IYTA 2AD5A 2PLAA 2C92A 4GEKA 3ZU4A 1JIQA 1KJ8A 3O8DA 5CB4A 2WB2A 4AU1A 3AYXB 3RU2A 3V9AA 5BV2P 4OHVA 3OM1A 3FDZB 4LRWA 2GYUA 3M6IA 4GWGA 4QXMA 1KU6A 4RCZA 5KNBA 4POAA 5DTRA 5IDYA 4OBBA 3UV7A 4RTQA 1U7UA 3IMKA 3N9IA 3S55A 1TEZA 3MZ0A 1TRHA 2VSXA 1B6GA 1ZUHA 1DEHA 4P7GA 4UD2A 2QR5A 4D74A 1CE8B 2UXCB 5TMBA 4US1R 2QDXA 2P69A 3PNQA 1ZYUA 3QPUA 5T5QA 1EXNA 1HTBA 4HMQA 4ND5A 4K9MA 3I42A 1UPFA 1WE2A 2C4WA 2I34A 3FCSB 3THWB 3CINA 1GFZA 5JASA 5F1OA 4WFJA 2WJ4A 2ZWMA 2IHJA 5KVQA 2JJYA 2JCSA 2H3EA 3QITA 1JXQA 1LJLA 1QAOA 4AJPA 1RYYA 3JS5A 3TBHA 3UVEA 5C8DA 4G1MB 3JQ9A 2KJQA 2IUSA 2PGDA 4LJAA 4XRRA 3ZX4A 1IZ0A 1FDVA 2PUHA 2BJVA 4Q18A 3BICA 3FFWA 4LWPA 3R5HA 3U4CA 4YAGA 4ZFNA 2VYQA 4MR8B 1U3GA 2RFLA 5C1PA 3FROA 2M6LA 2C2KA 3MFYA 4N5HX 1QZTA 5FI5A 3USES 4FZ5A 2RGGA 4UARA 5EQJB 5ESDA 4MYHA 4FE3A 3H1PA 4V38A 2WAMA 3T4EA 2WM9B 4U3JA 4K6CA 1YA8A 2IGTA 4D3ZA 1X1CA 5J40A 4P4TA 3TLGA 4DAOA 3GJ6A 2XR1A 4XCQA 1WBBA 1R4MA 4RSHA 1HDIA 4R1NA 2QE7A 1UJ6A 5AVZA 2XGMA 4HADA 2O3SA 4QNNA 3BMQA 1TVEA 2XQFA 5DXFA 1XRQA 1HRKA 5K3EA 2EHDA 2NW6A 3GT3A 3KR9A 3MD9A 5YASA 1F6DA 3VXKA 5AIAA 4GYJA 4DG5A 1FP4B 2PJDA 3HL4A 1MRZA 2DUJA 4HN2A 1ZJ6A 1L7RA 2X9LA 3JQGA 1UWVA 5I4IA 1BO6A 4Z4GA 1S1MA 1ZU5A 4R8RA 3E9QA 1WUKS 1QRAA 1SVUA 1LW6E 1L6IA 3H65A 3DF9A 1W5SA 4GKBA 4AURA 2IS1A 2Q62A 5SZIA 4ID3A 4TUYB 3Q72A 3GRRA 4FE7A 3U3MA 4DRXA 1N9GB 5EJEA 3V4LA 3C7AA 1N2OA 1X1BA 2IYNA 2NTNA 1LLCA 5FPTA 1T9ZA 3RRNA 1PVVA 4M22A 3BHMA 3NTRA 3ETHA 3RJ9A 2R85A 5CXQA 1JWLA 2I3AA 1SVSA 1RWBA 4V2UA 4F4HA 1YUNA 2ORED 3I5UA 3KKMA 4H7KA 4MB6A 1JEAA 1KMHB 2A0FA 1D9ZA 1DP4A 1ZD4A 5HKKD 3C85A 4M46A 3BJEA 2IYSA 1ZWKA 3NBZC 5GZ6A 4EF4A 4R98A 1THTA 2MCFA 3JATA 1ML3A 3EW9A 1Z3CA 3L1KA 4BWFB 4LDPA 3I9JA 1JVBA 2YV4A 5L53A 1PZXA 2GBFA 1KQPA 3G9QA 3SQLA 2HK6A 2VHJA 4UC0A 1HWYA 3JSXA 2XMDA 4ZVMA 5A4KA 1CJSA 1KAEA 4JYCA 5AJVB 5KTRA 2JCBA 1G8SA 2VDWA 3DPSA 3RK4A 1RI2A 3BA1A 1VJ1A 1RQ7A 1N2IA 3FRIA 3GCXA 2J48A 4L16A 4S1PA 1UC5B 2RI0A 1I1OA 4YWJA 5LB2A 4HZUB 4MI1A 4JKIA 4C07A 1B74A 3BH0A 1C41A 2EX0A 2JGRA 3NR2A 4Z99A 3E7FA 3KEQA 5AK0A 4AW9A 3CSUA 2BBTA 4ARUA 3CWQA 3MJ4A 5GADl 1H2FA 3HZZA 4LI0A 5AO9A 1F6BA 2F3RA 3IBFA 2C9ZA 1KI8A 3C1TA 4O4IB 2A9VA 1BCSA 2VN8A 2ZITA 4L8WB 4MW4A 1JKJA 5BSKA 3RFXA 4AUMA 2GUGA 2I80A 4HWKA 2RHMA 3DOOA 3ELBA 1X86B 1YCDA 4YY3B 2JLRA 3V1LA 4MWOA 1DX9A 1MB0A 1EKXA 1SKYB 2PA3A 3EXHC 4FSDA 4PXYA 3N7AA 3WB0A 3A27A 2YYAA 2ZSIA 3TD2A 4C04A 5E3HA 1K9SA 4JLKA 2RC6A 3H5LA 1I4DD 4N6GA 4XR9A 2AJDA 6NULA 4YIKA 3DMTA 2Z4RA 3H97A 3KZXA 3AC0A 3B9BA 3BZBA 3FFAA 1E0JA 2Q5LA 1NPYA 1QV6A 5JMWA 3A26A 2WWFA 3OIYA 5HJ5A 4ZCMA 1E89A 3V8MA 3CSDA 1FQJA 1XR3A 3OQJA 3NTXA 5ITSA 4FYPA 2C5FA 5IDQA 1I3LA 3PS9A 1YCGA 5HE9A 1IHOA 2AMYA 1DTWB 2P2ZA 2WMNB 3ZGYA 1JSCA 3K8ZA 4NNOA 3WNDA 4JKYA 2C04A 4WL0A 4BV3A 1W29A 3HXKA 1K68A 3PPWA 3SJ7A 4AD8A 2AS0A 3G0GA 4E5UA 4F86A 4LEIA 5CYPA 3WGIA 5E6SA 1TFUA 1R5OA 1VLJA 3EIHA 3IO5A 