1AHEA

Aspartate aminotransferase hexamutant
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternating arginine-modulated substrate specificity in an engineered tyrosine aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aheA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aheA01
3DR4A 3NUBA 3GZCA 1AICA 3MAUA 4IYOA 1AAMA 1RV4A 3AOWA 2X3LA 2DOUA 2X5FA 3CBFA 1AMQA 3RBLA 4GE7A 5K8BA 3PA9A 1MLZA 3R9AA 1SZUA 2R5CA 4AO9A 2HORA 3EIBA 1AAWA 1W7NA 2CJHA 1LC8A 4IYOB 1C7NA 5EAAA 4BMKA 3BS8A 1QZ9A 3ATHA 1VEFA 4A6UA 2AY4A 3BCBA 1D2FA 3B1DA 3FQ8A 2CINA 5D95A 3TATA 1V2DA 1YOOA 4UHOA 2HUIA 1ARHA 1CQ7A 4UOYA 3VP6A 1M6SA 2BYJA 1N2TA 4ZAHA 2JISA 1RVUA 2BI2A 1G7XA 3BWNC 3NDNA 3DXWA 4WXBA 4OYTA 7AATA 1UU1A 2VGSA 1KKJA 3IHJA 4RLGA 5HDMA 3JZLA 1SF2A 1AHYA 3JTXA 3TQXA 4ZSWA 4RKCA 2R2NA 1QJ3A 4ZDPA 2BI5A 4DBCA 2AY2A 1GCKA 1AJSB 5G0AA 1AMSA 2YOBA 1EQBA 4MSOA 4XJLA 4F5GA 3CAIA 4ADEA 4F5MA 3MADA 4DQ6A 3W1HA 3FQ7A 4XJOA 4R2NA 4I8AA 2W7GA 1DJUA 2ZC0A 3LV2A 3MC6C 1GEXA 5AX8A 3CQ6A 3QI6A 3PDBA 1G4VA 3JWBA 3NRAA 4P3MA 3K28A 2HOZA 4OTLA 4W8IA 3USFA 3NUIA 1UKJA 3PJ0A 3E2YA 3NYSA 4XEWA 2WK7A 4JEVA 3RCHA 4XJMA 4ITGA 2W7HA 3ASAA 1W3UA 9AATA 1GD9A 3VK4A 3FRKA 1TASA 4OC9A 5BJ3A 3UWCA 2V0YA 4TV7A 1CZEA 2Z1YA 2D65A 4ADDA 2AY1A 3NU8A 3AEPA 4A0RA 1AHEA 3NYUA 1C4KA 1M4NA 2NMPA 3FDBA 1MDOA 1CQ8A 4IX8A 2CH2A 3EZ1A 2VMYA 2W8JA 4CBSA 4OMAA 1UU2A 4F5LA 2EGYA 2TPLA 2ZSMA 3I5TA 1C9CA 3FTBA 4JEYA 2YKVA 2R5CB 1W23A 3P6KA 3JWAA 2FNIA 3PPLA 2D61A 4WP0A 2ZY3A 4WYAA 1O4SA 3ACZA 1ASLA 2EH6A 1KL2A 4L0OA 3M5UA 3CQ5A 3E2FA 2CB1A 3EIAA 1PMOA 1J32A 4R5FA 2AY6A 5C6UA 2GB3A 3QN6A 2VGWA 3KE3A 4CBRA 3GZDC 4E1OA 4ITXA 2JJHA 2BWNA 3ZZJA 2D63A 3QBOA 3OP7A 4WLHA 2DR1A 2ZSLA 5LHAA 3HL2A 1XEYA 1M7YA 2BI9A 4Y0IA 2Z1ZA 1RVYA 2ZJGA 1H1CA 2VMRA 4MQPA 1CS1A 1E5FA 4IXSA 1DKAA 3G0TA 2XH1A 2EZ1A 1ASBA 3WX9A 1ZOBA 4IXOA 1ASFA 3H7FA 1IJIA 1UU0A 1TOKA 1WSTA 2CH1A 4GSAA 1GDEA 1QIRA 1LC7A 3AEMC 1LK9A 3AV7A 1SVVA 1YIYA 2VMWA 4MQRA 1FG3A 4J8LA 2CFBA 3ELPA 3ZRQA 1W7LA 4KXKA 1G7WA 4ZM3A 4WD2A 5EUEA 3ISLA 3WKSA 1E5EA 1X0MA 1ARGA 4F5IA 4P7YA 3DODA 4ZASA 4XK1A 1AKBA 2YRRA 1KMJA 3NU7A 4ZWMA 4PFNA 2ZY5A 1OHVA 4ZLVA 1H0CA 5G09A 1DGEA 1YIZA 3RBFA 4OBVA 3VAXA 3II0A 2R5EA 4KAMA 1MLYA 4PFFA 2Z9XA 1BJOA 3WY7A 4F5JA 3WZFA 1WYTA 4RKDA 1V2FA 1OHYA 1G4XA 3BWNA 3RUYA 2DKBA 2VMVA 5EUNA 2CANA 5FT8A 2BIEA 2BWPA 3RI6A 2DGLA 4EU1A 2RFVA 1MGVA 2O1BA 2VYCA 2VMTA 1BJ4A 1M0PA 3BC8A 3G7QA 3KGWA 1KL1A 1S06A 2Z61A 1YJSA 1ORDA 4GE9A 4QGRA 1QITA 1CZCA 1D7SA 4K2BA 4JEZA 1ECXA 5HXXA 4JE5D 1QISA 4OT8A 3TFTA 3FZ8A 1AJRA 4LNLA 3ZRRA 4U1TA 4ZSYA 2HOYA 2QB2A 5DJ1A 5M49A 1ARIA 2BIAA 3B8XA 1B8GA 1S08A 3GBXA 1DGDA 5G4IA 4DGTA 2W7EA 3FVSA 1SZSA 1ASEA 1U08A 1GBNA 4Q75A 1V2EA 2HOXA 4RJYA 1ASGA 3FSLA 3F0HA 1QJ5A 4W91A 5HHYA 2W7KA 1D7UA 3FCRA 1AY5A 1S0AA 3E6GA 4TMRA 4CVQA 3HVYA 4CXRA 1DJEA 1IAYA 1O62A 5IWQA 4WYCA 2O0RA 4OCAA 2W8WA 3EUCA 4UHMA 4PVFA 1T3IA 2WK8A 5I92A 1BJWA 2AY3A 3AATA 1WYVA 4RIZA 3I4JA 3T32A 2OKJA 2QMAA 2AY5A 3A9XA 1IX7A 4ATQA 3PGYA 5FT5A 2DGMA 4E77A 1ASNA 2VMZA 1CL1A 1TARA 1AKAA 3A9ZA 3QHXA 4A0GA 4GDYA 1AX4A 3E9KA 3BCAA 1BQDA 1SZKA 2ZUKA 3HLMA 3P1TA 5DB5A 2W7IA 3OKSA 2EO5A 2CSTA 3GZDA 1AMAA 3MAFA 2F8JA 4WYDA 1J04A 3ECDA 3GR9A 4WYGA 3CQ4A 1BKGA 2CY8A 4FFCA 2W7LA 2Q7WA 1X29A 3ASBA 1JS3A 4MKJA 1GC2A 1OATA 4R8DA 1M0QA 4B98A 1OXPA 3G8MA 4Q6RA 4AH3A 3F9TA 1TPLA 1O69A 1GEYA 5G2PA 2XBNA 5EAVA 3KGXA 3HDOA 3K40A 1C0NA 2VI9A 1B9HA 4PIWA 1DFOA 2EZ2A 2DGKA 3LVJA 4WXFA 4BHDA 4XJPA 5FT4A 4EB7A 2ZYJA 4ADCA 5FT6A 4A6RA 1ZC9A 3I16A 1YNUA 4R5ZA 4UHNA 1MAQA 1I48A 2X8UA 3AOVA 4IW7A 3LVKA 2W8UA 2YKYA 2AY9A 1B4XA 3FFHA 4H51A 4MGRA 4F5FA 5M46A 4UQVA 2C0RA 3LVMA 4EB5A 2AEUA 2VLFA 2YCNA 3MAFB 2DKJA 3WCNA 8AATA 2Z67A 4WYFA 3GJUA 3ELEA 2D7ZA 4W1VA 1AMRA 3RCHB 2Z20A 1Y4IA 1X2AA 5EFSA 2C7TA 1IBJA 4BA5A 5M4DA 1WYTB 3KKIA 4GEBA 3FZ6A 3E77A 4IY7A 1Z7DA 2Z9UA 5F8VA 3ZRPA 2CJGA 1RV3A 1IUGA 4MKKA 3NNKA 1GC0A 1CL2A 4EFFA 1LC5A 3BV0A 3A8UX 4LW4A 1LW4A 3FFRA 2W8VA 2YCTA 2W7FA 1C7OA 3BN1A 4JF0A 4WLJA 4RM1A 4K2IA 4JEWA 1PG8A 3WLXA 1WKGA 4AZKA 5G4JA 5F9SA 3QPGA 1YJYA 2BYLA 3AENB 4MQQA 4Q76A 1I41A 4HF8A 2OKKA 3MC6A 2QLRA 3GSBA 2CTZA 4M2MA 4W5KA 4LNJA 4A0HA 1AIAA 2VGTA 1B5OA 2OQXA 3D6KA 2GSAA 4JF1A 4ZM4A 2D7YA 3WGCA 2CJDA 1SPAA 4A72A 2R0TA 1GEWA 2YHKA 4E3RA 3F6TA 4RAEA 4TN4A 1VJOA 2ORDA 3DRDA 4B9BA 2E7JA 1YAAA 4XQ2A 3JU7A 2PO3A 3LWSA 3VOMA 3FDDA 3W1JA 2PB2A 4LNMA 3TFUA 1ASAA 1BQAA 3AEJC 1IX8A 2GQNA 4RJ0A 4O6ZA 2X5DA 4WXGA 2FYFA 1AHFA 5J8QA 3BB8A 1I43A 2BI3A 1FC4A 2HP1A 2W7JA 1MDXA 3NX3A 2D64A 5BJ4A 3UAKA 2C44A 2E7IA 1MDZA 1VP4A 3FKDA 1KKPA 4RITA 3MBBA 1ARTA 2Z9VA 5D5SA 2ZP7A 1TOIA 1ARSA 3AEOA 3FD0A 3N75A 3N0LA 3K7YA 2VIBA 1BW0A 1JS6A 5EQCA 2EPJA 3TCMA 1CQ6A 1MAPA 1WYVB 2VGZA 3RQ1A 1IAXA 3QGUA 2YKUA 3A9YA 1AJSA 2BWOA 1AIBA 2VMUA 4U2HA 5TF5A 2JJGA 3DR7A 2VLHA 4OBUA 2C81A 2VMOA 2AEVA 2Z9WA 1BT4A 5G2QA 4AZJA 3E2ZA 4WBTA 3LVLB 2HUFA 1DJ9A 1KMKA 3PDXA 4ZWVA 1TOJA 2VGVA 4BQ0A 4W1XA 3B46A 1Z3ZA 3R4TA 1O61A 3DC1A 4GE4A 4LC3A 1GC3A 2JGTA 3B1CA 3VK3A 3UE8A 2W7DA 4JE5A 2W7MA 3FZ7A 1ASDA 1WYUB 2VMXA 3WCOA 2JG2A 3JW9A 2E7UA 1BJOB 1OXOA 2WK9A 3EI9A 4M2KA 1D7VA 3HT4A 1AY4A 4XAUA 1AHGA 2YKXA 1OHWA 1JG8A 3FVXA 5EIGB 4Q31A 4BA4A 2BI1A 3AELA 2ZY2A 4A6TA 4HVKA 3QM2A 2OGEA 3DU4A 4N0WA 3PD6A 4ADBA 1EG5A 1V72A 4A0FA 1M0OA 1M32A 3E2ZB 1AHXA 1X28A 1JF9A 4WYEA 2AY8A 3HMUA 2E54A 5LH9A 3PD6B 2YRIA 3MEBA 3EI6A 1S07A 4ZDOA 2ZY4A 3H14A 4LW2A 5E4ZA 3NTJA 1ASMA 3DYDA 2V1PA 1YJZA 4WB0A 5DJ9A 2GMSA 1TOGA 1SFFA 4J5UA 4F5HA 5DX5A 3COGA 3PDBB 2VMPA 1I29A 1PFFA 4N0BA 2BKWA 4ZDLA 2YCPA 4W1WA 2FNUA 5EIGA 1ASCA 2FQ6A 3PIUA 2G6WA 3FVUA 3WKRA 4AO4A 5JAYA 3EI8A 2VMSA 3BWOA 3HQTA 4Y0DA 1CJ0A 4E3QA 2JJEA 1BS0A 3DZZA 1LS3A 5M4BA 1FG7A 2GMUA 2QA3A 3MKJA 3HBXA 3EI7A 2QBTA 1C7GA 1EJIA 1WKHA 2AATA 1IX6A 2WKAA 5E5IA 5EUDA 2PB0A 1N31A 1TOEA 3L8AA 2BIGA 1LW5A 4IXZA 4AOAA 3NYTA 1B9IA 1BJNA 3GETA 4KYOA 2QB3A 2JJFA 4WB0B 2VMQA 1ELUA 4MY5A 3EI5A 4K2MA 1ELQA 2HP2A 4GRXA 4JEXA 4CXQA 3BCXA 4M2JA 1DTYA 1S09A 3FQAA 2VI8A 1QGNA 3PAAA 3DXVA 4Y0HA 2VGUA 3B1EA 3L44A 3N5MA 3LG0A 1M0NA 1WYUA 3Q8NA 4F4EA 2OATA 2FN6A 3AEJA 4ISYA 1D7RA 1PMMA 3IF2A 1IVRA 2VMNA 3ZZKA 1N8PA 2AY7A 1LKCA 1TATA 1XI9A 1W7MA 2W8TA 1GC4A 3GWPA 3VK2A 3A2BA 4A00A 5E3KA 3W1IA 3LY1A 1AKCA 4ATPA 4F5KA 4EMYA 1P3WA 2BHXA 3WGBA 1B5PA 2O7CA 2D5YA 2VIAA 3EZSA 3AENA 4FL0A 2HUUA 1ZODA 2D66A 2HZPA 1AY8A 2OGAA 3AEMA 2FM1A 4NOGA
