1AHEA

Aspartate aminotransferase hexamutant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternating arginine-modulated substrate specificity in an engineered tyrosine aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aheA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aheA01
3GWPA 3BC8A 3RUYA 3A8UX 1ELUA 4OCAA 1UU0A 2VGTA 1MLYA 4UHOA 3FD0A 1RV3A 4R5ZA 1GCKA 3VP6A 2DOUA 4CVQA 5F8VA 3AV7A 3CAIA 2VMXA 5BJ4A 5HDMA 1S07A 4U1TA 3TQXA 2GQNA 2BKWA 2VIAA 1YAAA 4I8AA 5LH9A 3KE3A 1H0CA 1KKPA 3ACZA 1AJSA 4R5FA 3HVYA 1V72A 1OHYA 3FDBA 5M46A 3DZZA 3G7QA 2CJHA 3E2YA 1M0PA 3L8AA 1ECXA 1PMOA 5J8QA 2W7JA 2VGWA 2FQ6A 1AHEA 2HUUA 2O1BA 1AAWA 3BCXA 1G7XA 4TMRA 4FL0A 3AOWA 5EUDA 2VMNA 4JEVA 1EQBA 1CQ6A 4R2NA 2FN6A 4GDYA 1BJ4A 2ZY3A 2CH1A 1GDEA 2VGSA 3MAUA 4GRXA 2D7YA 1ARGA 3EUCA 4AOAA 4ZM4A 1C9CA 1MLZA 2D64A 2XBNA 1TOEA 4N0WA 1AMAA 3A9ZA 3B46A 3NYTA 4UOYA 4RAEA 4K2IA 1WYUA 4PVFA 3RBFA 5JAYA 1AX4A 2YOBA 2R5CB 3ECDA 5E3KA 3WY7A 2VIBA 3LG0A 2Q7WA 3OKSA 2W7IA 1QJ5A 1SF2A 3ELPA 2ZUKA 2ZYJA 3Q8NA 1U08A 1AAMA 1MGVA 3PAAA 4OBVA 2PB2A 2W7GA 2YRIA 4R8DA 4BMKA 3BCBA 1B9HA 2D66A 3R9AA 4A0FA 4B98A 2ORDA 1V2FA 2AY5A 2GMUA 2QMAA 1YIZA 3PDBB 1CJ0A 3PDBA 5EIGA 1O62A 1WYTA 4ZDOA 1BT4A 1C4KA 1J04A 2AATA 2O7CA 2R2NA 4HVKA 1PG8A 3ZZKA 4Q6RA 3JW9A 1BW0A 2BYLA 3MAFB 4XJPA 4IXZA 1ZODA 3KGWA 1SFFA 3B1EA 3ZRRA 1PFFA 1QISA 3E2FA 5BJ3A 3NU7A 3GJUA 3I5TA 1IX6A 1C7NA 4LNMA 1SZKA 3HDOA 2EZ2A 3UE8A 1BQDA 3FSLA 4F5GA 3K28A 4LW2A 3I4JA 1S0AA 3R4TA 3AELA 1WYVA 3ASBA 4AH3A 2FNIA 3BWNC 3FVUA 1AJSB 1LC8A 4ZDLA 4CBRA 3DU4A 1DJ9A 3FVSA 4P7YA 1SZUA 2BI1A 1OATA 4MKKA 3W1HA 1YJYA 1LKCA 4ADEA 2PB0A 1GC0A 3WGBA 3LVJA 4ATQA 3BWNA 2Z1YA 5TF5A 1M6SA 1I29A 3E6GA 4GEBA 1D7RA 1WKGA 5FT5A 4F5FA 1CQ7A 1ZC9A 3NTJA 3VK4A 1M0NA 3NYSA 4WYEA 5DB5A 2DGLA 2CINA 1AMQA 1X2AA 3K40A 1DJEA 1E5EA 1DGDA 3BB8A 4ATPA 1B9IA 3MKJA 4F4EA 4WBTA 5EUNA 4WYGA 1YIYA 2VMPA 1QITA 1QZ9A 3LV2A 1I43A 3NU8A 3AEMA 1ASFA 1XI9A 4OTLA 4ZASA 1LK9A 2AEUA 3I16A 4F5JA 1BJWA 3GZCA 1SVVA 1AKBA 1MAQA 2W7HA 2VMQA 2AEVA 1RV4A 4LNLA 4B9BA 1W7NA 2JJHA 1LC7A 5G09A 4LC3A 3QM2A 5E4ZA 5DJ9A 2EGYA 1YNUA 4W5KA 1WYTB 3PGYA 1X29A 3DR4A 1W7LA 1AY4A 3UAKA 2CJGA 3N5MA 4GE4A 1GC4A 3PJ0A 1TOGA 4BHDA 2X3LA 4OBUA 3VK3A 4ZDPA 2WK9A 5DX5A 3JTXA 2Z67A 2CTZA 3HT4A 5G2QA 4AZKA 1D7VA 1ASGA 1BJNA 1M7YA 1YJZA 2JG2A 1N8PA 2R5CA 2VGVA 1AY8A 1IAYA 1MDZA 3TFUA 4J8LA 2X8UA 1XEYA 3RBLA 1LS3A 4OYTA 5K8BA 4GE7A 1DTYA 1J32A 2V1PA 3MADA 1C7OA 1VEFA 5EUEA 3EZSA 1TARA 4JEXA 4LNJA 2TPLA 3VOMA 1ASAA 3A2BA 4HF8A 4H51A 2BI3A 5FT8A 1EJIA 4F5HA 1OHVA 4K2BA 3ZRQA 3GBXA 4E77A 3QBOA 1ASMA 3EI7A 2JGTA 1O61A 4DQ6A 1LW5A 1FG3A 3T32A 3AENB 3NUBA 2QB3A 3AENA 1IUGA 2OKKA 1AY5A 3FVXA 1G4VA 4KYOA 1IBJA 3BN1A 3CQ4A 3H7FA 3JWBA 4QGRA 3HQTA 4WP0A 2F8JA 3DXWA 4F5IA 2D5YA 4WYCA 4WYDA 4Y0IA 1B4XA 3NNKA 4TN4A 1MDXA 4E1OA 2XH1A 3JZLA 3ZZJA 4A72A 4ZLVA 2JJFA 1AKCA 1AMSA 2VMSA 2ZJGA 4XAUA 1S09A 2W7EA 3GZDC 3QI6A 2VLHA 2CFBA 4UQVA 1CZCA 4A6TA 4KXKA 2R5EA 1BJOB 1S06A 2HOXA 1IX8A 1M32A 4K2MA 3EIAA 1MDOA 4XJLA 3ASAA 2D61A 2EH6A 4J5UA 1AJRA 2YKUA 5FT4A 2E7IA 4ISYA 2WK8A 2YHKA 1BS0A 1ASBA 1VP4A 2C81A 1G4XA 2O0RA 2X5DA 1TOIA 4OMAA 4Y0DA 4XQ2A 2YRRA 4RKCA 3NX3A 1X0MA 2W8UA 4JEWA 1RVUA 2W7LA 1KL2A 1GC2A 1I41A 4MQRA 4UHMA 4GSAA 4ADBA 4EB5A 1TASA 3AATA 3JU7A 4GE9A 2NMPA 3DYDA 4AO4A 2YKVA 1M0QA 5C6UA 2ZC0A 4W1VA 1UU2A 3E2ZB 1IAXA 1O69A 4IXSA 3E2ZA 4E3QA 3UWCA 1N31A 2JISA 1IX7A 4W91A 2OGEA 4JEYA 2ZSMA 3F0HA 4Q75A 2PO3A 4ITXA 4KAMA 5G4JA 1AICA 1MAPA 4ADCA 5EIGB 2BWNA 4MQPA 4MSOA 3IHJA 2HOZA 4ADDA 2DKJA 4W8IA 4BA4A 3EIBA 1O4SA 2HOYA 4WXGA 2AY8A 1BQAA 2VMOA 3GR9A 2QLRA 2VMUA 2VMYA 3CQ6A 2BHXA 5HXXA 2X5FA 2RFVA 3EI5A 4FFCA 3VAXA 1V2DA 2W8VA 3MC6C 4JF0A 2YCTA 4EFFA 5LHAA 1EG5A 1JG8A 1JF9A 3B1CA 4A0RA 1SPAA 4RIZA 4CXQA 3W1IA 1LC5A 4RJ0A 1WYVB 3USFA 3AEJA 3EZ1A 3LVLB 3M5UA 4E3RA 5M4BA 3MBBA 1CZEA 4RM1A 3G8MA 4M2KA 2C44A 1M4NA 4BQ0A 3FFRA 2GB3A 1G7WA 3TATA 1FC4A 3FQ7A 3TCMA 4UHNA 1ORDA 1Y4IA 2GMSA 4TV7A 3FDDA 2FYFA 1JS6A 1ARIA 4LW4A 3G0TA 2AY2A 9AATA 1QIRA 3WX9A 2DKBA 2YCNA 5D5SA 2W8WA 1AKAA 3K7YA 1KMKA 4WXFA 3AEMC 2Z61A 1GC3A 4CXRA 4JEZA 2ZP7A 2VMVA 4WYAA 1I48A 5AX8A 4A0HA 4ZAHA 7AATA 4PIWA 4WYFA 2BI2A 5FT6A 4P3MA 2BIAA 1VJOA 4M2MA 5EAAA 2HORA 3FCRA 1DFOA 2DGMA 2YKXA 1WKHA 2Z9VA 4MGRA 4F5LA 3DC1A 3PPLA 5IWQA 3EI9A 4A00A 4W1XA 4WB0A 5G2PA 1AIAA 2WK7A 2CANA 3DODA 3NRAA 1B8GA 2VMZA 2W7MA 1D2FA 3RCHB 2CB1A 3E77A 1IVRA 3WCOA 3WLXA 1X28A 3NYUA 3FZ6A 3P1TA 2CJDA 2VI9A 5E5IA 1ASLA 1H1CA 2OQXA 4IW7A 3WCNA 4ZM3A 3ZRPA 1W7MA 1ARSA 1OHWA 3PIUA 3DXVA 1OXOA 3WKSA 2FM1A 3LVKA 2QB2A 3PD6B 3NUIA 4F5MA 2Z9WA 4DBCA 3QHXA 3F6TA 2Z9XA 3BWOA 4RJYA 2VLFA 3ATHA 4MKJA 1CL1A 3F9TA 1CS1A 2HUIA 1AHFA 2QBTA 1W3UA 1JS3A 1WSTA 3QPGA 3FKDA 4N0BA 1GBNA 2AY1A 4W1WA 4JE5D 4CBSA 3OP7A 2ZSLA 2BWPA 3AEJC 3DRDA 5EFSA 2EO5A 2Z20A 3BS8A 2Z9UA 1Z7DA 2HP2A 4JE5A 1ASCA 2DGKA 2BIGA 4AO9A 5EAVA 1BKGA 5HHYA 4M2JA 2E54A 1TATA 4WD2A 3MC6A 1C0NA 1SZSA 3L44A 3MEBA 4IXOA 4L0OA 4PFFA 4PFNA 1KMJA 1B5OA 5G0AA 2HZPA 4IYOA 4F5KA 4IYOB 3FQ8A 4EB7A 2BI9A 2Z1ZA 3FZ7A 3HL2A 8AATA 2G6WA 3ELEA 4IX8A 4Y0HA 2W8TA 1ASNA 3N75A 1BJOA 4O6ZA 3A9YA 4Q76A 1P3WA 3HBXA 3P6KA 1ASDA 1GD9A 2VGZA 4A6UA 1ELQA 2EPJA 1ARTA 2HUFA 2JJEA 3FQAA 4JF1A 1AHGA 1GEYA 1CQ8A 3CBFA 5M49A 1ARHA 1N2TA 2V0YA 2D65A 3BCAA 1D7SA 2EZ1A 2WKAA 2VMTA 2OATA 4A0GA 3LY1A 3FZ8A 2DR1A 1AMRA 5EQCA 2OGAA 4ZWVA 4WLJA 1UU1A 3WKRA 3E9KA 1RVYA 3ISLA 1QJ3A 3TFTA 5G4IA 2E7UA 3CQ5A 1Z3ZA 2CH2A 3B8XA 3D6KA 5F9SA 1AHYA 2BIEA 2AY9A 3HMUA 3JWAA 2ZY2A 3KGXA 3BV0A 1AHXA 3IF2A 2VGUA 3AEPA 3DR7A 3H14A 3QN6A 4XJMA 3FRKA 1FG7A 2D7ZA 4EU1A 1DGEA 4U2HA 3II0A 4A6RA 4ZWMA 1WYUB 2AY7A 3VK2A 1YOOA 3RI6A 1E5FA 2VMRA 2ZY4A 1D7UA 3PDXA 1TPLA 1AIBA 3LWSA 3GZDA 4XJOA 3A9XA 4DGTA 4ZSYA 2AY6A 3HLMA 1TOJA 3PA9A 4WB0B 2C0RA 2BI5A 4OC9A 1TOKA 3RCHA 3AEOA 4RITA 4MQQA 5D95A 3AOVA 1OXPA 2VI8A 2HP1A 2W7FA 3FFHA 2OKJA 3FTBA 2YKYA 3GSBA 1IJIA 1LW4A 4XK1A 5I92A 3RQ1A 2W7DA 3MAFA 3QGUA 3B1DA 3PD6A 4Q31A 2BWOA 2JJGA 3WZFA 4ZSWA 1W23A 1V2EA 1ASEA 2VYCA 4RLGA 1T3IA 3LVMA 4NOGA 1GEWA 5DJ1A 3GETA 3EI6A 2ZY5A 2W8JA 1YJSA 1ZOBA 3N0LA 4WLHA 4XEWA 3COGA 1DKAA 4RKDA 4WXBA 1UKJA 4IY7A 1B5PA 2CY8A 1KL1A 4OT8A 5M4DA 2D63A 2AY4A 2FNUA 4ITGA 3W1JA 4BA5A 1KKJA 3KKIA 1S08A 1C7GA 1PMMA 1GEXA 2E7JA 4AZJA 1DJUA 2GSAA 1CL2A 2CSTA 2W7KA 2R0TA 2QA3A 3EI8A 2BYJA 2C7TA 1QGNA 2VMWA 3NDNA 2YCPA 4MY5A 3WGCA 2AY3A 1M0OA 4EMYA
