1AHEA

Aspartate aminotransferase hexamutant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternating arginine-modulated substrate specificity in an engineered tyrosine aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aheA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aheA01
3AEJC 1KL2A 1W3UA 1ELQA 4ZAHA 1TPLA 2X3LA 3G7QA 1WKHA 1PMMA 1ARSA 3UAKA 4ZDLA 4A0GA 1QISA 2HORA 1VJOA 3AELA 2AY6A 1WSTA 3H7FA 1TOKA 2QB2A 4HF8A 2YCTA 3E2ZA 4WXFA 3A8UX 1IX6A 4WYEA 5AX8A 5FT4A 2HP1A 2E7JA 1X2AA 1AICA 1MLYA 1DFOA 4RLGA 3TFUA 4XEWA 4RAEA 1MGVA 2V0YA 2AY7A 3RBFA 4CXRA 1AX4A 3RQ1A 4DBCA 4J8LA 1U08A 3VOMA 3ECDA 1BJWA 3DU4A 2Z1YA 3PDBA 2ZY3A 1O61A 2VMWA 1WYUA 4AO4A 4EFFA 3ASAA 1DJUA 1GC4A 2HOYA 3N0LA 5G0AA 3MAUA 2W8JA 4JF1A 2VMOA 1Y4IA 1ZC9A 1BS0A 2YRRA 3FRKA 1GEWA 2VMVA 2VYCA 3LY1A 3JWBA 4N0BA 3ZZJA 1UU0A 1BW0A 2VGWA 1E5FA 1ASDA 2VMQA 3B1EA 4PIWA 3GWPA 2ZY2A 3DR4A 1X28A 2FM1A 4JEWA 2DGLA 5D5SA 4ZWVA 1C7GA 2YHKA 1DGEA 3RBLA 3DC1A 4R5ZA 1V72A 4WBTA 4MQRA 4WLHA 3LV2A 4OC9A 2R0TA 3B1DA 3HVYA 2CB1A 3BN1A 4WYCA 2D61A 2Z20A 1LC5A 1QITA 1B9IA 4ZDOA 1UU1A 4OT8A 2ZYJA 2BI1A 4Y0IA 1QGNA 3NYSA 4A0RA 2W8UA 1FC4A 4Y0DA 3E6GA 2E7UA 2W8WA 2QB3A 3AEMC 1IJIA 2AY2A 2W7GA 3FVSA 2EO5A 4M2JA 4WYGA 5EUEA 2HOXA 4EU1A 1YAAA 3E2YA 1ORDA 3FD0A 4LW2A 2AY5A 3KGWA 8AATA 1GBNA 3KGXA 4IW7A 1ECXA 1YIYA 2CH2A 4F5MA 3A2BA 3BV0A 9AATA 1JG8A 1M0NA 4M2MA 1BJOB 1TARA 2VIAA 4CBRA 4MKKA 4XJLA 2W7IA 3I5TA 2Q7WA 2C81A 3T32A 2AY1A 1W7MA 4Q31A 1CQ7A 1BT4A 1TOJA 2EH6A 4A6TA 2BIAA 1AKCA 2DKBA 1M4NA 3GZCA 4LNLA 2CY8A 3N5MA 2ZY5A 4Q6RA 1AY5A 5EAAA 1SPAA 1OHWA 5EIGA 2RFVA 4HVKA 4CBSA 3K40A 5DJ9A 1ASEA 4EB5A 1M6SA 3DRDA 1JS3A 2QLRA 1CZEA 4O6ZA 4E3RA 1ARTA 2BI5A 1C9CA 4OCAA 3P6KA 4ZWMA 1GD9A 1AIBA 1MAPA 4Y0HA 1AHGA 5JAYA 2VGUA 1ASCA 1CZCA 1V2DA 1YNUA 3AENA 5BJ4A 4ADEA 1D7VA 3TQXA 1CS1A 1ZODA 2DGKA 2HOZA 2VGZA 3NYTA 4WLJA 5E3KA 2FNIA 4F5IA 5IWQA 1G4VA 3PIUA 2D66A 2X5FA 3LWSA 1YIZA 2OGAA 4XJPA 3UWCA 3AENB 2QMAA 1DKAA 4JEXA 4XJMA 2O1BA 1W7LA 4AZKA 1OHVA 1BJOA 2DR1A 2Z1ZA 3CBFA 4W8IA 2EPJA 2W7DA 4MSOA 4GE9A 3NTJA 3JTXA 3GZDC 1X29A 1O4SA 1AHXA 1MDXA 3WCOA 3FVUA 3GZDA 1S0AA 2ZJGA 2YCNA 4RKDA 5F8VA 3HQTA 1XEYA 5DB5A 5G2QA 3MBBA 4F5FA 2VMUA 3K7YA 4UQVA 4ITGA 1I29A 3NRAA 4GDYA 1M0PA 1D7SA 4ATQA 4E1OA 2BHXA 2VLFA 1WYTA 4BA5A 2GMSA 1I41A 3NDNA 2BI9A 3FSLA 5I92A 3GETA 1FG7A 2OATA 5G4IA 3BCAA 1MLZA 3A9YA 1VEFA 1D7UA 1YJZA 5EFSA 4ZLVA 3RUYA 1CL1A 4I8AA 2CINA 2GB3A 2ZC0A 1B5PA 2O0RA 4JE5D 1B9HA 4XQ2A 4ZSWA 2VMTA 3B8XA 1CJ0A 1M32A 3JU7A 4UHOA 4ZM3A 3JWAA 4A0FA 4WD2A 3II0A 4GE4A 1DJEA 2X5DA 5FT5A 2D7YA 1SZKA 1JF9A 2BWNA 1S09A 4B9BA 3LVMA 3PGYA 3FQ7A 4WYFA 2EZ1A 3EIAA 5BJ3A 2OKJA 1EQBA 2CTZA 4RJYA 4LNJA 4MGRA 4QGRA 4U2HA 1YOOA 2JGTA 1KKPA 2F8JA 4AOAA 2Z9VA 2VGTA 1PFFA 2VMXA 3EIBA 1P3WA 5G4JA 3BB8A 3MC6C 3EUCA 2DGMA 5F9SA 1IAXA 4CXQA 1WYVA 1ELUA 3NYUA 3IF2A 4LNMA 1SFFA 3JZLA 1AIAA 5TF5A 4Q75A 1V2FA 1G7WA 2D7ZA 2VMYA 3BS8A 3ATHA 3E77A 4IXSA 3BCXA 2QBTA 1GC3A 1AHFA 3FKDA 1C7OA 1B4XA 2D64A 4IY7A 3VK4A 4A72A 4F5LA 2WK7A 2HZPA 3ASBA 4XJOA 4MKJA 1TOEA 1ASGA 3PAAA 3WY7A 1EG5A 1IBJA 1WYVB 2AY8A 3QPGA 1QJ3A 1ZOBA 3OP7A 3AV7A 2E54A 2OGEA 2ZP7A 2Z9WA 1GDEA 2YCPA 1KMJA 1X0MA 3W1IA 1RVUA 3MADA 5EUDA 4BHDA 4R5FA 3QBOA 4K2BA 3RCHB 4F5JA 1G7XA 3VP6A 2CJGA 1WYUB 2YKXA 4ATPA 1O62A 1CL2A 7AATA 2W7HA 3FQ8A 3FZ6A 1V2EA 3A9ZA 4UHMA 3ACZA 3AEMA 1BJNA 1PMOA 3ELPA 4P7YA 4PFNA 4XK1A 2BIGA 2DKJA 2W8VA 2HUUA 1AHEA 4BA4A 4CVQA 3JW9A 1SF2A 1ASAA 1AY8A 1KKJA 1LKCA 4JE5A 3WGBA 2Z61A 1SZSA 2R2NA 4FL0A 4RKCA 4RIZA 2G6WA 1LK9A 1ARGA 4P3MA 4GEBA 3BCBA 1KL1A 1BQDA 2VMRA 2HUFA 1JS6A 1M0OA 5EQCA 4BQ0A 1I43A 1E5EA 3LVKA 2AATA 2BI3A 2VMNA 3PJ0A 4WXGA 5D95A 1AMAA 5LH9A 4W5KA 2VIBA 2AY9A 4F5HA 3CQ6A 4UOYA 3WKRA 1IX8A 2GMUA 1DTYA 4JF0A 3WX9A 3Q8NA 1TATA 1AJSA 4WB0A 3UE8A 3K28A 1GEXA 4K2IA 4MY5A 3ZRRA 1IUGA 4DQ6A 1LS3A 3GR9A 4U1TA 4N0WA 3GBXA 1C4KA 1OXPA 3ZRPA 4AH3A 1ASLA 3PDBB 4ZSYA 5C6UA 4J5UA 1GEYA 4WYDA 2JISA 3HT4A 1CQ8A 2PO3A 3WCNA 4GRXA 2E7IA 1BQAA 2FN6A 4L0OA 1EJIA 3DXVA 3R4TA 1GC2A 2VGVA 2YKUA 4ADCA 2PB2A 2QA3A 3WZFA 1QIRA 2JJHA 3F0HA 1AMQA 4WXBA 3E2ZB 5E5IA 3WKSA 3QN6A 1H1CA 2JJEA 1UKJA 1RV3A 3HMUA 5M4BA 4OBVA 3OKSA 1QJ5A 5G09A 3AOVA 2HUIA 3TCMA 4WYAA 2WK9A 3LVJA 1J32A 4F5GA 1IAYA 1C0NA 3DR7A 3QGUA 3W1JA 1G4XA 4E77A 4F5KA 3DXWA 3NU8A 2FQ6A 5M4DA 4A6UA 2CANA 1AHYA 3A9XA 2W7KA 2Z9UA 2OKKA 3CAIA 3PD6B 3ELEA 1ARIA 2XH1A 3EI5A 2R5CB 4ADDA 1XI9A 1O69A 3KKIA 1LW5A 4IYOA 4ZDPA 1OHYA 4OTLA 2JJGA 4TV7A 4TN4A 2VMPA 3HDOA 2C44A 2FYFA 3CQ5A 4JEVA 4M2KA 4W1VA 2Z67A 3L8AA 2C0RA 4IXOA 1M7YA 4W1WA 3FZ8A 1CQ6A 1AJRA 5G2PA 4AZJA 5HXXA 1C7NA 2VLHA 2Z9XA 1RVYA 3P1TA 4OYTA 2YKVA 1S06A 2O7CA 5J8QA 2W8TA 1D7RA 2VI9A 2D5YA 2GSAA 3BWNC 4IYOB 3I16A 3NUBA 4F4EA 1SZUA 2XBNA 3COGA 3QHXA 4RITA 2BKWA 3FZ7A 2YRIA 4H51A 3PD6A 3MAFA 5HDMA 2DOUA 3ZZKA 4UHNA 4WP0A 1IVRA 2YKYA 2W7FA 3EI9A 5M46A 1PG8A 1ASNA 2EGYA 1RV4A 4ITXA 2X8UA 1Z3ZA 2VGSA 4W91A 2AY3A 1S08A 2PB0A 5M49A 2HP2A 3G8MA 3IHJA 4K2MA 4KYOA 4E3QA 3TFTA 3ISLA 1N2TA 4MQQA 4A00A 5LHAA 5DJ1A 4NOGA 4R2NA 4JEZA 1W7NA 4XAUA 1SVVA 5EIGB 1UU2A 3CQ4A 3I4JA 2W7LA 2AY4A 3EZ1A 3USFA 2WKAA 3QI6A 4IX8A 4ISYA 4R8DA 2AEVA 2VMZA 2TPLA 2ZUKA 1MDZA 3MAFB 3FFHA 2V1PA 2BIEA 3NU7A 2WK8A 2R5EA 1WKGA 3RI6A 3DYDA 3F9TA 3ZRQA 1W23A 4EB7A 2FNUA 4LW4A 3E9KA 2W7MA 3DZZA 3WGCA 3QM2A 2VMSA 2YOBA 2BWOA 1OXOA 5FT6A 4PVFA 4KXKA 2ZY4A 1T3IA 3MKJA 3L44A 4DGTA 4W1XA 4KAMA 3F6TA 1TOIA 3LVLB 2R5CA 1YJSA 1LC7A 1H0CA 1WYTB 1AAMA 1FG3A 4GE7A 4RM1A 2CH1A 2EZ2A 3N75A 2CSTA 1AJSB 4WB0B 4IXZA 4MQPA 5DX5A 3D6KA 3GSBA 3HBXA 3VAXA 2OQXA 4OBUA 4AO9A 1B8GA 3BWOA 3EI6A 5K8BA 1N8PA 1ASFA 2BWPA 2D65A 4RJ0A 1TOGA 3B1CA 3AEOA 1IX7A 3HLMA 1AKAA 3AEJA 3B46A 3PPLA 5HHYA 1LW4A 3GJUA 3BC8A 2NMPA 1B5OA 1N31A 1MDOA 4TMRA 3VK3A 3PA9A 3BWNA 3E2FA 3AEPA 2W7JA 3AOWA 4PFFA 2ORDA 5FT8A 3DODA 1DJ9A 1S07A 1Z7DA 1DGDA 3PDXA 3R9AA 4B98A 2CJDA 3VK2A 3KE3A 2ZSMA 4ADBA 1AY4A 3NUIA 1ASBA 1J04A 3M5UA 4LC3A 2AEUA 3EZSA 1LC8A 1M0QA 1AMSA 3NX3A 3H14A 3RCHA 4EMYA 3FFRA 3FDBA 3FCRA 1GC0A 2CFBA 3MEBA 1KMKA 3HL2A 3AATA 5EAVA 2BYJA 2BYLA 3FDDA 3NNKA 4A6RA 1MAQA 4ZASA 3LG0A 3FVXA 4ZM4A 2CJHA 3MC6A 4FFCA 3EI8A 3W1HA 2VI8A 1ASMA 4Q76A 2D63A 1OATA 1GCKA 1QZ9A 2ZSLA 4GSAA 4JEYA 3FQAA 1YJYA 4A0HA 3TATA 1D2FA 2JJFA 3FTBA 1AMRA 2JG2A 3EI7A 4OMAA 1VP4A 4BMKA 2GQNA 3WLXA 3G0TA 1BKGA 2BI2A 5E4ZA 1AKBA 1I48A 2C7TA 5EUNA 1BJ4A 1ARHA 1AAWA 1TASA 2W7EA