chains in the Genus database with same CATH superfamily
3DR4A 3NUBA 3GZCA 1AICA 3MAUA 4IYOA 1AAMA 1RV4A 3AOWA 2X3LA 2DOUA 2X5FA 3CBFA 1AMQA 3RBLA 4GE7A 5K8BA 3PA9A 1MLZA 3R9AA 1SZUA 2R5CA 4AO9A 2HORA 3EIBA 1AAWA 1W7NA 2CJHA 1LC8A 4IYOB 1C7NA 5EAAA 2A1VA 4BMKA 3BS8A 3H9XA 3N7NA 1QZ9A 3ATHA 1VEFA 4A6UA 2AY4A 3BCBA 1D2FA 3B1DA 3FQ8A 2CINA 5D95A 4H63Q 3TATA 1V2DA 1YOOA 4UHOA 2HUIA 1ARHA 1CQ7A 4UOYA 3VP6A 1M6SA 2BYJA 1N2TA 4ZAHA 2JISA 1RVUA 2BI2A 1G7XA 3BWNC 3NDNA 3DXWA 4WXBA 4OYTA 7AATA 1UU1A 2VGSA 1KKJA 3IHJA 4RLGA 5HDMA 3JZLA 1SF2A 1AHYA 3JTXA 3TQXA 4ZSWA 4RKCA 2R2NA 1QJ3A 4ZDPA 2BI5A 4DBCA 2AY2A 2FKIA 1GCKA 1AJSB 5G0AA 1AMSA 2YOBA 1EQBA 4MSOA 4XJLA 4F5GA 3CAIA 4ADEA 4F5MA 3MADA 4DQ6A 3W1HA 3FQ7A 4XJOA 4R2NA 4I8AA 2W7GA 1DJUA 2ZC0A 3LV2A 3MC6C 1GEXA 5AX8A 3CQ6A 3QI6A 3PDBA 1G4VA 3JWBA 3NRAA 4P3MA 3K28A 2HOZA 4OTLA 4W8IA 3USFA 3NUIA 1UKJA 3PJ0A 3E2YA 3NYSA 4XEWA 2WK7A 4JEVA 3RCHA 4XJMA 4ITGA 2W7HA 3ASAA 1W3UA 9AATA 1GD9A 3VK4A 3FRKA 1TASA 4OC9A 5BJ3A 3UWCA 2V0YA 4TV7A 1CZEA 2Z1YA 2D65A 4ADDA 2AY1A 3NU8A 3AEPA 4A0RA 1AHEA 3NYUA 1C4KA 1M4NA 2NMPA 3FDBA 1MDOA 1CQ8A 4IX8A 2CH2A 3EZ1A 2VMYA 2W8JA 4CBSA 4OMAA 1UU2A 4F5LA 2EGYA 2TPLA 2ZSMA 3I5TA 1C9CA 3FTBA 4JEYA 2YKVA 2R5CB 1W23A 3P6KA 3JWAA 2FNIA 3PPLA 2D61A 4WP0A 2ZY3A 4WYAA 1O4SA 3ACZA 1ASLA 2EH6A 1KL2A 4L0OA 3M5UA 3CQ5A 3E2FA 2CB1A 3EIAA 1PMOA 1J32A 4R5FA 2AY6A 5C6UA 2GB3A 3QN6A 2VGWA 3KE3A 4CBRA 3GZDC 4E1OA 4ITXA 2JJHA 2BWNA 3ZZJA 2D63A 3QBOA 3OP7A 4WLHA 2DR1A 2ZSLA 5LHAA 3HL2A 1XEYA 1M7YA 2BI9A 4Y0IA 2Z1ZA 1RVYA 2ZJGA 1H1CA 2VMRA 4MQPA 1CS1A 1E5FA 4IXSA 1DKAA 3G0TA 2XH1A 2EZ1A 1ASBA 3WX9A 1ZOBA 3N4XA 4IXOA 1ASFA 3H7FA 1IJIA 1UU0A 1TOKA 1WSTA 2CH1A 4GSAA 1GDEA 1QIRA 1LC7A 3AEMC 1LK9A 3AV7A 1SVVA 1YIYA 2VMWA 4MQRA 1FG3A 4J8LA 2CFBA 3ELPA 3ZRQA 1W7LA 4KXKA 1G7WA 4ZM3A 4WD2A 5EUEA 3ISLA 3WKSA 1E5EA 1X0MA 1ARGA 4F5IA 4P7YA 3DODA 4ZASA 4XK1A 1AKBA 2YRRA 1KMJA 3NU7A 4ZWMA 4PFNA 2ZY5A 1OHVA 4ZLVA 1H0CA 5G09A 1DGEA 1YIZA 3RBFA 4OBVA 3VAXA 3II0A 2R5EA 4KAMA 1MLYA 4PFFA 2Z9XA 1BJOA 3WY7A 4F5JA 3WZFA 1WYTA 4RKDA 1V2FA 1OHYA 1G4XA 3BWNA 3RUYA 2DKBA 2VMVA 5EUNA 2CANA 5FT8A 2BIEA 2BWPA 3RI6A 2DGLA 4EU1A 2RFVA 1MGVA 2O1BA 2VYCA 2VMTA 1BJ4A 1M0PA 3BC8A 3G7QA 3KGWA 1KL1A 1S06A 2Z61A 1YJSA 1ORDA 4GE9A 4QGRA 1QITA 1CZCA 1D7SA 4K2BA 4JEZA 1ECXA 5HXXA 4JE5D 1QISA 4OT8A 3TFTA 3FZ8A 1AJRA 4LNLA 3ZRRA 4U1TA 4ZSYA 2HOYA 2QB2A 5DJ1A 5M49A 1ARIA 2BIAA 3B8XA 1B8GA 1S08A 3GBXA 1DGDA 5G4IA 4DGTA 2W7EA 3FVSA 1SZSA 1ASEA 1U08A 1GBNA 4Q75A 1V2EA 2HOXA 4RJYA 1ASGA 3FSLA 3F0HA 1QJ5A 4W91A 5HHYA 2W7KA 1D7UA 3FCRA 1AY5A 1S0AA 3E6GA 4TMRA 4CVQA 3HVYA 4CXRA 1DJEA 1IAYA 1O62A 5IWQA 4WYCA 2O0RA 4OCAA 2W8WA 3EUCA 4UHMA 4PVFA 2WB6A 1T3IA 2WK8A 5I92A 1BJWA 2AY3A 3AATA 1WYVA 4RIZA 3I4JA 3T32A 2OKJA 2QMAA 2AY5A 3A9XA 1IX7A 4ATQA 3PGYA 5FT5A 2DGMA 2G7JA 4E77A 1ASNA 2VMZA 1CL1A 1TARA 1AKAA 3A9ZA 3QHXA 4A0GA 4GDYA 1AX4A 3E9KA 3BCAA 1BQDA 1SZKA 2ZUKA 3HLMA 3P1TA 5DB5A 2W7IA 4K05A 3OKSA 2EO5A 2CSTA 3GZDA 1AMAA 3MAFA 2F8JA 4WYDA 1J04A 3ECDA 3GR9A 4WYGA 3CQ4A 1BKGA 2CY8A 4FFCA 2W7LA 2Q7WA 1X29A 3ASBA 1JS3A 4MKJA 1GC2A 1OATA 4R8DA 1M0QA 4B98A 1OXPA 3G8MA 4Q6RA 4AH3A 3F9TA 1TPLA 1O69A 1GEYA 5G2PA 2XBNA 5EAVA 3KGXA 3HDOA 3K40A 1C0NA 2VI9A 1B9HA 4PIWA 1DFOA 2EZ2A 2DGKA 3LVJA 4WXFA 4BHDA 4XJPA 5FT4A 4EB7A 2ZYJA 4ADCA 5FT6A 4A6RA 1ZC9A 3I16A 1YNUA 4R5ZA 4UHNA 1MAQA 1I48A 2X8UA 3AOVA 4IW7A 3LVKA 2W8UA 2YKYA 2AY9A 1B4XA 3FFHA 4H51A 4MGRA 4F5FA 5M46A 4UQVA 2C0RA 3LVMA 4EB5A 2AEUA 2VLFA 2YCNA 3MAFB 2DKJA 3WCNA 8AATA 2Z67A 4WYFA 3GJUA 3ELEA 2D7ZA 4W1VA 1AMRA 3RCHB 2Z20A 1Y4IA 1X2AA 5EFSA 2C7TA 1IBJA 4BA5A 2KFPA 5M4DA 1WYTB 3KKIA 4GEBA 3FZ6A 3E77A 4IY7A 1Z7DA 3N4SA 2Z9UA 5F8VA 3ZRPA 2CJGA 1RV3A 1IUGA 4MKKA 3NNKA 1GC0A 1CL2A 4EFFA 1LC5A 3BV0A 3A8UX 4LW4A 1LW4A 3FFRA 2W8VA 2YCTA 2W7FA 1C7OA 3BN1A 4JF0A 4WLJA 2QSRA 4RM1A 4K2IA 4JEWA 1PG8A 3WLXA 1WKGA 4AZKA 5G4JA 5F9SA 3QPGA 1YJYA 2BYLA 3AENB 4MQQA 4Q76A 1I41A 4HF8A 2OKKA 3MC6A 2QLRA 3GSBA 2CTZA 4M2MA 4W5KA 4LNJA 4A0HA 1AIAA 2VGTA 1B5OA 2OQXA 3D6KA 2GSAA 4JF1A 4ZM4A 2D7YA 3WGCA 2CJDA 1SPAA 4A72A 2R0TA 1GEWA 2YHKA 4E3RA 3F6TA 4RAEA 4TN4A 1VJOA 2ORDA 3DRDA 4B9BA 2E7JA 1YAAA 4XQ2A 3JU7A 2PO3A 3LWSA 3VOMA 3FDDA 3W1JA 2PB2A 4LNMA 3TFUA 1ASAA 1BQAA 3AEJC 1IX8A 2GQNA 4RJ0A 4O6ZA 2X5DA 4WXGA 2FYFA 1AHFA 5J8QA 3BB8A 1I43A 2BI3A 1FC4A 2HP1A 2W7JA 1MDXA 3NX3A 2D64A 5BJ4A 3UAKA 2C44A 2E7IA 1MDZA 1VP4A 3FKDA 1KKPA 4RITA 3MBBA 1ARTA 2Z9VA 5D5SA 2ZP7A 1TOIA 1ARSA 3AEOA 3FD0A 3N75A 3N0LA 3K7YA 2VIBA 1BW0A 1JS6A 5EQCA 5KTBA 2EPJA 3TCMA 1CQ6A 1MAPA 1WYVB 2VGZA 3RQ1A 1IAXA 3QGUA 2YKUA 3A9YA 1AJSA 2BWOA 1AIBA 2VMUA 4U2HA 5TF5A 2JJGA 3DR7A 2VLHA 4OBUA 2C81A 2VMOA 2AEVA 2Z9WA 1BT4A 5G2QA 4AZJA 3E2ZA 4WBTA 3LVLB 2HUFA 1DJ9A 1KMKA 3PDXA 4ZWVA 1TOJA 2VGVA 4BQ0A 4W1XA 3B46A 1Z3ZA 3R4TA 1O61A 3DC1A 4GE4A 4LC3A 1GC3A 2JGTA 3B1CA 3VK3A 1KAFA 3UE8A 2W7DA 4JE5A 2W7MA 3FZ7A 1ASDA 1WYUB 2VMXA 3WCOA 2JG2A 3JW9A 2E7UA 1BJOB 1OXOA 2WK9A 3EI9A 4M2KA 1D7VA 3HT4A 1AY4A 4XAUA 1AHGA 2YKXA 1OHWA 1JG8A 3FVXA 5EIGB 4Q31A 4BA4A 2BI1A 3AELA 2ZY2A 4A6TA 4HVKA 3QM2A 2OGEA 3DU4A 4N0WA 3PD6A 4ADBA 1EG5A 1V72A 4A0FA 1M0OA 1M32A 3E2ZB 1AHXA 1X28A 1JF9A 4WYEA 2AY8A 3HMUA 2E54A 5LH9A 3PD6B 2YRIA 3MEBA 3EI6A 1S07A 4ZDOA 2ZY4A 3H14A 4LW2A 5E4ZA 3NTJA 1ASMA 3DYDA 2V1PA 1YJZA 