chains in the Genus database with same CATH superfamily
3GWPA 3BC8A 3RUYA 3A8UX 1ELUA 4OCAA 1UU0A 2FKIA 2VGTA 1MLYA 4UHOA 3FD0A 1RV3A 4R5ZA 1GCKA 3VP6A 2DOUA 4CVQA 5F8VA 3AV7A 3CAIA 2VMXA 5BJ4A 5HDMA 1S07A 4U1TA 3TQXA 2GQNA 2BKWA 2VIAA 1YAAA 4I8AA 5LH9A 3KE3A 1H0CA 1KKPA 3ACZA 1AJSA 4R5FA 3HVYA 1V72A 1OHYA 3FDBA 5M46A 3DZZA 3G7QA 2CJHA 3E2YA 1M0PA 3L8AA 1ECXA 1PMOA 5J8QA 2W7JA 2VGWA 2FQ6A 1AHEA 2HUUA 2O1BA 1AAWA 3BCXA 1G7XA 4TMRA 4FL0A 3AOWA 5EUDA 2VMNA 4JEVA 1EQBA 1CQ6A 4R2NA 2FN6A 4GDYA 1BJ4A 2ZY3A 2CH1A 1GDEA 2VGSA 3MAUA 4GRXA 2D7YA 1ARGA 3EUCA 4AOAA 4ZM4A 1KAFA 3H9XA 1C9CA 1MLZA 2D64A 2XBNA 1TOEA 4N0WA 1AMAA 3A9ZA 3B46A 3NYTA 4UOYA 4RAEA 4K2IA 1WYUA 4PVFA 3RBFA 5JAYA 1AX4A 2YOBA 2A1VA 2R5CB 3ECDA 5E3KA 3WY7A 2VIBA 3LG0A 2Q7WA 3OKSA 2W7IA 1QJ5A 1SF2A 2WB6A 3ELPA 2ZUKA 2ZYJA 2QSRA 3Q8NA 1U08A 1AAMA 1MGVA 3PAAA 4OBVA 2PB2A 2W7GA 2YRIA 4R8DA 4BMKA 3BCBA 1B9HA 2D66A 3R9AA 4A0FA 4B98A 2ORDA 1V2FA 2AY5A 2GMUA 2QMAA 1YIZA 3PDBB 1CJ0A 3PDBA 5EIGA 1O62A 1WYTA 4ZDOA 1BT4A 1C4KA 1J04A 2AATA 2O7CA 2R2NA 4HVKA 1PG8A 3ZZKA 4Q6RA 3JW9A 1BW0A 2BYLA 3MAFB 4XJPA 4IXZA 1ZODA 3KGWA 1SFFA 3B1EA 3ZRRA 1PFFA 1QISA 3E2FA 5BJ3A 3NU7A 3GJUA 3I5TA 1IX6A 1C7NA 4LNMA 1SZKA 3HDOA 2EZ2A 3UE8A 1BQDA 3FSLA 4F5GA 3K28A 4LW2A 3I4JA 1S0AA 3R4TA 3AELA 1WYVA 3ASBA 4AH3A 2FNIA 3BWNC 3FVUA 1AJSB 1LC8A 4ZDLA 4CBRA 3DU4A 1DJ9A 3FVSA 4P7YA 1SZUA 2BI1A 1OATA 4MKKA 3W1HA 1YJYA 1LKCA 4ADEA 2PB0A 1GC0A 3WGBA 3LVJA 4ATQA 3BWNA 2Z1YA 5TF5A 1M6SA 1I29A 3E6GA 4GEBA 1D7RA 1WKGA 5FT5A 4F5FA 1CQ7A 1ZC9A 3NTJA 3VK4A 1M0NA 3NYSA 4WYEA 5DB5A 2DGLA 2CINA 1AMQA 1X2AA 3K40A 1DJEA 1E5EA 1DGDA 3BB8A 4ATPA 1B9IA 3MKJA 4F4EA 4WBTA 5EUNA 4WYGA 1YIYA 2VMPA 1QITA 1QZ9A 3LV2A 1I43A 3NU8A 3AEMA 1ASFA 1XI9A 4OTLA 4ZASA 1LK9A 2AEUA 3I16A 4F5JA 1BJWA 3GZCA 1SVVA 1AKBA 1MAQA 2W7HA 2VMQA 2AEVA 1RV4A 4LNLA 4B9BA 1W7NA 3N4RA 2JJHA 1LC7A 5G09A 4LC3A 3QM2A 5E4ZA 5DJ9A 2EGYA 1YNUA 4W5KA 1WYTB 3PGYA 1X29A 3DR4A 1W7LA 1AY4A 3UAKA 2CJGA 3N5MA 4GE4A 1GC4A 3PJ0A 1TOGA 4BHDA 2X3LA 4OBUA 3VK3A 4ZDPA 2WK9A 5DX5A 3JTXA 2Z67A 2CTZA 3HT4A 5G2QA 4AZKA 1D7VA 1ASGA 1BJNA 1M7YA 1YJZA 2JG2A 1N8PA 2R5CA 2VGVA 1AY8A 1IAYA 1MDZA 3TFUA 4J8LA 2X8UA 1XEYA 3RBLA 1LS3A 4OYTA 5K8BA 4GE7A 1DTYA 1J32A 2V1PA 3MADA 1C7OA 1VEFA 5EUEA 3EZSA 1TARA 4JEXA 4LNJA 2TPLA 3VOMA 1ASAA 3A2BA 4HF8A 4H51A 2BI3A 5FT8A 1EJIA 4F5HA 1OHVA 4K2BA 3ZRQA 3GBXA 4E77A 3QBOA 1ASMA 3EI7A 2JGTA 1O61A 4DQ6A 1LW5A 1FG3A 3T32A 3AENB 3NUBA 2QB3A 3AENA 1IUGA 2OKKA 1AY5A 3FVXA 1G4VA 4KYOA 1IBJA 3BN1A 3CQ4A 3H7FA 3JWBA 4QGRA 3HQTA 4WP0A 2F8JA 3DXWA 4F5IA 2D5YA 4WYCA 4WYDA 4Y0IA 1B4XA 3NNKA 4TN4A 1MDXA 4E1OA 2XH1A 3JZLA 3ZZJA 4A72A 4ZLVA 2JJFA 1AKCA 1AMSA 2VMSA 2ZJGA 4XAUA 1S09A 2W7EA 3GZDC 3QI6A 2VLHA 2CFBA 4UQVA 1CZCA 4A6TA 2G7JA 4KXKA 2R5EA 1BJOB 1S06A 2HOXA 1IX8A 1M32A 4K2MA 3EIAA 1MDOA 4XJLA 3ASAA 2D61A 2EH6A 4J5UA 1AJRA 2YKUA 5FT4A 2E7IA 4ISYA 2WK8A 2YHKA 1BS0A 1ASBA 1VP4A 2C81A 1G4XA 2O0RA 2X5DA 1TOIA 4OMAA 4Y0DA 4XQ2A 2YRRA 2EYQA 4RKCA 3NX3A 1X0MA 2W8UA 4JEWA 1RVUA 2W7LA 1KL2A 1GC2A 1I41A 4MQRA 4UHMA 4GSAA 4ADBA 4EB5A 1TASA 3AATA 3JU7A 4GE9A 2NMPA 3DYDA 4AO4A 2YKVA 1M0QA 5C6UA 2ZC0A 4W1VA 1UU2A 3E2ZB 1IAXA 1O69A 4IXSA 3E2ZA 4E3QA 3UWCA 1N31A 2JISA 1IX7A 4W91A 2OGEA 4JEYA 2ZSMA 3F0HA 4Q75A 2PO3A 4ITXA 4KAMA 5G4JA 1AICA 1MAPA 4ADCA 5EIGB 2BWNA 4MQPA 4MSOA 3IHJA 2HOZA 4ADDA 2DKJA 4W8IA 4BA4A 3EIBA 1O4SA 2HOYA 4WXGA 3N7NA 2AY8A 1BQAA 2VMOA 3GR9A 2QLRA 2VMUA 2VMYA 3CQ6A 2BHXA 5HXXA 2X5FA 2RFVA 3EI5A 4FFCA 3VAXA 1V2DA 2W8VA 3MC6C 4JF0A 2YCTA 4EFFA 5LHAA 1EG5A 1JG8A 1JF9A 3B1CA 4A0RA 1SPAA 4RIZA 4CXQA 3W1IA 1LC5A 4RJ0A 1WYVB 3USFA 3AEJA 3EZ1A 3LVLB 3M5UA 4E3RA 5M4BA 3MBBA 1CZEA 4RM1A 3G8MA 4M2KA 2C44A 1M4NA 4BQ0A 3FFRA 2GB3A 1G7WA 3TATA 1FC4A 3FQ7A 3TCMA 4UHNA 1ORDA 1Y4IA 2GMSA 4TV7A 3FDDA 2FYFA 1JS6A 1ARIA 4LW4A 3G0TA 2AY2A 9AATA 1QIRA 3WX9A 2DKBA 2YCNA 5D5SA 2W8WA 1AKAA 3K7YA 1KMKA 4WXFA 3AEMC 2Z61A 1GC3A 4CXRA 4JEZA 2ZP7A 2VMVA 4WYAA 1I48A 5AX8A 4A0HA 4ZAHA 7AATA 4PIWA 4WYFA 2BI2A 5FT6A 4P3MA 2BIAA 1VJOA 4M2MA 5EAAA 2HORA 3FCRA 1DFOA 2DGMA 2YKXA 1WKHA 2Z9VA 4MGRA 4F5LA 3DC1A 3PPLA 5IWQA 3EI9A 4A00A 4W1XA 4WB0A 5G2PA 1AIAA 2WK7A 2CANA 3DODA 3NRAA 1B8GA 2VMZA 2W7MA 1D2FA 3RCHB 2CB1A 3E77A 1IVRA 3WCOA 3WLXA 1X28A 3NYUA 3FZ6A 3P1TA 2CJDA 2VI9A 5E5IA 1ASLA 1H1CA 2OQXA 4IW7A 3WCNA 4ZM3A 3ZRPA 1W7MA 1ARSA 1OHWA 3PIUA 3DXVA 1OXOA 3WKSA 2FM1A 3LVKA 2QB2A 3PD6B 3NUIA 4F5MA 2Z9WA 4DBCA 3QHXA 3F6TA 2Z9XA 3BWOA 4RJYA 2VLFA 3ATHA 4MKJA 1CL1A 3F9TA 1CS1A 3N4XA 2HUIA 1AHFA 2QBTA 1W3UA 1JS3A 1WSTA 3QPGA 3FKDA 4N0BA 1GBNA 2AY1A 4W1WA 4JE5D 4CBSA 3OP7A 2ZSLA 2BWPA 3AEJC 3DRDA 5EFSA 2EO5A 2Z20A 3BS8A 2Z9UA 1Z7DA 2HP2A 4JE5A 1ASCA 2DGKA 2BIGA 4AO9A 5EAVA 1BKGA 5HHYA 4M2JA 2E54A 1TATA 4WD2A 3MC6A 1C0NA 1SZSA 3L44A 3MEBA 4IXOA 4L0OA 4PFFA 4PFNA 1KMJA 1B5OA 5G0AA 2HZPA 4IYOA 4F5KA 4IYOB 3FQ8A 4EB7A 2KFPA 2BI9A 2Z1ZA 3FZ7A 3HL2A 8AATA 2G6WA 4H63Q 3ELEA 4IX8A 4Y0HA 2W8TA 1ASNA 3N75A 1BJOA 4O6ZA 3A9YA 4Q76A 1P3WA 3HBXA 3P6KA 1ASDA 1GD9A 2VGZA 4A6UA 1ELQA 2EPJA 1ARTA 2HUFA 2JJEA 3FQAA 4JF1A 1AHGA 1GEYA 1CQ8A 3CBFA 5M49A 1ARHA 1N2TA 2V0YA 2D65A 3BCAA 1D7SA 2EZ1A 2WKAA 2VMTA 2OATA 4A0GA 3LY1A 3FZ8A 2DR1A 1AMRA 5EQCA 2OGAA 4ZWVA 4WLJA 1UU1A 3N4SA 3WKRA 3E9KA 1RVYA 3ISLA 1QJ3A 3TFTA 5G4IA 2E7UA 3CQ5A 1Z3ZA 2CH2A 