chains in the Genus database with same CATH superfamily
3AEJC 1KL2A 1W3UA 1ELQA 4ZAHA 1TPLA 2X3LA 3G7QA 1WKHA 1PMMA 1ARSA 1KAFA 3UAKA 4ZDLA 4A0GA 1QISA 2HORA 1VJOA 3AELA 2AY6A 1WSTA 3H7FA 1TOKA 2QB2A 4HF8A 2YCTA 3E2ZA 4WXFA 3A8UX 1IX6A 4WYEA 5AX8A 5FT4A 2HP1A 2E7JA 1X2AA 1AICA 1MLYA 1DFOA 4RLGA 3TFUA 4XEWA 4RAEA 1MGVA 2V0YA 2AY7A 3RBFA 4CXRA 1AX4A 3RQ1A 4DBCA 4J8LA 1U08A 3VOMA 3ECDA 2WB6A 1BJWA 3DU4A 2Z1YA 3PDBA 2ZY3A 1O61A 2EYQA 2VMWA 1WYUA 4AO4A 4EFFA 3ASAA 1DJUA 1GC4A 2HOYA 3N0LA 5G0AA 3MAUA 2W8JA 4JF1A 2VMOA 1Y4IA 1ZC9A 1BS0A 2YRRA 3FRKA 1GEWA 2VMVA 2VYCA 3LY1A 3JWBA 4N0BA 3ZZJA 1UU0A 1BW0A 2VGWA 1E5FA 1ASDA 2VMQA 3B1EA 4PIWA 3GWPA 2ZY2A 3DR4A 1X28A 2FM1A 4JEWA 2DGLA 5D5SA 2QSRA 4ZWVA 1C7GA 3H9XA 2YHKA 1DGEA 3RBLA 3DC1A 4R5ZA 1V72A 4WBTA 4MQRA 4WLHA 3LV2A 4OC9A 3N4RA 2R0TA 3B1DA 3HVYA 2CB1A 3BN1A 4WYCA 2D61A 2Z20A 1LC5A 1QITA 1B9IA 4ZDOA 4H63Q 1UU1A 4OT8A 2ZYJA 2BI1A 4Y0IA 1QGNA 3NYSA 4A0RA 2W8UA 1FC4A 4Y0DA 3E6GA 2E7UA 2W8WA 2QB3A 3AEMC 1IJIA 2AY2A 2W7GA 3FVSA 5KTBA 2EO5A 4M2JA 4WYGA 5EUEA 2HOXA 4EU1A 1YAAA 3E2YA 1ORDA 3FD0A 4LW2A 2AY5A 3KGWA 8AATA 1GBNA 3KGXA 4IW7A 1ECXA 1YIYA 2CH2A 4F5MA 3A2BA 3BV0A 9AATA 1JG8A 1M0NA 4M2MA 1BJOB 1TARA 2VIAA 4CBRA 4MKKA 4XJLA 2W7IA 3I5TA 2Q7WA 2C81A 3T32A 2AY1A 1W7MA 4Q31A 1CQ7A 1BT4A 1TOJA 2EH6A 4A6TA 2BIAA 2A1VA 1AKCA 2DKBA 1M4NA 3GZCA 4LNLA 2CY8A 3N5MA 2ZY5A 2FKIA 4Q6RA 1AY5A 5EAAA 1SPAA 1OHWA 5EIGA 2RFVA 4HVKA 4CBSA 3K40A 5DJ9A 1ASEA 4EB5A 1M6SA 2G7JA 3DRDA 1JS3A 2QLRA 1CZEA 4O6ZA 4E3RA 1ARTA 2BI5A 1C9CA 4OCAA 3P6KA 4ZWMA 1GD9A 1AIBA 1MAPA 4Y0HA 1AHGA 5JAYA 2VGUA 1ASCA 1CZCA 1V2DA 1YNUA 3AENA 5BJ4A 4ADEA 1D7VA 3TQXA 1CS1A 1ZODA 2DGKA 2HOZA 2VGZA 3NYTA 4WLJA 5E3KA 2FNIA 4F5IA 5IWQA 1G4VA 3PIUA 2D66A 2X5FA 3LWSA 1YIZA 2OGAA 4XJPA 3UWCA 3AENB 2QMAA 1DKAA 4JEXA 4XJMA 2O1BA 1W7LA 4AZKA 1OHVA 1BJOA 2DR1A 2Z1ZA 3CBFA 4W8IA 2EPJA 2W7DA 4MSOA 4GE9A 3NTJA 3JTXA 3GZDC 1X29A 1O4SA 1AHXA 1MDXA 3WCOA 3FVUA 3GZDA 1S0AA 2ZJGA 2YCNA 4RKDA 5F8VA 3HQTA 1XEYA 5DB5A 5G2QA 3MBBA 4F5FA 2VMUA 3K7YA 4UQVA 4ITGA 1I29A 3NRAA 4GDYA 1M0PA 1D7SA 4ATQA 4E1OA 2BHXA 2VLFA 1WYTA 4BA5A 2GMSA 1I41A 3NDNA 2BI9A 3FSLA 5I92A 3GETA 1FG7A 2OATA 5G4IA 3BCAA 1MLZA 3A9YA 1VEFA 1D7UA 1YJZA 5EFSA 4ZLVA 3RUYA 1CL1A 4I8AA 2CINA 2GB3A 2ZC0A 1B5PA 2O0RA 4JE5D 1B9HA 4XQ2A 4ZSWA 2VMTA 3B8XA 1CJ0A 1M32A 3JU7A 4UHOA 4ZM3A 3JWAA 4A0FA 4WD2A 3II0A 4GE4A 1DJEA 2X5DA 5FT5A 2D7YA 1SZKA 1JF9A 2BWNA 1S09A 4B9BA 3LVMA 3PGYA 3FQ7A 4WYFA 2EZ1A 3EIAA 5BJ3A 2OKJA 1EQBA 2CTZA 4RJYA 4LNJA 4MGRA 4QGRA 4U2HA 1YOOA 2JGTA 1KKPA 2F8JA 4AOAA 2Z9VA 2VGTA 1PFFA 2VMXA 3EIBA 1P3WA 5G4JA 3BB8A 3MC6C 3EUCA 2DGMA 5F9SA 1IAXA 4CXQA 1WYVA 1ELUA 3NYUA 3IF2A 4LNMA 1SFFA 3JZLA 1AIAA 5TF5A 4Q75A 1V2FA 1G7WA 2D7ZA 2VMYA 3BS8A 3ATHA 3E77A 4IXSA 3BCXA 2QBTA 1GC3A 1AHFA 3FKDA 1C7OA 1B4XA 2D64A 4IY7A 3VK4A 4A72A 4F5LA 2WK7A 2HZPA 3ASBA 4XJOA 4MKJA 1TOEA 1ASGA 3PAAA 3WY7A 1EG5A 1IBJA 1WYVB 2AY8A 3QPGA 1QJ3A 1ZOBA 3OP7A 3AV7A 2E54A 2OGEA 2ZP7A 2Z9WA 1GDEA 2YCPA 1KMJA 1X0MA 3W1IA 1RVUA 3MADA 5EUDA 4BHDA 4R5FA 3QBOA 4K2BA 3RCHB 4F5JA 1G7XA 3VP6A 2CJGA 1WYUB 2YKXA 4ATPA 1O62A 1CL2A 7AATA 2W7HA 3FQ8A 3FZ6A 1V2EA 3A9ZA 4UHMA 3ACZA 3AEMA 1BJNA 1PMOA 3ELPA 4P7YA 4PFNA 4XK1A 2BIGA 2DKJA 2W8VA 2HUUA 1AHEA 4BA4A 4CVQA 3JW9A 1SF2A 1ASAA 1AY8A 1KKJA 1LKCA 4JE5A 3WGBA 2Z61A 1SZSA 2R2NA 4FL0A 4RKCA 4RIZA 2G6WA 1LK9A 1ARGA 4P3MA 4GEBA 3BCBA 1KL1A 1BQDA 2VMRA 2HUFA 1JS6A 1M0OA 5EQCA 4BQ0A 1I43A 1E5EA 3LVKA 2AATA 2BI3A 2VMNA 3PJ0A 4WXGA 5D95A 1AMAA 5LH9A 4W5KA 2VIBA 2AY9A 4F5HA 3CQ6A 4UOYA 3WKRA 1IX8A 2GMUA 1DTYA 4JF0A 3WX9A 3Q8NA 1TATA 1AJSA 4WB0A 3UE8A 3K28A 1GEXA 4K2IA 4MY5A 3ZRRA 1IUGA 4DQ6A 1LS3A 3GR9A 4U1TA 4N0WA 3GBXA 1C4KA 1OXPA 3ZRPA 4AH3A 1ASLA 3PDBB 4ZSYA 5C6UA 4J5UA 1GEYA 4WYDA 2JISA 3HT4A 1CQ8A 2PO3A 3WCNA 4GRXA 2E7IA 1BQAA 2FN6A 4L0OA 1EJIA 3DXVA 3R4TA 1GC2A 2VGVA 2KFPA 2YKUA 4ADCA 2PB2A 2QA3A 3WZFA 1QIRA 2JJHA 3F0HA 1AMQA 4WXBA 3E2ZB 5E5IA 3WKSA 3QN6A 1H1CA 2JJEA 1UKJA 1RV3A 3HMUA 5M4BA 4OBVA 3OKSA 1QJ5A 5G09A 3AOVA 2HUIA 3TCMA 4WYAA 2WK9A 3LVJA 1J32A 4F5GA 1IAYA 1C0NA 3DR7A 3QGUA 3W1JA 1G4XA 4E77A 4F5KA 4K05A 3DXWA 3NU8A 2FQ6A 5M4DA 4A6UA 2CANA 1AHYA 3A9XA 2W7KA 2Z9UA 2OKKA 3CAIA 3PD6B 3ELEA 1ARIA 2XH1A 3EI5A 2R5CB 4ADDA 1XI9A 1O69A 3KKIA 1LW5A 4IYOA 4ZDPA 1OHYA 4OTLA 2JJGA 4TV7A 4TN4A 2VMPA 3HDOA 2C44A 2FYFA 3CQ5A 4JEVA 4M2KA 4W1VA 2Z67A 3L8AA 2C0RA 4IXOA 1M7YA 4W1WA 3FZ8A 1CQ6A 1AJRA 5G2PA 4AZJA 5HXXA 1C7NA 2VLHA 2Z9XA 1RVYA 3P1TA 4OYTA 2YKVA 1S06A 2O7CA 5J8QA 2W8TA 1D7RA 2VI9A 2D5YA 2GSAA 3BWNC 4IYOB 3I16A 3NUBA 4F4EA 1SZUA 2XBNA 3COGA 3QHXA 4RITA 2BKWA 3FZ7A 2YRIA 4H51A 3PD6A 3MAFA 5HDMA 2DOUA 3ZZKA 4UHNA 4WP0A 1IVRA 2YKYA 2W7FA 3EI9A 5M46A 1PG8A 1ASNA 2EGYA 1RV4A 4ITXA 2X8UA 1Z3ZA 2VGSA 4W91A 2AY3A 1S08A 2PB0A 5M49A 2HP2A 3G8MA 3IHJA 4K2MA 4KYOA 4E3QA 3TFTA 3ISLA 1N2TA 4MQQA 4A00A 5LHAA 5DJ1A 4NOGA 4R2NA 4JEZA 1W7NA 4XAUA 1SVVA 5EIGB 1UU2A 3CQ4A 3I4JA 2W7LA 2AY4A 3EZ1A 3USFA 2WKAA 3QI6A 4IX8A 4ISYA 4R8DA 2AEVA 2VMZA 2TPLA 2ZUKA 1MDZA 3MAFB 3FFHA 2V1PA 2BIEA 3NU7A 2WK8A 2R5EA 1WKGA 3RI6A 3DYDA 3F9TA 3ZRQA 1W23A 4EB7A 2FNUA 4LW4A 3E9KA 2W7MA 3DZZA 3WGCA 3QM2A 2VMSA 2YOBA 2BWOA 1OXOA 5FT6A 4PVFA 4KXKA 2ZY4A 1T3IA 3MKJA 3L44A 4DGTA 4W1XA 4KAMA 3F6TA 1TOIA 3LVLB 2R5CA 1YJSA 1LC7A 1H0CA 1WYTB 1AAMA 