4WB0A 5DJ9A 2GMSA 1TOGA 1SFFA 4J5UA 4F5HA 5DX5A 3COGA 3PDBB 2VMPA 1I29A 1PFFA 4N0BA 2BKWA 4ZDLA 2YCPA 4W1WA 2FNUA 5EIGA 1ASCA 2FQ6A 3PIUA 2G6WA 3FVUA 3WKRA 4AO4A 5JAYA 3EI8A 2VMSA 3BWOA 3HQTA 4Y0DA 1CJ0A 4E3QA 2JJEA 1BS0A 3DZZA 1LS3A 5M4BA 1FG7A 2GMUA 2QA3A 3MKJA 3HBXA 3EI7A 2QBTA 1C7GA 1EJIA 1WKHA 2AATA 1IX6A 2WKAA 5E5IA 5EUDA 2PB0A 1N31A 1TOEA 3L8AA 2BIGA 1LW5A 4IXZA 4AOAA 3NYTA 1B9IA 1BJNA 3GETA 4KYOA 2QB3A 2JJFA 4WB0B 2VMQA 1ELUA 4MY5A 3EI5A 4K2MA 1ELQA 2HP2A 4GRXA 4JEXA 4CXQA 3BCXA 4M2JA 1DTYA 1S09A 3FQAA 2VI8A 1QGNA 3PAAA 2EYQA 3DXVA 4Y0HA 2VGUA 3B1EA 3L44A 3N5MA 3LG0A 1M0NA 1WYUA 3Q8NA 4F4EA 2OATA 2FN6A 3AEJA 4ISYA 1D7RA 1PMMA 3IF2A 1IVRA 3N4RA 2VMNA 3ZZKA 1N8PA 2AY7A 1LKCA 1TATA 1XI9A 1W7MA 2W8TA 1GC4A 3GWPA 3VK2A 3A2BA 4A00A 5E3KA 3W1IA 3LY1A 1AKCA 4ATPA 4F5KA 4EMYA 1P3WA 2BHXA 3WGBA 1B5PA 2O7CA 2D5YA 2VIAA 3EZSA 3AENA 4FL0A 2HUUA 1ZODA 2D66A 2HZPA 1AY8A 2OGAA 3AEMA 2FM1A 4NOGA
chains in the Genus database with same CATH topology
3DR4A 3NUBA 3GZCA 1AICA 3MAUA 4IYOA 1AAMA 1RV4A 3AOWA 2X3LA 2DOUA 2X5FA 3CBFA 1AMQA 3RBLA 4GE7A 5K8BA 3PA9A 1MLZA 3R9AA 1SZUA 2R5CA 4AO9A 2HORA 3EIBA 1AAWA 1W7NA 2CJHA 1LC8A 4IYOB 1C7NA 5EAAA 2A1VA 4BMKA 3BS8A 3H9XA 3N7NA 1QZ9A 3ATHA 1VEFA 4A6UA 2AY4A 3BCBA 1D2FA 3B1DA 3FQ8A 2CINA 5D95A 4H63Q 3TATA 1V2DA 1YOOA 4UHOA 2HUIA 1ARHA 1CQ7A 4UOYA 3VP6A 1M6SA 2BYJA 1N2TA 4ZAHA 2JISA 1RVUA 2BI2A 1G7XA 3BWNC 3NDNA 3DXWA 4WXBA 4OYTA 7AATA 1UU1A 2VGSA 1KKJA 3IHJA 4RLGA 5HDMA 3JZLA 1SF2A 1AHYA 3JTXA 3TQXA 4ZSWA 4RKCA 2R2NA 1QJ3A 4ZDPA 2BI5A 4DBCA 2AY2A 2FKIA 1GCKA 1AJSB 5G0AA 1AMSA 2YOBA 1EQBA 4MSOA 4XJLA 4F5GA 3CAIA 4ADEA 4F5MA 3MADA 4DQ6A 3W1HA 3FQ7A 4XJOA 4R2NA 4I8AA 2W7GA 1DJUA 2ZC0A 3LV2A 3MC6C 1GEXA 5AX8A 3CQ6A 3QI6A 3PDBA 1G4VA 3JWBA 3NRAA 4P3MA 3K28A 2HOZA 4OTLA 4W8IA 3USFA 3NUIA 1UKJA 3PJ0A 3E2YA 3NYSA 4XEWA 2WK7A 4JEVA 3RCHA 4XJMA 4ITGA 2W7HA 3ASAA 1W3UA 9AATA 1GD9A 3VK4A 3FRKA 1TASA 4OC9A 5BJ3A 3UWCA 2V0YA 4TV7A 1CZEA 2Z1YA 2D65A 4ADDA 2AY1A 3NU8A 3AEPA 4A0RA 1AHEA 3NYUA 1C4KA 1M4NA 2NMPA 3FDBA 1MDOA 1CQ8A 4IX8A 2CH2A 3EZ1A 2VMYA 2W8JA 4CBSA 4OMAA 1UU2A 4F5LA 2EGYA 2TPLA 2ZSMA 3I5TA 1C9CA 3FTBA 4JEYA 2YKVA 2R5CB 1W23A 3P6KA 3JWAA 2FNIA 3PPLA 2D61A 4WP0A 2ZY3A 4WYAA 1O4SA 3ACZA 1ASLA 2EH6A 1KL2A 4L0OA 3M5UA 3CQ5A 3E2FA 2CB1A 3EIAA 1PMOA 1J32A 4R5FA 2AY6A 5C6UA 2GB3A 3QN6A 2VGWA 3KE3A 4CBRA 3GZDC 4E1OA 4ITXA 2JJHA 2BWNA 3ZZJA 2D63A 3QBOA 3OP7A 4WLHA 2DR1A 2ZSLA 5LHAA 3HL2A 1XEYA 1M7YA 2BI9A 4Y0IA 2Z1ZA 1RVYA 2ZJGA 1H1CA 2VMRA 4MQPA 1CS1A 1E5FA 4IXSA 1DKAA 3G0TA 2XH1A 2EZ1A 1ASBA 3WX9A 1ZOBA 3N4XA 4IXOA 1ASFA 3H7FA 1IJIA 1UU0A 1TOKA 1WSTA 2CH1A 4GSAA 1GDEA 1QIRA 1LC7A 3AEMC 1LK9A 3AV7A 1SVVA 1YIYA 2VMWA 4MQRA 1FG3A 4J8LA 2CFBA 3ELPA 3ZRQA 1W7LA 4KXKA 1G7WA 4ZM3A 4WD2A 5EUEA 3ISLA 3WKSA 1E5EA 1X0MA 1ARGA 4F5IA 4P7YA 3DODA 4ZASA 4XK1A 1AKBA 2YRRA 1KMJA 3NU7A 4ZWMA 4PFNA 2ZY5A 1OHVA 4ZLVA 1H0CA 5G09A 1DGEA 1YIZA 3RBFA 4OBVA 3VAXA 3II0A 2R5EA 4KAMA 1MLYA 4PFFA 2Z9XA 1BJOA 3WY7A 4F5JA 3WZFA 1WYTA 4RKDA 1V2FA 1OHYA 1G4XA 3BWNA 3RUYA 2DKBA 2VMVA 5EUNA 2CANA 5FT8A 2BIEA 2BWPA 3RI6A 2DGLA 4EU1A 2RFVA 1MGVA 2O1BA 2VYCA 2VMTA 1BJ4A 1M0PA 3BC8A 3G7QA 3KGWA 1KL1A 1S06A 2Z61A 1YJSA 1ORDA 4GE9A 4QGRA 1QITA 1CZCA 1D7SA 4K2BA 4JEZA 1ECXA 5HXXA 4JE5D 1QISA 4OT8A 3TFTA 3FZ8A 1AJRA 4LNLA 3ZRRA 4U1TA 4ZSYA 2HOYA 2QB2A 5DJ1A 5M49A 1ARIA 2BIAA 3B8XA 1B8GA 1S08A 3GBXA 1DGDA 5G4IA 4DGTA 2W7EA 3FVSA 1SZSA 1ASEA 1U08A 1GBNA 4Q75A 1V2EA 2HOXA 4RJYA 1ASGA 3FSLA 3F0HA 1QJ5A 4W91A 5HHYA 2W7KA 1D7UA 3FCRA 1AY5A 1S0AA 3E6GA 4TMRA 4CVQA 3HVYA 4CXRA 1DJEA 1IAYA 1O62A 5IWQA 4WYCA 2O0RA 4OCAA 2W8WA 3EUCA 4UHMA 4PVFA 2WB6A 1T3IA 2WK8A 5I92A 1BJWA 2AY3A 3AATA 1WYVA 4RIZA 3I4JA 3T32A 2OKJA 2QMAA 2AY5A 3A9XA 1IX7A 4ATQA 3PGYA 5FT5A 2DGMA 2G7JA 4E77A 1ASNA 2VMZA 1CL1A 1TARA 1AKAA 3A9ZA 3QHXA 4A0GA 4GDYA 1AX4A 3E9KA 3BCAA 1BQDA 1SZKA 2ZUKA 3HLMA 3P1TA 5DB5A 2W7IA 4K05A 3OKSA 2EO5A 2CSTA 3GZDA 1AMAA 3MAFA 2F8JA 4WYDA 1J04A 3ECDA 3GR9A 4WYGA 3CQ4A 1BKGA 2CY8A 4FFCA 2W7LA 2Q7WA 1X29A 3ASBA 1JS3A 4MKJA 1GC2A 1OATA 4R8DA 1M0QA 4B98A 1OXPA 3G8MA 4Q6RA 4AH3A 3F9TA 1TPLA 1O69A 1GEYA 5G2PA 2XBNA 5EAVA 3KGXA 3HDOA 3K40A 1C0NA 2VI9A 1B9HA 4PIWA 1DFOA 2EZ2A 2DGKA 3LVJA 4WXFA 4BHDA 4XJPA 5FT4A 4EB7A 2ZYJA 4ADCA 5FT6A 4A6RA 1ZC9A 3I16A 1YNUA 4R5ZA 4UHNA 1MAQA 1I48A 2X8UA 3AOVA 4IW7A 3LVKA 2W8UA 2YKYA 2AY9A 1B4XA 3FFHA 4H51A 4MGRA 4F5FA 5M46A 4UQVA 2C0RA 3LVMA 4EB5A 2AEUA 2VLFA 2YCNA 3MAFB 2DKJA 3WCNA 8AATA 2Z67A 4WYFA 3GJUA 3ELEA 2D7ZA 4W1VA 1AMRA 3RCHB 2Z20A 1Y4IA 1X2AA 5EFSA 2C7TA 1IBJA 4BA5A 2KFPA 5M4DA 1WYTB 3KKIA 4GEBA 3FZ6A 3E77A 4IY7A 1Z7DA 3N4SA 2Z9UA 5F8VA 3ZRPA 2CJGA 1RV3A 1IUGA 4MKKA 3NNKA 1GC0A 1CL2A 4EFFA 1LC5A 3BV0A 3A8UX 4LW4A 1LW4A 3FFRA 2W8VA 2YCTA 2W7FA 1C7OA 3BN1A 4JF0A 4WLJA 2QSRA 4RM1A 4K2IA 4JEWA 1PG8A 3WLXA 1WKGA 4AZKA 5G4JA 5F9SA 3QPGA 1YJYA 2BYLA 3AENB 4MQQA 4Q76A 1I41A 4HF8A 2OKKA 3MC6A 2QLRA 3GSBA 2CTZA 4M2MA 4W5KA 4LNJA 4A0HA 1AIAA 2VGTA 1B5OA 2OQXA 3D6KA 2GSAA 4JF1A 4ZM4A 2D7YA 3WGCA 2CJDA 1SPAA 4A72A 2R0TA 1GEWA 2YHKA 4E3RA 3F6TA 4RAEA 4TN4A 1VJOA 2ORDA 3DRDA 4B9BA 2E7JA 1YAAA 4XQ2A 3JU7A 2PO3A 3LWSA 3VOMA 3FDDA 3W1JA 2PB2A 4LNMA 3TFUA 1ASAA 1BQAA 3AEJC 1IX8A 2GQNA 4RJ0A 4O6ZA 2X5DA 4WXGA 2FYFA 1AHFA 5J8QA 3BB8A 1I43A 2BI3A 1FC4A 2HP1A 2W7JA 1MDXA 3NX3A 2D64A 5BJ4A 3UAKA 2C44A 2E7IA 1MDZA 1VP4A 3FKDA 1KKPA 4RITA 3MBBA 1ARTA 2Z9VA 5D5SA 2ZP7A 1TOIA 1ARSA 3AEOA 3FD0A 3N75A 3N0LA 3K7YA 2VIBA 1BW0A 1JS6A 5EQCA 5KTBA 2EPJA 3TCMA 1CQ6A 1MAPA 1WYVB 2VGZA 3RQ1A 1IAXA 3QGUA 2YKUA 3A9YA 1AJSA 2BWOA 1AIBA 2VMUA 4U2HA 5TF5A 2JJGA 3DR7A 2VLHA 4OBUA 2C81A 2VMOA 2AEVA 2Z9WA 1BT4A 5G2QA 4AZJA 3E2ZA 4WBTA 3LVLB 2HUFA 1DJ9A 1KMKA 3PDXA 4ZWVA 1TOJA 2VGVA 4BQ0A 4W1XA 3B46A 1Z3ZA 3R4TA 1O61A 3DC1A 4GE4A 4LC3A 1GC3A 2JGTA 3B1CA 3VK3A 3UE8A 2W7DA 4JE5A 2W7MA 3FZ7A 1ASDA 1WYUB 