3B8XA 3D6KA 5F9SA 1AHYA 2BIEA 2AY9A 3HMUA 3JWAA 2ZY2A 3KGXA 3BV0A 1AHXA 3IF2A 2VGUA 3AEPA 3DR7A 3H14A 3QN6A 4XJMA 3FRKA 1FG7A 2D7ZA 4EU1A 1DGEA 4U2HA 3II0A 4A6RA 4ZWMA 1WYUB 2AY7A 3VK2A 1YOOA 3RI6A 1E5FA 2VMRA 2ZY4A 1D7UA 3PDXA 1TPLA 1AIBA 3LWSA 3GZDA 4XJOA 3A9XA 5KTBA 4DGTA 4ZSYA 2AY6A 3HLMA 1TOJA 3PA9A 4WB0B 2C0RA 2BI5A 4OC9A 1TOKA 3RCHA 3AEOA 4RITA 4MQQA 5D95A 3AOVA 1OXPA 2VI8A 2HP1A 2W7FA 3FFHA 4K05A 2OKJA 3FTBA 2YKYA 3GSBA 1IJIA 1LW4A 4XK1A 5I92A 3RQ1A 2W7DA 3MAFA 3QGUA 3B1DA 3PD6A 4Q31A 2BWOA 2JJGA 3WZFA 4ZSWA 1W23A 1V2EA 1ASEA 2VYCA 4RLGA 1T3IA 3LVMA 4NOGA 1GEWA 5DJ1A 3GETA 3EI6A 2ZY5A 2W8JA 1YJSA 1ZOBA 3N0LA 4WLHA 4XEWA 3COGA 1DKAA 4RKDA 4WXBA 1UKJA 4IY7A 1B5PA 2CY8A 1KL1A 4OT8A 5M4DA 2D63A 2AY4A 2FNUA 4ITGA 3W1JA 4BA5A 1KKJA 3KKIA 1S08A 1C7GA 1PMMA 1GEXA 2E7JA 4AZJA 1DJUA 2GSAA 1CL2A 2CSTA 2W7KA 2R0TA 2QA3A 3EI8A 2BYJA 2C7TA 1QGNA 2VMWA 3NDNA 2YCPA 4MY5A 3WGCA 2AY3A 1M0OA 4EMYA
chains in the Genus database with same CATH topology
3GWPA 3BC8A 3RUYA 3A8UX 1ELUA 4OCAA 1UU0A 2FKIA 2VGTA 1MLYA 4UHOA 3FD0A 1RV3A 4R5ZA 1GCKA 3VP6A 2DOUA 4CVQA 5F8VA 3AV7A 3CAIA 2VMXA 5BJ4A 5HDMA 1S07A 4U1TA 3TQXA 2GQNA 2BKWA 2VIAA 1YAAA 4I8AA 5LH9A 3KE3A 1H0CA 1KKPA 3ACZA 1AJSA 4R5FA 3HVYA 1V72A 1OHYA 3FDBA 5M46A 3DZZA 3G7QA 2CJHA 3E2YA 1M0PA 3L8AA 1ECXA 1PMOA 5J8QA 2W7JA 2VGWA 2FQ6A 1AHEA 2HUUA 2O1BA 1AAWA 3BCXA 1G7XA 4TMRA 4FL0A 3AOWA 5EUDA 2VMNA 4JEVA 1EQBA 1CQ6A 4R2NA 2FN6A 4GDYA 1BJ4A 2ZY3A 2CH1A 1GDEA 2VGSA 3MAUA 4GRXA 2D7YA 1ARGA 3EUCA 4AOAA 4ZM4A 3H9XA 1C9CA 1MLZA 2D64A 2XBNA 1TOEA 4N0WA 1AMAA 3A9ZA 3B46A 3NYTA 4UOYA 4RAEA 4K2IA 1WYUA 4PVFA 3RBFA 5JAYA 1AX4A 2YOBA 2A1VA 2R5CB 3ECDA 5E3KA 3WY7A 2VIBA 3LG0A 2Q7WA 3OKSA 2W7IA 1QJ5A 1SF2A 2WB6A 3ELPA 2ZUKA 2ZYJA 2QSRA 3Q8NA 1U08A 1AAMA 1MGVA 3PAAA 4OBVA 2PB2A 2W7GA 2YRIA 4R8DA 4BMKA 3BCBA 1B9HA 2D66A 3R9AA 4A0FA 4B98A 2ORDA 1V2FA 2AY5A 2GMUA 2QMAA 1YIZA 3PDBB 1CJ0A 3PDBA 5EIGA 1O62A 1WYTA 4ZDOA 1BT4A 1C4KA 1J04A 2AATA 2O7CA 2R2NA 4HVKA 1PG8A 3ZZKA 4Q6RA 3JW9A 1BW0A 2BYLA 3MAFB 4XJPA 4IXZA 1ZODA 3KGWA 1SFFA 3B1EA 3ZRRA 1PFFA 1QISA 3E2FA 5BJ3A 3NU7A 3GJUA 3I5TA 1IX6A 1C7NA 4LNMA 1SZKA 3HDOA 2EZ2A 3UE8A 1BQDA 3FSLA 4F5GA 3K28A 4LW2A 3I4JA 1S0AA 3R4TA 3AELA 1WYVA 3ASBA 4AH3A 2FNIA 3BWNC 3FVUA 1AJSB 1LC8A 4ZDLA 4CBRA 3DU4A 1DJ9A 3FVSA 4P7YA 1SZUA 2BI1A 1OATA 4MKKA 3W1HA 1YJYA 1LKCA 4ADEA 2PB0A 1GC0A 3WGBA 3LVJA 4ATQA 3BWNA 2Z1YA 5TF5A 1M6SA 1I29A 3E6GA 4GEBA 1D7RA 1WKGA 5FT5A 4F5FA 1CQ7A 1ZC9A 3NTJA 3VK4A 1M0NA 3NYSA 4WYEA 5DB5A 2DGLA 2CINA 1AMQA 1X2AA 3K40A 1DJEA 1E5EA 1DGDA 3BB8A 4ATPA 1B9IA 3MKJA 4F4EA 4WBTA 5EUNA 4WYGA 1YIYA 2VMPA 1QITA 1QZ9A 3LV2A 1I43A 3NU8A 3AEMA 1ASFA 1XI9A 4OTLA 4ZASA 1LK9A 2AEUA 3I16A 4F5JA 1BJWA 3GZCA 1SVVA 1AKBA 1MAQA 2W7HA 2VMQA 2AEVA 1RV4A 4LNLA 4B9BA 1W7NA 3N4RA 2JJHA 1LC7A 5G09A 4LC3A 3QM2A 5E4ZA 5DJ9A 2EGYA 1YNUA 4W5KA 1WYTB 3PGYA 1X29A 3DR4A 1W7LA 1AY4A 3UAKA 2CJGA 3N5MA 4GE4A 1GC4A 3PJ0A 1TOGA 4BHDA 2X3LA 4OBUA 3VK3A 4ZDPA 2WK9A 5DX5A 3JTXA 2Z67A 2CTZA 3HT4A 5G2QA 4AZKA 1D7VA 1ASGA 1BJNA 1M7YA 1YJZA 2JG2A 1N8PA 2R5CA 2VGVA 1AY8A 1IAYA 1MDZA 3TFUA 4J8LA 2X8UA 1XEYA 3RBLA 1LS3A 4OYTA 5K8BA 4GE7A 1DTYA 1J32A 2V1PA 3MADA 1C7OA 1VEFA 5EUEA 3EZSA 1TARA 4JEXA 4LNJA 2TPLA 3VOMA 1ASAA 3A2BA 4HF8A 4H51A 2BI3A 5FT8A 1EJIA 4F5HA 1OHVA 4K2BA 3ZRQA 3GBXA 4E77A 3QBOA 1ASMA 3EI7A 2JGTA 1O61A 4DQ6A 1LW5A 1FG3A 3T32A 3AENB 3NUBA 2QB3A 3AENA 1IUGA 2OKKA 1AY5A 3FVXA 1G4VA 4KYOA 1IBJA 3BN1A 3CQ4A 3H7FA 3JWBA 4QGRA 3HQTA 4WP0A 2F8JA 3DXWA 4F5IA 2D5YA 4WYCA 4WYDA 4Y0IA 1B4XA 3NNKA 4TN4A 1MDXA 4E1OA 2XH1A 3JZLA 3ZZJA 4A72A 4ZLVA 2JJFA 1AKCA 1AMSA 2VMSA 2ZJGA 4XAUA 1S09A 2W7EA 3GZDC 3QI6A 2VLHA 2CFBA 4UQVA 1CZCA 4A6TA 2G7JA 4KXKA 2R5EA 1BJOB 1S06A 2HOXA 1IX8A 1M32A 4K2MA 3EIAA 1MDOA 4XJLA 3ASAA 2D61A 2EH6A 4J5UA 1AJRA 2YKUA 5FT4A 2E7IA 4ISYA 2WK8A 2YHKA 1BS0A 1ASBA 1VP4A 2C81A 1G4XA 2O0RA 2X5DA 1TOIA 4OMAA 4Y0DA 4XQ2A 2YRRA 2EYQA 4RKCA 3NX3A 1X0MA 2W8UA 4JEWA 1RVUA 2W7LA 1KL2A 1GC2A 1I41A 4MQRA 4UHMA 4GSAA 4ADBA 4EB5A 1TASA 3AATA 3JU7A 4GE9A 2NMPA 3DYDA 4AO4A 2YKVA 1M0QA 5C6UA 2ZC0A 4W1VA 1UU2A 3E2ZB 1IAXA 1O69A 4IXSA 3E2ZA 4E3QA 3UWCA 1N31A 2JISA 1IX7A 4W91A 2OGEA 4JEYA 2ZSMA 3F0HA 4Q75A 2PO3A 4ITXA 4KAMA 5G4JA 1AICA 1MAPA 4ADCA 5EIGB 2BWNA 4MQPA 4MSOA 3IHJA 2HOZA 4ADDA 2DKJA 4W8IA 4BA4A 3EIBA 1O4SA 2HOYA 4WXGA 3N7NA 2AY8A 1BQAA 2VMOA 3GR9A 2QLRA 2VMUA 2VMYA 3CQ6A 2BHXA 5HXXA 2X5FA 2RFVA 3EI5A 4FFCA 3VAXA 1V2DA 2W8VA 3MC6C 4JF0A 2YCTA 4EFFA 5LHAA 1EG5A 1JG8A 1JF9A 3B1CA 4A0RA 1SPAA 4RIZA 4CXQA 3W1IA 1LC5A 4RJ0A 1WYVB 3USFA 3AEJA 3EZ1A 3LVLB 3M5UA 4E3RA 5M4BA 3MBBA 1CZEA 4RM1A 3G8MA 4M2KA 2C44A 1M4NA 4BQ0A 3FFRA 2GB3A 1G7WA 3TATA 1FC4A 3FQ7A 3TCMA 4UHNA 1ORDA 1Y4IA 2GMSA 4TV7A 3FDDA 2FYFA 1JS6A 1ARIA 4LW4A 3G0TA 2AY2A 9AATA 1QIRA 3WX9A 2DKBA 2YCNA 5D5SA 2W8WA 1AKAA 3K7YA 1KMKA 4WXFA 3AEMC 2Z61A 1GC3A 4CXRA 4JEZA 2ZP7A 2VMVA 4WYAA 1I48A 5AX8A 4A0HA 4ZAHA 7AATA 4PIWA 4WYFA 2BI2A 5FT6A 4P3MA 2BIAA 1VJOA 4M2MA 5EAAA 2HORA 3FCRA 1DFOA 2DGMA 2YKXA 1WKHA 2Z9VA 4MGRA 4F5LA 3DC1A 3PPLA 5IWQA 3EI9A 4A00A 4W1XA 4WB0A 5G2PA 1AIAA 2WK7A 2CANA 3DODA 3NRAA 1B8GA 2VMZA 2W7MA 1D2FA 3RCHB 2CB1A 3E77A 1IVRA 3WCOA 3WLXA 1X28A 3NYUA 3FZ6A 3P1TA 2CJDA 2VI9A 5E5IA 1ASLA 1H1CA 2OQXA 4IW7A 3WCNA 4ZM3A 3ZRPA 1W7MA 1ARSA 1OHWA 3PIUA 3DXVA 1OXOA 3WKSA 2FM1A 3LVKA 2QB2A 3PD6B 3NUIA 4F5MA 2Z9WA 4DBCA 3QHXA 3F6TA 2Z9XA 3BWOA 4RJYA 2VLFA 3ATHA 4MKJA 1CL1A 3F9TA 1CS1A 3N4XA 2HUIA 1AHFA 2QBTA 1W3UA 1JS3A 1WSTA 3QPGA 3FKDA 4N0BA 1GBNA 2AY1A 4W1WA 4JE5D 4CBSA 3OP7A 2ZSLA 2BWPA 3AEJC 3DRDA 5EFSA 2EO5A 2Z20A 3BS8A 2Z9UA 1Z7DA 2HP2A 4JE5A 1ASCA 2DGKA 2BIGA 4AO9A 5EAVA 1BKGA 5HHYA 4M2JA 2E54A 1TATA 4WD2A 3MC6A 1C0NA 1SZSA 3L44A 3MEBA 4IXOA 4L0OA 4PFFA 4PFNA 1KMJA 1B5OA 5G0AA 2HZPA 4IYOA 4F5KA 4IYOB 3FQ8A 4EB7A 2KFPA 2BI9A 2Z1ZA 3FZ7A 3HL2A 8AATA 2G6WA 