2O2SA 2H1LA 5A4FS 3EBLA 3B1YA 3ACBA 4AUNA 2F90A 4BMCA 1SPXA 3IQWA 3OM9A 4ANFA 1G20A 2X7HA 2YYZA 3T9EA 3UN1A 4ZJZA 1RAEA 2H4JA 1G41A 3RBAA 5IT5A 5LP6B 3BWDD 3N0TA 4KL8S 1EZ1A 2WIJA 4OQEA 4DCTA 1QC5A 2EBHX 1XDWA 5LQKA 2OCLA 4HAZA 2WZDA 3CTMA 5IBCA 3NFRA 3DHEA 1MCZA 2ODQA 3I2GA 4GQBA 1R50A 1G8AA 2NU6B 4I66A 4IEEA 3EC2A 4PY2A 3PHBE 3SC3A 2XDYA 4U2BA 3W06A 1GZVA 1MO2A 1DAKA 2YCBA 3L8GA 3RGGA 3M34A 1OYYA 4TLAA 4E2XA 3FCAA 1QSGA 2BR4A 3QGMA 2C9CA 4IQFA 2OTCA 2FPPB 4GG1A 4JI7B 5IJWA 5BVHA 3SZRA 1DKMA 1JMYA 1ADJA 1COWD 4TKLA 4OFBA 1ZLYA 1X9HA 3B5EA 1G60A 3OIDA 1TLLA 1NFFA 2BPOA 1L4BA 1UPAA 1VE9A 2ZQYA 2JK1A 4I19A 1IZYA 3F78A 2VHUA 3DAGA 4C9BA 5LM3A 4YI5A 3KXDA 2GPYA 3ROGA 3LOQA 4WZZA 4BCDA 1GGMA 3IP6A 1NA5A 2PXXA 3E9RA 3K6RA 4PO3X 5TRTA 3WIVA 3A32A 3C6KA 3UWDA 4PANA 2H31A 2Q21A 2AE2A 1A8SA 4J0FA 2BIFA 1FRFS 3CU5A 3MWGA 1ODKA 4KXVA 3AJDA 5K0FA 4MGKR 3I2IA 1OTXA 2FNAA 1I0ZA 3F5DA 4ZEXA 2XLCA 3C4VA 1TKAA 4C76A 1Z6GA 3M4ZA 1A96A 2EKBA 1KK0A 1P44A 1OZ0A 1Q7EA 3AI3A 3GRPA 2AFVA 4CWAA 3EXEA 4ETNA 5FTWA 3GRCA 5F2OA 3TL6A 1BX3A 2WIDA 1ATZA 3QFSA 3ZGXA 1E2MA 1F0YA 4X91A 5CBPB 3ZLBA 1DFHA 1ETUA 1MDBA 2JL1A 4K87A 3RC2A 4HJRA 2W2LA 4QRDA 1NVBA 4AJIA 2GZSA 4GI3A 2V0NA 3STUA 1LNQA 1DIOB 1KVTA 1V1MB 3GGCA 4QIHA 1II8B 3R6DA 3RH0A 4YLYA 2V96A 4L72A 1NOIA 1OPXA 2PL1A 3EVTA 5HQJA 2HQ1A 3ADKA 3IJRA 3T0IA 1QVZA 5C53B 3VJRA 3L0ZA 4R1UA 1AK2A 5AJZA 3R6WA 2PD4A 4LXQA 4H0NA 1VBMA 1A88A 4QDXA 2RGDA 4IDCA 3UATA 1ZRNA 2P9GA 4P08A 2ZXEA 4FDVA 1VPDA 3L7OA 4PTYA 4J3JA 5EMKA 5HXAA 4LDAA 1QDEA 2R11A 2GNAA 2VAPA 3IULA 5BWCA 4MI3A 3SX4A 4PZ9A 4M54A 2PO5A 3U6BA 1NMEA 4RFVA 1RLIA 3ZDQA 1Y7LA 4B3RB 3LHIA 5IEJA 4KACA 4QJIA 4M1MA 4QQNA 4W9NC 2N46A 4HEA6 4EM6A 3SHTA 5JDCA 2AKEA 4DA0A 3CJTA 1ZMOA 1VKZA 2O2CA 4PCUA 5FOSA 2NX2A 3WGOA 1J07A 1W0KD 5KPJA 2LR0A 1JQJC 4O25A 3K0KA 1A9SA 3KB6A 1IPEA 2QVXX 1YB1A 3B89A 3JASA 5DHUA 1GPH1 2GF0A 5TQ2B 4D3FA 2F55A 2W6QA 4MSUA 3ZH2A 5AK6A 4IWYA 3OTHA 1DEKA 4LYAA 2ZT8A 4N7MA 1QH8B 2OLEA 2DCMA 3OJ0A 3QEOA 4U9UA 1E2QA 2OHFA 4JA2A 1WCIB 3OZSA 5G0TA 5TEWA 1PP4A 1NVVR 1TVMA 1N3YA 1B76A 1V8FA 2Q4OA 2WKPA 5MHTA 1R9NA 1PNRA 3DDSA 5DHTA 2O7VA 3LWNA 3C8UA 1D1SA 4GP9A 3U62A 3DB2A 1DFGA 1PW5A 1RYZA 2GJ8A 1DWQA 2HHAA 4JWKA 4ND7A 4PNPA 4UHCA 4B83A 3JZDA 4KNWA 4P0QB 2VPWA 4YI3A 2QROA 4U2DA 1H6DA 3VH4A 3W3ZB 3HJBA 2ZDQA 2N47A 1G63A 2CLOB 3SDSA 4DTCA 2HFJA 1FDWA 1ICEA 4MAFA 3WL7A 4TX1A 1L7AA 1YV9A 2VLBA 3N0VA 3OLQA 4NBRA 4U7HA 1NY5A 4X62B 1OQAA 1ZO8A 1DC4A 1Q16A 2GEFA 3OP1A 4IG4A 4QFMA 1ESCA 2ZJFA 4Q15A 3LUBA 4H7JA 3H9GA 4G25A 4UZFA 4Y2SA 2IP2A 4AN1A 1NR7A 2HF7A 1Z5GA 1X7ZB 3NYQA 1YR9A 1Y8QA 4LNUB 5BV1A 5EJ6A 3G0HA 2D5AA 3EXG2 4P8RA 2Q0QA 4P93A 5K0CA 1TYDE 3ZG6A 2A5DA 4YRFA 3M1AA 3OZBA 5JHHB 1UQUA 3WL8A 3M6WA 3TW8B 4OAOA 2HMTA 4E4RA 3ZWCA 2EWVA 2AMLA 1IZZA 3FZYA 3Q3CA 2E4VA 4YASA 2O2EA 3F9RA 3IHKA 4A5OA 4FM9A 4Q47A 1Y1RA 3ECCA 4CODB 1RPAA 3R3VA 1GZUA 1MENA 3OFJA 