1FG3A 4GE7A 4RM1A 2CH1A 2EZ2A 3N75A 2CSTA 1AJSB 4WB0B 4IXZA 4MQPA 5DX5A 3D6KA 3GSBA 3HBXA 3VAXA 2OQXA 4OBUA 4AO9A 1B8GA 3BWOA 3EI6A 5K8BA 1N8PA 1ASFA 2BWPA 2D65A 4RJ0A 1TOGA 3B1CA 3AEOA 1IX7A 3HLMA 1AKAA 3AEJA 3B46A 3PPLA 5HHYA 3N4SA 1LW4A 3GJUA 3N4XA 3BC8A 2NMPA 1B5OA 1N31A 1MDOA 4TMRA 3VK3A 3PA9A 3BWNA 3E2FA 3AEPA 2W7JA 3AOWA 3N7NA 4PFFA 2ORDA 5FT8A 3DODA 1DJ9A 1S07A 1Z7DA 1DGDA 3PDXA 3R9AA 4B98A 2CJDA 3VK2A 3KE3A 2ZSMA 4ADBA 1AY4A 3NUIA 1ASBA 1J04A 3M5UA 4LC3A 2AEUA 3EZSA 1LC8A 1M0QA 1AMSA 3NX3A 3H14A 3RCHA 4EMYA 3FFRA 3FDBA 3FCRA 1GC0A 2CFBA 3MEBA 1KMKA 3HL2A 3AATA 5EAVA 2BYJA 2BYLA 3FDDA 3NNKA 4A6RA 1MAQA 4ZASA 3LG0A 3FVXA 4ZM4A 2CJHA 3MC6A 4FFCA 3EI8A 3W1HA 2VI8A 1ASMA 4Q76A 2D63A 1OATA 1GCKA 1QZ9A 2ZSLA 4GSAA 4JEYA 3FQAA 1YJYA 4A0HA 3TATA 1D2FA 2JJFA 3FTBA 1AMRA 2JG2A 3EI7A 4OMAA 1VP4A 4BMKA 2GQNA 3WLXA 3G0TA 1BKGA 2BI2A 5E4ZA 1AKBA 1I48A 2C7TA 5EUNA 1BJ4A 1ARHA 1AAWA 1TASA 2W7EA
chains in the Genus database with same CATH topology
3AEJC 1KL2A 1W3UA 1ELQA 4ZAHA 1TPLA 2X3LA 3G7QA 1WKHA 1PMMA 1ARSA 3UAKA 4ZDLA 4A0GA 1QISA 2HORA 1VJOA 3AELA 2AY6A 1WSTA 3H7FA 1TOKA 2QB2A 4HF8A 2YCTA 3E2ZA 4WXFA 3A8UX 1IX6A 4WYEA 5AX8A 5FT4A 2HP1A 2E7JA 1X2AA 1AICA 1MLYA 1DFOA 4RLGA 3TFUA 4XEWA 4RAEA 1MGVA 2V0YA 2AY7A 3RBFA 4CXRA 1AX4A 3RQ1A 4DBCA 4J8LA 1U08A 3VOMA 3ECDA 2WB6A 1BJWA 3DU4A 2Z1YA 3PDBA 2ZY3A 1O61A 2EYQA 2VMWA 1WYUA 4AO4A 4EFFA 3ASAA 1DJUA 1GC4A 2HOYA 3N0LA 5G0AA 3MAUA 2W8JA 4JF1A 2VMOA 1Y4IA 1ZC9A 1BS0A 2YRRA 3FRKA 1GEWA 2VMVA 2VYCA 3LY1A 3JWBA 4N0BA 3ZZJA 1UU0A 1BW0A 2VGWA 1E5FA 1ASDA 2VMQA 3B1EA 4PIWA 3GWPA 2ZY2A 3DR4A 1X28A 2FM1A 4JEWA 2DGLA 5D5SA 2QSRA 4ZWVA 1C7GA 3H9XA 2YHKA 1DGEA 3RBLA 3DC1A 4R5ZA 1V72A 4WBTA 4MQRA 4WLHA 3LV2A 4OC9A 3N4RA 2R0TA 3B1DA 3HVYA 2CB1A 3BN1A 4WYCA 2D61A 2Z20A 1LC5A 1QITA 1B9IA 4ZDOA 4H63Q 1UU1A 4OT8A 2ZYJA 2BI1A 4Y0IA 1QGNA 3NYSA 4A0RA 2W8UA 1FC4A 4Y0DA 3E6GA 2E7UA 2W8WA 2QB3A 3AEMC 1IJIA 2AY2A 2W7GA 3FVSA 5KTBA 2EO5A 4M2JA 4WYGA 5EUEA 2HOXA 4EU1A 1YAAA 3E2YA 1ORDA 3FD0A 4LW2A 2AY5A 3KGWA 8AATA 1GBNA 3KGXA 4IW7A 1ECXA 1YIYA 2CH2A 4F5MA 3A2BA 3BV0A 9AATA 1JG8A 1M0NA 4M2MA 1BJOB 1TARA 2VIAA 4CBRA 4MKKA 4XJLA 2W7IA 3I5TA 2Q7WA 2C81A 3T32A 2AY1A 1W7MA 4Q31A 1CQ7A 1BT4A 1TOJA 2EH6A 4A6TA 2BIAA 2A1VA 1AKCA 2DKBA 1M4NA 3GZCA 4LNLA 2CY8A 3N5MA 2ZY5A 2FKIA 4Q6RA 1AY5A 5EAAA 1SPAA 1OHWA 5EIGA 2RFVA 4HVKA 4CBSA 3K40A 5DJ9A 1ASEA 4EB5A 1M6SA 2G7JA 3DRDA 1JS3A 2QLRA 1CZEA 4O6ZA 4E3RA 1ARTA 2BI5A 1C9CA 4OCAA 3P6KA 4ZWMA 1GD9A 1AIBA 1MAPA 4Y0HA 1AHGA 5JAYA 2VGUA 1ASCA 1CZCA 1V2DA 1YNUA 3AENA 5BJ4A 4ADEA 1D7VA 3TQXA 1CS1A 1ZODA 2DGKA 2HOZA 2VGZA 3NYTA 4WLJA 5E3KA 2FNIA 4F5IA 5IWQA 1G4VA 3PIUA 2D66A 2X5FA 3LWSA 1YIZA 2OGAA 4XJPA 3UWCA 3AENB 2QMAA 1DKAA 4JEXA 4XJMA 2O1BA 1W7LA 4AZKA 1OHVA 1BJOA 2DR1A 2Z1ZA 3CBFA 4W8IA 2EPJA 2W7DA 4MSOA 4GE9A 3NTJA 3JTXA 3GZDC 1X29A 1O4SA 1AHXA 1MDXA 3WCOA 3FVUA 3GZDA 1S0AA 2ZJGA 2YCNA 4RKDA 5F8VA 3HQTA 1XEYA 5DB5A 5G2QA 3MBBA 4F5FA 2VMUA 3K7YA 4UQVA 4ITGA 1I29A 3NRAA 4GDYA 1M0PA 1D7SA 4ATQA 4E1OA 2BHXA 2VLFA 1WYTA 4BA5A 2GMSA 1I41A 3NDNA 2BI9A 3FSLA 5I92A 3GETA 1FG7A 2OATA 5G4IA 3BCAA 1MLZA 3A9YA 1VEFA 1D7UA 1YJZA 5EFSA 4ZLVA 3RUYA 1CL1A 4I8AA 2CINA 2GB3A 2ZC0A 1B5PA 2O0RA 4JE5D 1B9HA 4XQ2A 4ZSWA 2VMTA 3B8XA 1CJ0A 1M32A 3JU7A 4UHOA 4ZM3A 3JWAA 4A0FA 4WD2A 3II0A 4GE4A 1DJEA 2X5DA 5FT5A 2D7YA 1SZKA 1JF9A 2BWNA 1S09A 4B9BA 3LVMA 3PGYA 3FQ7A 4WYFA 2EZ1A 3EIAA 5BJ3A 2OKJA 1EQBA 2CTZA 4RJYA 4LNJA 4MGRA 4QGRA 4U2HA 1YOOA 2JGTA 1KKPA 2F8JA 4AOAA 2Z9VA 2VGTA 1PFFA 2VMXA 3EIBA 1P3WA 5G4JA 3BB8A 3MC6C 3EUCA 2DGMA 5F9SA 1IAXA 4CXQA 1WYVA 1ELUA 3NYUA 3IF2A 4LNMA 1SFFA 3JZLA 1AIAA 5TF5A 4Q75A 1V2FA 1G7WA 2D7ZA 2VMYA 3BS8A 3ATHA 3E77A 4IXSA 3BCXA 2QBTA 1GC3A 1AHFA 3FKDA 1C7OA 1B4XA 2D64A 4IY7A 3VK4A 4A72A 4F5LA 2WK7A 2HZPA 3ASBA 4XJOA 4MKJA 1TOEA 1ASGA 3PAAA 3WY7A 1EG5A 1IBJA 1WYVB 2AY8A 3QPGA 1QJ3A 1ZOBA 3OP7A 3AV7A 2E54A 2OGEA 2ZP7A 2Z9WA 1GDEA 2YCPA 1KMJA 1X0MA 3W1IA 1RVUA 3MADA 5EUDA 4BHDA 4R5FA 3QBOA 4K2BA 3RCHB 4F5JA 1G7XA 3VP6A 2CJGA 1WYUB 2YKXA 4ATPA 1O62A 1CL2A 7AATA 2W7HA 3FQ8A 3FZ6A 1V2EA 3A9ZA 4UHMA 3ACZA 3AEMA 1BJNA 1PMOA 3ELPA 4P7YA 4PFNA 4XK1A 2BIGA 2DKJA 2W8VA 2HUUA 1AHEA 4BA4A 4CVQA 3JW9A 1SF2A 1ASAA 1AY8A 1KKJA 1LKCA 4JE5A 3WGBA 2Z61A 1SZSA 2R2NA 4FL0A 4RKCA 4RIZA 2G6WA 1LK9A 1ARGA 4P3MA 4GEBA 3BCBA 1KL1A 1BQDA 2VMRA 2HUFA 1JS6A 1M0OA 5EQCA 4BQ0A 1I43A 1E5EA 3LVKA 2AATA 2BI3A 2VMNA 3PJ0A 4WXGA 5D95A 1AMAA 5LH9A 4W5KA 2VIBA 2AY9A 4F5HA 3CQ6A 4UOYA 3WKRA 1IX8A 2GMUA 1DTYA 4JF0A 3WX9A 3Q8NA 1TATA 1AJSA 4WB0A 3UE8A 3K28A 1GEXA 4K2IA 4MY5A 3ZRRA 1IUGA 4DQ6A 1LS3A 3GR9A 4U1TA 4N0WA 3GBXA 1C4KA 1OXPA 3ZRPA 4AH3A 1ASLA 3PDBB 4ZSYA 5C6UA 4J5UA 1GEYA 4WYDA 2JISA 3HT4A 1CQ8A 2PO3A 3WCNA 4GRXA 2E7IA 1BQAA 2FN6A 4L0OA 1EJIA 3DXVA 3R4TA 1GC2A 2VGVA 2KFPA 2YKUA 4ADCA 2PB2A 2QA3A 3WZFA 1QIRA 2JJHA 3F0HA 1AMQA 4WXBA 3E2ZB 5E5IA 3WKSA 3QN6A 1H1CA 2JJEA 1UKJA 1RV3A 3HMUA 5M4BA 4OBVA 3OKSA 1QJ5A 5G09A 3AOVA 2HUIA 3TCMA 4WYAA 2WK9A 3LVJA 1J32A 4F5GA 1IAYA 1C0NA 3DR7A 3QGUA 3W1JA 1G4XA 4E77A 4F5KA 4K05A 3DXWA 3NU8A 2FQ6A 5M4DA 4A6UA 2CANA 1AHYA 3A9XA 2W7KA 2Z9UA 2OKKA 3CAIA 3PD6B 3ELEA 1ARIA 2XH1A 3EI5A 2R5CB 4ADDA 1XI9A 1O69A 3KKIA 1LW5A 4IYOA 4ZDPA 1OHYA 4OTLA 2JJGA 4TV7A 4TN4A 2VMPA 3HDOA 2C44A 2FYFA 3CQ5A 4JEVA 4M2KA 4W1VA 2Z67A 3L8AA 2C0RA 4IXOA 1M7YA 4W1WA 3FZ8A 1CQ6A 1AJRA 5G2PA 4AZJA 5HXXA 1C7NA 2VLHA 2Z9XA 1RVYA 3P1TA 4OYTA 2YKVA 1S06A 2O7CA 5J8QA 2W8TA 1D7RA 2VI9A 2D5YA 2GSAA 3BWNC 4IYOB 3I16A 3NUBA 4F4EA 1SZUA 2XBNA 3COGA 3QHXA 4RITA 2BKWA 3FZ7A 2YRIA 4H51A 3PD6A 3MAFA 5HDMA 2DOUA 3ZZKA 4UHNA 4WP0A 1IVRA 2YKYA 2W7FA 3EI9A 5M46A 1PG8A 1ASNA 2EGYA 1RV4A 4ITXA 2X8UA 1Z3ZA 2VGSA 4W91A 2AY3A 1S08A 2PB0A 5M49A 2HP2A 3G8MA 3IHJA 4K2MA 4KYOA 4E3QA 3TFTA 3ISLA 1N2TA 4MQQA 4A00A 5LHAA 5DJ1A 4NOGA 4R2NA 4JEZA 1W7NA 4XAUA 1SVVA 