2VMXA 3WCOA 2JG2A 3JW9A 2E7UA 1BJOB 1OXOA 2WK9A 3EI9A 4M2KA 1D7VA 3HT4A 1AY4A 4XAUA 1AHGA 2YKXA 1OHWA 1JG8A 3FVXA 5EIGB 4Q31A 4BA4A 2BI1A 3AELA 2ZY2A 4A6TA 4HVKA 3QM2A 2OGEA 3DU4A 4N0WA 3PD6A 4ADBA 1EG5A 1V72A 4A0FA 1M0OA 1M32A 3E2ZB 1AHXA 1X28A 1JF9A 4WYEA 2AY8A 3HMUA 2E54A 5LH9A 3PD6B 2YRIA 3MEBA 3EI6A 1S07A 4ZDOA 2ZY4A 3H14A 4LW2A 5E4ZA 3NTJA 1ASMA 3DYDA 2V1PA 1YJZA 4WB0A 5DJ9A 2GMSA 1TOGA 1SFFA 4J5UA 4F5HA 5DX5A 3COGA 3PDBB 2VMPA 1I29A 1PFFA 4N0BA 2BKWA 4ZDLA 2YCPA 4W1WA 2FNUA 5EIGA 1ASCA 2FQ6A 3PIUA 2G6WA 3FVUA 3WKRA 4AO4A 5JAYA 3EI8A 2VMSA 3BWOA 3HQTA 4Y0DA 1CJ0A 4E3QA 2JJEA 1BS0A 3DZZA 1LS3A 5M4BA 1FG7A 2GMUA 2QA3A 3MKJA 3HBXA 3EI7A 2QBTA 1C7GA 1EJIA 1WKHA 2AATA 1IX6A 2WKAA 5E5IA 5EUDA 2PB0A 1N31A 1TOEA 3L8AA 2BIGA 1LW5A 4IXZA 4AOAA 3NYTA 1B9IA 1BJNA 3GETA 4KYOA 2QB3A 2JJFA 4WB0B 2VMQA 1ELUA 4MY5A 3EI5A 4K2MA 1ELQA 2HP2A 4GRXA 4JEXA 4CXQA 3BCXA 4M2JA 1DTYA 1S09A 3FQAA 2VI8A 1QGNA 3PAAA 2EYQA 3DXVA 4Y0HA 2VGUA 3B1EA 3L44A 3N5MA 3LG0A 1M0NA 1WYUA 3Q8NA 4F4EA 2OATA 2FN6A 3AEJA 4ISYA 1D7RA 1PMMA 3IF2A 1IVRA 3N4RA 2VMNA 3ZZKA 1N8PA 2AY7A 1LKCA 1TATA 1XI9A 1W7MA 2W8TA 1GC4A 3GWPA 3VK2A 3A2BA 4A00A 5E3KA 3W1IA 3LY1A 1AKCA 4ATPA 4F5KA 4EMYA 1P3WA 2BHXA 3WGBA 1B5PA 2O7CA 2D5YA 2VIAA 3EZSA 3AENA 4FL0A 2HUUA 1ZODA 2D66A 2HZPA 1AY8A 2OGAA 3AEMA 2FM1A 4NOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR4 A;  3NUB A;  3GZC A;  1AIC A;  3MAU A;  4IYO A;  1AAM A;  1RV4 A;  3AOW A;  2X3L A;  2DOU A;  2X5F A;  3CBF A;  1AMQ A;  3RBL A;  4GE7 A;  5K8B A;  3PA9 A;  1MLZ A;  3R9A A;  1SZU A;  2R5C A;  4AO9 A;  2HOR A;  3EIB A;  1AAW A;  1W7N A;  2CJH A;  1LC8 A;  4IYO B;  1C7N A;  5EAA A;  4BMK A;  3BS8 A;  1QZ9 A;  3ATH A;  1VEF A;  4A6U A;  2AY4 A;  3BCB A;  1D2F A;  3B1D A;  3FQ8 A;  2CIN A;  5D95 A;  3TAT A;  1V2D A;  1YOO A;  4UHO A;  2HUI A;  1ARH A;  1CQ7 A;  4UOY A;  3VP6 A;  1M6S A;  2BYJ A;  1N2T A;  4ZAH A;  2JIS A;  1RVU A;  2BI2 A;  1G7X A;  3BWN C;  3NDN A;  3DXW A;  4WXB A;  4OYT A;  7AAT A;  1UU1 A;  2VGS A;  1KKJ A;  3IHJ A;  4RLG A;  5HDM A;  3JZL A;  1SF2 A;  1AHY A;  3JTX A;  3TQX A;  4ZSW A;  4RKC A;  2R2N A;  1QJ3 A;  4ZDP A;  2BI5 A;  4DBC A;  2AY2 A;  1GCK A;  1AJS B;  5G0A A;  1AMS A;  2YOB A;  1EQB A;  4MSO A;  4XJL A;  4F5G A;  3CAI A;  4ADE A;  4F5M A;  3MAD A;  4DQ6 A;  3W1H A;  3FQ7 A;  4XJO A;  4R2N A;  4I8A A;  2W7G A;  1DJU A;  2ZC0 A;  3LV2 A;  3MC6 C;  1GEX A;  5AX8 A;  3CQ6 A;  3QI6 A;  3PDB A;  1G4V A;  3JWB A;  3NRA A;  4P3M A;  3K28 A;  2HOZ A;  4OTL A;  4W8I A;  3USF A;  3NUI A;  1UKJ A;  3PJ0 A;  3E2Y A;  3NYS A;  4XEW A;  2WK7 A;  4JEV A;  3RCH A;  4XJM A;  4ITG A;  2W7H A;  3ASA A;  1W3U A;  9AAT A;  1GD9 A;  3VK4 A;  3FRK A;  1TAS A;  4OC9 A;  5BJ3 A;  3UWC A;  2V0Y A;  4TV7 A;  1CZE A;  2Z1Y A;  2D65 A;  4ADD A;  2AY1 A;  3NU8 A;  3AEP A;  4A0R A;  1AHE A;  3NYU A;  1C4K A;  1M4N A;  2NMP A;  3FDB A;  1MDO A;  1CQ8 A;  4IX8 A;  2CH2 A;  3EZ1 A;  2VMY A;  2W8J A;  4CBS A;  4OMA A;  1UU2 A;  4F5L A;  2EGY A;  2TPL A;  2ZSM A;  3I5T A;  1C9C A;  3FTB A;  4JEY A;  2YKV A;  2R5C B;  1W23 A;  3P6K A;  3JWA A;  2FNI A;  3PPL A;  2D61 A;  4WP0 A;  2ZY3 A;  4WYA A;  1O4S A;  3ACZ A;  1ASL A;  2EH6 A;  1KL2 A;  4L0O A;  3M5U A;  3CQ5 A;  3E2F A;  2CB1 A;  3EIA A;  1PMO A;  1J32 A;  4R5F A;  2AY6 A;  5C6U A;  2GB3 A;  3QN6 A;  2VGW A;  3KE3 A;  4CBR A;  3GZD C;  4E1O A;  4ITX A;  2JJH A;  2BWN A;  3ZZJ A;  2D63 A;  3QBO A;  3OP7 A;  4WLH A;  2DR1 A;  2ZSL A;  5LHA A;  3HL2 A;  1XEY A;  1M7Y A;  2BI9 A;  4Y0I A;  2Z1Z A;  1RVY A;  2ZJG A;  1H1C A;  2VMR A;  4MQP A;  1CS1 A;  1E5F A;  4IXS A;  1DKA A;  3G0T A;  2XH1 A;  2EZ1 A;  1ASB A;  3WX9 A;  1ZOB A;  4IXO A;  1ASF A;  3H7F A;  1IJI A;  1UU0 A;  1TOK A;  1WST A;  2CH1 A;  4GSA A;  1GDE A;  1QIR A;  1LC7 A;  3AEM C;  1LK9 A;  3AV7 A;  1SVV A;  1YIY A;  2VMW A;  4MQR A;  1FG3 A;  4J8L A;  2CFB A;  3ELP A;  3ZRQ A;  1W7L A;  4KXK A;  1G7W A;  4ZM3 A;  4WD2 A;  5EUE A;  3ISL A;  3WKS A;  1E5E A;  1X0M A;  1ARG A;  4F5I A;  4P7Y A;  3DOD A;  4ZAS A;  4XK1 A;  1AKB A;  2YRR A;  1KMJ A;  3NU7 A;  4ZWM A;  4PFN A;  2ZY5 A;  1OHV A;  4ZLV A;  1H0C A;  5G09 A;  1DGE A;  1YIZ A;  3RBF A;  4OBV A;  3VAX A;  3II0 A;  2R5E A;  4KAM A;  1MLY A;  4PFF A;  2Z9X A;  1BJO A;  3WY7 A;  4F5J A;  3WZF A;  1WYT A;  4RKD A;  1V2F A;  1OHY A;  1G4X A;  3BWN A;  3RUY A;  2DKB A;  2VMV A;  5EUN A;  2CAN A;  5FT8 A;  2BIE A;  2BWP A;  3RI6 A;  2DGL A;  4EU1 A;  2RFV A;  1MGV A;  2O1B A;  2VYC A;  2VMT A;  1BJ4 A;  1M0P A;  3BC8 A;  3G7Q A;  3KGW A;  1KL1 A;  1S06 A;  2Z61 A;  1YJS A;  1ORD A;  4GE9 A;  4QGR A;  1QIT A;  1CZC A;  1D7S A;  4K2B A;  4JEZ A;  1ECX A;  5HXX A;  4JE5 D;  1QIS A;  4OT8 A;  3TFT A;  3FZ8 A;  1AJR A;  4LNL A;  3ZRR A;  4U1T A;  4ZSY A;  2HOY A;  2QB2 A;  5DJ1 A;  5M49 A;  1ARI A;  2BIA A;  3B8X A;  1B8G A;  1S08 A;  3GBX A;  1DGD A;  5G4I A;  4DGT A;  2W7E A;  3FVS A;  1SZS A;  1ASE A;  1U08 A;  1GBN A;  4Q75 A;  1V2E A;  2HOX A;  4RJY A;  1ASG A;  3FSL A;  3F0H A;  1QJ5 A;  4W91 A;  5HHY A;  2W7K A;  1D7U A;  3FCR A;  1AY5 A;  1S0A A;  3E6G A;  4TMR A;  4CVQ A;  3HVY A;  4CXR A;  1DJE A;  1IAY A;  1O62 A;  5IWQ A;  4WYC A;  2O0R A;  4OCA A;  2W8W A;  3EUC A;  4UHM A;  4PVF A;  1T3I A;  2WK8 A;  5I92 A;  1BJW A;  2AY3 A;  3AAT A;  1WYV A;  4RIZ A;  3I4J A;  3T32 A;  2OKJ A;  2QMA A;  2AY5 A;  3A9X A;  1IX7 A;  4ATQ A;  3PGY A;  5FT5 A;  2DGM A;  4E77 A;  1ASN A;  2VMZ A;  1CL1 A;  1TAR A;  1AKA A;  3A9Z A;  3QHX A;  4A0G A;  4GDY A;  1AX4 A;  3E9K A;  3BCA A;  1BQD A;  1SZK A;  2ZUK A;  3HLM A;  3P1T A;  5DB5 A;  2W7I A;  3OKS A;  2EO5 A;  2CST A;  3GZD A;  1AMA A;  3MAF A;  2F8J A;  4WYD A;  1J04 A;  3ECD A;  3GR9 A;  4WYG A;  3CQ4 A;  1BKG A;  2CY8 A;  4FFC A;  2W7L A;  2Q7W A;  1X29 