1O3YA 3H1EA 5TC4A 3RYIA 4G24A 5A3JA 1SUBA 3AVUA 4TTPA 4BN0A 3TE6A 5A6VA 1F38A 2QTZA 4S2UA 1NMYA 2PGIA 4RGYA 4JZKA 2WJIA 5IFKA 5TE9A 2QIOA 3G1UA 3USCS 1XTJA 5LQAA 4RE6A 5FRDA 3OM0A 5ITZA 4PAMA 4BNIA 1QLWA 3DWEX 4IBOA 1EJBA 3CA8A 1EJ6A 4MDHA 4UUOA 3MUEA 2H4WA 4B85A 1R4MB 4KMRA 4JYMA 4G07A 5ECYA 2L82A 3KAQA 3L0SA 3HKBA 3A6EA 2DBZA 3HA5A 4RIGA 2EW8A 1BC5A 2JCXA 2WHEA 2FGKA 3ND6A 3S27A 4B4UA 1GZDA 1CZHA 2EZ9A 1ELOA 4IH4A 2M6KA 4BO4A 5BOVA 4JJZA 5H80A 2ZXFA 3I34X 3R3SA 4H7HA 3SR3A 1HZZA 4KRYA 3EGOA 2R2AA 1OLXB 3Q5GA 1N9ZA 1LBTA 2RJNA 2Y67A 3TEJA 3M3PA 3X2SA 1JHAA 4DDKA 4C4OA 4OQ4A 2V6FA 1MV5A 2BDUA 1G1AA 4P3OA 1LWNA 2GZHA 4UNRA 7ABPA 1Z8HA 2XOEA 2ILTA 3FOCA 3BIOA 2C8VA 2IRWA 1E92A 3MTEA 3F7OA 4DRXB 5JAHA 3W8NA 2NO0A 1D2NA 1OAOA 2HJ9A 3RKRA 2GAJA 3DYVA 3V3TA 2ODPA 5FADA 3X43A 3P1JA 4TZ6A 1QH1B 4OQPA 1TZCA 1XKXA 2NWQA 4IOKA 3RIXA 1ZG3A 2BEUA 1RE1A 1SXJC 3H83A 3LU1A 2YMPA 1V6CA 4DBZA 4KYIB 3ZDAA 3AKDA 3KYBA 4FCTA 4HQOA 2W98A 2G8LA 3K6KA 3BFJA 1Q0TA 1SHJA 5HDQA 1WBDA 2Q5EA 2I5PO 2IYFA 1N77A 2C98A 2R8ZA 1EZ4A 3I8XA 2Q8PA 3CZPA 2IUTA 2Y77A 2KM1A 2JANA 5DK6A 5P21A 3NNDA 1N25A 3CUKA 2JFQA 1XDZA 3EPJA 1JSRA 5TGDA 3QNWA 2W2OA 3H8VA 3AEKA 4D9FA 4LZOA 4CM1A 5EP2A 4D5EA 5ICGA 1A9QA 4RY9A 3JZIA 2BCGY 2WSSA 3BMNA 3BMCB 1QIMA 1ZUIA 5GVSA 3HBMA 4Z1OA 3SX2A 4N9WA 4XIGS 1GXSB 1J99A 2YMLA 3HYRA 5HJ7A 3O31A 1PHRA 2VUTA 3UJPA 3UF0A 1Z22A 3A36A 3NC1C 1XROA 5CB4F 3L8FA 3F8WA 3D0RA 1KF0A 3Q7QA 2NZUG 4JGBA 5ED4A 3A6DA 3CWCA 3IA2A 4UUMA 4LYEA 3BK7A 2GEJA 3RSHA 2V3WA 4G5QA 3UCFA 3WK7A 5FV7A 4CKBB 3OZFA 5BSRA 4WT7A 1YI8A 3C2QA 3ZGOA 1P2SA 1Y9EA 3UAOA 2E49A 5KJCA 5I4CA 3LUJA 1V11B 2QW0X 2OCYC 2VA8A 1NTRA 1YQGA 3IRVA 2A0KA 4YJ3F 4B3DA 4L85A 3U4QB 4JUFA 4AMGA 4UHEA 5JSQA 1XU4A 2C03A 2DT5A 3N6VA 4LTDA 4B74A 1EJ2A 1MNAA 2CWWA 4IQGA 1JIVA 1JYFA 4PSKA 4PWZA 1Y80A 5FULA 1JJIA 2MIIA 1WNTA 3ANNA 4OU5A 2ARKA 4IRMA 4LOIA 4AS2A 1U0HC 3USZA 1APBA 1JFLA 2G17A 2WC1A 2FP4A 3HBNA 3UT5A 5ILGA 4MMXB 4RTLA 4CCWA 4OSOA 3NTVA 1WOYA 5AVYA 3DE4X 5EJ5A 5ITWA 1VIAA 3L4JA 5JY1A 4CQMB 1OH7A 5U9CA 1AXGA 3FHJA 4BBJA 1L4YA 2B1GA 2C57A 1VHJA 1NJFA 4D97A 1ZLXA 4TGLA 3CZ9A 1XZIA 3E7DA 3H5NA 5EFOA 4C3UA 4AJEA 3KOZA 1G6Q1 1NSTA 4NATA 1OBOA 1G291 4IZOA 4QOHA 3BCSA 4QLAA 3DBOB 2MYUA 3W8DA 5CW2A 1SG0A 2P78A 4P2GA 1I2MA 5DNVA 1USIA 3LFTA 2BF4A 3EX7C 3AB7A 4EPXA 1PZFA 4AXBA 1Z28A 4K0KB 1VJTA 4HAYA 2AZMA 2BV3A 1YRQA 2OCBA 5CDUA 5A1JA 4KIJA 1XYYA 3UMFA 3RDPA 5FPKA 4WY8A 1WEKA 2ADMA 2CXHA 2QTFA 3CCFA 3LDAA 3OOHA 5GM1A 1W36C 1RPTA 2P11A 4HMPA 1M8JA 5CG1A 1ZRSA 3EDOA 3P9YA 2AOXA 1JJVA 4GRIA 2C2GA 3EDQA 3IT0A 1EXMA 5A9RA 5LR6A 1IB0A 3AEKB 4ZZ0A 5AVWA 4NDZA 5E2IA 1LU9A 4Y1FA 2DUUA 4FJ1A 4PS1A 5EJ4A 3RSGA 5EUCA 2H2IA 1UBFA 1JA1A 4YRPA 2AC2A 2LKCA 4OBXA 4TS1A 3UMBA 4DMCA 1V5EA 4E31A 2CBGA 2JLWA 2BGGA 3ENVA 2VCEA 2XYHA 1PYOA 2Q1UA 3AB3A 4BO3A 2H48A 3ZH9B 3LYLA 3CISA 3IEIA 2Z6QA 1AQLA 1BE6A 3GYGA 3V7WA 3D8SA 