5EIGB 1UU2A 3CQ4A 3I4JA 2W7LA 2AY4A 3EZ1A 3USFA 2WKAA 3QI6A 4IX8A 4ISYA 4R8DA 2AEVA 2VMZA 2TPLA 2ZUKA 1MDZA 3MAFB 3FFHA 2V1PA 2BIEA 3NU7A 2WK8A 2R5EA 1WKGA 3RI6A 3DYDA 3F9TA 3ZRQA 1W23A 4EB7A 2FNUA 4LW4A 3E9KA 2W7MA 3DZZA 3WGCA 3QM2A 2VMSA 2YOBA 2BWOA 1OXOA 5FT6A 4PVFA 4KXKA 2ZY4A 1T3IA 3MKJA 3L44A 4DGTA 4W1XA 4KAMA 3F6TA 1TOIA 3LVLB 2R5CA 1YJSA 1LC7A 1H0CA 1WYTB 1AAMA 1FG3A 4GE7A 4RM1A 2CH1A 2EZ2A 3N75A 2CSTA 1AJSB 4WB0B 4IXZA 4MQPA 5DX5A 3D6KA 3GSBA 3HBXA 3VAXA 2OQXA 4OBUA 4AO9A 1B8GA 3BWOA 3EI6A 5K8BA 1N8PA 1ASFA 2BWPA 2D65A 4RJ0A 1TOGA 3B1CA 3AEOA 1IX7A 3HLMA 1AKAA 3AEJA 3B46A 3PPLA 5HHYA 3N4SA 1LW4A 3GJUA 3N4XA 3BC8A 2NMPA 1B5OA 1N31A 1MDOA 4TMRA 3VK3A 3PA9A 3BWNA 3E2FA 3AEPA 2W7JA 3AOWA 3N7NA 4PFFA 2ORDA 5FT8A 3DODA 1DJ9A 1S07A 1Z7DA 1DGDA 3PDXA 3R9AA 4B98A 2CJDA 3VK2A 3KE3A 2ZSMA 4ADBA 1AY4A 3NUIA 1ASBA 1J04A 3M5UA 4LC3A 2AEUA 3EZSA 1LC8A 1M0QA 1AMSA 3NX3A 3H14A 3RCHA 4EMYA 3FFRA 3FDBA 3FCRA 1GC0A 2CFBA 3MEBA 1KMKA 3HL2A 3AATA 5EAVA 2BYJA 2BYLA 3FDDA 3NNKA 4A6RA 1MAQA 4ZASA 3LG0A 3FVXA 4ZM4A 2CJHA 3MC6A 4FFCA 3EI8A 3W1HA 2VI8A 1ASMA 4Q76A 2D63A 1OATA 1GCKA 1QZ9A 2ZSLA 4GSAA 4JEYA 3FQAA 1YJYA 4A0HA 3TATA 1D2FA 2JJFA 3FTBA 1AMRA 2JG2A 3EI7A 4OMAA 1VP4A 4BMKA 2GQNA 3WLXA 3G0TA 1BKGA 2BI2A 5E4ZA 1AKBA 1I48A 2C7TA 5EUNA 1BJ4A 1ARHA 1AAWA 1TASA 2W7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEJ C;  1KL2 A;  1W3U A;  1ELQ A;  4ZAH A;  1TPL A;  2X3L A;  3G7Q A;  1WKH A;  1PMM A;  1ARS A;  3UAK A;  4ZDL A;  4A0G A;  1QIS A;  2HOR A;  1VJO A;  3AEL A;  2AY6 A;  1WST A;  3H7F A;  1TOK A;  2QB2 A;  4HF8 A;  2YCT A;  3E2Z A;  4WXF A;  3A8U X;  1IX6 A;  4WYE A;  5AX8 A;  5FT4 A;  2HP1 A;  2E7J A;  1X2A A;  1AIC A;  1MLY A;  1DFO A;  4RLG A;  3TFU A;  4XEW A;  4RAE A;  1MGV A;  2V0Y A;  2AY7 A;  3RBF A;  4CXR A;  1AX4 A;  3RQ1 A;  4DBC A;  4J8L A;  1U08 A;  3VOM A;  3ECD A;  1BJW A;  3DU4 A;  2Z1Y A;  3PDB A;  2ZY3 A;  1O61 A;  2VMW A;  1WYU A;  4AO4 A;  4EFF A;  3ASA A;  1DJU A;  1GC4 A;  2HOY A;  3N0L A;  5G0A A;  3MAU A;  2W8J A;  4JF1 A;  2VMO A;  1Y4I A;  1ZC9 A;  1BS0 A;  2YRR A;  3FRK A;  1GEW A;  2VMV A;  2VYC A;  3LY1 A;  3JWB A;  4N0B A;  3ZZJ A;  1UU0 A;  1BW0 A;  2VGW A;  1E5F A;  1ASD A;  2VMQ A;  3B1E A;  4PIW A;  3GWP A;  2ZY2 A;  3DR4 A;  1X28 A;  2FM1 A;  4JEW A;  2DGL A;  5D5S A;  4ZWV A;  1C7G A;  2YHK A;  1DGE A;  3RBL A;  3DC1 A;  4R5Z A;  1V72 A;  4WBT A;  4MQR A;  4WLH A;  3LV2 A;  4OC9 A;  2R0T A;  3B1D A;  3HVY A;  2CB1 A;  3BN1 A;  4WYC A;  2D61 A;  2Z20 A;  1LC5 A;  1QIT A;  1B9I A;  4ZDO A;  1UU1 A;  4OT8 A;  2ZYJ A;  2BI1 A;  4Y0I A;  1QGN A;  3NYS A;  4A0R A;  2W8U A;  1FC4 A;  4Y0D A;  3E6G A;  2E7U A;  2W8W A;  2QB3 A;  3AEM C;  1IJI A;  2AY2 A;  2W7G A;  3FVS A;  2EO5 A;  4M2J A;  4WYG A;  5EUE A;  2HOX A;  4EU1 A;  1YAA A;  3E2Y A;  1ORD A;  3FD0 A;  4LW2 A;  2AY5 A;  3KGW A;  8AAT A;  1GBN A;  3KGX A;  4IW7 A;  1ECX A;  1YIY A;  2CH2 A;  4F5M A;  3A2B A;  3BV0 A;  9AAT A;  1JG8 A;  1M0N A;  4M2M A;  1BJO B;  1TAR A;  2VIA A;  4CBR A;  4MKK A;  4XJL A;  2W7I A;  3I5T A;  2Q7W A;  2C81 A;  3T32 A;  2AY1 A;  1W7M A;  4Q31 A;  1CQ7 A;  1BT4 A;  1TOJ A;  2EH6 A;  4A6T A;  2BIA A;  1AKC A;  2DKB A;  1M4N A;  3GZC A;  4LNL A;  2CY8 A;  3N5M A;  2ZY5 A;  4Q6R A;  1AY5 A;  5EAA A;  1SPA A;  1OHW A;  5EIG A;  2RFV A;  4HVK A;  4CBS A;  3K40 A;  5DJ9 A;  1ASE A;  4EB5 A;  1M6S A;  3DRD A;  1JS3 A;  2QLR A;  1CZE A;  4O6Z A;  4E3R A;  1ART A;  2BI5 A;  1C9C A;  4OCA A;  3P6K A;  4ZWM A;  1GD9 A;  1AIB A;  1MAP A;  4Y0H A;  1AHG A;  5JAY A;  2VGU A;  1ASC A;  1CZC A;  1V2D A;  1YNU A;  3AEN A;  5BJ4 A;  4ADE A;  1D7V A;  3TQX A;  1CS1 A;  1ZOD A;  2DGK A;  2HOZ A;  2VGZ A;  3NYT A;  4WLJ A;  5E3K A;  2FNI A;  4F5I A;  5IWQ A;  1G4V A;  3PIU A;  2D66 A;  2X5F A;  3LWS A;  1YIZ A;  2OGA A;  4XJP A;  3UWC A;  3AEN B;  2QMA A;  1DKA A;  4JEX A;  4XJM A;  2O1B A;  1W7L A;  4AZK A;  1OHV A;  1BJO A;  2DR1 A;  2Z1Z A;  3CBF A;  4W8I A;  2EPJ A;  2W7D A;  4MSO A;  4GE9 A;  3NTJ A;  3JTX A;  3GZD C;  1X29 A;  1O4S A;  1AHX A;  1MDX A;  3WCO A;  3FVU A;  3GZD A;  1S0A A;  2ZJG A;  2YCN A;  4RKD A;  5F8V A;  3HQT A;  1XEY A;  5DB5 A;  5G2Q A;  3MBB A;  4F5F A;  2VMU A;  3K7Y A;  4UQV A;  4ITG A;  1I29 A;  3NRA A;  4GDY A;  1M0P A;  1D7S A;  4ATQ A;  4E1O A;  2BHX A;  2VLF A;  1WYT A;  4BA5 A;  2GMS A;  1I41 A;  3NDN A;  2BI9 A;  3FSL A;  5I92 A;  3GET A;  1FG7 A;  2OAT A;  5G4I A;  3BCA A;  1MLZ A;  3A9Y A;  1VEF A;  1D7U A;  1YJZ A;  5EFS A;  4ZLV A;  3RUY A;  1CL1 A;  4I8A A;  2CIN A;  2GB3 A;  2ZC0 A;  1B5P A;  2O0R A;  4JE5 D;  1B9H A;  4XQ2 A;  4ZSW A;  2VMT A;  3B8X A;  1CJ0 A;  1M32 A;  3JU7 A;  4UHO A;  4ZM3 A;  3JWA A;  4A0F A;  4WD2 A;  3II0 A;  4GE4 A;  1DJE A;  2X5D A;  5FT5 A;  2D7Y A;  1SZK A;  1JF9 A;  2BWN A;  1S09 A;  4B9B A;  3LVM A;  3PGY A;  3FQ7 A;  4WYF A;  2EZ1 A;  3EIA A;  5BJ3 A;  2OKJ A;  1EQB A;  2CTZ A;  4RJY A;  4LNJ A;  4MGR A;  4QGR A;  4U2H A;  1YOO A;  2JGT A;  1KKP A;  2F8J A;  4AOA A;  2Z9V A;  2VGT A;  1PFF A;  2VMX A;  3EIB A;  1P3W A;  5G4J A;  3BB8 A;  3MC6 C;  3EUC A;  2DGM A;  5F9S A;  1IAX A;  4CXQ A;  1WYV A;  1ELU A;  3NYU A;  3IF2 A;  4LNM A;  1SFF A;  3JZL A;  1AIA A;  5TF5 A;  4Q75 A;  1V2F A;  1G7W A;  2D7Z A;  2VMY A;  3BS8 A;  3ATH A;  3E77 A;  4IXS A;  3BCX A;  2QBT A;  1GC3 A;  1AHF A;  3FKD A;  1C7O A;  1B4X A;  2D64 A;  4IY7 A;  3VK4 A;  4A72 A;  4F5L A;  2WK7 A;  2HZP A;  3ASB A;  4XJO A;  4MKJ A;  1TOE A;  1ASG A;  3PAA A;  3WY7 A;  1EG5 A;  1IBJ A;  1WYV B;  2AY8 A;  3QPG A;  1QJ3 A;  1ZOB A;  3OP7 A;  3AV7 A;  2E54 A;  2OGE A;  2ZP7 A;  2Z9W A;  1GDE A;  2YCP A;  1KMJ A;  1X0M A;  3W1I A;  1RVU A;  3MAD A;  5EUD A;  4BHD A;  4R5F A;  3QBO A;  4K2B A;  3RCH B;  4F5J A;  1G7X A;  3VP6 A;  2CJG