A;  3ASB A;  1JS3 A;  4MKJ A;  1GC2 A;  1OAT A;  4R8D A;  1M0Q A;  4B98 A;  1OXP A;  3G8M A;  4Q6R A;  4AH3 A;  3F9T A;  1TPL A;  1O69 A;  1GEY A;  5G2P A;  2XBN A;  5EAV A;  3KGX A;  3HDO A;  3K40 A;  1C0N A;  2VI9 A;  1B9H A;  4PIW A;  1DFO A;  2EZ2 A;  2DGK A;  3LVJ A;  4WXF A;  4BHD A;  4XJP A;  5FT4 A;  4EB7 A;  2ZYJ A;  4ADC A;  5FT6 A;  4A6R A;  1ZC9 A;  3I16 A;  1YNU A;  4R5Z A;  4UHN A;  1MAQ A;  1I48 A;  2X8U A;  3AOV A;  4IW7 A;  3LVK A;  2W8U A;  2YKY A;  2AY9 A;  1B4X A;  3FFH A;  4H51 A;  4MGR A;  4F5F A;  5M46 A;  4UQV A;  2C0R A;  3LVM A;  4EB5 A;  2AEU A;  2VLF A;  2YCN A;  3MAF B;  2DKJ A;  3WCN A;  8AAT A;  2Z67 A;  4WYF A;  3GJU A;  3ELE A;  2D7Z A;  4W1V A;  1AMR A;  3RCH B;  2Z20 A;  1Y4I A;  1X2A A;  5EFS A;  2C7T A;  1IBJ A;  4BA5 A;  5M4D A;  1WYT B;  3KKI A;  4GEB A;  3FZ6 A;  3E77 A;  4IY7 A;  1Z7D A;  2Z9U A;  5F8V A;  3ZRP A;  2CJG A;  1RV3 A;  1IUG A;  4MKK A;  3NNK A;  1GC0 A;  1CL2 A;  4EFF A;  1LC5 A;  3BV0 A;  3A8U X;  4LW4 A;  1LW4 A;  3FFR A;  2W8V A;  2YCT A;  2W7F A;  1C7O A;  3BN1 A;  4JF0 A;  4WLJ A;  4RM1 A;  4K2I A;  4JEW A;  1PG8 A;  3WLX A;  1WKG A;  4AZK A;  5G4J A;  5F9S A;  3QPG A;  1YJY A;  2BYL A;  3AEN B;  4MQQ A;  4Q76 A;  1I41 A;  4HF8 A;  2OKK A;  3MC6 A;  2QLR A;  3GSB A;  2CTZ A;  4M2M A;  4W5K A;  4LNJ A;  4A0H A;  1AIA A;  2VGT A;  1B5O A;  2OQX A;  3D6K A;  2GSA A;  4JF1 A;  4ZM4 A;  2D7Y A;  3WGC A;  2CJD A;  1SPA A;  4A72 A;  2R0T A;  1GEW A;  2YHK A;  4E3R A;  3F6T A;  4RAE A;  4TN4 A;  1VJO A;  2ORD A;  3DRD A;  4B9B A;  2E7J A;  1YAA A;  4XQ2 A;  3JU7 A;  2PO3 A;  3LWS A;  3VOM A;  3FDD A;  3W1J A;  2PB2 A;  4LNM A;  3TFU A;  1ASA A;  1BQA A;  3AEJ C;  1IX8 A;  2GQN A;  4RJ0 A;  4O6Z A;  2X5D A;  4WXG A;  2FYF A;  1AHF A;  5J8Q A;  3BB8 A;  1I43 A;  2BI3 A;  1FC4 A;  2HP1 A;  2W7J A;  1MDX A;  3NX3 A;  2D64 A;  5BJ4 A;  3UAK A;  2C44 A;  2E7I A;  1MDZ A;  1VP4 A;  3FKD A;  1KKP A;  4RIT A;  3MBB A;  1ART A;  2Z9V A;  5D5S A;  2ZP7 A;  1TOI A;  1ARS A;  3AEO A;  3FD0 A;  3N75 A;  3N0L A;  3K7Y A;  2VIB A;  1BW0 A;  1JS6 A;  5EQC A;  2EPJ A;  3TCM A;  1CQ6 A;  1MAP A;  1WYV B;  2VGZ A;  3RQ1 A;  1IAX A;  3QGU A;  2YKU A;  3A9Y A;  1AJS A;  2BWO A;  1AIB A;  2VMU A;  4U2H A;  5TF5 A;  2JJG A;  3DR7 A;  2VLH A;  4OBU A;  2C81 A;  2VMO A;  2AEV A;  2Z9W A;  1BT4 A;  5G2Q A;  4AZJ A;  3E2Z A;  4WBT A;  3LVL B;  2HUF A;  1DJ9 A;  1KMK A;  3PDX A;  4ZWV A;  1TOJ A;  2VGV A;  4BQ0 A;  4W1X A;  3B46 A;  1Z3Z A;  3R4T A;  1O61 A;  3DC1 A;  4GE4 A;  4LC3 A;  1GC3 A;  2JGT A;  3B1C A;  3VK3 A;  3UE8 A;  2W7D A;  4JE5 A;  2W7M A;  3FZ7 A;  1ASD A;  1WYU B;  2VMX A;  3WCO A;  2JG2 A;  3JW9 A;  2E7U A;  1BJO B;  1OXO A;  2WK9 A;  3EI9 A;  4M2K A;  1D7V A;  3HT4 A;  1AY4 A;  4XAU A;  1AHG A;  2YKX A;  1OHW A;  1JG8 A;  3FVX A;  5EIG B;  4Q31 A;  4BA4 A;  2BI1 A;  3AEL A;  2ZY2 A;  4A6T A;  4HVK A;  3QM2 A;  2OGE A;  3DU4 A;  4N0W A;  3PD6 A;  4ADB A;  1EG5 A;  1V72 A;  4A0F A;  1M0O A;  1M32 A;  3E2Z B;  1AHX A;  1X28 A;  1JF9 A;  4WYE A;  2AY8 A;  3HMU A;  2E54 A;  5LH9 A;  3PD6 B;  2YRI A;  3MEB A;  3EI6 A;  1S07 A;  4ZDO A;  2ZY4 A;  3H14 A;  4LW2 A;  5E4Z A;  3NTJ A;  1ASM A;  3DYD A;  2V1P A;  1YJZ A;  4WB0 A;  5DJ9 A;  2GMS A;  1TOG A;  1SFF A;  4J5U A;  4F5H A;  5DX5 A;  3COG A;  3PDB B;  2VMP A;  1I29 A;  1PFF A;  4N0B A;  2BKW A;  4ZDL A;  2YCP A;  4W1W A;  2FNU A;  5EIG A;  1ASC A;  2FQ6 A;  3PIU A;  2G6W A;  3FVU A;  3WKR A;  4AO4 A;  5JAY A;  3EI8 A;  2VMS A;  3BWO A;  3HQT A;  4Y0D A;  1CJ0 A;  4E3Q A;  2JJE A;  1BS0 A;  3DZZ A;  1LS3 A;  5M4B A;  1FG7 A;  2GMU A;  2QA3 A;  3MKJ A;  3HBX A;  3EI7 A;  2QBT A;  1C7G A;  1EJI A;  1WKH A;  2AAT A;  1IX6 A;  2WKA A;  5E5I A;  5EUD A;  2PB0 A;  1N31 A;  1TOE A;  3L8A A;  2BIG A;  1LW5 A;  4IXZ A;  4AOA A;  3NYT A;  1B9I A;  1BJN A;  3GET A;  4KYO A;  2QB3 A;  2JJF A;  4WB0 B;  2VMQ A;  1ELU A;  4MY5 A;  3EI5 A;  4K2M A;  1ELQ A;  2HP2 A;  4GRX A;  4JEX A;  4CXQ A;  3BCX A;  4M2J A;  1DTY A;  1S09 A;  3FQA A;  2VI8 A;  1QGN A;  3PAA A;  3DXV A;  4Y0H A;  2VGU A;  3B1E A;  3L44 A;  3N5M A;  3LG0 A;  1M0N A;  1WYU A;  3Q8N A;  4F4E A;  2OAT A;  2FN6 A;  3AEJ A;  4ISY A;  1D7R A;  1PMM A;  3IF2 A;  1IVR A;  2VMN A;  3ZZK A;  1N8P A;  2AY7 A;  1LKC A;  1TAT A;  1XI9 A;  1W7M A;  2W8T A;  1GC4 A;  3GWP A;  3VK2 A;  3A2B A;  4A00 A;  5E3K A;  3W1I A;  3LY1 A;  1AKC A;  4ATP A;  4F5K A;  4EMY A;  1P3W A;  2BHX A;  3WGB A;  1B5P A;  2O7C A;  2D5Y A;  2VIA A;  3EZS A;  3AEN A;  4FL0 A;  2HUU A;  1ZOD A;  2D66 A;  2HZP A;  1AY8 A;  2OGA A;  3AEM A;  2FM1 A;  4NOG A; 
#chains in the Genus database with same CATH topology
 3DR4 A;  3NUB A;  3GZC A;  1AIC A;  3MAU A;  4IYO A;  1AAM A;  1RV4 A;  3AOW A;  2X3L A;  2DOU A;  2X5F A;  3CBF A;  1AMQ A;  3RBL A;  4GE7 A;  5K8B A;  3PA9 A;  1MLZ A;  3R9A A;  1SZU A;  2R5C A;  4AO9 A;  2HOR A;  3EIB A;  1AAW A;  1W7N A;  2CJH A;  1LC8 A;  4IYO B;  1C7N A;  5EAA A;  2A1V A;  4BMK A;  3BS8 A;  3H9X A;  3N7N A;  1QZ9 A;  3ATH A;  1VEF A;  4A6U A;  2AY4 A;  3BCB A;  1D2F A;  3B1D A;  3FQ8 A;  2CIN A;  5D95 A;  4H63 Q;  3TAT A;  1V2D A;  1YOO A;  4UHO A;  2HUI A;  1ARH A;  1CQ7 A;  4UOY A;  3VP6 A;  1M6S A;  2BYJ A;  1N2T A;  4ZAH A;  2JIS A;  1RVU A;  2BI2 A;  1G7X A;  3BWN C;  3NDN A;  3DXW A;  4WXB A;  4OYT A;  7AAT A;  1UU1 A;  2VGS A;  1KKJ A;  3IHJ A;  4RLG A;  5HDM A;  3JZL A;  1SF2 A;  1AHY A;  3JTX A;  3TQX A;  4ZSW A;  4RKC A;  2R2N A;  1QJ3 A;  4ZDP A;  2BI5 A;  4DBC A;  2AY2 A;  2FKI A;  1GCK A;  1AJS B;  5G0A A;  1AMS A;  2YOB A;  1EQB A;  4MSO A;  4XJL A;  4F5G A;  3CAI A;  4ADE A;  4F5M A;  3MAD A;  4DQ6 A;  3W1H A;  3FQ7 A;  4XJO A;  4R2N A;  4I8A A;  2W7G A;  1DJU A;  2ZC0 A;  3LV2 A;  3MC6 C;  1GEX A;  5AX8 A;  3CQ6 