4H63Q 3ELEA 4IX8A 4Y0HA 2W8TA 1ASNA 3N75A 1BJOA 4O6ZA 3A9YA 4Q76A 1P3WA 3HBXA 3P6KA 1ASDA 1GD9A 2VGZA 4A6UA 1ELQA 2EPJA 1ARTA 2HUFA 2JJEA 3FQAA 4JF1A 1AHGA 1GEYA 1CQ8A 3CBFA 5M49A 1ARHA 1N2TA 2V0YA 2D65A 3BCAA 1D7SA 2EZ1A 2WKAA 2VMTA 2OATA 4A0GA 3LY1A 3FZ8A 2DR1A 1AMRA 5EQCA 2OGAA 4ZWVA 4WLJA 1UU1A 3N4SA 3WKRA 3E9KA 1RVYA 3ISLA 1QJ3A 3TFTA 5G4IA 2E7UA 3CQ5A 1Z3ZA 2CH2A 3B8XA 3D6KA 5F9SA 1AHYA 2BIEA 2AY9A 3HMUA 3JWAA 2ZY2A 3KGXA 3BV0A 1AHXA 3IF2A 2VGUA 3AEPA 3DR7A 3H14A 3QN6A 4XJMA 3FRKA 1FG7A 2D7ZA 4EU1A 1DGEA 4U2HA 3II0A 4A6RA 4ZWMA 1WYUB 2AY7A 3VK2A 1YOOA 3RI6A 1E5FA 2VMRA 2ZY4A 1D7UA 3PDXA 1TPLA 1AIBA 3LWSA 3GZDA 4XJOA 3A9XA 5KTBA 4DGTA 4ZSYA 2AY6A 3HLMA 1TOJA 3PA9A 4WB0B 2C0RA 2BI5A 4OC9A 1TOKA 3RCHA 3AEOA 4RITA 4MQQA 5D95A 3AOVA 1OXPA 2VI8A 2HP1A 2W7FA 3FFHA 4K05A 2OKJA 3FTBA 2YKYA 3GSBA 1IJIA 1LW4A 4XK1A 5I92A 3RQ1A 2W7DA 3MAFA 3QGUA 3B1DA 3PD6A 4Q31A 2BWOA 2JJGA 3WZFA 4ZSWA 1W23A 1V2EA 1ASEA 2VYCA 4RLGA 1T3IA 3LVMA 4NOGA 1GEWA 5DJ1A 3GETA 3EI6A 2ZY5A 2W8JA 1YJSA 1ZOBA 3N0LA 4WLHA 4XEWA 3COGA 1DKAA 4RKDA 4WXBA 1UKJA 4IY7A 1B5PA 2CY8A 1KL1A 4OT8A 5M4DA 2D63A 2AY4A 2FNUA 4ITGA 3W1JA 4BA5A 1KKJA 3KKIA 1S08A 1C7GA 1PMMA 1GEXA 2E7JA 4AZJA 1DJUA 2GSAA 1CL2A 2CSTA 2W7KA 2R0TA 2QA3A 3EI8A 2BYJA 2C7TA 1QGNA 2VMWA 3NDNA 2YCPA 4MY5A 3WGCA 2AY3A 1M0OA 4EMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWP A;  3BC8 A;  3RUY A;  3A8U X;  1ELU A;  4OCA A;  1UU0 A;  2VGT A;  1MLY A;  4UHO A;  3FD0 A;  1RV3 A;  4R5Z A;  1GCK A;  3VP6 A;  2DOU A;  4CVQ A;  5F8V A;  3AV7 A;  3CAI A;  2VMX A;  5BJ4 A;  5HDM A;  1S07 A;  4U1T A;  3TQX A;  2GQN A;  2BKW A;  2VIA A;  1YAA A;  4I8A A;  5LH9 A;  3KE3 A;  1H0C A;  1KKP A;  3ACZ A;  1AJS A;  4R5F A;  3HVY A;  1V72 A;  1OHY A;  3FDB A;  5M46 A;  3DZZ A;  3G7Q A;  2CJH A;  3E2Y A;  1M0P A;  3L8A A;  1ECX A;  1PMO A;  5J8Q A;  2W7J A;  2VGW A;  2FQ6 A;  1AHE A;  2HUU A;  2O1B A;  1AAW A;  3BCX A;  1G7X A;  4TMR A;  4FL0 A;  3AOW A;  5EUD A;  2VMN A;  4JEV A;  1EQB A;  1CQ6 A;  4R2N A;  2FN6 A;  4GDY A;  1BJ4 A;  2ZY3 A;  2CH1 A;  1GDE A;  2VGS A;  3MAU A;  4GRX A;  2D7Y A;  1ARG A;  3EUC A;  4AOA A;  4ZM4 A;  1C9C A;  1MLZ A;  2D64 A;  2XBN A;  1TOE A;  4N0W A;  1AMA A;  3A9Z A;  3B46 A;  3NYT A;  4UOY A;  4RAE A;  4K2I A;  1WYU A;  4PVF A;  3RBF A;  5JAY A;  1AX4 A;  2YOB A;  2R5C B;  3ECD A;  5E3K A;  3WY7 A;  2VIB A;  3LG0 A;  2Q7W A;  3OKS A;  2W7I A;  1QJ5 A;  1SF2 A;  3ELP A;  2ZUK A;  2ZYJ A;  3Q8N A;  1U08 A;  1AAM A;  1MGV A;  3PAA A;  4OBV A;  2PB2 A;  2W7G A;  2YRI A;  4R8D A;  4BMK A;  3BCB A;  1B9H A;  2D66 A;  3R9A A;  4A0F A;  4B98 A;  2ORD A;  1V2F A;  2AY5 A;  2GMU A;  2QMA A;  1YIZ A;  3PDB B;  1CJ0 A;  3PDB A;  5EIG A;  1O62 A;  1WYT A;  4ZDO A;  1BT4 A;  1C4K A;  1J04 A;  2AAT A;  2O7C A;  2R2N A;  4HVK A;  1PG8 A;  3ZZK A;  4Q6R A;  3JW9 A;  1BW0 A;  2BYL A;  3MAF B;  4XJP A;  4IXZ A;  1ZOD A;  3KGW A;  1SFF A;  3B1E A;  3ZRR A;  1PFF A;  1QIS A;  3E2F A;  5BJ3 A;  3NU7 A;  3GJU A;  3I5T A;  1IX6 A;  1C7N A;  4LNM A;  1SZK A;  3HDO A;  2EZ2 A;  3UE8 A;  1BQD A;  3FSL A;  4F5G A;  3K28 A;  4LW2 A;  3I4J A;  1S0A A;  3R4T A;  3AEL A;  1WYV A;  3ASB A;  4AH3 A;  2FNI A;  3BWN C;  3FVU A;  1AJS B;  1LC8 A;  4ZDL A;  4CBR A;  3DU4 A;  1DJ9 A;  3FVS A;  4P7Y A;  1SZU A;  2BI1 A;  1OAT A;  4MKK A;  3W1H A;  1YJY A;  1LKC A;  4ADE A;  2PB0 A;  1GC0 A;  3WGB A;  3LVJ A;  4ATQ A;  3BWN A;  2Z1Y A;  5TF5 A;  1M6S A;  1I29 A;  3E6G A;  4GEB A;  1D7R A;  1WKG A;  5FT5 A;  4F5F A;  1CQ7 A;  1ZC9 A;  3NTJ A;  3VK4 A;  1M0N A;  3NYS A;  4WYE A;  5DB5 A;  2DGL A;  2CIN A;  1AMQ A;  1X2A A;  3K40 A;  1DJE A;  1E5E A;  1DGD A;  3BB8 A;  4ATP A;  1B9I A;  3MKJ A;  4F4E A;  4WBT A;  5EUN A;  4WYG A;  1YIY A;  2VMP A;  1QIT A;  1QZ9 A;  3LV2 A;  1I43 A;  3NU8 A;  3AEM A;  1ASF A;  1XI9 A;  4OTL A;  4ZAS A;  1LK9 A;  2AEU A;  3I16 A;  4F5J A;  1BJW A;  3GZC A;  1SVV A;  1AKB A;  1MAQ A;  2W7H A;  2VMQ A;  2AEV A;  1RV4 A;  4LNL A;  4B9B A;  1W7N A;  2JJH A;  1LC7 A;  5G09 A;  4LC3 A;  3QM2 A;  5E4Z A;  5DJ9 A;  2EGY A;  1YNU A;  4W5K A;  1WYT B;  3PGY A;  1X29 A;  3DR4 A;  1W7L A;  1AY4 A;  3UAK A;  2CJG A;  3N5M A;  4GE4 A;  1GC4 A;  3PJ0 A;  1TOG A;  4BHD A;  2X3L A;  4OBU A;  3VK3 A;  4ZDP A;  2WK9 A;  5DX5 A;  3JTX A;  2Z67 A;  2CTZ A;  3HT4 A;  5G2Q A;  4AZK A;  1D7V A;  1ASG A;  1BJN A;  1M7Y A;  1YJZ A;  2JG2 A;  1N8P A;  2R5C A;  2VGV A;  1AY8 A;  1IAY A;  1MDZ A;  3TFU A;  4J8L A;  2X8U A;  1XEY A;  3RBL A;  1LS3 A;  4OYT A;  5K8B A;  4GE7 A;  1DTY A;  1J32 A;  2V1P A;  3MAD A;  1C7O A;  1VEF A;  5EUE A;  3EZS A;  1TAR A;  4JEX A;  4LNJ A;  2TPL A;  3VOM A;  1ASA A;  3A2B A;  4HF8 A;  4H51 A;  2BI3 A;  5FT8 A;  1EJI A;  4F5H A;  1OHV A;  4K2B A;  3ZRQ A;  3GBX A;  4E77 A;  3QBO A;  1ASM A;  3EI7 A;  2JGT A;  1O61 A;  4DQ6 A;  1LW5 A;  1FG3 A;  3T32 A;  3AEN B;  3NUB A;  2QB3 A;  3AEN A;  1IUG A;  2OKK A;  1AY5 A;  3FVX A;  1G4V A;  4KYO A;  1IBJ A;  3BN1 A;  3CQ4 A;  3H7F A;  3JWB A;  4QGR A;  3HQT A;  4WP0 A;  2F8J A;  3DXW A;  4F5I A;  2D5Y A;  4WYC A;  4WYD A;  4Y0I A;  1B4X A;  3NNK A;  4TN4 A;  1MDX A;  4E1O A;  2XH1 A;  3JZL A;  3ZZJ A;  4A72 A;  4ZLV A;  2JJF A;  1AKC A;  1AMS A;  2VMS A;  2ZJG A;  4XAU A;  1S09 A;  2W7E A;  3GZD C;  3QI6 A;  2VLH A;  2CFB A;  4UQV A;  1CZC A;  4A6T A;  4KXK A;  2R5E A;  1BJO B;  1S06 A;  2HOX A;  1IX8 A;  1M32 A;  4K2M A;  3EIA A;  1MDO A;  4XJL A;  3ASA A;  2D61 A;  2EH6 A;  4J5U A;  1AJR A;  2YKU A;  5FT4 A;  2E7I A;  4ISY A;  2WK8 A;  2YHK A;  1BS0 A;  1ASB A;  1VP4 A;  2C81 A;  1G4X A;  2O0R A;  2X5D A;  1TOI A;  4OMA A;  4Y0D A;  4XQ2 A;  2YRR A;  4RKC A;  3NX3 A;  1X0M A;  2W8U A;  4JEW A;  1RVU A;  2W7L A;  1KL2 A;  1GC2 A;  1I41 A;  4MQR A;  4UHM A;  4GSA A;  4ADB A;  4EB5 