A;  1WYU B;  2YKX A;  4ATP A;  1O62 A;  1CL2 A;  7AAT A;  2W7H A;  3FQ8 A;  3FZ6 A;  1V2E A;  3A9Z A;  4UHM A;  3ACZ A;  3AEM A;  1BJN A;  1PMO A;  3ELP A;  4P7Y A;  4PFN A;  4XK1 A;  2BIG A;  2DKJ A;  2W8V A;  2HUU A;  1AHE A;  4BA4 A;  4CVQ A;  3JW9 A;  1SF2 A;  1ASA A;  1AY8 A;  1KKJ A;  1LKC A;  4JE5 A;  3WGB A;  2Z61 A;  1SZS A;  2R2N A;  4FL0 A;  4RKC A;  4RIZ A;  2G6W A;  1LK9 A;  1ARG A;  4P3M A;  4GEB A;  3BCB A;  1KL1 A;  1BQD A;  2VMR A;  2HUF A;  1JS6 A;  1M0O A;  5EQC A;  4BQ0 A;  1I43 A;  1E5E A;  3LVK A;  2AAT A;  2BI3 A;  2VMN A;  3PJ0 A;  4WXG A;  5D95 A;  1AMA A;  5LH9 A;  4W5K A;  2VIB A;  2AY9 A;  4F5H A;  3CQ6 A;  4UOY A;  3WKR A;  1IX8 A;  2GMU A;  1DTY A;  4JF0 A;  3WX9 A;  3Q8N A;  1TAT A;  1AJS A;  4WB0 A;  3UE8 A;  3K28 A;  1GEX A;  4K2I A;  4MY5 A;  3ZRR A;  1IUG A;  4DQ6 A;  1LS3 A;  3GR9 A;  4U1T A;  4N0W A;  3GBX A;  1C4K A;  1OXP A;  3ZRP A;  4AH3 A;  1ASL A;  3PDB B;  4ZSY A;  5C6U A;  4J5U A;  1GEY A;  4WYD A;  2JIS A;  3HT4 A;  1CQ8 A;  2PO3 A;  3WCN A;  4GRX A;  2E7I A;  1BQA A;  2FN6 A;  4L0O A;  1EJI A;  3DXV A;  3R4T A;  1GC2 A;  2VGV A;  2YKU A;  4ADC A;  2PB2 A;  2QA3 A;  3WZF A;  1QIR A;  2JJH A;  3F0H A;  1AMQ A;  4WXB A;  3E2Z B;  5E5I A;  3WKS A;  3QN6 A;  1H1C A;  2JJE A;  1UKJ A;  1RV3 A;  3HMU A;  5M4B A;  4OBV A;  3OKS A;  1QJ5 A;  5G09 A;  3AOV A;  2HUI A;  3TCM A;  4WYA A;  2WK9 A;  3LVJ A;  1J32 A;  4F5G A;  1IAY A;  1C0N A;  3DR7 A;  3QGU A;  3W1J A;  1G4X A;  4E77 A;  4F5K A;  3DXW A;  3NU8 A;  2FQ6 A;  5M4D A;  4A6U A;  2CAN A;  1AHY A;  3A9X A;  2W7K A;  2Z9U A;  2OKK A;  3CAI A;  3PD6 B;  3ELE A;  1ARI A;  2XH1 A;  3EI5 A;  2R5C B;  4ADD A;  1XI9 A;  1O69 A;  3KKI A;  1LW5 A;  4IYO A;  4ZDP A;  1OHY A;  4OTL A;  2JJG A;  4TV7 A;  4TN4 A;  2VMP A;  3HDO A;  2C44 A;  2FYF A;  3CQ5 A;  4JEV A;  4M2K A;  4W1V A;  2Z67 A;  3L8A A;  2C0R A;  4IXO A;  1M7Y A;  4W1W A;  3FZ8 A;  1CQ6 A;  1AJR A;  5G2P A;  4AZJ A;  5HXX A;  1C7N A;  2VLH A;  2Z9X A;  1RVY A;  3P1T A;  4OYT A;  2YKV A;  1S06 A;  2O7C A;  5J8Q A;  2W8T A;  1D7R A;  2VI9 A;  2D5Y A;  2GSA A;  3BWN C;  4IYO B;  3I16 A;  3NUB A;  4F4E A;  1SZU A;  2XBN A;  3COG A;  3QHX A;  4RIT A;  2BKW A;  3FZ7 A;  2YRI A;  4H51 A;  3PD6 A;  3MAF A;  5HDM A;  2DOU A;  3ZZK A;  4UHN A;  4WP0 A;  1IVR A;  2YKY A;  2W7F A;  3EI9 A;  5M46 A;  1PG8 A;  1ASN A;  2EGY A;  1RV4 A;  4ITX A;  2X8U A;  1Z3Z A;  2VGS A;  4W91 A;  2AY3 A;  1S08 A;  2PB0 A;  5M49 A;  2HP2 A;  3G8M A;  3IHJ A;  4K2M A;  4KYO A;  4E3Q A;  3TFT A;  3ISL A;  1N2T A;  4MQQ A;  4A00 A;  5LHA A;  5DJ1 A;  4NOG A;  4R2N A;  4JEZ A;  1W7N A;  4XAU A;  1SVV A;  5EIG B;  1UU2 A;  3CQ4 A;  3I4J A;  2W7L A;  2AY4 A;  3EZ1 A;  3USF A;  2WKA A;  3QI6 A;  4IX8 A;  4ISY A;  4R8D A;  2AEV A;  2VMZ A;  2TPL A;  2ZUK A;  1MDZ A;  3MAF B;  3FFH A;  2V1P A;  2BIE A;  3NU7 A;  2WK8 A;  2R5E A;  1WKG A;  3RI6 A;  3DYD A;  3F9T A;  3ZRQ A;  1W23 A;  4EB7 A;  2FNU A;  4LW4 A;  3E9K A;  2W7M A;  3DZZ A;  3WGC A;  3QM2 A;  2VMS A;  2YOB A;  2BWO A;  1OXO A;  5FT6 A;  4PVF A;  4KXK A;  2ZY4 A;  1T3I A;  3MKJ A;  3L44 A;  4DGT A;  4W1X A;  4KAM A;  3F6T A;  1TOI A;  3LVL B;  2R5C A;  1YJS A;  1LC7 A;  1H0C A;  1WYT B;  1AAM A;  1FG3 A;  4GE7 A;  4RM1 A;  2CH1 A;  2EZ2 A;  3N75 A;  2CST A;  1AJS B;  4WB0 B;  4IXZ A;  4MQP A;  5DX5 A;  3D6K A;  3GSB A;  3HBX A;  3VAX A;  2OQX A;  4OBU A;  4AO9 A;  1B8G A;  3BWO A;  3EI6 A;  5K8B A;  1N8P A;  1ASF A;  2BWP A;  2D65 A;  4RJ0 A;  1TOG A;  3B1C A;  3AEO A;  1IX7 A;  3HLM A;  1AKA A;  3AEJ A;  3B46 A;  3PPL A;  5HHY A;  1LW4 A;  3GJU A;  3BC8 A;  2NMP A;  1B5O A;  1N31 A;  1MDO A;  4TMR A;  3VK3 A;  3PA9 A;  3BWN A;  3E2F A;  3AEP A;  2W7J A;  3AOW A;  4PFF A;  2ORD A;  5FT8 A;  3DOD A;  1DJ9 A;  1S07 A;  1Z7D A;  1DGD A;  3PDX A;  3R9A A;  4B98 A;  2CJD A;  3VK2 A;  3KE3 A;  2ZSM A;  4ADB A;  1AY4 A;  3NUI A;  1ASB A;  1J04 A;  3M5U A;  4LC3 A;  2AEU A;  3EZS A;  1LC8 A;  1M0Q A;  1AMS A;  3NX3 A;  3H14 A;  3RCH A;  4EMY A;  3FFR A;  3FDB A;  3FCR A;  1GC0 A;  2CFB A;  3MEB A;  1KMK A;  3HL2 A;  3AAT A;  5EAV A;  2BYJ A;  2BYL A;  3FDD A;  3NNK A;  4A6R A;  1MAQ A;  4ZAS A;  3LG0 A;  3FVX A;  4ZM4 A;  2CJH A;  3MC6 A;  4FFC A;  3EI8 A;  3W1H A;  2VI8 A;  1ASM A;  4Q76 A;  2D63 A;  1OAT A;  1GCK A;  1QZ9 A;  2ZSL A;  4GSA A;  4JEY A;  3FQA A;  1YJY A;  4A0H A;  3TAT A;  1D2F A;  2JJF A;  3FTB A;  1AMR A;  2JG2 A;  3EI7 A;  4OMA A;  1VP4 A;  4BMK A;  2GQN A;  3WLX A;  3G0T A;  1BKG A;  2BI2 A;  5E4Z A;  1AKB A;  1I48 A;  2C7T A;  5EUN A;  1BJ4 A;  1ARH A;  1AAW A;  1TAS A;  2W7E A; 
#chains in the Genus database with same CATH topology
 3AEJ C;  1KL2 A;  1W3U A;  1ELQ A;  4ZAH A;  1TPL A;  2X3L A;  3G7Q A;  1WKH A;  1PMM A;  1ARS A;  1KAF A;  3UAK A;  4ZDL A;  4A0G A;  1QIS A;  2HOR A;  1VJO A;  3AEL A;  2AY6 A;  1WST A;  3H7F A;  1TOK A;  2QB2 A;  4HF8 A;  2YCT A;  3E2Z A;  4WXF A;  3A8U X;  1IX6 A;  4WYE A;  5AX8 A;  5FT4 A;  2HP1 A;  2E7J A;  1X2A A;  1AIC A;  1MLY A;  1DFO A;  4RLG A;  3TFU A;  4XEW A;  4RAE A;  1MGV A;  2V0Y A;  2AY7 A;  3RBF A;  4CXR A;  1AX4 A;  3RQ1 A;  4DBC A;  4J8L A;  1U08 A;  3VOM A;  3ECD A;  2WB6 A;  1BJW A;  3DU4 A;  2Z1Y A;  3PDB A;  2ZY3 A;  1O61 A;  2EYQ A;  2VMW A;  1WYU A;  4AO4 A;  4EFF A;  3ASA A;  1DJU A;  1GC4 A;  2HOY A;  3N0L A;  5G0A A;  3MAU A;  2W8J A;  4JF1 A;  2VMO A;  1Y4I A;  1ZC9 A;  1BS0 A;  2YRR A;  3FRK A;  1GEW A;  2VMV A;  2VYC A;  3LY1 A;  3JWB A;  4N0B A;  3ZZJ A;  1UU0 A;  1BW0 A;  2VGW A;  1E5F A;  1ASD A;  2VMQ A;  3B1E A;  4PIW A;  3GWP A;  2ZY2 A;  3DR4 A;  1X28 A;  2FM1 A;  4JEW A;  2DGL A;  5D5S A;  2QSR A;  4ZWV A;  1C7G A;  3H9X A;  2YHK A;  1DGE A;  3RBL A;  3DC1 A;  4R5Z A;  1V72 A;  4WBT A;  4MQR A;  4WLH A;  3LV2 