A;  3QI6 A;  3PDB A;  1G4V A;  3JWB A;  3NRA A;  4P3M A;  3K28 A;  2HOZ A;  4OTL A;  4W8I A;  3USF A;  3NUI A;  1UKJ A;  3PJ0 A;  3E2Y A;  3NYS A;  4XEW A;  2WK7 A;  4JEV A;  3RCH A;  4XJM A;  4ITG A;  2W7H A;  3ASA A;  1W3U A;  9AAT A;  1GD9 A;  3VK4 A;  3FRK A;  1TAS A;  4OC9 A;  5BJ3 A;  3UWC A;  2V0Y A;  4TV7 A;  1CZE A;  2Z1Y A;  2D65 A;  4ADD A;  2AY1 A;  3NU8 A;  3AEP A;  4A0R A;  1AHE A;  3NYU A;  1C4K A;  1M4N A;  2NMP A;  3FDB A;  1MDO A;  1CQ8 A;  4IX8 A;  2CH2 A;  3EZ1 A;  2VMY A;  2W8J A;  4CBS A;  4OMA A;  1UU2 A;  4F5L A;  2EGY A;  2TPL A;  2ZSM A;  3I5T A;  1C9C A;  3FTB A;  4JEY A;  2YKV A;  2R5C B;  1W23 A;  3P6K A;  3JWA A;  2FNI A;  3PPL A;  2D61 A;  4WP0 A;  2ZY3 A;  4WYA A;  1O4S A;  3ACZ A;  1ASL A;  2EH6 A;  1KL2 A;  4L0O A;  3M5U A;  3CQ5 A;  3E2F A;  2CB1 A;  3EIA A;  1PMO A;  1J32 A;  4R5F A;  2AY6 A;  5C6U A;  2GB3 A;  3QN6 A;  2VGW A;  3KE3 A;  4CBR A;  3GZD C;  4E1O A;  4ITX A;  2JJH A;  2BWN A;  3ZZJ A;  2D63 A;  3QBO A;  3OP7 A;  4WLH A;  2DR1 A;  2ZSL A;  5LHA A;  3HL2 A;  1XEY A;  1M7Y A;  2BI9 A;  4Y0I A;  2Z1Z A;  1RVY A;  2ZJG A;  1H1C A;  2VMR A;  4MQP A;  1CS1 A;  1E5F A;  4IXS A;  1DKA A;  3G0T A;  2XH1 A;  2EZ1 A;  1ASB A;  3WX9 A;  1ZOB A;  3N4X A;  4IXO A;  1ASF A;  3H7F A;  1IJI A;  1UU0 A;  1TOK A;  1WST A;  2CH1 A;  4GSA A;  1GDE A;  1QIR A;  1LC7 A;  3AEM C;  1LK9 A;  3AV7 A;  1SVV A;  1YIY A;  2VMW A;  4MQR A;  1FG3 A;  4J8L A;  2CFB A;  3ELP A;  3ZRQ A;  1W7L A;  4KXK A;  1G7W A;  4ZM3 A;  4WD2 A;  5EUE A;  3ISL A;  3WKS A;  1E5E A;  1X0M A;  1ARG A;  4F5I A;  4P7Y A;  3DOD A;  4ZAS A;  4XK1 A;  1AKB A;  2YRR A;  1KMJ A;  3NU7 A;  4ZWM A;  4PFN A;  2ZY5 A;  1OHV A;  4ZLV A;  1H0C A;  5G09 A;  1DGE A;  1YIZ A;  3RBF A;  4OBV A;  3VAX A;  3II0 A;  2R5E A;  4KAM A;  1MLY A;  4PFF A;  2Z9X A;  1BJO A;  3WY7 A;  4F5J A;  3WZF A;  1WYT A;  4RKD A;  1V2F A;  1OHY A;  1G4X A;  3BWN A;  3RUY A;  2DKB A;  2VMV A;  5EUN A;  2CAN A;  5FT8 A;  2BIE A;  2BWP A;  3RI6 A;  2DGL A;  4EU1 A;  2RFV A;  1MGV A;  2O1B A;  2VYC A;  2VMT A;  1BJ4 A;  1M0P A;  3BC8 A;  3G7Q A;  3KGW A;  1KL1 A;  1S06 A;  2Z61 A;  1YJS A;  1ORD A;  4GE9 A;  4QGR A;  1QIT A;  1CZC A;  1D7S A;  4K2B A;  4JEZ A;  1ECX A;  5HXX A;  4JE5 D;  1QIS A;  4OT8 A;  3TFT A;  3FZ8 A;  1AJR A;  4LNL A;  3ZRR A;  4U1T A;  4ZSY A;  2HOY A;  2QB2 A;  5DJ1 A;  5M49 A;  1ARI A;  2BIA A;  3B8X A;  1B8G A;  1S08 A;  3GBX A;  1DGD A;  5G4I A;  4DGT A;  2W7E A;  3FVS A;  1SZS A;  1ASE A;  1U08 A;  1GBN A;  4Q75 A;  1V2E A;  2HOX A;  4RJY A;  1ASG A;  3FSL A;  3F0H A;  1QJ5 A;  4W91 A;  5HHY A;  2W7K A;  1D7U A;  3FCR A;  1AY5 A;  1S0A A;  3E6G A;  4TMR A;  4CVQ A;  3HVY A;  4CXR A;  1DJE A;  1IAY A;  1O62 A;  5IWQ A;  4WYC A;  2O0R A;  4OCA A;  2W8W A;  3EUC A;  4UHM A;  4PVF A;  2WB6 A;  1T3I A;  2WK8 A;  5I92 A;  1BJW A;  2AY3 A;  3AAT A;  1WYV A;  4RIZ A;  3I4J A;  3T32 A;  2OKJ A;  2QMA A;  2AY5 A;  3A9X A;  1IX7 A;  4ATQ A;  3PGY A;  5FT5 A;  2DGM A;  2G7J A;  4E77 A;  1ASN A;  2VMZ A;  1CL1 A;  1TAR A;  1AKA A;  3A9Z A;  3QHX A;  4A0G A;  4GDY A;  1AX4 A;  3E9K A;  3BCA A;  1BQD A;  1SZK A;  2ZUK A;  3HLM A;  3P1T A;  5DB5 A;  2W7I A;  4K05 A;  3OKS A;  2EO5 A;  2CST A;  3GZD A;  1AMA A;  3MAF A;  2F8J A;  4WYD A;  1J04 A;  3ECD A;  3GR9 A;  4WYG A;  3CQ4 A;  1BKG A;  2CY8 A;  4FFC A;  2W7L A;  2Q7W A;  1X29 A;  3ASB A;  1JS3 A;  4MKJ A;  1GC2 A;  1OAT A;  4R8D A;  1M0Q A;  4B98 A;  1OXP A;  3G8M A;  4Q6R A;  4AH3 A;  3F9T A;  1TPL A;  1O69 A;  1GEY A;  5G2P A;  2XBN A;  5EAV A;  3KGX A;  3HDO A;  3K40 A;  1C0N A;  2VI9 A;  1B9H A;  4PIW A;  1DFO A;  2EZ2 A;  2DGK A;  3LVJ A;  4WXF A;  4BHD A;  4XJP A;  5FT4 A;  4EB7 A;  2ZYJ A;  4ADC A;  5FT6 A;  4A6R A;  1ZC9 A;  3I16 A;  1YNU A;  4R5Z A;  4UHN A;  1MAQ A;  1I48 A;  2X8U A;  3AOV A;  4IW7 A;  3LVK A;  2W8U A;  2YKY A;  2AY9 A;  1B4X A;  3FFH A;  4H51 A;  4MGR A;  4F5F A;  5M46 A;  4UQV A;  2C0R A;  3LVM A;  4EB5 A;  2AEU A;  2VLF A;  2YCN A;  3MAF B;  2DKJ A;  3WCN A;  8AAT A;  2Z67 A;  4WYF A;  3GJU A;  3ELE A;  2D7Z A;  4W1V A;  1AMR A;  3RCH B;  2Z20 A;  1Y4I A;  1X2A A;  5EFS A;  2C7T A;  1IBJ A;  4BA5 A;  2KFP A;  5M4D A;  1WYT B;  3KKI A;  4GEB A;  3FZ6 A;  3E77 A;  4IY7 A;  1Z7D A;  3N4S A;  2Z9U A;  5F8V A;  3ZRP A;  2CJG A;  1RV3 A;  1IUG A;  4MKK A;  3NNK A;  1GC0 A;  1CL2 A;  4EFF A;  1LC5 A;  3BV0 A;  3A8U X;  4LW4 A;  1LW4 A;  3FFR A;  2W8V A;  2YCT A;  2W7F A;  1C7O A;  3BN1 A;  4JF0 A;  4WLJ A;  2QSR A;  4RM1 A;  4K2I A;  4JEW A;  1PG8 A;  3WLX A;  1WKG A;  4AZK A;  5G4J A;  5F9S A;  3QPG A;  1YJY A;  2BYL A;  3AEN B;  4MQQ A;  4Q76 A;  1I41 A;  4HF8 A;  2OKK A;  3MC6 A;  2QLR A;  3GSB A;  2CTZ A;  4M2M A;  4W5K A;  4LNJ A;  4A0H A;  1AIA A;  2VGT A;  1B5O A;  2OQX A;  3D6K A;  2GSA A;  4JF1 A;  4ZM4 A;  2D7Y A;  3WGC A;  2CJD A;  1SPA A;  4A72 A;  2R0T A;  1GEW A;  2YHK A;  4E3R A;  3F6T A;  4RAE A;  4TN4 A;  1VJO A;  2ORD A;  3DRD A;  4B9B A;  2E7J A;  1YAA A;  4XQ2 A;  3JU7 A;  2PO3 A;  3LWS A;  3VOM A;  3FDD A;  3W1J A;  2PB2 A;  4LNM A;  3TFU A;  1ASA A;  1BQA A;  3AEJ C;  1IX8 A;  2GQN A;  4RJ0 A;  4O6Z A;  2X5D A;  4WXG A;  2FYF A;  1AHF A;  5J8Q A;  3BB8 A;  1I43 A;  2BI3 A;  1FC4 A;  2HP1 A;  2W7J A;  1MDX A;  3NX3 A;  2D64 A;  5BJ4 A;  3UAK A;  2C44 A;  2E7I A;  1MDZ A;  1VP4 A;  3FKD A;  1KKP A;  4RIT A;  3MBB A;  1ART A;  2Z9V A;  5D5S A;  2ZP7 A;  1TOI A;  1ARS A;  3AEO A;  3FD0 A;  3N75 A;  3N0L A;  3K7Y A;  2VIB A;  1BW0 A;  1JS6 A;  5EQC A;  5KTB A;  2EPJ A;  3TCM A;  1CQ6 A;  1MAP A;  1WYV B;  2VGZ A;  3RQ1 A;  1IAX A;  3QGU A;  2YKU A;  3A9Y A;  1AJS A;  2BWO A;  1AIB A;  2VMU A;  4U2H A;  5TF5 A;  2JJG A;  3DR7 A;  2VLH A;  4OBU A;  2C81 A;  2VMO A;  2AEV A;  2Z9W A;  1BT4 A;  5G2Q