A;  1TAS A;  3AAT A;  3JU7 A;  4GE9 A;  2NMP A;  3DYD A;  4AO4 A;  2YKV A;  1M0Q A;  5C6U A;  2ZC0 A;  4W1V A;  1UU2 A;  3E2Z B;  1IAX A;  1O69 A;  4IXS A;  3E2Z A;  4E3Q A;  3UWC A;  1N31 A;  2JIS A;  1IX7 A;  4W91 A;  2OGE A;  4JEY A;  2ZSM A;  3F0H A;  4Q75 A;  2PO3 A;  4ITX A;  4KAM A;  5G4J A;  1AIC A;  1MAP A;  4ADC A;  5EIG B;  2BWN A;  4MQP A;  4MSO A;  3IHJ A;  2HOZ A;  4ADD A;  2DKJ A;  4W8I A;  4BA4 A;  3EIB A;  1O4S A;  2HOY A;  4WXG A;  2AY8 A;  1BQA A;  2VMO A;  3GR9 A;  2QLR A;  2VMU A;  2VMY A;  3CQ6 A;  2BHX A;  5HXX A;  2X5F A;  2RFV A;  3EI5 A;  4FFC A;  3VAX A;  1V2D A;  2W8V A;  3MC6 C;  4JF0 A;  2YCT A;  4EFF A;  5LHA A;  1EG5 A;  1JG8 A;  1JF9 A;  3B1C A;  4A0R A;  1SPA A;  4RIZ A;  4CXQ A;  3W1I A;  1LC5 A;  4RJ0 A;  1WYV B;  3USF A;  3AEJ A;  3EZ1 A;  3LVL B;  3M5U A;  4E3R A;  5M4B A;  3MBB A;  1CZE A;  4RM1 A;  3G8M A;  4M2K A;  2C44 A;  1M4N A;  4BQ0 A;  3FFR A;  2GB3 A;  1G7W A;  3TAT A;  1FC4 A;  3FQ7 A;  3TCM A;  4UHN A;  1ORD A;  1Y4I A;  2GMS A;  4TV7 A;  3FDD A;  2FYF A;  1JS6 A;  1ARI A;  4LW4 A;  3G0T A;  2AY2 A;  9AAT A;  1QIR A;  3WX9 A;  2DKB A;  2YCN A;  5D5S A;  2W8W A;  1AKA A;  3K7Y A;  1KMK A;  4WXF A;  3AEM C;  2Z61 A;  1GC3 A;  4CXR A;  4JEZ A;  2ZP7 A;  2VMV A;  4WYA A;  1I48 A;  5AX8 A;  4A0H A;  4ZAH A;  7AAT A;  4PIW A;  4WYF A;  2BI2 A;  5FT6 A;  4P3M A;  2BIA A;  1VJO A;  4M2M A;  5EAA A;  2HOR A;  3FCR A;  1DFO A;  2DGM A;  2YKX A;  1WKH A;  2Z9V A;  4MGR A;  4F5L A;  3DC1 A;  3PPL A;  5IWQ A;  3EI9 A;  4A00 A;  4W1X A;  4WB0 A;  5G2P A;  1AIA A;  2WK7 A;  2CAN A;  3DOD A;  3NRA A;  1B8G A;  2VMZ A;  2W7M A;  1D2F A;  3RCH B;  2CB1 A;  3E77 A;  1IVR A;  3WCO A;  3WLX A;  1X28 A;  3NYU A;  3FZ6 A;  3P1T A;  2CJD A;  2VI9 A;  5E5I A;  1ASL A;  1H1C A;  2OQX A;  4IW7 A;  3WCN A;  4ZM3 A;  3ZRP A;  1W7M A;  1ARS A;  1OHW A;  3PIU A;  3DXV A;  1OXO A;  3WKS A;  2FM1 A;  3LVK A;  2QB2 A;  3PD6 B;  3NUI A;  4F5M A;  2Z9W A;  4DBC A;  3QHX A;  3F6T A;  2Z9X A;  3BWO A;  4RJY A;  2VLF A;  3ATH A;  4MKJ A;  1CL1 A;  3F9T A;  1CS1 A;  2HUI A;  1AHF A;  2QBT A;  1W3U A;  1JS3 A;  1WST A;  3QPG A;  3FKD A;  4N0B A;  1GBN A;  2AY1 A;  4W1W A;  4JE5 D;  4CBS A;  3OP7 A;  2ZSL A;  2BWP A;  3AEJ C;  3DRD A;  5EFS A;  2EO5 A;  2Z20 A;  3BS8 A;  2Z9U A;  1Z7D A;  2HP2 A;  4JE5 A;  1ASC A;  2DGK A;  2BIG A;  4AO9 A;  5EAV A;  1BKG A;  5HHY A;  4M2J A;  2E54 A;  1TAT A;  4WD2 A;  3MC6 A;  1C0N A;  1SZS A;  3L44 A;  3MEB A;  4IXO A;  4L0O A;  4PFF A;  4PFN A;  1KMJ A;  1B5O A;  5G0A A;  2HZP A;  4IYO A;  4F5K A;  4IYO B;  3FQ8 A;  4EB7 A;  2BI9 A;  2Z1Z A;  3FZ7 A;  3HL2 A;  8AAT A;  2G6W A;  3ELE A;  4IX8 A;  4Y0H A;  2W8T A;  1ASN A;  3N75 A;  1BJO A;  4O6Z A;  3A9Y A;  4Q76 A;  1P3W A;  3HBX A;  3P6K A;  1ASD A;  1GD9 A;  2VGZ A;  4A6U A;  1ELQ A;  2EPJ A;  1ART A;  2HUF A;  2JJE A;  3FQA A;  4JF1 A;  1AHG A;  1GEY A;  1CQ8 A;  3CBF A;  5M49 A;  1ARH A;  1N2T A;  2V0Y A;  2D65 A;  3BCA A;  1D7S A;  2EZ1 A;  2WKA A;  2VMT A;  2OAT A;  4A0G A;  3LY1 A;  3FZ8 A;  2DR1 A;  1AMR A;  5EQC A;  2OGA A;  4ZWV A;  4WLJ A;  1UU1 A;  3WKR A;  3E9K A;  1RVY A;  3ISL A;  1QJ3 A;  3TFT A;  5G4I A;  2E7U A;  3CQ5 A;  1Z3Z A;  2CH2 A;  3B8X A;  3D6K A;  5F9S A;  1AHY A;  2BIE A;  2AY9 A;  3HMU A;  3JWA A;  2ZY2 A;  3KGX A;  3BV0 A;  1AHX A;  3IF2 A;  2VGU A;  3AEP A;  3DR7 A;  3H14 A;  3QN6 A;  4XJM A;  3FRK A;  1FG7 A;  2D7Z A;  4EU1 A;  1DGE A;  4U2H A;  3II0 A;  4A6R A;  4ZWM A;  1WYU B;  2AY7 A;  3VK2 A;  1YOO A;  3RI6 A;  1E5F A;  2VMR A;  2ZY4 A;  1D7U A;  3PDX A;  1TPL A;  1AIB A;  3LWS A;  3GZD A;  4XJO A;  3A9X A;  4DGT A;  4ZSY A;  2AY6 A;  3HLM A;  1TOJ A;  3PA9 A;  4WB0 B;  2C0R A;  2BI5 A;  4OC9 A;  1TOK A;  3RCH A;  3AEO A;  4RIT A;  4MQQ A;  5D95 A;  3AOV A;  1OXP A;  2VI8 A;  2HP1 A;  2W7F A;  3FFH A;  2OKJ A;  3FTB A;  2YKY A;  3GSB A;  1IJI A;  1LW4 A;  4XK1 A;  5I92 A;  3RQ1 A;  2W7D A;  3MAF A;  3QGU A;  3B1D A;  3PD6 A;  4Q31 A;  2BWO A;  2JJG A;  3WZF A;  4ZSW A;  1W23 A;  1V2E A;  1ASE A;  2VYC A;  4RLG A;  1T3I A;  3LVM A;  4NOG A;  1GEW A;  5DJ1 A;  3GET A;  3EI6 A;  2ZY5 A;  2W8J A;  1YJS A;  1ZOB A;  3N0L A;  4WLH A;  4XEW A;  3COG A;  1DKA A;  4RKD A;  4WXB A;  1UKJ A;  4IY7 A;  1B5P A;  2CY8 A;  1KL1 A;  4OT8 A;  5M4D A;  2D63 A;  2AY4 A;  2FNU A;  4ITG A;  3W1J A;  4BA5 A;  1KKJ A;  3KKI A;  1S08 A;  1C7G A;  1PMM A;  1GEX A;  2E7J A;  4AZJ A;  1DJU A;  2GSA A;  1CL2 A;  2CST A;  2W7K A;  2R0T A;  2QA3 A;  3EI8 A;  2BYJ A;  2C7T A;  1QGN A;  2VMW A;  3NDN A;  2YCP A;  4MY5 A;  3WGC A;  2AY3 A;  1M0O A;  4EMY A; 
#chains in the Genus database with same CATH topology
 3GWP A;  3BC8 A;  3RUY A;  3A8U X;  1ELU A;  4OCA A;  1UU0 A;  2FKI A;  2VGT A;  1MLY A;  4UHO A;  3FD0 A;  1RV3 A;  4R5Z A;  1GCK A;  3VP6 A;  2DOU A;  4CVQ A;  5F8V A;  3AV7 A;  3CAI A;  2VMX A;  5BJ4 A;  5HDM A;  1S07 A;  4U1T A;  3TQX A;  2GQN A;  2BKW A;  2VIA A;  1YAA A;  4I8A A;  5LH9 A;  3KE3 A;  1H0C A;  1KKP A;  3ACZ A;  1AJS A;  4R5F A;  3HVY A;  1V72 A;  1OHY A;  3FDB A;  5M46 A;  3DZZ A;  3G7Q A;  2CJH A;  3E2Y A;  1M0P A;  3L8A A;  1ECX A;  1PMO A;  5J8Q A;  2W7J A;  2VGW A;  2FQ6 A;  1AHE A;  2HUU A;  2O1B A;  1AAW A;  3BCX A;  1G7X A;  4TMR A;  4FL0 A;  3AOW A;  5EUD A;  2VMN A;  4JEV A;  1EQB A;  1CQ6 A;  4R2N A;  2FN6 A;  4GDY A;  1BJ4 A;  2ZY3 A;  2CH1 A;  1GDE A;  2VGS A;  3MAU A;  4GRX A;  2D7Y A;  1ARG A;  3EUC A;  4AOA A;  4ZM4 A;  1KAF A;  3H9X A;  1C9C A;  1MLZ A;  2D64 A;  2XBN A;  1TOE A;  4N0W A;  1AMA A;  3A9Z A;  3B46 A;  3NYT A;  4UOY A;  4RAE A;  4K2I A;  1WYU A;  4PVF A;  3RBF A;  5JAY A;  1AX4 A;  2YOB A;  2A1V A;  2R5C B;  3ECD A;  5E3K A;  3WY7 A;  2VIB A;  3LG0 A;  2Q7W A;  3OKS A;  2W7I A;  1QJ5 A;  1SF2 A;  2WB6 