A;  4OC9 A;  3N4R A;  2R0T A;  3B1D A;  3HVY A;  2CB1 A;  3BN1 A;  4WYC A;  2D61 A;  2Z20 A;  1LC5 A;  1QIT A;  1B9I A;  4ZDO A;  4H63 Q;  1UU1 A;  4OT8 A;  2ZYJ A;  2BI1 A;  4Y0I A;  1QGN A;  3NYS A;  4A0R A;  2W8U A;  1FC4 A;  4Y0D A;  3E6G A;  2E7U A;  2W8W A;  2QB3 A;  3AEM C;  1IJI A;  2AY2 A;  2W7G A;  3FVS A;  5KTB A;  2EO5 A;  4M2J A;  4WYG A;  5EUE A;  2HOX A;  4EU1 A;  1YAA A;  3E2Y A;  1ORD A;  3FD0 A;  4LW2 A;  2AY5 A;  3KGW A;  8AAT A;  1GBN A;  3KGX A;  4IW7 A;  1ECX A;  1YIY A;  2CH2 A;  4F5M A;  3A2B A;  3BV0 A;  9AAT A;  1JG8 A;  1M0N A;  4M2M A;  1BJO B;  1TAR A;  2VIA A;  4CBR A;  4MKK A;  4XJL A;  2W7I A;  3I5T A;  2Q7W A;  2C81 A;  3T32 A;  2AY1 A;  1W7M A;  4Q31 A;  1CQ7 A;  1BT4 A;  1TOJ A;  2EH6 A;  4A6T A;  2BIA A;  2A1V A;  1AKC A;  2DKB A;  1M4N A;  3GZC A;  4LNL A;  2CY8 A;  3N5M A;  2ZY5 A;  2FKI A;  4Q6R A;  1AY5 A;  5EAA A;  1SPA A;  1OHW A;  5EIG A;  2RFV A;  4HVK A;  4CBS A;  3K40 A;  5DJ9 A;  1ASE A;  4EB5 A;  1M6S A;  2G7J A;  3DRD A;  1JS3 A;  2QLR A;  1CZE A;  4O6Z A;  4E3R A;  1ART A;  2BI5 A;  1C9C A;  4OCA A;  3P6K A;  4ZWM A;  1GD9 A;  1AIB A;  1MAP A;  4Y0H A;  1AHG A;  5JAY A;  2VGU A;  1ASC A;  1CZC A;  1V2D A;  1YNU A;  3AEN A;  5BJ4 A;  4ADE A;  1D7V A;  3TQX A;  1CS1 A;  1ZOD A;  2DGK A;  2HOZ A;  2VGZ A;  3NYT A;  4WLJ A;  5E3K A;  2FNI A;  4F5I A;  5IWQ A;  1G4V A;  3PIU A;  2D66 A;  2X5F A;  3LWS A;  1YIZ A;  2OGA A;  4XJP A;  3UWC A;  3AEN B;  2QMA A;  1DKA A;  4JEX A;  4XJM A;  2O1B A;  1W7L A;  4AZK A;  1OHV A;  1BJO A;  2DR1 A;  2Z1Z A;  3CBF A;  4W8I A;  2EPJ A;  2W7D A;  4MSO A;  4GE9 A;  3NTJ A;  3JTX A;  3GZD C;  1X29 A;  1O4S A;  1AHX A;  1MDX A;  3WCO A;  3FVU A;  3GZD A;  1S0A A;  2ZJG A;  2YCN A;  4RKD A;  5F8V A;  3HQT A;  1XEY A;  5DB5 A;  5G2Q A;  3MBB A;  4F5F A;  2VMU A;  3K7Y A;  4UQV A;  4ITG A;  1I29 A;  3NRA A;  4GDY A;  1M0P A;  1D7S A;  4ATQ A;  4E1O A;  2BHX A;  2VLF A;  1WYT A;  4BA5 A;  2GMS A;  1I41 A;  3NDN A;  2BI9 A;  3FSL A;  5I92 A;  3GET A;  1FG7 A;  2OAT A;  5G4I A;  3BCA A;  1MLZ A;  3A9Y A;  1VEF A;  1D7U A;  1YJZ A;  5EFS A;  4ZLV A;  3RUY A;  1CL1 A;  4I8A A;  2CIN A;  2GB3 A;  2ZC0 A;  1B5P A;  2O0R A;  4JE5 D;  1B9H A;  4XQ2 A;  4ZSW A;  2VMT A;  3B8X A;  1CJ0 A;  1M32 A;  3JU7 A;  4UHO A;  4ZM3 A;  3JWA A;  4A0F A;  4WD2 A;  3II0 A;  4GE4 A;  1DJE A;  2X5D A;  5FT5 A;  2D7Y A;  1SZK A;  1JF9 A;  2BWN A;  1S09 A;  4B9B A;  3LVM A;  3PGY A;  3FQ7 A;  4WYF A;  2EZ1 A;  3EIA A;  5BJ3 A;  2OKJ A;  1EQB A;  2CTZ A;  4RJY A;  4LNJ A;  4MGR A;  4QGR A;  4U2H A;  1YOO A;  2JGT A;  1KKP A;  2F8J A;  4AOA A;  2Z9V A;  2VGT A;  1PFF A;  2VMX A;  3EIB A;  1P3W A;  5G4J A;  3BB8 A;  3MC6 C;  3EUC A;  2DGM A;  5F9S A;  1IAX A;  4CXQ A;  1WYV A;  1ELU A;  3NYU A;  3IF2 A;  4LNM A;  1SFF A;  3JZL A;  1AIA A;  5TF5 A;  4Q75 A;  1V2F A;  1G7W A;  2D7Z A;  2VMY A;  3BS8 A;  3ATH A;  3E77 A;  4IXS A;  3BCX A;  2QBT A;  1GC3 A;  1AHF A;  3FKD A;  1C7O A;  1B4X A;  2D64 A;  4IY7 A;  3VK4 A;  4A72 A;  4F5L A;  2WK7 A;  2HZP A;  3ASB A;  4XJO A;  4MKJ A;  1TOE A;  1ASG A;  3PAA A;  3WY7 A;  1EG5 A;  1IBJ A;  1WYV B;  2AY8 A;  3QPG A;  1QJ3 A;  1ZOB A;  3OP7 A;  3AV7 A;  2E54 A;  2OGE A;  2ZP7 A;  2Z9W A;  1GDE A;  2YCP A;  1KMJ A;  1X0M A;  3W1I A;  1RVU A;  3MAD A;  5EUD A;  4BHD A;  4R5F A;  3QBO A;  4K2B A;  3RCH B;  4F5J A;  1G7X A;  3VP6 A;  2CJG A;  1WYU B;  2YKX A;  4ATP A;  1O62 A;  1CL2 A;  7AAT A;  2W7H A;  3FQ8 A;  3FZ6 A;  1V2E A;  3A9Z A;  4UHM A;  3ACZ A;  3AEM A;  1BJN A;  1PMO A;  3ELP A;  4P7Y A;  4PFN A;  4XK1 A;  2BIG A;  2DKJ A;  2W8V A;  2HUU A;  1AHE A;  4BA4 A;  4CVQ A;  3JW9 A;  1SF2 A;  1ASA A;  1AY8 A;  1KKJ A;  1LKC A;  4JE5 A;  3WGB A;  2Z61 A;  1SZS A;  2R2N A;  4FL0 A;  4RKC A;  4RIZ A;  2G6W A;  1LK9 A;  1ARG A;  4P3M A;  4GEB A;  3BCB A;  1KL1 A;  1BQD A;  2VMR A;  2HUF A;  1JS6 A;  1M0O A;  5EQC A;  4BQ0 A;  1I43 A;  1E5E A;  3LVK A;  2AAT A;  2BI3 A;  2VMN A;  3PJ0 A;  4WXG A;  5D95 A;  1AMA A;  5LH9 A;  4W5K A;  2VIB A;  2AY9 A;  4F5H A;  3CQ6 A;  4UOY A;  3WKR A;  1IX8 A;  2GMU A;  1DTY A;  4JF0 A;  3WX9 A;  3Q8N A;  1TAT A;  1AJS A;  4WB0 A;  3UE8 A;  3K28 A;  1GEX A;  4K2I A;  4MY5 A;  3ZRR A;  1IUG A;  4DQ6 A;  1LS3 A;  3GR9 A;  4U1T A;  4N0W A;  3GBX A;  1C4K A;  1OXP A;  3ZRP A;  4AH3 A;  1ASL A;  3PDB B;  4ZSY A;  5C6U A;  4J5U A;  1GEY A;  4WYD A;  2JIS A;  3HT4 A;  1CQ8 A;  2PO3 A;  3WCN A;  4GRX A;  2E7I A;  1BQA A;  2FN6 A;  4L0O A;  1EJI A;  3DXV A;  3R4T A;  1GC2 A;  2VGV A;  2KFP A;  2YKU A;  4ADC A;  2PB2 A;  2QA3 A;  3WZF A;  1QIR A;  2JJH A;  3F0H A;  1AMQ A;  4WXB A;  3E2Z B;  5E5I A;  3WKS A;  3QN6 A;  1H1C A;  2JJE A;  1UKJ A;  1RV3 A;  3HMU A;  5M4B A;  4OBV A;  3OKS A;  1QJ5 A;  5G09 A;  3AOV A;  2HUI A;  3TCM A;  4WYA A;  2WK9 A;  3LVJ A;  1J32 A;  4F5G A;  1IAY A;  1C0N A;  3DR7 A;  3QGU A;  3W1J A;  1G4X A;  4E77 A;  4F5K A;  4K05 A;  3DXW A;  3NU8 A;  2FQ6 A;  5M4D A;  4A6U A;  2CAN A;  1AHY A;  3A9X A;  2W7K A;  2Z9U A;  2OKK A;  3CAI A;  3PD6 B;  3ELE A;  1ARI A;  2XH1 A;  3EI5 A;  2R5C B;  4ADD A;  1XI9 A;  1O69 A;  3KKI A;  1LW5 A;  4IYO A;  4ZDP A;  1OHY A;  4OTL A;  2JJG A;  4TV7 A;  4TN4 A;  2VMP A;  3HDO A;  2C44 A;  2FYF A;  3CQ5 A;  4JEV A;  4M2K A;  4W1V A;  2Z67 A;  3L8A A;  2C0R A;  4IXO A;  1M7Y A;  4W1W A;  3FZ8 A;  1CQ6 A;  1AJR A;  5G2P A;  4AZJ A;  5HXX A;  1C7N A;  2VLH A;  2Z9X A;  1RVY A;  3P1T A;  4OYT A;  2YKV A;  1S06 A;  2O7C A;  5J8Q A;  2W8T A;  1D7R A;  2VI9 A;  2D5Y A;  2GSA A;  3BWN C;  4IYO B;  3I16 A;  3NUB A;  4F4E A;  1SZU A;  2XBN A;  3COG A;  3QHX A;  4RIT A;  2BKW A;  3FZ7 A;  2YRI A;  4H51 A;  3PD6 A;  3MAF A;  5HDM A;  2DOU A;  3ZZK A;  4UHN A;  4WP0 A;  1IVR A;  2YKY A;  2W7F A;  3EI9 A;  5M46 