5FNVB 4ZHSA 4GDMA 1H3FA 3AF0A 1KI7A 2VRCA 4PC7A 4IDGA 3TXXA 2XJ9A 4HDKA 4MYDA 5A5FA 5JY6A 2YFKA 2QTAA 1C4XA 1TIBA 5TGTA 2HLPA 2GFIA 3VTAA 1JDSA 1SCIA 1JG6A 1EVQA 3KE8A 1EIZA 5EYPB 1IQPA 1YD7A 4DF3A 2FWMX 4E5NA 5IYZF 3RJMA 1LDGA 1EAYA 1Z7WA 3KALA 4XB1A 1GGNA 3TZBA 2J9FB 4A16A 2QX6A 1I2BA 1U5BA 4HYTA 3DE0X 4GMHA 4UEWA 4U9IS 2FDCA 4G5YA 1ZGCA 4LXUA 2F3PA 2C2WA 1TMGE 3DZFA 1XCMA 4RHEA 4RXMA 1AO0A 4H7FA 1SCKA 4H7PA 4EJSB 2O0KA 1G64A 4K6MA 4DMFA 1E9SA 1YI1A 4PSVA 2H2AA 3IH5A 1MA3A 1Y9AA 5BYKA 1DKNA 4K05A 1M2GA 3F6RA 5KTOA 1OFVA 4EUKA 2ACVA 1WCV1 2QNIA 4ZCTA 5AVRA 2OVBA 2VQDA 4E4YA 1XZBA 2G5TA 2WV7A 1KYXA 1CPYA 1FXUA 4ZYWA 2HI0A 2ZIUB 1CRWG 5IT4A 1Z26A 4PTLA 3D7RA 5E38A 3RS0A 1SH7A 5J2TB 1LBIA 4P5PA 1FFEA 1D4ZA 1IE3A 1YZKA 4GF5A 2XZTA 1SPBS 4WASA 3Q8WA 4OV6B 4WXYB 4EEKA 5EQFA 4RIEA 5IVPA 2COKA 1KK2A 1TO6A 1XDSA 1ZCFA 1XZJA 1KETA 2OGSA 3BDIA 5EEGA 3AHIA 1QX3A 3X1ZA 3OJFA 2F48A 4QOIA 4ZVLA 3I62A 2JLSA 4XJTA 3PD0A 3EE6A 3R6LA 4KGXA 4X5OA 1ECBA 1NQ5A 1NW5A 1KFKB 3TSOA 3TD6A 4EB3A 3BMOB 4RZXA 4II7A 1QG2A 4X63A 5AUQA 3GQBB 4Y6RA 1NBEA 3L7NA 4MZDA 2G09A 3OVMA 1BN7A 3MTJA 5IJZA 2R5NA 4IGAA 2GSDA 5T4HA 1K7XB 2E4WA 3LVQE 3NTLA 3O93A 4MUHA 2XH8A 4A0HA 1RMTA 1O6GA 4JGGA 4RD3A 4E94A 3GPLA 4XWAA 5G1OA 5CLFA 4IHJA 2IV7A 3H84A 1JHOA 2ZPAA 3G9TA 1NBOA 1RJ9B 2C4MA 2ADOA 4H6PA 1CUHA 5FL7D 3SOZA 1KE1A 2IT1A 1Y6FA 1JILA 4O2BB 4M9ZA 4UXHA 3RBXA 1Y6ZA 3B1VA 3OZIA 4XPZA 3TG8A 2XWBF 4LDJA 4PRLA 1QO0A 1U8TA 2B1QA 2BSAA 1E3EA 1R0BA 3LDGA 1EUDB 1H6CA 1TNDA 5IKEA 3Q7IA 3KZMA 3KWLA 3PRJA 4J0QA 4OXQA 2VZ0A 2ZVPX 1YB5A 3HRHA 3PQ2A 3FPSA 5FFNA 4R7TA 3DEKA 1ULTA 1ACJA 3STHA 3SEAA 4G0VA 4BGIA 2PVSA 1LFAA 2V3CC 1MAWA 4MWSA 4PN3A 5I51A 3KQQA 3B2QA 3K32A 4RTNA 1PT7A 5I9BA 3ZYCA 4LCBA 2PM8A 3ILYA 4QM6A 3CG0A 1ID1A 2CYBA 2ZR7A 3NOQA 2EXXA 3BIWA 3BQMB 5C34B 3M5PA 5T8KC 4KMSA 2EBWA 4UM9B 1KQFA 1U63A 4GD3Q 2REXB 5FWAA 1RWVA 4J90A 3LTEA 4DCUA 3V2UA 1Y9ZA 5AW0A 1HOTA 2Z5VA 3U7EB 2V45A 3LZDA 4MV0A 4DW8A 4A0SA 3MMXA 4NQRA 2HJRA 5EZYA 4CPDA 3H3FA 4ENRA 4YO7A 5IAAA 4ZPXA 1USGA 5I5GA 2ZU6A 1Z62A 4A2QA 2W2MA 3ZXXA 3LT5A 2FEMA 5CIQA 5BMOA 3BRSA 3AVWA 3A1SA 5KX5F 1E2LA 1U0LA 1F0NA 1VSBA 1T8WA 1H6BA 3OUZA 3HY4A 4NBWA 4ECEA 4YRBA 3BL6A 4KCGA 3N8HA 1DZ3A 4C0AC 2EDAA 4X44A 1M2WA 5LWHA 5E1BA 2PUCA 3REQB 1RHKA 4M7OA 1RHJA 4TV8B 1P3DA 3QOFA 1MFPA 2FF5A 5DLYA 1UKCA 1EWRA 2O1SA 3GNTA 3SJCA 4IIDA 1E8MA 5ICCA 3CS3A 1DBWA 2GLXA 3IQIX 3O1IC 2HMVA 4Q9DA 3GNSA 4MAAA 1CJBA 4PZLA 3TPZA 3V55A 2VIIA 3F3SA 1VMDA 3VYRB 1GV0A 2QZJA 1BRTA 4A92A 1LQTA 1NQUA 2Y93A 5DHRA 4LFBB 3CKYA 4IW3B 4FQ8A 3PDUA 3WV4A 3VPSA 1NP6A 4B5LA 1PJCA 1E5QA 3AG5A 5K0TA 2HF2A 2FSVA 4II2A 2WZQA 1XN1A 4UJ5A 4YH1A 4YP7A 4F3YA 3ZD6A 1W36D 4FSHA 3NG1A 1MX5A 1JAYA 1HEUA 1REQB 1U2GA 1OTYA 3HYTA 3NIDB 1FDUA 1SD5A 2I2AA 2VJLA 3IUJA 4FS3A 2PJZA 3BGDA 5G2OA 2FK7A 4KQXA 3CZMA 3DGEC 2E3JA 2YQZA 4MB0A 4ZC1A 1Z4PX 4Z1MA 1N2CA 3RVMA 4LYGA 3IOBA 4AG3A 