A;  3ELP A;  2ZUK A;  2ZYJ A;  2QSR A;  3Q8N A;  1U08 A;  1AAM A;  1MGV A;  3PAA A;  4OBV A;  2PB2 A;  2W7G A;  2YRI A;  4R8D A;  4BMK A;  3BCB A;  1B9H A;  2D66 A;  3R9A A;  4A0F A;  4B98 A;  2ORD A;  1V2F A;  2AY5 A;  2GMU A;  2QMA A;  1YIZ A;  3PDB B;  1CJ0 A;  3PDB A;  5EIG A;  1O62 A;  1WYT A;  4ZDO A;  1BT4 A;  1C4K A;  1J04 A;  2AAT A;  2O7C A;  2R2N A;  4HVK A;  1PG8 A;  3ZZK A;  4Q6R A;  3JW9 A;  1BW0 A;  2BYL A;  3MAF B;  4XJP A;  4IXZ A;  1ZOD A;  3KGW A;  1SFF A;  3B1E A;  3ZRR A;  1PFF A;  1QIS A;  3E2F A;  5BJ3 A;  3NU7 A;  3GJU A;  3I5T A;  1IX6 A;  1C7N A;  4LNM A;  1SZK A;  3HDO A;  2EZ2 A;  3UE8 A;  1BQD A;  3FSL A;  4F5G A;  3K28 A;  4LW2 A;  3I4J A;  1S0A A;  3R4T A;  3AEL A;  1WYV A;  3ASB A;  4AH3 A;  2FNI A;  3BWN C;  3FVU A;  1AJS B;  1LC8 A;  4ZDL A;  4CBR A;  3DU4 A;  1DJ9 A;  3FVS A;  4P7Y A;  1SZU A;  2BI1 A;  1OAT A;  4MKK A;  3W1H A;  1YJY A;  1LKC A;  4ADE A;  2PB0 A;  1GC0 A;  3WGB A;  3LVJ A;  4ATQ A;  3BWN A;  2Z1Y A;  5TF5 A;  1M6S A;  1I29 A;  3E6G A;  4GEB A;  1D7R A;  1WKG A;  5FT5 A;  4F5F A;  1CQ7 A;  1ZC9 A;  3NTJ A;  3VK4 A;  1M0N A;  3NYS A;  4WYE A;  5DB5 A;  2DGL A;  2CIN A;  1AMQ A;  1X2A A;  3K40 A;  1DJE A;  1E5E A;  1DGD A;  3BB8 A;  4ATP A;  1B9I A;  3MKJ A;  4F4E A;  4WBT A;  5EUN A;  4WYG A;  1YIY A;  2VMP A;  1QIT A;  1QZ9 A;  3LV2 A;  1I43 A;  3NU8 A;  3AEM A;  1ASF A;  1XI9 A;  4OTL A;  4ZAS A;  1LK9 A;  2AEU A;  3I16 A;  4F5J A;  1BJW A;  3GZC A;  1SVV A;  1AKB A;  1MAQ A;  2W7H A;  2VMQ A;  2AEV A;  1RV4 A;  4LNL A;  4B9B A;  1W7N A;  3N4R A;  2JJH A;  1LC7 A;  5G09 A;  4LC3 A;  3QM2 A;  5E4Z A;  5DJ9 A;  2EGY A;  1YNU A;  4W5K A;  1WYT B;  3PGY A;  1X29 A;  3DR4 A;  1W7L A;  1AY4 A;  3UAK A;  2CJG A;  3N5M A;  4GE4 A;  1GC4 A;  3PJ0 A;  1TOG A;  4BHD A;  2X3L A;  4OBU A;  3VK3 A;  4ZDP A;  2WK9 A;  5DX5 A;  3JTX A;  2Z67 A;  2CTZ A;  3HT4 A;  5G2Q A;  4AZK A;  1D7V A;  1ASG A;  1BJN A;  1M7Y A;  1YJZ A;  2JG2 A;  1N8P A;  2R5C A;  2VGV A;  1AY8 A;  1IAY A;  1MDZ A;  3TFU A;  4J8L A;  2X8U A;  1XEY A;  3RBL A;  1LS3 A;  4OYT A;  5K8B A;  4GE7 A;  1DTY A;  1J32 A;  2V1P A;  3MAD A;  1C7O A;  1VEF A;  5EUE A;  3EZS A;  1TAR A;  4JEX A;  4LNJ A;  2TPL A;  3VOM A;  1ASA A;  3A2B A;  4HF8 A;  4H51 A;  2BI3 A;  5FT8 A;  1EJI A;  4F5H A;  1OHV A;  4K2B A;  3ZRQ A;  3GBX A;  4E77 A;  3QBO A;  1ASM A;  3EI7 A;  2JGT A;  1O61 A;  4DQ6 A;  1LW5 A;  1FG3 A;  3T32 A;  3AEN B;  3NUB A;  2QB3 A;  3AEN A;  1IUG A;  2OKK A;  1AY5 A;  3FVX A;  1G4V A;  4KYO A;  1IBJ A;  3BN1 A;  3CQ4 A;  3H7F A;  3JWB A;  4QGR A;  3HQT A;  4WP0 A;  2F8J A;  3DXW A;  4F5I A;  2D5Y A;  4WYC A;  4WYD A;  4Y0I A;  1B4X A;  3NNK A;  4TN4 A;  1MDX A;  4E1O A;  2XH1 A;  3JZL A;  3ZZJ A;  4A72 A;  4ZLV A;  2JJF A;  1AKC A;  1AMS A;  2VMS A;  2ZJG A;  4XAU A;  1S09 A;  2W7E A;  3GZD C;  3QI6 A;  2VLH A;  2CFB A;  4UQV A;  1CZC A;  4A6T A;  2G7J A;  4KXK A;  2R5E A;  1BJO B;  1S06 A;  2HOX A;  1IX8 A;  1M32 A;  4K2M A;  3EIA A;  1MDO A;  4XJL A;  3ASA A;  2D61 A;  2EH6 A;  4J5U A;  1AJR A;  2YKU A;  5FT4 A;  2E7I A;  4ISY A;  2WK8 A;  2YHK A;  1BS0 A;  1ASB A;  1VP4 A;  2C81 A;  1G4X A;  2O0R A;  2X5D A;  1TOI A;  4OMA A;  4Y0D A;  4XQ2 A;  2YRR A;  2EYQ A;  4RKC A;  3NX3 A;  1X0M A;  2W8U A;  4JEW A;  1RVU A;  2W7L A;  1KL2 A;  1GC2 A;  1I41 A;  4MQR A;  4UHM A;  4GSA A;  4ADB A;  4EB5 A;  1TAS A;  3AAT A;  3JU7 A;  4GE9 A;  2NMP A;  3DYD A;  4AO4 A;  2YKV A;  1M0Q A;  5C6U A;  2ZC0 A;  4W1V A;  1UU2 A;  3E2Z B;  1IAX A;  1O69 A;  4IXS A;  3E2Z A;  4E3Q A;  3UWC A;  1N31 A;  2JIS A;  1IX7 A;  4W91 A;  2OGE A;  4JEY A;  2ZSM A;  3F0H A;  4Q75 A;  2PO3 A;  4ITX A;  4KAM A;  5G4J A;  1AIC A;  1MAP A;  4ADC A;  5EIG B;  2BWN A;  4MQP A;  4MSO A;  3IHJ A;  2HOZ A;  4ADD A;  2DKJ A;  4W8I A;  4BA4 A;  3EIB A;  1O4S A;  2HOY A;  4WXG A;  3N7N A;  2AY8 A;  1BQA A;  2VMO A;  3GR9 A;  2QLR A;  2VMU A;  2VMY A;  3CQ6 A;  2BHX A;  5HXX A;  2X5F A;  2RFV A;  3EI5 A;  4FFC A;  3VAX A;  1V2D A;  2W8V A;  3MC6 C;  4JF0 A;  2YCT A;  4EFF A;  5LHA A;  1EG5 A;  1JG8 A;  1JF9 A;  3B1C A;  4A0R A;  1SPA A;  4RIZ A;  4CXQ A;  3W1I A;  1LC5 A;  4RJ0 A;  1WYV B;  3USF A;  3AEJ A;  3EZ1 A;  3LVL B;  3M5U A;  4E3R A;  5M4B A;  3MBB A;  1CZE A;  4RM1 A;  3G8M A;  4M2K A;  2C44 A;  1M4N A;  4BQ0 A;  3FFR A;  2GB3 A;  1G7W A;  3TAT A;  1FC4 A;  3FQ7 A;  3TCM A;  4UHN A;  1ORD A;  1Y4I A;  2GMS A;  4TV7 A;  3FDD A;  2FYF A;  1JS6 A;  1ARI A;  4LW4 A;  3G0T A;  2AY2 A;  9AAT A;  1QIR A;  3WX9 A;  2DKB A;  2YCN A;  5D5S A;  2W8W A;  1AKA A;  3K7Y A;  1KMK A;  4WXF A;  3AEM C;  2Z61 A;  1GC3 A;  4CXR A;  4JEZ A;  2ZP7 A;  2VMV A;  4WYA A;  1I48 A;  5AX8 A;  4A0H A;  4ZAH A;  7AAT A;  4PIW A;  4WYF A;  2BI2 A;  5FT6 A;  4P3M A;  2BIA A;  1VJO A;  4M2M A;  5EAA A;  2HOR A;  3FCR A;  1DFO A;  2DGM A;  2YKX A;  1WKH A;  2Z9V A;  4MGR A;  4F5L A;  3DC1 A;  3PPL A;  5IWQ A;  3EI9 A;  4A00 A;  4W1X A;  4WB0 A;  5G2P A;  1AIA A;  2WK7 A;  2CAN A;  3DOD A;  3NRA A;  1B8G A;  2VMZ A;  2W7M A;  1D2F A;  3RCH B;  2CB1 A;  3E77 A;  1IVR A;  3WCO A;  3WLX A;  1X28 A;  3NYU A;  3FZ6 A;  3P1T A;  2CJD A;  2VI9 A;  5E5I A;  1ASL A;  1H1C A;  2OQX A;  4IW7 A;  3WCN A;  4ZM3 A;  3ZRP A;  1W7M A;  1ARS A;  1OHW A;  3PIU A;  3DXV A;  1OXO A;  3WKS A;  2FM1 A;  3LVK A;  2QB2 A;  3PD6 B;  3NUI A;  4F5M A;  2Z9W A;  4DBC A;  3QHX A;  3F6T A;  2Z9X A;  3BWO A;  4RJY A;  2VLF A;  3ATH A;  4MKJ A;  1CL1 A;  3F9T A;  1CS1 A;  3N4X A;  2HUI A;  1AHF A;  2QBT A;  1W3U A;  1JS3 A;  1WST A;  3QPG A;  3FKD A;  4N0B A;  1GBN A;  2AY1 A;  4W1W A;  4JE5 D;  4CBS A;  3OP7 A;  2ZSL A;  2BWP A;  3AEJ C;  3DRD A;  5EFS A;  2EO5 A;  2Z20 A;  3BS8 A;  2Z9U A;  1Z7D A;  2HP2 A;  4JE5 A;  1ASC A;  2DGK A;  2BIG A;  4AO9 