A;  1PG8 A;  1ASN A;  2EGY A;  1RV4 A;  4ITX A;  2X8U A;  1Z3Z A;  2VGS A;  4W91 A;  2AY3 A;  1S08 A;  2PB0 A;  5M49 A;  2HP2 A;  3G8M A;  3IHJ A;  4K2M A;  4KYO A;  4E3Q A;  3TFT A;  3ISL A;  1N2T A;  4MQQ A;  4A00 A;  5LHA A;  5DJ1 A;  4NOG A;  4R2N A;  4JEZ A;  1W7N A;  4XAU A;  1SVV A;  5EIG B;  1UU2 A;  3CQ4 A;  3I4J A;  2W7L A;  2AY4 A;  3EZ1 A;  3USF A;  2WKA A;  3QI6 A;  4IX8 A;  4ISY A;  4R8D A;  2AEV A;  2VMZ A;  2TPL A;  2ZUK A;  1MDZ A;  3MAF B;  3FFH A;  2V1P A;  2BIE A;  3NU7 A;  2WK8 A;  2R5E A;  1WKG A;  3RI6 A;  3DYD A;  3F9T A;  3ZRQ A;  1W23 A;  4EB7 A;  2FNU A;  4LW4 A;  3E9K A;  2W7M A;  3DZZ A;  3WGC A;  3QM2 A;  2VMS A;  2YOB A;  2BWO A;  1OXO A;  5FT6 A;  4PVF A;  4KXK A;  2ZY4 A;  1T3I A;  3MKJ A;  3L44 A;  4DGT A;  4W1X A;  4KAM A;  3F6T A;  1TOI A;  3LVL B;  2R5C A;  1YJS A;  1LC7 A;  1H0C A;  1WYT B;  1AAM A;  1FG3 A;  4GE7 A;  4RM1 A;  2CH1 A;  2EZ2 A;  3N75 A;  2CST A;  1AJS B;  4WB0 B;  4IXZ A;  4MQP A;  5DX5 A;  3D6K A;  3GSB A;  3HBX A;  3VAX A;  2OQX A;  4OBU A;  4AO9 A;  1B8G A;  3BWO A;  3EI6 A;  5K8B A;  1N8P A;  1ASF A;  2BWP A;  2D65 A;  4RJ0 A;  1TOG A;  3B1C A;  3AEO A;  1IX7 A;  3HLM A;  1AKA A;  3AEJ A;  3B46 A;  3PPL A;  5HHY A;  3N4S A;  1LW4 A;  3GJU A;  3N4X A;  3BC8 A;  2NMP A;  1B5O A;  1N31 A;  1MDO A;  4TMR A;  3VK3 A;  3PA9 A;  3BWN A;  3E2F A;  3AEP A;  2W7J A;  3AOW A;  3N7N A;  4PFF A;  2ORD A;  5FT8 A;  3DOD A;  1DJ9 A;  1S07 A;  1Z7D A;  1DGD A;  3PDX A;  3R9A A;  4B98 A;  2CJD A;  3VK2 A;  3KE3 A;  2ZSM A;  4ADB A;  1AY4 A;  3NUI A;  1ASB A;  1J04 A;  3M5U A;  4LC3 A;  2AEU A;  3EZS A;  1LC8 A;  1M0Q A;  1AMS A;  3NX3 A;  3H14 A;  3RCH A;  4EMY A;  3FFR A;  3FDB A;  3FCR A;  1GC0 A;  2CFB A;  3MEB A;  1KMK A;  3HL2 A;  3AAT A;  5EAV A;  2BYJ A;  2BYL A;  3FDD A;  3NNK A;  4A6R A;  1MAQ A;  4ZAS A;  3LG0 A;  3FVX A;  4ZM4 A;  2CJH A;  3MC6 A;  4FFC A;  3EI8 A;  3W1H A;  2VI8 A;  1ASM A;  4Q76 A;  2D63 A;  1OAT A;  1GCK A;  1QZ9 A;  2ZSL A;  4GSA A;  4JEY A;  3FQA A;  1YJY A;  4A0H A;  3TAT A;  1D2F A;  2JJF A;  3FTB A;  1AMR A;  2JG2 A;  3EI7 A;  4OMA A;  1VP4 A;  4BMK A;  2GQN A;  3WLX A;  3G0T A;  1BKG A;  2BI2 A;  5E4Z A;  1AKB A;  1I48 A;  2C7T A;  5EUN A;  1BJ4 A;  1ARH A;  1AAW A;  1TAS A;  2W7E A; 
#chains in the Genus database with same CATH homology
 3AEJ C;  1KL2 A;  1W3U A;  1ELQ A;  4ZAH A;  1TPL A;  2X3L A;  3G7Q A;  1WKH A;  1PMM A;  1ARS A;  3UAK A;  4ZDL A;  4A0G A;  1QIS A;  2HOR A;  1VJO A;  3AEL A;  2AY6 A;  1WST A;  3H7F A;  1TOK A;  2QB2 A;  4HF8 A;  2YCT A;  3E2Z A;  4WXF A;  3A8U X;  1IX6 A;  4WYE A;  5AX8 A;  5FT4 A;  2HP1 A;  2E7J A;  1X2A A;  1AIC A;  1MLY A;  1DFO A;  4RLG A;  3TFU A;  4XEW A;  4RAE A;  1MGV A;  2V0Y A;  2AY7 A;  3RBF A;  4CXR A;  1AX4 A;  3RQ1 A;  4DBC A;  4J8L A;  1U08 A;  3VOM A;  3ECD A;  2WB6 A;  1BJW A;  3DU4 A;  2Z1Y A;  3PDB A;  2ZY3 A;  1O61 A;  2EYQ A;  2VMW A;  1WYU A;  4AO4 A;  4EFF A;  3ASA A;  1DJU A;  1GC4 A;  2HOY A;  3N0L A;  5G0A A;  3MAU A;  2W8J A;  4JF1 A;  2VMO A;  1Y4I A;  1ZC9 A;  1BS0 A;  2YRR A;  3FRK A;  1GEW A;  2VMV A;  2VYC A;  3LY1 A;  3JWB A;  4N0B A;  3ZZJ A;  1UU0 A;  1BW0 A;  2VGW A;  1E5F A;  1ASD A;  2VMQ A;  3B1E A;  4PIW A;  3GWP A;  2ZY2 A;  3DR4 A;  1X28 A;  2FM1 A;  4JEW A;  2DGL A;  5D5S A;  2QSR A;  4ZWV A;  1C7G A;  3H9X A;  2YHK A;  1DGE A;  3RBL A;  3DC1 A;  4R5Z A;  1V72 A;  4WBT A;  4MQR A;  4WLH A;  3LV2 A;  4OC9 A;  3N4R A;  2R0T A;  3B1D A;  3HVY A;  2CB1 A;  3BN1 A;  4WYC A;  2D61 A;  2Z20 A;  1LC5 A;  1QIT A;  1B9I A;  4ZDO A;  4H63 Q;  1UU1 A;  4OT8 A;  2ZYJ A;  2BI1 A;  4Y0I A;  1QGN A;  3NYS A;  4A0R A;  2W8U A;  1FC4 A;  4Y0D A;  3E6G A;  2E7U A;  2W8W A;  2QB3 A;  3AEM C;  1IJI A;  2AY2 A;  2W7G A;  3FVS A;  5KTB A;  2EO5 A;  4M2J A;  4WYG A;  5EUE A;  2HOX A;  4EU1 A;  1YAA A;  3E2Y A;  1ORD A;  3FD0 A;  4LW2 A;  2AY5 A;  3KGW A;  8AAT A;  1GBN A;  3KGX A;  4IW7 A;  1ECX A;  1YIY A;  2CH2 A;  4F5M A;  3A2B A;  3BV0 A;  9AAT A;  1JG8 A;  1M0N A;  4M2M A;  1BJO B;  1TAR A;  2VIA A;  4CBR A;  4MKK A;  4XJL A;  2W7I A;  3I5T A;  2Q7W A;  2C81 A;  3T32 A;  2AY1 A;  1W7M A;  4Q31 A;  1CQ7 A;  1BT4 A;  1TOJ A;  2EH6 A;  4A6T A;  2BIA A;  2A1V A;  1AKC A;  2DKB A;  1M4N A;  3GZC A;  4LNL A;  2CY8 A;  3N5M A;  2ZY5 A;  2FKI A;  4Q6R A;  1AY5 A;  5EAA A;  1SPA A;  1OHW A;  5EIG A;  2RFV A;  4HVK A;  4CBS A;  3K40 A;  5DJ9 A;  1ASE A;  4EB5 A;  1M6S A;  2G7J A;  3DRD A;  1JS3 A;  2QLR A;  1CZE A;  4O6Z A;  4E3R A;  1ART A;  2BI5 A;  1C9C A;  4OCA A;  3P6K A;  4ZWM A;  1GD9 A;  1AIB A;  1MAP A;  4Y0H A;  1AHG A;  5JAY A;  2VGU A;  1ASC A;  1CZC A;  1V2D A;  1YNU A;  3AEN A;  5BJ4 A;  4ADE A;  1D7V A;  3TQX A;  1CS1 A;  1ZOD A;  2DGK A;  2HOZ A;  2VGZ A;  3NYT A;  4WLJ A;  5E3K A;  2FNI A;  4F5I A;  5IWQ A;  1G4V A;  3PIU A;  2D66 A;  2X5F A;  3LWS A;  1YIZ A;  2OGA A;  4XJP A;  3UWC A;  3AEN B;  2QMA A;  1DKA A;  4JEX A;  4XJM A;  2O1B A;  1W7L A;  4AZK A;  1OHV A;  1BJO A;  2DR1 A;  2Z1Z A;  3CBF A;  4W8I A;  2EPJ A;  2W7D A;  4MSO A;  4GE9 A;  3NTJ A;  3JTX A;  3GZD C;  1X29 A;  1O4S A;  1AHX A;  1MDX A;  3WCO A;  3FVU A;  3GZD A;  1S0A A;  2ZJG A;  2YCN A;  4RKD A;  5F8V A;  3HQT A;  1XEY A;  5DB5 A;  5G2Q A;  3MBB A;  4F5F A;  2VMU A;  3K7Y A;  4UQV A;  4ITG A;  1I29 A;  3NRA A;  4GDY A;  1M0P A;  1D7S A;  4ATQ A;  4E1O A;  2BHX A;  2VLF A;  1WYT A;  4BA5 A;  2GMS A;  1I41 A;  3NDN A;  2BI9 A;  3FSL A;  5I92 A;  3GET A;  1FG7 A;  2OAT A;  5G4I A;  3BCA A;  1MLZ A;  3A9Y A;  1VEF A;  1D7U A;  1YJZ A;  5EFS A;  4ZLV A;  3RUY A;  1CL1 A;  4I8A A;  2CIN A;  2GB3 A;  2ZC0 A;  1B5P A;  2O0R A;  4JE5 D;  1B9H A;  4XQ2 A;  4ZSW A;  2VMT A;  3B8X A;  1CJ0 A;  1M32 A;  3JU7 A;  4UHO A;  4ZM3 A;  3JWA A;  4A0F A;  4WD2 