5LDDC 1UP4A 3JRNA 2ZYTX 2ZRBA 3SIPA 3V1TC 1QTIA 2GTHA 2PCLA 4XWTA 5AVTA 5AI4A 3QX7A 5EIWA 5ES3A 1P9LA 4MPPA 5CVJA 3BIJA 3DD5A 1TK9A 3ZU6A 1OR8A 1VBFA 2C88A 4H7IA 4HNQA 4M87A 4EPVA 2HDNB 2GK4A 4RK6A 2WABA 3CLSD 1JQDA 1UAYA 2NO6A 4ITVA 4BMSA 1V3VA 3A9UA 2MJLA 3EAGA 2FSPA 2VWPA 2FMFA 4K9OA 2JZNA 4EKIA 4IQ4A 1MB3A 1X1EA 4Q03A 1NNSA 5CPFA 1GZ3A 4F5WA 3CLHA 3U5ZB 3FOWA 4XCXA 5BMVF 3G89A 2EKZA 4ARBA 4YRZA 4PPGA 3CURA 1RWWA 3VNUA 4PE5B 2XXAA 2EL9A 5DASA 2R8OA 3N2GB 2PU7A 1HNZB 1SIUA 2H2WA 2TSYB 3SSNA 1FFWA 3K1AB 3OQHA 4HQLA 4B3IA 1KI6B 4OP1A 3Q3VA 2WTUA 4TXJA 3WLKX 4GWLA 1VYHA 4OHFA 4ZV9A 2IELA 2GDJA 2NACA 1CRZA 2BKEA 3ZW7A 5EMLA 3ZD8A 4RAQA 5KQLA 3FMPB 1YIDA 5B1SA 3HWRA 1TXGA 4EO9A 4J76A 1CJMA 1CQIB 5FWYB 3WKCA 1VL8A 3MVEA 3NHWA 2APJA 2RH8A 4DEYA 3TQFA 5BXQC 3KNZA 5JECA 3L40A 4OI0A 1EUYA 3BGWA 5JAQA 3CGGA 4FMPA 4NFHA 3WXBA 2YIVX 1XHLA 3NV7A 5CM2Z 1GV1A 3WMEA 5LMUB 3LBFA 2A9QA 1B8UA 1IRIA 4L2IA 2C84A 4B3CA 1ZDMA 4EAAA 1XA4A 5AVXA 4ISBA 2A58A 5COAA 1JDJA 2Z83A 3PHGA 1OXUA 1U8AA 1S3FA 4KQWA 1J2EA 4TMWA 2YZKA 3ZI4A 2VJYA 3I2JA 3HEBA 3HFSA 1R4NB 3R0ZA 3DDNA 4RESA 3CQ9A 4CM4A 3I76A 3U3OA 3K70D 3E58A 2R6CA 5L7TA 2QDKA 2PUTA 4IDAA 2Z1NA 3VR5A 3GLSA 1G8FA 5IN4A 3WLAA 2YOFA 3FG9A 4WBNB 2HNBA 4RKYA 1PWYE 1N2EA 4R1OA 3JQCA 4M0KA 3KJZA 1RNLA 2VJMB 4GMXA 2ORWA 3KVNA 2C7BA 1ZAYA 1NW3A 1U6JA 4RH1A 4I50A 3KHSA 1Y1PA 1VPEA 4GVXA 4YHBA 3Q98A 5B12A 2YCLA 1AKVA 4N6NA 1C1DA 3JPYA 3GR6A 4W1SA 1NW9B 5C52B 1AB5A 4OLFA 1BCSB 2GYVA 3ILXA 3TW6A 1PU2A 1Y5RA 1Y5MA 1SRRA 4OLHA 1EFUA 2ZIEA 4M0LA 4UHKA 4X8HA 4DWWA 4NJMB 3M6UA 4LF5B 2BMEA 2QAGB 1HMYA 3HH8A 2DAPA 3NVMB 2HSZA 2J6CA 3BUSA 5DNYB 2SNIE 5KHAA 3ADBA 3OX3A 3V4PB 4MVJM 3BDAA 1PQWA 2AFRA 4M6WA 4ZYTA 5DYWA 1J2YA 2FW8A 2BFFA 4GKVA 5FUQA 3SC2B 1NG1A 4FLMA 4DM4A 1E98A 1EUCB 2IHTA 3EZNA 3VPAA 3REGA 1JIIA 4MUMA 3O1JC 4A10A 2PPLA 5K0SA 3EH2A 2DR0A 1HLGA 1NX6A 4KBYA 1M67A 1P1KA 1PYDA 4HNRA 3S1AA 3TMAA 4DIKA 3E18A 2BISA 3KL4A 4DWOA 3KBBA 4NABA 4DLLA 1M54A 2DJ5A 2RC5A 2C0PA 5B7NA 5KU1A 3CONA 4WZAA 4ZHQA 2UAGA 3LK7A 3BEOA 3QW2A 1SUWA 1L5MA 2F1IA 4DC0A 3RSZA 4R0NA 1A04A 1SZDA 4J1QA 4EKNB 2FSIA 3CZRA 1NQTA 4R6XA 1QZUA 3P9PA 3JAMA 4JXXA 3D6VA 5E3IA 3KYDB 2G0TA 2ZWOA 1GGJA 3MWEB 1LX7A 4FKBA 4OOEA 3UPTA 4OBEA 3THYB 4KDEA 1YTLA 3HCDA 2C54A 1UBUS 3VX3A 1CQJA 3LQ4A 3FGOA 4IICA 3B3FA 4ND8A 4PNHA 1HNWB 4MGIR 3KBOA 5EXSA 3A2KA 3O4HA 1I2ZA 4PSUA 3R5SA 5C18A 2FQYA 4DZRA 3TQIA 1RAFA 2X2FA 5CURA 3T9AA 5JWOA 4QXRA 1EU1A 4JC4A 2M98A 4CHTA 6AT1A 2QQEA 4QUBA 4BNKA 2O8DA 1GR0A 1EE9A 1YS7A 2ZBDA 4XWKA 1HSZA 1C8VB 1H6AA 1JBEA 1QFZA 1L7QA 1GPLA 3CGWA 3DJFA 3RBZA 3ZS8A 5HQTA 3GFQA 3A11A 2UZ1A 4HAUA 2GCGA 3DFMA 4G41A 5KCMA 4XQ0A 3RO7A 1XYGA 1U8XX 4LJ7A 4KPGA 4NFLA 4KOAA 1W59A 5AXAA 1P91A 1NKSA 2KBEA 3E3OA 3GJ3A 3LWDA 4HX9A 1C7EA 4PLZA 3SQMA 3T3OA 1E0AA 1J2RA 2W2PA 4ZRDA 5FOWA 5KI6A 4IVNA 1JDBB 1KQOA 3A1WA 4MVJH 2B99A 5L4LA 4BNLA 2Q1WA 5JC8A 2O7QA 