A;  5EAV A;  1BKG A;  5HHY A;  4M2J A;  2E54 A;  1TAT A;  4WD2 A;  3MC6 A;  1C0N A;  1SZS A;  3L44 A;  3MEB A;  4IXO A;  4L0O A;  4PFF A;  4PFN A;  1KMJ A;  1B5O A;  5G0A A;  2HZP A;  4IYO A;  4F5K A;  4IYO B;  3FQ8 A;  4EB7 A;  2KFP A;  2BI9 A;  2Z1Z A;  3FZ7 A;  3HL2 A;  8AAT A;  2G6W A;  4H63 Q;  3ELE A;  4IX8 A;  4Y0H A;  2W8T A;  1ASN A;  3N75 A;  1BJO A;  4O6Z A;  3A9Y A;  4Q76 A;  1P3W A;  3HBX A;  3P6K A;  1ASD A;  1GD9 A;  2VGZ A;  4A6U A;  1ELQ A;  2EPJ A;  1ART A;  2HUF A;  2JJE A;  3FQA A;  4JF1 A;  1AHG A;  1GEY A;  1CQ8 A;  3CBF A;  5M49 A;  1ARH A;  1N2T A;  2V0Y A;  2D65 A;  3BCA A;  1D7S A;  2EZ1 A;  2WKA A;  2VMT A;  2OAT A;  4A0G A;  3LY1 A;  3FZ8 A;  2DR1 A;  1AMR A;  5EQC A;  2OGA A;  4ZWV A;  4WLJ A;  1UU1 A;  3N4S A;  3WKR A;  3E9K A;  1RVY A;  3ISL A;  1QJ3 A;  3TFT A;  5G4I A;  2E7U A;  3CQ5 A;  1Z3Z A;  2CH2 A;  3B8X A;  3D6K A;  5F9S A;  1AHY A;  2BIE A;  2AY9 A;  3HMU A;  3JWA A;  2ZY2 A;  3KGX A;  3BV0 A;  1AHX A;  3IF2 A;  2VGU A;  3AEP A;  3DR7 A;  3H14 A;  3QN6 A;  4XJM A;  3FRK A;  1FG7 A;  2D7Z A;  4EU1 A;  1DGE A;  4U2H A;  3II0 A;  4A6R A;  4ZWM A;  1WYU B;  2AY7 A;  3VK2 A;  1YOO A;  3RI6 A;  1E5F A;  2VMR A;  2ZY4 A;  1D7U A;  3PDX A;  1TPL A;  1AIB A;  3LWS A;  3GZD A;  4XJO A;  3A9X A;  5KTB A;  4DGT A;  4ZSY A;  2AY6 A;  3HLM A;  1TOJ A;  3PA9 A;  4WB0 B;  2C0R A;  2BI5 A;  4OC9 A;  1TOK A;  3RCH A;  3AEO A;  4RIT A;  4MQQ A;  5D95 A;  3AOV A;  1OXP A;  2VI8 A;  2HP1 A;  2W7F A;  3FFH A;  4K05 A;  2OKJ A;  3FTB A;  2YKY A;  3GSB A;  1IJI A;  1LW4 A;  4XK1 A;  5I92 A;  3RQ1 A;  2W7D A;  3MAF A;  3QGU A;  3B1D A;  3PD6 A;  4Q31 A;  2BWO A;  2JJG A;  3WZF A;  4ZSW A;  1W23 A;  1V2E A;  1ASE A;  2VYC A;  4RLG A;  1T3I A;  3LVM A;  4NOG A;  1GEW A;  5DJ1 A;  3GET A;  3EI6 A;  2ZY5 A;  2W8J A;  1YJS A;  1ZOB A;  3N0L A;  4WLH A;  4XEW A;  3COG A;  1DKA A;  4RKD A;  4WXB A;  1UKJ A;  4IY7 A;  1B5P A;  2CY8 A;  1KL1 A;  4OT8 A;  5M4D A;  2D63 A;  2AY4 A;  2FNU A;  4ITG A;  3W1J A;  4BA5 A;  1KKJ A;  3KKI A;  1S08 A;  1C7G A;  1PMM A;  1GEX A;  2E7J A;  4AZJ A;  1DJU A;  2GSA A;  1CL2 A;  2CST A;  2W7K A;  2R0T A;  2QA3 A;  3EI8 A;  2BYJ A;  2C7T A;  1QGN A;  2VMW A;  3NDN A;  2YCP A;  4MY5 A;  3WGC A;  2AY3 A;  1M0O A;  4EMY A; 
#chains in the Genus database with same CATH homology
 3GWP A;  3BC8 A;  3RUY A;  3A8U X;  1ELU A;  4OCA A;  1UU0 A;  2FKI A;  2VGT A;  1MLY A;  4UHO A;  3FD0 A;  1RV3 A;  4R5Z A;  1GCK A;  3VP6 A;  2DOU A;  4CVQ A;  5F8V A;  3AV7 A;  3CAI A;  2VMX A;  5BJ4 A;  5HDM A;  1S07 A;  4U1T A;  3TQX A;  2GQN A;  2BKW A;  2VIA A;  1YAA A;  4I8A A;  5LH9 A;  3KE3 A;  1H0C A;  1KKP A;  3ACZ A;  1AJS A;  4R5F A;  3HVY A;  1V72 A;  1OHY A;  3FDB A;  5M46 A;  3DZZ A;  3G7Q A;  2CJH A;  3E2Y A;  1M0P A;  3L8A A;  1ECX A;  1PMO A;  5J8Q A;  2W7J A;  2VGW A;  2FQ6 A;  1AHE A;  2HUU A;  2O1B A;  1AAW A;  3BCX A;  1G7X A;  4TMR A;  4FL0 A;  3AOW A;  5EUD A;  2VMN A;  4JEV A;  1EQB A;  1CQ6 A;  4R2N A;  2FN6 A;  4GDY A;  1BJ4 A;  2ZY3 A;  2CH1 A;  1GDE A;  2VGS A;  3MAU A;  4GRX A;  2D7Y A;  1ARG A;  3EUC A;  4AOA A;  4ZM4 A;  3H9X A;  1C9C A;  1MLZ A;  2D64 A;  2XBN A;  1TOE A;  4N0W A;  1AMA A;  3A9Z A;  3B46 A;  3NYT A;  4UOY A;  4RAE A;  4K2I A;  1WYU A;  4PVF A;  3RBF A;  5JAY A;  1AX4 A;  2YOB A;  2A1V A;  2R5C B;  3ECD A;  5E3K A;  3WY7 A;  2VIB A;  3LG0 A;  2Q7W A;  3OKS A;  2W7I A;  1QJ5 A;  1SF2 A;  2WB6 A;  3ELP A;  2ZUK A;  2ZYJ A;  2QSR A;  3Q8N A;  1U08 A;  1AAM A;  1MGV A;  3PAA A;  4OBV A;  2PB2 A;  2W7G A;  2YRI A;  4R8D A;  4BMK A;  3BCB A;  1B9H A;  2D66 A;  3R9A A;  4A0F A;  4B98 A;  2ORD A;  1V2F A;  2AY5 A;  2GMU A;  2QMA A;  1YIZ A;  3PDB B;  1CJ0 A;  3PDB A;  5EIG A;  1O62 A;  1WYT A;  4ZDO A;  1BT4 A;  1C4K A;  1J04 A;  2AAT A;  2O7C A;  2R2N A;  4HVK A;  1PG8 A;  3ZZK A;  4Q6R A;  3JW9 A;  1BW0 A;  2BYL A;  3MAF B;  4XJP A;  4IXZ A;  1ZOD A;  3KGW A;  1SFF A;  3B1E A;  3ZRR A;  1PFF A;  1QIS A;  3E2F A;  5BJ3 A;  3NU7 A;  3GJU A;  3I5T A;  1IX6 A;  1C7N A;  4LNM A;  1SZK A;  3HDO A;  2EZ2 A;  3UE8 A;  1BQD A;  3FSL A;  4F5G A;  3K28 A;  4LW2 A;  3I4J A;  1S0A A;  3R4T A;  3AEL A;  1WYV A;  3ASB A;  4AH3 A;  2FNI A;  3BWN C;  3FVU A;  1AJS B;  1LC8 A;  4ZDL A;  4CBR A;  3DU4 A;  1DJ9 A;  3FVS A;  4P7Y A;  1SZU A;  2BI1 A;  1OAT A;  4MKK A;  3W1H A;  1YJY A;  1LKC A;  4ADE A;  2PB0 A;  1GC0 A;  3WGB A;  3LVJ A;  4ATQ A;  3BWN A;  2Z1Y A;  5TF5 A;  1M6S A;  1I29 A;  3E6G A;  4GEB A;  1D7R A;  1WKG A;  5FT5 A;  4F5F A;  1CQ7 A;  1ZC9 A;  3NTJ A;  3VK4 A;  1M0N A;  3NYS A;  4WYE A;  5DB5 A;  2DGL A;  2CIN A;  1AMQ A;  1X2A A;  3K40 A;  1DJE A;  1E5E A;  1DGD A;  3BB8 A;  4ATP A;  1B9I A;  3MKJ A;  4F4E A;  4WBT A;  5EUN A;  4WYG A;  1YIY A;  2VMP A;  1QIT A;  1QZ9 A;  3LV2 A;  1I43 A;  3NU8 A;  3AEM A;  1ASF A;  1XI9 A;  4OTL A;  4ZAS A;  1LK9 A;  2AEU A;  3I16 A;  4F5J A;  1BJW A;  3GZC A;  1SVV A;  1AKB A;  1MAQ A;  2W7H A;  2VMQ A;  2AEV A;  1RV4 A;  4LNL A;  4B9B A;  1W7N A;  3N4R A;  2JJH A;  1LC7 A;  5G09 A;  4LC3 A;  3QM2 A;  5E4Z A;  5DJ9 A;  2EGY A;  1YNU A;  4W5K A;  1WYT B;  3PGY A;  1X29 A;  3DR4 A;  1W7L A;  1AY4 A;  3UAK A;  2CJG A;  3N5M A;  4GE4 A;  1GC4 A;  3PJ0 A;  1TOG A;  4BHD A;  2X3L A;  4OBU A;  3VK3 A;  4ZDP A;  2WK9 A;  5DX5 A;  3JTX A;  2Z67 A;  2CTZ A;  3HT4 A;  5G2Q A;  4AZK A;  1D7V A;  1ASG A;  1BJN A;  1M7Y A;  1YJZ A;  2JG2 A;  1N8P A;  2R5C A;  2VGV A;  1AY8 A;  1IAY A;  1MDZ A;  3TFU A;  4J8L A;  2X8U A;  1XEY A;  3RBL A;  1LS3 A;  4OYT A;  5K8B A;  4GE7 A;  1DTY A;  1J32 A;  2V1P A;  3MAD A;  1C7O A;  1VEF A;  5EUE A;  3EZS A;  1TAR A;  4JEX A;  4LNJ A;  2TPL A;  3VOM A;  1ASA A;  3A2B A;  4HF8 A;  4H51 A;  2BI3 A;  5FT8 A;  1EJI A;  4F5H A;  1OHV A;  4K2B A;  3ZRQ A;  3GBX A;  4E77 A;  3QBO A;  1ASM A;  3EI7 A;  2JGT A;  1O61 A;  4DQ6 A;  1LW5 A;  1FG3 A;  3T32 A;  3AEN B;  3NUB A;  2QB3 A;  3AEN A;  1IUG A;  2OKK A;  1AY5 A;  3FVX A;  1G4V A;  4KYO A;  1IBJ A;  3BN1 A;  3CQ4 A;  3H7F A;  3JWB A;  4QGR A;  3HQT A;  4WP0 A;  2F8J A;  3DXW A;  4F5I A;  2D5Y A;  4WYC A;  4WYD A;  4Y0I A;  1B4X A;  3NNK A;  4TN4 A;  1MDX A;  4E1O A;  2XH1 A;  3JZL A;  3ZZJ A;  4A72 A;  4ZLV A;  2JJF A;  1AKC A;  1AMS A;  2VMS A;  2ZJG A;  4XAU A;  1S09 A;  2W7E A;  3GZD C;  3QI6 A;  2VLH A;  2CFB A;  4UQV A;  1CZC A;  4A6T A;  2G7J A;  4KXK A;  2R5E A;  1BJO B;  1S06 A;  2HOX A;  1IX8 A;  1M32 A;  4K2M A;  3EIA A;  1MDO A;  4XJL A;  3ASA A;  2D61 A;  2EH6 A;  4J5U A;  1AJR A;  2YKU A;  5FT4 A;  2E7I A;  4ISY A;  2WK8 A;  2YHK A;  1BS0 A;  1ASB A;  1VP4 A;  2C81 A;  1G4X A;  2O0R A;  2X5D A;  1TOI A;  4OMA A;  4Y0D A;  4XQ2 A;  2YRR A;  2EYQ A;  4RKC A;  3NX3 A;  1X0M A;  2W8U A;  4JEW A;  1RVU A;  2W7L A;  1KL2 A;  1GC2 A;  1I41 A;  4MQR A;  4UHM A;  4GSA A;  4ADB A;  4EB5 A;  1TAS A;  3AAT A;  3JU7 A;  4GE9 A;  2NMP A;  3DYD A;  4AO4 A;  2YKV A;  1M0Q A;  5C6U A;  2ZC0 A;  4W1V A;  1UU2 A;  3E2Z B;  1IAX A;  1O69 A;  4IXS A;  3E2Z A;  4E3Q A;  3UWC A;  1N31 A;  2JIS A;  1IX7 A;  4W91 A;  2OGE A;  4JEY A;  2ZSM A;  3F0H A;  4Q75 A;  2PO3 A;  4ITX A;  4KAM A;  5G4J A;  1AIC A;  1MAP A;  4ADC A;  5EIG B;  2BWN A;  4MQP A;  4MSO A;  3IHJ A;  2HOZ A;  4ADD A;  2DKJ A;  4W8I A;  4BA4 A;  3EIB A;  1O4S A;  2HOY A;  4WXG A;  3N7N A;  2AY8 A;  1BQA A;  2VMO A;  3GR9 A;  2QLR A;  2VMU A;  2VMY A;  3CQ6 A;  2BHX A;  5HXX A;  2X5F A;  2RFV A;  3EI5 A;  4FFC A;  3VAX A;  1V2D A;  2W8V A;  3MC6 C;  4JF0 A;  2YCT A;  4EFF A;  5LHA A;  1EG5 A;  1JG8 A;  1JF9 A;  3B1C A;  4A0R A;  1SPA A;  4RIZ A;  4CXQ A;  3W1I A;  1LC5 A;  4RJ0 A;  1WYV B;  3USF A;  3AEJ A;  3EZ1 A;  3LVL B;  3M5U A;  4E3R A;  5M4B A;  3MBB A;  1CZE A;  4RM1 A;  3G8M A;  4M2K A;  2C44 A;  1M4N A;  4BQ0 A;  3FFR A;  2GB3 A;  1G7W A;  3TAT A;  1FC4 A;  3FQ7 A;  3TCM A;  4UHN A;  1ORD A;  1Y4I A;  2GMS A;  4TV7 A;  3FDD A;  2FYF A;  1JS6 A;  1ARI A;  4LW4 A;  3G0T A;  2AY2 A;  9AAT A;  1QIR A;  3WX9 A;  2DKB A;  2YCN A;  5D5S A;  2W8W A;  1AKA A;  3K7Y A;  1KMK A;  4WXF A;  3AEM C;  2Z61 A;  1GC3 A;  4CXR A;  4JEZ A;  2ZP7 A;  2VMV A;  4WYA A;  1I48 A;  5AX8 A;  4A0H A;  4ZAH A;  7AAT A;  4PIW A;  4WYF A;  2BI2 A;  5FT6 A;  4P3M A;  2BIA A;  1VJO A;  4M2M A;  5EAA A;  2HOR A;  3FCR A;  1DFO A;  2DGM A;  2YKX A;  1WKH A;  2Z9V A;  4MGR A;  4F5L A;  3DC1 A;  3PPL A;  5IWQ A;  3EI9 A;  4A00 A;  4W1X A;  4WB0 A;  5G2P A;  1AIA A;  2WK7 A;  2CAN A;  3DOD A;  3NRA A;  1B8G A;  2VMZ A;  2W7M A;  1D2F A;  3RCH B;  2CB1 A;  3E77 A;  1IVR A;  3WCO A;  3WLX A;  1X28 A;  3NYU A;  3FZ6 A;  3P1T A;  2CJD A;  2VI9 A;  5E5I A;  1ASL A;  1H1C A;  2OQX A;  4IW7 A;  3WCN A;  4ZM3 A;  3ZRP A;  1W7M A;  1ARS A;  1OHW A;  3PIU A;  3DXV A;  1OXO A;  3WKS A;  2FM1 A;  3LVK A;  2QB2 A;  3PD6 B;  3NUI A;  4F5M A;  2Z9W A;  4DBC A;  3QHX A;  3F6T A;  2Z9X A;  3BWO A;  4RJY A;  2VLF A;  3ATH A;  4MKJ A;  1CL1 A;  3F9T A;  1CS1 A;  3N4X A;  2HUI A;  1AHF A;  2QBT A;  1W3U A;  1JS3 A;  1WST A;  3QPG A;  3FKD A;  4N0B A;  1GBN A;  2AY1 A;  4W1W A;  4JE5 D;  4CBS A;  3OP7 A;  2ZSL A;  2BWP A;  3AEJ C;  3DRD A;  5EFS A;  2EO5 A;  2Z20 A;  3BS8 A;  2Z9U A;  1Z7D A;  2HP2 A;  4JE5 A;  1ASC A;  2DGK A;  2BIG A;  4AO9 A;  5EAV A;  1BKG A;  5HHY A;  4M2J A;  2E54 A;  1TAT A;  4WD2 A;  3MC6 A;  1C0N A;  1SZS A;  3L44 A;  3MEB A;  4IXO A;  4L0O A;  4PFF A;  4PFN A;  1KMJ A;  1B5O A;  5G0A A;  2HZP A;  4IYO A;  4F5K A;  4IYO B;  3FQ8 A;  4EB7 A;  2KFP A;  2BI9 A;  2Z1Z A;  3FZ7 A;  3HL2 A;  8AAT A;  2G6W A;  4H63 Q;  3ELE A;  4IX8 A;  4Y0H A;  2W8T A;  1ASN A;  3N75 A;  1BJO A;  4O6Z A;  3A9Y A;  4Q76 A;  1P3W A;  3HBX A;  3P6K A;  1ASD A;  1GD9 A;  2VGZ A;  4A6U A;  1ELQ A;  2EPJ A;  1ART A;  2HUF A;  2JJE A;  3FQA A;  4JF1 A;  1AHG A;  1GEY A;  1CQ8 A;  3CBF A;  5M49 A;  1ARH A;  1N2T A;  2V0Y A;  2D65 A;  3BCA A;  1D7S A;  2EZ1 A;  2WKA A;  2VMT A;  2OAT A;  4A0G A;  3LY1 A;  3FZ8 A;  2DR1 A;  1AMR A;  5EQC A;  2OGA A;  4ZWV A;  4WLJ A;  1UU1 A;  3N4S A;  3WKR A;  3E9K A;  1RVY A;  3ISL A;  1QJ3 A;  3TFT A;  5G4I A;  2E7U A;  3CQ5 A;  1Z3Z A;  2CH2 A;  3B8X A;  3D6K A;  5F9S A;  1AHY A;  2BIE A;  2AY9 A;  3HMU A;  3JWA A;  2ZY2 A;  3KGX A;  3BV0 A;  1AHX A;  3IF2 A;  2VGU A;  3AEP A;  3DR7 A;  3H14 A;  3QN6 A;  4XJM A;  3FRK A;  1FG7 A;  2D7Z A;  4EU1 A;  1DGE A;  4U2H A;  3II0 A;  4A6R A;  4ZWM A;  1WYU B;  2AY7 A;  3VK2 A;  1YOO A;  3RI6 A;  1E5F A;  2VMR A;  2ZY4 A;  1D7U A;  3PDX A;  1TPL A;  1AIB A;  3LWS A;  3GZD A;  4XJO A;  3A9X A;  5KTB A;  4DGT A;  4ZSY A;  2AY6 A;  3HLM A;  1TOJ A;  3PA9 A;  4WB0 B;  2C0R A;  2BI5 A;  4OC9 A;  1TOK A;  3RCH A;  3AEO A;  4RIT A;  4MQQ A;  5D95 A;  3AOV A;  1OXP A;  2VI8 A;  2HP1 A;  2W7F A;  3FFH A;  4K05 A;  2OKJ A;  3FTB A;  2YKY A;  3GSB A;  1IJI A;  1LW4 A;  4XK1 A;  5I92 A;  3RQ1 A;  2W7D A;  3MAF A;  3QGU A;  3B1D A;  3PD6 A;  4Q31 A;  2BWO A;  2JJG A;  3WZF A;  4ZSW A;  1W23 A;  1V2E A;  1ASE A;  2VYC A;  4RLG A;  1T3I A;  3LVM A;  4NOG A;  1GEW A;  5DJ1 A;  3GET A;  3EI6 A;  2ZY5 A;  2W8J A;  1YJS A;  1ZOB A;  3N0L A;  4WLH A;  4XEW A;  3COG A;  1DKA A;  4RKD A;  4WXB A;  1UKJ A;  4IY7 A;  1B5P A;  2CY8 A;  1KL1 A;  4OT8 A;  5M4D A;  2D63 A;  2AY4 A;  2FNU A;  4ITG A;  3W1J A;  4BA5 A;  1KKJ A;  3KKI A;  1S08 A;  1C7G A;  1PMM A;  1GEX A;  2E7J A;  4AZJ A;  1DJU A;  2GSA A;  1CL2 A;  2CST A;  2W7K A;  2R0T A;  2QA3 A;  3EI8 A;  2BYJ A;  2C7T A;  1QGN A;  2VMW A;  3NDN A;  2YCP A;  4MY5 A;  3WGC A;  2AY3 A;  1M0O A;  4EMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...