A;  3II0 A;  4GE4 A;  1DJE A;  2X5D A;  5FT5 A;  2D7Y A;  1SZK A;  1JF9 A;  2BWN A;  1S09 A;  4B9B A;  3LVM A;  3PGY A;  3FQ7 A;  4WYF A;  2EZ1 A;  3EIA A;  5BJ3 A;  2OKJ A;  1EQB A;  2CTZ A;  4RJY A;  4LNJ A;  4MGR A;  4QGR A;  4U2H A;  1YOO A;  2JGT A;  1KKP A;  2F8J A;  4AOA A;  2Z9V A;  2VGT A;  1PFF A;  2VMX A;  3EIB A;  1P3W A;  5G4J A;  3BB8 A;  3MC6 C;  3EUC A;  2DGM A;  5F9S A;  1IAX A;  4CXQ A;  1WYV A;  1ELU A;  3NYU A;  3IF2 A;  4LNM A;  1SFF A;  3JZL A;  1AIA A;  5TF5 A;  4Q75 A;  1V2F A;  1G7W A;  2D7Z A;  2VMY A;  3BS8 A;  3ATH A;  3E77 A;  4IXS A;  3BCX A;  2QBT A;  1GC3 A;  1AHF A;  3FKD A;  1C7O A;  1B4X A;  2D64 A;  4IY7 A;  3VK4 A;  4A72 A;  4F5L A;  2WK7 A;  2HZP A;  3ASB A;  4XJO A;  4MKJ A;  1TOE A;  1ASG A;  3PAA A;  3WY7 A;  1EG5 A;  1IBJ A;  1WYV B;  2AY8 A;  3QPG A;  1QJ3 A;  1ZOB A;  3OP7 A;  3AV7 A;  2E54 A;  2OGE A;  2ZP7 A;  2Z9W A;  1GDE A;  2YCP A;  1KMJ A;  1X0M A;  3W1I A;  1RVU A;  3MAD A;  5EUD A;  4BHD A;  4R5F A;  3QBO A;  4K2B A;  3RCH B;  4F5J A;  1G7X A;  3VP6 A;  2CJG A;  1WYU B;  2YKX A;  4ATP A;  1O62 A;  1CL2 A;  7AAT A;  2W7H A;  3FQ8 A;  3FZ6 A;  1V2E A;  3A9Z A;  4UHM A;  3ACZ A;  3AEM A;  1BJN A;  1PMO A;  3ELP A;  4P7Y A;  4PFN A;  4XK1 A;  2BIG A;  2DKJ A;  2W8V A;  2HUU A;  1AHE A;  4BA4 A;  4CVQ A;  3JW9 A;  1SF2 A;  1ASA A;  1AY8 A;  1KKJ A;  1LKC A;  4JE5 A;  3WGB A;  2Z61 A;  1SZS A;  2R2N A;  4FL0 A;  4RKC A;  4RIZ A;  2G6W A;  1LK9 A;  1ARG A;  4P3M A;  4GEB A;  3BCB A;  1KL1 A;  1BQD A;  2VMR A;  2HUF A;  1JS6 A;  1M0O A;  5EQC A;  4BQ0 A;  1I43 A;  1E5E A;  3LVK A;  2AAT A;  2BI3 A;  2VMN A;  3PJ0 A;  4WXG A;  5D95 A;  1AMA A;  5LH9 A;  4W5K A;  2VIB A;  2AY9 A;  4F5H A;  3CQ6 A;  4UOY A;  3WKR A;  1IX8 A;  2GMU A;  1DTY A;  4JF0 A;  3WX9 A;  3Q8N A;  1TAT A;  1AJS A;  4WB0 A;  3UE8 A;  3K28 A;  1GEX A;  4K2I A;  4MY5 A;  3ZRR A;  1IUG A;  4DQ6 A;  1LS3 A;  3GR9 A;  4U1T A;  4N0W A;  3GBX A;  1C4K A;  1OXP A;  3ZRP A;  4AH3 A;  1ASL A;  3PDB B;  4ZSY A;  5C6U A;  4J5U A;  1GEY A;  4WYD A;  2JIS A;  3HT4 A;  1CQ8 A;  2PO3 A;  3WCN A;  4GRX A;  2E7I A;  1BQA A;  2FN6 A;  4L0O A;  1EJI A;  3DXV A;  3R4T A;  1GC2 A;  2VGV A;  2KFP A;  2YKU A;  4ADC A;  2PB2 A;  2QA3 A;  3WZF A;  1QIR A;  2JJH A;  3F0H A;  1AMQ A;  4WXB A;  3E2Z B;  5E5I A;  3WKS A;  3QN6 A;  1H1C A;  2JJE A;  1UKJ A;  1RV3 A;  3HMU A;  5M4B A;  4OBV A;  3OKS A;  1QJ5 A;  5G09 A;  3AOV A;  2HUI A;  3TCM A;  4WYA A;  2WK9 A;  3LVJ A;  1J32 A;  4F5G A;  1IAY A;  1C0N A;  3DR7 A;  3QGU A;  3W1J A;  1G4X A;  4E77 A;  4F5K A;  4K05 A;  3DXW A;  3NU8 A;  2FQ6 A;  5M4D A;  4A6U A;  2CAN A;  1AHY A;  3A9X A;  2W7K A;  2Z9U A;  2OKK A;  3CAI A;  3PD6 B;  3ELE A;  1ARI A;  2XH1 A;  3EI5 A;  2R5C B;  4ADD A;  1XI9 A;  1O69 A;  3KKI A;  1LW5 A;  4IYO A;  4ZDP A;  1OHY A;  4OTL A;  2JJG A;  4TV7 A;  4TN4 A;  2VMP A;  3HDO A;  2C44 A;  2FYF A;  3CQ5 A;  4JEV A;  4M2K A;  4W1V A;  2Z67 A;  3L8A A;  2C0R A;  4IXO A;  1M7Y A;  4W1W A;  3FZ8 A;  1CQ6 A;  1AJR A;  5G2P A;  4AZJ A;  5HXX A;  1C7N A;  2VLH A;  2Z9X A;  1RVY A;  3P1T A;  4OYT A;  2YKV A;  1S06 A;  2O7C A;  5J8Q A;  2W8T A;  1D7R A;  2VI9 A;  2D5Y A;  2GSA A;  3BWN C;  4IYO B;  3I16 A;  3NUB A;  4F4E A;  1SZU A;  2XBN A;  3COG A;  3QHX A;  4RIT A;  2BKW A;  3FZ7 A;  2YRI A;  4H51 A;  3PD6 A;  3MAF A;  5HDM A;  2DOU A;  3ZZK A;  4UHN A;  4WP0 A;  1IVR A;  2YKY A;  2W7F A;  3EI9 A;  5M46 A;  1PG8 A;  1ASN A;  2EGY A;  1RV4 A;  4ITX A;  2X8U A;  1Z3Z A;  2VGS A;  4W91 A;  2AY3 A;  1S08 A;  2PB0 A;  5M49 A;  2HP2 A;  3G8M A;  3IHJ A;  4K2M A;  4KYO A;  4E3Q A;  3TFT A;  3ISL A;  1N2T A;  4MQQ A;  4A00 A;  5LHA A;  5DJ1 A;  4NOG A;  4R2N A;  4JEZ A;  1W7N A;  4XAU A;  1SVV A;  5EIG B;  1UU2 A;  3CQ4 A;  3I4J A;  2W7L A;  2AY4 A;  3EZ1 A;  3USF A;  2WKA A;  3QI6 A;  4IX8 A;  4ISY A;  4R8D A;  2AEV A;  2VMZ A;  2TPL A;  2ZUK A;  1MDZ A;  3MAF B;  3FFH A;  2V1P A;  2BIE A;  3NU7 A;  2WK8 A;  2R5E A;  1WKG A;  3RI6 A;  3DYD A;  3F9T A;  3ZRQ A;  1W23 A;  4EB7 A;  2FNU A;  4LW4 A;  3E9K A;  2W7M A;  3DZZ A;  3WGC A;  3QM2 A;  2VMS A;  2YOB A;  2BWO A;  1OXO A;  5FT6 A;  4PVF A;  4KXK A;  2ZY4 A;  1T3I A;  3MKJ A;  3L44 A;  4DGT A;  4W1X A;  4KAM A;  3F6T A;  1TOI A;  3LVL B;  2R5C A;  1YJS A;  1LC7 A;  1H0C A;  1WYT B;  1AAM A;  1FG3 A;  4GE7 A;  4RM1 A;  2CH1 A;  2EZ2 A;  3N75 A;  2CST A;  1AJS B;  4WB0 B;  4IXZ A;  4MQP A;  5DX5 A;  3D6K A;  3GSB A;  3HBX A;  3VAX A;  2OQX A;  4OBU A;  4AO9 A;  1B8G A;  3BWO A;  3EI6 A;  5K8B A;  1N8P A;  1ASF A;  2BWP A;  2D65 A;  4RJ0 A;  1TOG A;  3B1C A;  3AEO A;  1IX7 A;  3HLM A;  1AKA A;  3AEJ A;  3B46 A;  3PPL A;  5HHY A;  3N4S A;  1LW4 A;  3GJU A;  3N4X A;  3BC8 A;  2NMP A;  1B5O A;  1N31 A;  1MDO A;  4TMR A;  3VK3 A;  3PA9 A;  3BWN A;  3E2F A;  3AEP A;  2W7J A;  3AOW A;  3N7N A;  4PFF A;  2ORD A;  5FT8 A;  3DOD A;  1DJ9 A;  1S07 A;  1Z7D A;  1DGD A;  3PDX A;  3R9A A;  4B98 A;  2CJD A;  3VK2 A;  3KE3 A;  2ZSM A;  4ADB A;  1AY4 A;  3NUI A;  1ASB A;  1J04 A;  3M5U A;  4LC3 A;  2AEU A;  3EZS A;  1LC8 A;  1M0Q A;  1AMS A;  3NX3 A;  3H14 A;  3RCH A;  4EMY A;  3FFR A;  3FDB A;  3FCR A;  1GC0 A;  2CFB A;  3MEB A;  1KMK A;  3HL2 A;  3AAT A;  5EAV A;  2BYJ A;  2BYL A;  3FDD A;  3NNK A;  4A6R A;  1MAQ A;  4ZAS A;  3LG0 A;  3FVX A;  4ZM4 A;  2CJH A;  3MC6 A;  4FFC A;  3EI8 A;  3W1H A;  2VI8 A;  1ASM A;  4Q76 A;  2D63 A;  1OAT A;  1GCK A;  1QZ9 A;  2ZSL A;  4GSA A;  4JEY A;  3FQA A;  1YJY A;  4A0H A;  3TAT A;  1D2F A;  2JJF A;  3FTB A;  1AMR A;  2JG2 A;  3EI7 A;  4OMA A;  1VP4 A;  4BMK A;  2GQN A;  3WLX A;  3G0T A;  1BKG A;  2BI2 A;  5E4Z A;  1AKB A;  1I48 A;  2C7T A;  5EUN A;  1BJ4 A;  1ARH A;  1AAW A;  1TAS A;  2W7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...