1VSQA 2Y6UA 1SD2A 3WYGA 2IF2A 1L4FA 4U6SA 1XZLA 2EC5A 2YY6A 4EIWA 3IFSA 1ST2A 3AETA 3CM0A 4WDQA 5K8VA 5FA5A 1E2EA 1QO0D 2HPVA 3PC4A 4IJWA 4X6LA 3MILA 3WIBA 2C29D 4HN4B 3DUWA 3DO6A 2D4HA 3RUEA 4QM7A 1ZNYA 4B4DA 3E27A 1FP4A 1UK8A 1C7IA 1GNQA 2CZQA 2OLJA 2VPTA 2Z56A 4XSGA 1JG1A 1EQUA 2IYEA 2WJPA 2JGIA 4WK4B 4LK2A 4R69A 5AVSA 2H65A 4O2AA 2ZBPA 3R40A 5KNBH 4I8XA 2FPGB 2WF6A 4G3XA 1PL7A 1Q5PA 1KPHA 1ND5A 4FNAA 3AI2A 3U16A 1KZ6A 3OQBA 2I2CA 4EVIA 4D46A 5H7XA 4HRAA 2OV3A 4BGUA 3CVJA 4IOMA 2VOEA 1UJCA 1BD3A 3K92A 2YVKA 3FOAA 4HC4A 2V59A 4JMLA 3CRRA 4GI5A 3CLSC 4J1TA 2WTNA 2BM1A 3KTFA 1Z8FA 2ZB3A 3IP5A 2FUG6 3FCXA 5AKHA 1LVUA 1RXSA 4EITA 2PPVA 4DV7B 1P60A 5IK2D 3HKCB 3IOYA 1MZVA 1Z2EA 1GSIA 3ROXA 4U4AA 1IH8A 3FVTA 4KLZA 3G79A 1TPZA 3MJSA 2IU6A 3KHTA 3HU1A 1T3SA 2V5UA 4BMZA 3EQ6A 5AHOA 1QF9A 5CIYA 2I6QA 2ZI9A 3GJ4A 1JNXX 1CUCA 1VHLA 4TLMB 3AW9A 4KVZA 2RB4A 4PGMA 3RRFA 1EM8A 1BXGA 1Z25A 2EKQA 2HK8A 2HY7A 4OXKA 1KZHA 3U44B 8ABPA 4X95A 1A7KA 1P39A 4NCNA 1NF8A 2IVZA 4EHHA 2QX7A 4O4HA 5LP1A 1ODCA 5BSEA 3A1NA 1QQTA 3VSDA 3GK3A 4CR6A 4BO9A 4QRHA 2NVBA 1DKUA 1DTEA 1N2GA 2Z9CA 3B6MA 3C7KA 2UZ1B 3REOA 4BEWA 5IPFA 5T41A 1F12A 3V1NA 1W88B 1A0OA 2R1VB 1NF9A 5TY0A 1TO1E 1X39A 3RAFC 1ZGJA 5TX7A 1ZRHA 3JYLA 1JEEA 3E70C 2YJZA 1CY7A 3C3CA 2XQKA 1EK5A 4INPA 3TJRA 3UW3A 4GLFA 2QL7A 3LO5A 2WVJA 1KJ9A 4KI0A 4L8GA 5TF0A 1CCWA 1PLJA 4RVNA 1MA0A 2X0NA 2ZETA 3C5EA 2KMLA 2QYSA 3KOYA 1HT1E 4FI3C 4EHFA 2PE5A 3PCXA 1H2BA 1JZQA 4M4SA 4QREA 4X1OA 1K7SN 3VHQA 1KO7A 1QHEA 2C59A 3DXFA 5BSHA 4ZVOA 3HN7A 1EVYA 3NEPX 2XTZA 4NJEB 1ISHA 3PC6A 3I4CA 1QK4A 3OZXA 4O4LA 5BV8A 3L4KA 3EXFA 1JKIA 1DNPA 2BM0A 1U31A 2XE7A 1JAZA 4OFZA 4Q9HA 5IYZA 4X7MA 1ZK2A 1ULHA 1F60A 3OEEA 2CFTA 1F17A 3RS7A 1OH6A 1UQTA 2K5UA 2LIVA 3CX4A 1RLOA 5I3CA 1X7YA 3QG5A 3T99A 3IE0A 3KTDA 3L6RA 4GPBA 1PUXA 4HL6A 1ZMBA 3CTPA 4DV2B 2ZIAA 3CE9A 3TW8A 1C7QA 4PQRA 4TKMA 3PQ4A 4QLBA 8LDHA 1YHYA 1XPOA 1E4OA 1TEHA 2I7CA 2DULA 4TLDA 1QB8A 2X0IA 3WGZA 3DDUA 3OEYA 5DT9A 1W85B 4FGJA 4EHAA 3JYNA 3PHCA 5CHYA 1OWLA 1YZQA 2VBCA 2R6DA 4RZQA 1QH9A 2P77A 3QVGB 1DJNA 2W2NA 1HDGO 1WXQA 2ZRHA 1WCXA 4LHZA 4XVRA 3JARA 2D62A 2UVQA 3LCMA 1NQAO 3FF1A 1T8RA 3MAJA 3TZKA 4LYFA 3VZSA 4YJGA 1T4BA 3EIXA 5LJIA 2QZ4A 4IILA 5FPYA 1LTKA 1PFKA 2W8BB 4L51A 5CX1A 4DAEA 3OOWA 4LPKA 1CY0A 1SXJA 4LVOA 3SNKA 5J4VA 2XGJA 5DN9A 3GJTA 2EWWA 1XWIA 2IHNA 5FF9A 3DAYA 4HF7A 1EWQA 3FJYA 3TLZA 1NUSA 3QQPA 1V1MA 3TLEA 3QKSB 4NBSA 5FUVA 5BO5A 3OHPA 4LMAA 3ND5A 5DW3A 1M7GA 1TT7A 3Q10A 4HLDA 4OHMA 2VXOA 2PTHA 4RJJA 2VG8A 2C2ZA 2I2BA 4QUJA 3HXQA 5F2KA 5ADUS 2QZ9A 4A7PA 5SZKB 1DUSA 2Q5HA 3IKMB 4RPGA 5LA6B 4NZNA 3LQ1A 4URWR 1A76A 4EY4A 4R3UC 4B35A 3GLGB 3TLGB 1I10A 3KZCA 2J5RA 1CR4A 1U3VA 1Z83A 3PVCA 1ZJYA 3NBYC 1JZSA 4ZZIA 3W2TA 4B6RA 3LLUA 2FEWB 1KI6A 4FYIA 3TEMA 4H1UA 3U56A 3FVVA 3CPHA 4Z7JA 2WE8A 4S12A 3U9TA 2WM8A 4KDCA 3QLEA 2ZRLA 3MGCA 3DTVD 5LYJB 4JJ6A 5IJAA 2VHXA 4KOEC 2ZOSA 1X3LA 3AGQA 3Q8LA 2GKSA 1PQUA 3EWSA 4A9AA 3ZYZA 3A0UA 3O75A 4X1YA 4BFTA 4TN5A 1A1VA 4G4SP 3QXSA 3QELB 4I1IA 5ALYA 5EG5A 4EG6A 4BNHA 3PK0A 2J0EA 3MUNA 4WKPA 3JQGB 5C5EA 1M6NA 2XMQA 4JB8A 1AZSC 2OO5C 2H00A 2R8EA 4CM6A 1UT5A 4EMUA 2V74B 1RPZA 4RELA 4KN5A 3VU9B 4I6EA 1X77A 3IGFA 3JW8A 5C8YB 3EFEA 1EVLA 3C6QA 3GVXA 3GIDA 4F12A 5BRJA 3O4VA 2NU7A 2J6BA 5M7EA 1XMIA 2I54A 1E6LA 4JI2B 2PVCA 3EXFB 5IYZB 3B53X 4FSXA 1DOHA 4LDRA 3G2PA 3FNIA 4PGAA 3WRVA 1CD5A 4BVAA 4UCWA 4DZZA 1NBME 2WILA 4ZKDA 1DV2A 2IIPA 1PGNA 2G7ZA 4G8DA 2GD0A 1BMTA 1O94C 4LISA 4MYCA 2H1SA 2C83A 2ODAA 5LQCA 4JJ4A 1TW3A 3MGBA 4UPDA 4M99A 3FZQA 3MLBA 2QXYA 1FFSA 3AUKA 3WFJA 2RAPA 1CLUA 1GN9A 2JBAA 4RLQA 5BOSA 5KEIA 2YUIA 4KSBA 5IM4A 2DSTA 5C32A 4KXMA 3O8CA 2F17A 2WFZA 2QP9X 1VSVA 3C39A 3IC5A 3FMGA 1AUOA 1TAQA 1U7XA 2X76A 3BXFA 3KPVA 4XTCS 5B2ZA 3FPCA 4ZVQA 3WK8A 1XJCA 4OQYA 2XD4A 4WUVA 4JN6B 2RHBA 4JQCA 6REQB 2PSFA 2H1HA 3WLLA 3L7KA 2Y9MB 4HQRA 3KPWA 5CNKA 2WPDD 3ST7A 4B0PA 4Z7NB 5BUQA 1H5UA 3ESQA 1TE2A 4CMIA 1UBEA 4LZJA 3U3RA 4MVJF 4PZ0A 5D7NA 3SZLA 4BX3A 1A8HA 2AQ8A 4MUJA 3EVDA 3GFBA 1CUDA 3BWBA 5F1KA 3CZAA 4M89A 1N6OA 1UMCA 1T0HB 4TTVA 2OP0A 3M3DA 3S7TA 1H9BA 3ES9A 3HGTA 4HDRA 1CR0A 9ATCA 1BGWA 1G0OA 2ADFA 5LJLA 1T5OA 3MOGA 5KOHB 1YZYA 3CLKA 4IMIB 3JQ8A 5F7OA 1E7MA 4P7KA 2NGRA 3MRTA 1E63A 1PJTA 1E2GA 1IHPA 5SZHB 4W5JA 2YHSA 4EJSC 3LUPA 3UBMA 1JHQA 1OZHA 3PFHA 3BWEA 4DJFC 3BJMA 3Q7RA 3F6EX 3QUCA 2H5EA 1GN8A 2ZYRA 4NX2A 4YCAA 1UFRA 2NG1A 4YHHB 1DADA 4S0ZA 5FCDA 5KOIA 1D4OA 4MMYB 1ZOOA 5FD8A 5K03A 1DKQA 1CUUA 1K8YB 3DW1X 3LGXA 1SOAA 2IBMA 4JHXA 2H9IA 4RL4A 1SVNA 3D3KA 4OB8A 4R05A 4RZSA 1YA4A 3TH5A 3U4HA 1NW6A 2E5WA 3O8QB 5FWXA 3TLAA 2YWDA 2OK7A 3HCNA 2XZPA 5BNFA 4Q9IA 3RAGA 1KI4A 1KXZA 1PJ8A 3ZUGA 2X3FA 3S8MA 1V9CA 4KSYA 2QU7A 3R0JA 2A84A 1TT5B 2WWYA 2CHEA 5E6SB 5JD3A 3QX8A 3I2HA 1UAGA 1Z47A 2CY0A 2OKGA 2PMWB 1WZEA 2XCOA 3MCVA 4ZDWA 3M1IA 3AQ4A 5TDHA 2NU9A 3KKZA 2WF7A 5ERXA 1R5JA 3W1WA 1I3OA 4TV9A 3G2NA 4DV5B 1Z0UA 3N8KA 4L02A 4MKIA 2R7AA 1Y34E 2WU3A 4OPMA 4IMRA 2KI5A 5GAJA 1PEAA 1JVSA 3BH6A 3CNNA 3H2ZA 3OECA 4PVDA 1YDWA 2XNJA 2GBIA 1KFEB 2CXNA 4QECA 4X71A 5KDDA 4OB6A 4G5OA 4ZU3A 5CFPA 2A7XA 2W6ID 1V1RA 2PKRA 3DKRA 1LB1B 1T0UA 2HMSA 5AVKA 3QOXA 5IVKA 3NPMA 2JLVA 4NMMA 3ACCA 1SC1A 3CUVA 1MB2A 4BCBA 1MX9A 3WYDA 3ZXYA 4MVCA 5K0BA 1TKBA 2PWAA 1B4DA 3LE8A 3S5UA 3ZN2A 1TM1E 5JNVA 1A5AB 1QWOA 2QN9A 1R6VA 4U2CA 1YQUA 1UC8A 3B6EA 3UV6A 2BWJA 3NXKA 2ZS8A 1E1RD 1PBTA 3QEJA 1X0VA 2CT8A 1AXRA 3A4MA 1U1EA 3OFVA 4FGZA 3W5CA 2BY4A 4MS1B 3BWYA 2I1LA 3GNQA 3MJCA 4R1SA 5JEDA 1H4SA 4M0UA 3O91A 4JP2A 5ALHA 5EJMA 2V1UA 1RQXA 3RF6A 3M6MD 3NONA 1NLUA 5CBKA 4GOKA 2H16A 1RXEA 3E9CA 1ZNXA 2FZGA 3F7MA 4GECA 3HHPA 2VATA 1QORA 3PNVA 2P9TA 4I9UA 3UAZA 3AEQA 5GJCA 4KQHA 4DYHA 1PS9A 3RYHA 1H85A 2HN9A 5D5HA 4PC2A 2AE1A 1S7CA 1SU7A 2P5YA 5DGTA 4U3JB 2PT7A 3RYCA 4NOJA 4B46A 4GEGA 3TNLA 3FKJA 