A;  4AZJ A;  3E2Z A;  4WBT A;  3LVL B;  2HUF A;  1DJ9 A;  1KMK A;  3PDX A;  4ZWV A;  1TOJ A;  2VGV A;  4BQ0 A;  4W1X A;  3B46 A;  1Z3Z A;  3R4T A;  1O61 A;  3DC1 A;  4GE4 A;  4LC3 A;  1GC3 A;  2JGT A;  3B1C A;  3VK3 A;  1KAF A;  3UE8 A;  2W7D A;  4JE5 A;  2W7M A;  3FZ7 A;  1ASD A;  1WYU B;  2VMX A;  3WCO A;  2JG2 A;  3JW9 A;  2E7U A;  1BJO B;  1OXO A;  2WK9 A;  3EI9 A;  4M2K A;  1D7V A;  3HT4 A;  1AY4 A;  4XAU A;  1AHG A;  2YKX A;  1OHW A;  1JG8 A;  3FVX A;  5EIG B;  4Q31 A;  4BA4 A;  2BI1 A;  3AEL A;  2ZY2 A;  4A6T A;  4HVK A;  3QM2 A;  2OGE A;  3DU4 A;  4N0W A;  3PD6 A;  4ADB A;  1EG5 A;  1V72 A;  4A0F A;  1M0O A;  1M32 A;  3E2Z B;  1AHX A;  1X28 A;  1JF9 A;  4WYE A;  2AY8 A;  3HMU A;  2E54 A;  5LH9 A;  3PD6 B;  2YRI A;  3MEB A;  3EI6 A;  1S07 A;  4ZDO A;  2ZY4 A;  3H14 A;  4LW2 A;  5E4Z A;  3NTJ A;  1ASM A;  3DYD A;  2V1P A;  1YJZ A;  4WB0 A;  5DJ9 A;  2GMS A;  1TOG A;  1SFF A;  4J5U A;  4F5H A;  5DX5 A;  3COG A;  3PDB B;  2VMP A;  1I29 A;  1PFF A;  4N0B A;  2BKW A;  4ZDL A;  2YCP A;  4W1W A;  2FNU A;  5EIG A;  1ASC A;  2FQ6 A;  3PIU A;  2G6W A;  3FVU A;  3WKR A;  4AO4 A;  5JAY A;  3EI8 A;  2VMS A;  3BWO A;  3HQT A;  4Y0D A;  1CJ0 A;  4E3Q A;  2JJE A;  1BS0 A;  3DZZ A;  1LS3 A;  5M4B A;  1FG7 A;  2GMU A;  2QA3 A;  3MKJ A;  3HBX A;  3EI7 A;  2QBT A;  1C7G A;  1EJI A;  1WKH A;  2AAT A;  1IX6 A;  2WKA A;  5E5I A;  5EUD A;  2PB0 A;  1N31 A;  1TOE A;  3L8A A;  2BIG A;  1LW5 A;  4IXZ A;  4AOA A;  3NYT A;  1B9I A;  1BJN A;  3GET A;  4KYO A;  2QB3 A;  2JJF A;  4WB0 B;  2VMQ A;  1ELU A;  4MY5 A;  3EI5 A;  4K2M A;  1ELQ A;  2HP2 A;  4GRX A;  4JEX A;  4CXQ A;  3BCX A;  4M2J A;  1DTY A;  1S09 A;  3FQA A;  2VI8 A;  1QGN A;  3PAA A;  2EYQ A;  3DXV A;  4Y0H A;  2VGU A;  3B1E A;  3L44 A;  3N5M A;  3LG0 A;  1M0N A;  1WYU A;  3Q8N A;  4F4E A;  2OAT A;  2FN6 A;  3AEJ A;  4ISY A;  1D7R A;  1PMM A;  3IF2 A;  1IVR A;  3N4R A;  2VMN A;  3ZZK A;  1N8P A;  2AY7 A;  1LKC A;  1TAT A;  1XI9 A;  1W7M A;  2W8T A;  1GC4 A;  3GWP A;  3VK2 A;  3A2B A;  4A00 A;  5E3K A;  3W1I A;  3LY1 A;  1AKC A;  4ATP A;  4F5K A;  4EMY A;  1P3W A;  2BHX A;  3WGB A;  1B5P A;  2O7C A;  2D5Y A;  2VIA A;  3EZS A;  3AEN A;  4FL0 A;  2HUU A;  1ZOD A;  2D66 A;  2HZP A;  1AY8 A;  2OGA A;  3AEM A;  2FM1 A;  4NOG A; 
#chains in the Genus database with same CATH homology
 3DR4 A;  3NUB A;  3GZC A;  1AIC A;  3MAU A;  4IYO A;  1AAM A;  1RV4 A;  3AOW A;  2X3L A;  2DOU A;  2X5F A;  3CBF A;  1AMQ A;  3RBL A;  4GE7 A;  5K8B A;  3PA9 A;  1MLZ A;  3R9A A;  1SZU A;  2R5C A;  4AO9 A;  2HOR A;  3EIB A;  1AAW A;  1W7N A;  2CJH A;  1LC8 A;  4IYO B;  1C7N A;  5EAA A;  2A1V A;  4BMK A;  3BS8 A;  3H9X A;  3N7N A;  1QZ9 A;  3ATH A;  1VEF A;  4A6U A;  2AY4 A;  3BCB A;  1D2F A;  3B1D A;  3FQ8 A;  2CIN A;  5D95 A;  4H63 Q;  3TAT A;  1V2D A;  1YOO A;  4UHO A;  2HUI A;  1ARH A;  1CQ7 A;  4UOY A;  3VP6 A;  1M6S A;  2BYJ A;  1N2T A;  4ZAH A;  2JIS A;  1RVU A;  2BI2 A;  1G7X A;  3BWN C;  3NDN A;  3DXW A;  4WXB A;  4OYT A;  7AAT A;  1UU1 A;  2VGS A;  1KKJ A;  3IHJ A;  4RLG A;  5HDM A;  3JZL A;  1SF2 A;  1AHY A;  3JTX A;  3TQX A;  4ZSW A;  4RKC A;  2R2N A;  1QJ3 A;  4ZDP A;  2BI5 A;  4DBC A;  2AY2 A;  2FKI A;  1GCK A;  1AJS B;  5G0A A;  1AMS A;  2YOB A;  1EQB A;  4MSO A;  4XJL A;  4F5G A;  3CAI A;  4ADE A;  4F5M A;  3MAD A;  4DQ6 A;  3W1H A;  3FQ7 A;  4XJO A;  4R2N A;  4I8A A;  2W7G A;  1DJU A;  2ZC0 A;  3LV2 A;  3MC6 C;  1GEX A;  5AX8 A;  3CQ6 A;  3QI6 A;  3PDB A;  1G4V A;  3JWB A;  3NRA A;  4P3M A;  3K28 A;  2HOZ A;  4OTL A;  4W8I A;  3USF A;  3NUI A;  1UKJ A;  3PJ0 A;  3E2Y A;  3NYS A;  4XEW A;  2WK7 A;  4JEV A;  3RCH A;  4XJM A;  4ITG A;  2W7H A;  3ASA A;  1W3U A;  9AAT A;  1GD9 A;  3VK4 A;  3FRK A;  1TAS A;  4OC9 A;  5BJ3 A;  3UWC A;  2V0Y A;  4TV7 A;  1CZE A;  2Z1Y A;  2D65 A;  4ADD A;  2AY1 A;  3NU8 A;  3AEP A;  4A0R A;  1AHE A;  3NYU A;  1C4K A;  1M4N A;  2NMP A;  3FDB A;  1MDO A;  1CQ8 A;  4IX8 A;  2CH2 A;  3EZ1 A;  2VMY A;  2W8J A;  4CBS A;  4OMA A;  1UU2 A;  4F5L A;  2EGY A;  2TPL A;  2ZSM A;  3I5T A;  1C9C A;  3FTB A;  4JEY A;  2YKV A;  2R5C B;  1W23 A;  3P6K A;  3JWA A;  2FNI A;  3PPL A;  2D61 A;  4WP0 A;  2ZY3 A;  4WYA A;  1O4S A;  3ACZ A;  1ASL A;  2EH6 A;  1KL2 A;  4L0O A;  3M5U A;  3CQ5 A;  3E2F A;  2CB1 A;  3EIA A;  1PMO A;  1J32 A;  4R5F A;  2AY6 A;  5C6U A;  2GB3 A;  3QN6 A;  2VGW A;  3KE3 A;  4CBR A;  3GZD C;  4E1O A;  4ITX A;  2JJH A;  2BWN A;  3ZZJ A;  2D63 A;  3QBO A;  3OP7 A;  4WLH A;  2DR1 A;  2ZSL A;  5LHA A;  3HL2 A;  1XEY A;  1M7Y A;  2BI9 A;  4Y0I A;  2Z1Z A;  1RVY A;  2ZJG A;  1H1C A;  2VMR A;  4MQP A;  1CS1 A;  1E5F A;  4IXS A;  1DKA A;  3G0T A;  2XH1 A;  2EZ1 A;  1ASB A;  3WX9 A;  1ZOB A;  3N4X A;  4IXO A;  1ASF A;  3H7F A;  1IJI A;  1UU0 A;  1TOK A;  1WST A;  2CH1 A;  4GSA A;  1GDE A;  1QIR A;  1LC7 A;  3AEM C;  1LK9 A;  3AV7 A;  1SVV A;  1YIY A;  2VMW A;  4MQR A;  1FG3 A;  4J8L A;  2CFB A;  3ELP A;  3ZRQ A;  1W7L A;  4KXK A;  1G7W A;  4ZM3 A;  4WD2 A;  5EUE A;  3ISL A;  3WKS A;  1E5E A;  1X0M A;  1ARG A;  4F5I A;  4P7Y A;  3DOD A;  4ZAS A;  4XK1 A;  1AKB A;  2YRR A;  1KMJ A;  3NU7 A;  4ZWM A;  4PFN A;  2ZY5 A;  1OHV A;  4ZLV A;  1H0C A;  5G09 A;  1DGE A;  1YIZ A;  3RBF A;  4OBV A;  3VAX A;  3II0 A;  2R5E A;  4KAM A;  1MLY A;  4PFF A;  2Z9X A;  1BJO A;  3WY7 A;  4F5J A;  3WZF A;  1WYT A;  4RKD A;  1V2F A;  1OHY A;  1G4X A;  3BWN A;  3RUY A;  2DKB A;  2VMV A;  5EUN A;  2CAN A;  5FT8 A;  2BIE A;  2BWP A;  3RI6 A;  2DGL A;  4EU1 A;  2RFV A;  1MGV A;  2O1B A;  2VYC A;  2VMT A;  1BJ4 A;  1M0P A;  3BC8 A;  3G7Q A;  3KGW A;  1KL1 A;  1S06 A;  2Z61 A;  1YJS A;  1ORD A;  4GE9 A;  4QGR A;  1QIT A;  1CZC A;  1D7S A;  4K2B A;  4JEZ A;  1ECX A;  5HXX A;  4JE5 D;  1QIS A;  4OT8 A;  3TFT A;  3FZ8 A;  1AJR A;  4LNL A;  3ZRR