1OI7A 3EASA 4AUEA 5EIOA 5B3KA 4B3FX 1UF9A 3VV2A 2ZB2A 2XCRB 1IOVA 3EWIA 1GCUA 5E4JA 4Z1MD 1MX3A 2WJHA 4FMCF 1DCKA 4WLUA 2P2NA 5HILA 2JASA 1N34B 3UK0A 3OCXA 4Q4HA 2D0PB 1LLDA 2P9ZA 4P0TA 1JEDA 1WF3A 2BR5A 2E4ZA 3FRJA 1ACLA 1QGDA 2H0QA 5EQTA 5C31A 3TZEA 1XZ8A 2PAAA 3THOA 4BQFA 3LSTA 4KN8A 5FWXB 1XF9A 1YQDA 2FUG1 1Y42X 4RM2A 4HVTA 2F4VB 3SS9X 4D6YA 4M9RA 3FWHA 4KBFA 4EB8A 2CHGA 2YH2A 2H2GA 4WWHA 3ZJ5A 2YWBA 1SB9A 4FFBB 5ECWA 2TECE 4HGRA 3TLMA 2AFHB 2YMQA 1KYTA 1K8XB 1UKBA 2GD6A 3B48A 4Y6SA 2OYRA 3CRMA 3RS3A 1QJCA 5EGSA 3JWPA 4FHEA 2BSQA 2JRLA 3AUJB 1V8DA 2R1VA 2P0YA 2ZRMA 4UHBA 4I5DA 4ZDJA 2P1RA 3GEEA 4MKZA 5MFZA 2JCYA 3L6OO 5KTTA 4OXIA 1SXPA 3K2BA 1O6BA 5KYWB 4R9NA 3DAOA 4J9VA 2IHUA 4OP2A 4EK9A 4UFOA 4DQ0A 1EWYA 2GPBA 3CJRA 1CERA 4ILKA 1T5TA 4IMJB 2ZATA 3R76A 2BD0A 4ZDIA 3K0SA 4ZPJA 3ZZ1A 5ALDA 4KNYA 2WNHA 4Y6LA 5MGBA 1NBHA 2NADA 1M6VA 3A2MA 3LY5A 4KIGA 4QUDA 1SKQA 3SU8A 1SOWA 1UQRA 1MPXA 2VNJA 2XUAA 4G86A 5ALEA 1JR6A 2JGDA 3WGVA 2FRDA 4F46A 2GA8A 3IPYA 3B60A 4RF2A 4CL8A 5DNUA 3ZZNA 3K8OE 4AO6A 2ZJ3A 3TXAA 2G4CA 2P4EA 2GASA 2ZAYA 1Z12A 1WMSA 3KQPA 2NU8B 1WPXA 2O6HA 3L01A 1SEVA 4MKGA 3RUPA 2VTEA 3A9SA 1O54A 2UU9B 2H8KA 3FMOB 4DRZA 3DOHA 4OK6A 3PQEA 4UUBA 1AHHA 2FPLA 2VJKA 3HB9A 3GLFE 3IKVA 1ENPA 3OO0A 3GRYA 1JHRA 2VSQA 1Q7RA 1XZGA 2OL4A 4HQNA 4ZVKA 3VR5H 4CCSA 1J7JA 4B2IA 1VL1A 1E6KA 2I78A 4MUEA 3NB0A 2ZIWB 1ZGZA 4G0YA 4WZAE 3VR3D 2XUZA 2JD2A 1VG8A 4BBAA 4YYZA 4CIYA 3AW8A 1M2OA 4X20A 1M6HA 2VR1A 2XUHA 3ADPA 4E09A 4E30A 1IBSA 3O9ZA 1IWBB 2WDPA 4FGKA 1B15A 3GWGA 3DLCA 4JOCA 4KODA 2YXBA 3EJWA 5WRFA 3HQ4O 3FVRA 4F2HA 2XWQA 4RA9B 2PCJA 1Z35A 3QU9A 3T5MA 1KJIA 3GT0A 5JHGB 4AQYB 3CH7A 3PWZA 3SYLA 3A6PC 5K3FB 4XQ9A 5KREA 2B6NA 2BRUC 4O4IA 3RSLA 5J43A 1CZLA 2NV2B 1BKDR 1MAHA 1YHNA 1ZM4A 1XRJA 2YN4A 2YJ4A 3HADA 4HG2A 3V42A 4A73A 3FYTA 4NDNE 1H5NA 1XZQA 3RLFA 3TNYA 4DG8A 5JARA 2CJXA 4QBKA 1O0SA 2QTVB 3WXMA 1WJGA 4L57A 3BREA 5GONB 4UBLA 4P53A 1SUEA 4AJNA 1TK2A 2GAFA 2Q5CA 2KYRA 3OX2A 2DYKA 4TYMA 5BORA 4DIDA 3B6ZA 2JKZA 3N70A 5SZJA 1REQA 1FRZA 1PGOA 1VDZA 4PCAA 3W6NA 1Z33A 2VPQA 1V4VA 4YCJA 3P96A 3KFLA 4FN4A 3AIOA 1T6NA 1Y9DA 2HIMA 2R00A 3C0KA 3SDZA 3ZY3A 1JFRA 1T24A 5TPZD 1KIFA 4DGQA 3JQPA 4I5GA 3RU9A 4YUVA 1QP7A 4J94A 1ZD3A 1XT6A 2VKQA 1YOVA 1F8GA 1FUIA 2GLTA 3AKYA 3B6KA 3L7JA 1I51A 2ASEA 2QLJA 3DL7A 3FYUB 3Q5DA 2J4DA 3PQFA 4G26A 4HAIA 4JHLA 5ALFA 4EUEA 1I13A 1NGSA 2A4MA 4IKOA 3QU7A 4FK8A 2BKUA 3GLTA 4PG5A 1DKOA 3NGLA 3DXZA 4LSWA 2VYFA 4Y2PA 5IVIA 4OJYA 4D9GA 1HE4A 3HGQA 5H83A 5IEBA 5DP1A 2G06A 3B5IA 1VE6A 1N5KA 3O26A 5LP6C 4DA4A 1IY1A 2PXCA 4JJIA 5AKIA 3K71B 3CUWA 4ARSA 2I1QA 3UC9A 1T8UA 1YNSA 1BZYA 3DW3X 1KC1A 2X1MA 3L0OA 3FNEA 3PWSA 2QW1A 1L8XA 4WN9A 4TMTA 1N2JA 4I36A 1KORA 1EUDA 2X42A 1E69A 4RKQA 5F4ZA 4B44A 1G98A 2RGRA 3OD1A 1JH9A 4D02A 1YK1A 3NT4A 2ZJ0A 5F52A 1Y5LA 3SFZA 5KNCA 4NOLA 4AP9A 4YAIA 1BJRE 1BVHA 1SQFA 3UY4A 1T0BA 4MQ4A 4FZJA