A;  4U1T A;  4ZSY A;  2HOY A;  2QB2 A;  5DJ1 A;  5M49 A;  1ARI A;  2BIA A;  3B8X A;  1B8G A;  1S08 A;  3GBX A;  1DGD A;  5G4I A;  4DGT A;  2W7E A;  3FVS A;  1SZS A;  1ASE A;  1U08 A;  1GBN A;  4Q75 A;  1V2E A;  2HOX A;  4RJY A;  1ASG A;  3FSL A;  3F0H A;  1QJ5 A;  4W91 A;  5HHY A;  2W7K A;  1D7U A;  3FCR A;  1AY5 A;  1S0A A;  3E6G A;  4TMR A;  4CVQ A;  3HVY A;  4CXR A;  1DJE A;  1IAY A;  1O62 A;  5IWQ A;  4WYC A;  2O0R A;  4OCA A;  2W8W A;  3EUC A;  4UHM A;  4PVF A;  2WB6 A;  1T3I A;  2WK8 A;  5I92 A;  1BJW A;  2AY3 A;  3AAT A;  1WYV A;  4RIZ A;  3I4J A;  3T32 A;  2OKJ A;  2QMA A;  2AY5 A;  3A9X A;  1IX7 A;  4ATQ A;  3PGY A;  5FT5 A;  2DGM A;  2G7J A;  4E77 A;  1ASN A;  2VMZ A;  1CL1 A;  1TAR A;  1AKA A;  3A9Z A;  3QHX A;  4A0G A;  4GDY A;  1AX4 A;  3E9K A;  3BCA A;  1BQD A;  1SZK A;  2ZUK A;  3HLM A;  3P1T A;  5DB5 A;  2W7I A;  4K05 A;  3OKS A;  2EO5 A;  2CST A;  3GZD A;  1AMA A;  3MAF A;  2F8J A;  4WYD A;  1J04 A;  3ECD A;  3GR9 A;  4WYG A;  3CQ4 A;  1BKG A;  2CY8 A;  4FFC A;  2W7L A;  2Q7W A;  1X29 A;  3ASB A;  1JS3 A;  4MKJ A;  1GC2 A;  1OAT A;  4R8D A;  1M0Q A;  4B98 A;  1OXP A;  3G8M A;  4Q6R A;  4AH3 A;  3F9T A;  1TPL A;  1O69 A;  1GEY A;  5G2P A;  2XBN A;  5EAV A;  3KGX A;  3HDO A;  3K40 A;  1C0N A;  2VI9 A;  1B9H A;  4PIW A;  1DFO A;  2EZ2 A;  2DGK A;  3LVJ A;  4WXF A;  4BHD A;  4XJP A;  5FT4 A;  4EB7 A;  2ZYJ A;  4ADC A;  5FT6 A;  4A6R A;  1ZC9 A;  3I16 A;  1YNU A;  4R5Z A;  4UHN A;  1MAQ A;  1I48 A;  2X8U A;  3AOV A;  4IW7 A;  3LVK A;  2W8U A;  2YKY A;  2AY9 A;  1B4X A;  3FFH A;  4H51 A;  4MGR A;  4F5F A;  5M46 A;  4UQV A;  2C0R A;  3LVM A;  4EB5 A;  2AEU A;  2VLF A;  2YCN A;  3MAF B;  2DKJ A;  3WCN A;  8AAT A;  2Z67 A;  4WYF A;  3GJU A;  3ELE A;  2D7Z A;  4W1V A;  1AMR A;  3RCH B;  2Z20 A;  1Y4I A;  1X2A A;  5EFS A;  2C7T A;  1IBJ A;  4BA5 A;  2KFP A;  5M4D A;  1WYT B;  3KKI A;  4GEB A;  3FZ6 A;  3E77 A;  4IY7 A;  1Z7D A;  3N4S A;  2Z9U A;  5F8V A;  3ZRP A;  2CJG A;  1RV3 A;  1IUG A;  4MKK A;  3NNK A;  1GC0 A;  1CL2 A;  4EFF A;  1LC5 A;  3BV0 A;  3A8U X;  4LW4 A;  1LW4 A;  3FFR A;  2W8V A;  2YCT A;  2W7F A;  1C7O A;  3BN1 A;  4JF0 A;  4WLJ A;  2QSR A;  4RM1 A;  4K2I A;  4JEW A;  1PG8 A;  3WLX A;  1WKG A;  4AZK A;  5G4J A;  5F9S A;  3QPG A;  1YJY A;  2BYL A;  3AEN B;  4MQQ A;  4Q76 A;  1I41 A;  4HF8 A;  2OKK A;  3MC6 A;  2QLR A;  3GSB A;  2CTZ A;  4M2M A;  4W5K A;  4LNJ A;  4A0H A;  1AIA A;  2VGT A;  1B5O A;  2OQX A;  3D6K A;  2GSA A;  4JF1 A;  4ZM4 A;  2D7Y A;  3WGC A;  2CJD A;  1SPA A;  4A72 A;  2R0T A;  1GEW A;  2YHK A;  4E3R A;  3F6T A;  4RAE A;  4TN4 A;  1VJO A;  2ORD A;  3DRD A;  4B9B A;  2E7J A;  1YAA A;  4XQ2 A;  3JU7 A;  2PO3 A;  3LWS A;  3VOM A;  3FDD A;  3W1J A;  2PB2 A;  4LNM A;  3TFU A;  1ASA A;  1BQA A;  3AEJ C;  1IX8 A;  2GQN A;  4RJ0 A;  4O6Z A;  2X5D A;  4WXG A;  2FYF A;  1AHF A;  5J8Q A;  3BB8 A;  1I43 A;  2BI3 A;  1FC4 A;  2HP1 A;  2W7J A;  1MDX A;  3NX3 A;  2D64 A;  5BJ4 A;  3UAK A;  2C44 A;  2E7I A;  1MDZ A;  1VP4 A;  3FKD A;  1KKP A;  4RIT A;  3MBB A;  1ART A;  2Z9V A;  5D5S A;  2ZP7 A;  1TOI A;  1ARS A;  3AEO A;  3FD0 A;  3N75 A;  3N0L A;  3K7Y A;  2VIB A;  1BW0 A;  1JS6 A;  5EQC A;  5KTB A;  2EPJ A;  3TCM A;  1CQ6 A;  1MAP A;  1WYV B;  2VGZ A;  3RQ1 A;  1IAX A;  3QGU A;  2YKU A;  3A9Y A;  1AJS A;  2BWO A;  1AIB A;  2VMU A;  4U2H A;  5TF5 A;  2JJG A;  3DR7 A;  2VLH A;  4OBU A;  2C81 A;  2VMO A;  2AEV A;  2Z9W A;  1BT4 A;  5G2Q A;  4AZJ A;  3E2Z A;  4WBT A;  3LVL B;  2HUF A;  1DJ9 A;  1KMK A;  3PDX A;  4ZWV A;  1TOJ A;  2VGV A;  4BQ0 A;  4W1X A;  3B46 A;  1Z3Z A;  3R4T A;  1O61 A;  3DC1 A;  4GE4 A;  4LC3 A;  1GC3 A;  2JGT A;  3B1C A;  3VK3 A;  3UE8 A;  2W7D A;  4JE5 A;  2W7M A;  3FZ7 A;  1ASD A;  1WYU B;  2VMX A;  3WCO A;  2JG2 A;  3JW9 A;  2E7U A;  1BJO B;  1OXO A;  2WK9 A;  3EI9 A;  4M2K A;  1D7V A;  3HT4 A;  1AY4 A;  4XAU A;  1AHG A;  2YKX A;  1OHW A;  1JG8 A;  3FVX A;  5EIG B;  4Q31 A;  4BA4 A;  2BI1 A;  3AEL A;  2ZY2 A;  4A6T A;  4HVK A;  3QM2 A;  2OGE A;  3DU4 A;  4N0W A;  3PD6 A;  4ADB A;  1EG5 A;  1V72 A;  4A0F A;  1M0O A;  1M32 A;  3E2Z B;  1AHX A;  1X28 A;  1JF9 A;  4WYE A;  2AY8 A;  3HMU A;  2E54 A;  5LH9 A;  3PD6 B;  2YRI A;  3MEB A;  3EI6 A;  1S07 A;  4ZDO A;  2ZY4 A;  3H14 A;  4LW2 A;  5E4Z A;  3NTJ A;  1ASM A;  3DYD A;  2V1P A;  1YJZ A;  4WB0 A;  5DJ9 A;  2GMS A;  1TOG A;  1SFF A;  4J5U A;  4F5H A;  5DX5 A;  3COG A;  3PDB B;  2VMP A;  1I29 A;  1PFF A;  4N0B A;  2BKW A;  4ZDL A;  2YCP A;  4W1W A;  2FNU A;  5EIG A;  1ASC A;  2FQ6 A;  3PIU A;  2G6W A;  3FVU A;  3WKR A;  4AO4 A;  5JAY A;  3EI8 A;  2VMS A;  3BWO A;  3HQT A;  4Y0D A;  1CJ0 A;  4E3Q A;  2JJE A;  1BS0 A;  3DZZ A;  1LS3 A;  5M4B A;  1FG7 A;  2GMU A;  2QA3 A;  3MKJ A;  3HBX A;  3EI7 A;  2QBT A;  1C7G A;  1EJI A;  1WKH A;  2AAT A;  1IX6 A;  2WKA A;  5E5I A;  5EUD A;  2PB0 A;  1N31 A;  1TOE A;  3L8A A;  2BIG A;  1LW5 A;  4IXZ A;  4AOA A;  3NYT A;  1B9I A;  1BJN A;  3GET A;  4KYO A;  2QB3 A;  2JJF A;  4WB0 B;  2VMQ A;  1ELU A;  4MY5 A;  3EI5 A;  4K2M A;  1ELQ A;  2HP2 A;  4GRX A;  4JEX A;  4CXQ A;  3BCX A;  4M2J A;  1DTY A;  1S09 A;  3FQA A;  2VI8 A;  1QGN A;  3PAA A;  2EYQ A;  3DXV A;  4Y0H A;  2VGU A;  3B1E A;  3L44 A;  3N5M A;  3LG0 A;  1M0N A;  1WYU A;  3Q8N A;  4F4E A;  2OAT A;  2FN6 A;  3AEJ A;  4ISY A;  1D7R A;  1PMM A;  3IF2 A;  1IVR A;  3N4R A;  2VMN A;  3ZZK A;  1N8P A;  2AY7 A;  1LKC A;  1TAT A;  1XI9 A;  1W7M A;  2W8T A;  1GC4 A;  3GWP A;  3VK2 A;  3A2B A;  4A00 A;  5E3K A;  3W1I A;  3LY1 A;  1AKC A;  4ATP A;  4F5K A;  4EMY A;  1P3W A;  2BHX A;  3WGB A;  1B5P A;  2O7C A;  2D5Y A;  2VIA A;  3EZS A;  3AEN A;  4FL0 A;  2HUU A;  1ZOD A;  2D66 A;  2HZP A;  1AY8 A;  2OGA A;  3AEM A;  2FM1 A;  4NOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...