1AHKA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
129
structure length
129
Chain Sequence
b'DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 5
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahkA00
3MU3A 2E59A 3M7OA 5IJCC 1KTJA 2E56A 1XWVA 1NEPA 1WRFA 1AHKA 2Z65C 3WEAA 2F08A 3FXIC 3T6QC 3VQ2C 1A9VA 2HKAA 3RG1C 3ULAB 2Z64C 4G8AC 5KWYC 3VQ1C 3MTXA 3B2DC 5IJBC 3WEBA 1AHMA 5IJDC
chains in the Genus database with same CATH superfamily
5D1QD 3ZTDC 2DW5A 3BAIA 3FH8A 1M2VB 3KJ6L 4XO3A 3L3KB 1USZA 4HXBL 1BVKB 5GZOC 4WEEA 1EK3A 2XWDA 1E2VA 5IOPA 3ARZA 3MRFA 4AEIL 5IMMA 4GW1B 1XGRB 2IH8A 4OLZL 2P49B 2CKBL 1AACA 3WOVA 1P4BH 5IJVA 4IU3B 5E1IA 2AV7B 1L6ZA 2O6DA 4OJFL 2ARWA 4TVPE 3RVUC 3T6WA 3FPYA 4G1EB 4Z3IA 4BK4A 4BKLB 3ARPA 3C12A 4X6DE 3X12A 4MNQB 2OPCA 5C08B 4O02L 2WGXA 3H7BB 4JM2B 1U95A 3NQKA 5CZXD 3SKNB 3RVVC 1L6PA 2YPVA 4YWGH 4BINA 3JZYA 2JLPA 1A1OB 1Z5YD 2X0UA 1DE4B 4WHTB 1NJ9B 4IJ3C 4G9FE 2BVYA 5DF0A 5ABDE 3FQ2A 4O5LL 3GHEL 5ETUA 2R1YA 2QL1A 3ATAA 4NYLA 4N2OA 2FATH 3KNBB 3P30L 3H6AA 3OLIA 1NGWB 4H88L 1CFBA 4ES9A 1S7SB 4B53A 3RZCD 1ACCA 2QELA 4XE5B 3S8WA 1MLCA 1DVTA 3DC0A 3MI6A 3VB8A 1FN4A 4N86A 4G6ML 2TRYA 3ZTNH 1SOKA 4NC1E 4JRYB 4I18C 4HIHA 4FQJH 5HGAB 4RRPM 3PS6A 4N2GA 3MRBA 4NBXB 5TK4A 3DX3A 4OLVL 5JXED 4NKMA 1UM6L 1U8JA 1ZOXA 2K7PA 2FJFA 4X5WB 3SDAA 2UZXB 3O3BA 3WDHA 1NCUA 3OAUH 4KQ3H 3DK0A 3QJUB 3L3DA 2B0SH 1Z32X 4NQCB 2WLJA 4ONHA 3TA3B 3R7QA 2DLGA 4QTFA 1SJEB 2WTRB 3EJQA 4JFOB 1S9XA 4EI5C 3AADB 1DQTA 2IH1B 5IB2A 2VXUH 1E42A 4UOZA 4AM0A 1RHHA 4I5BB 5E4EC 1PF3A 4GG8A 5FYKL 1KIRB 4HWEL 4V1DB 4FZ8L 4X98B 4L18A 5ICZB 4YHPA 1JHKH 2ETWA 4HK3N 2DQJH 3GO1L 4MAUH 3HVDA 3QT2A 3UACA 4QD2E 4RX4A 4AQAA 2HTKD 3EFFB 1I3RB 4JR9L 2W0PA 4CRPA 1CR9L 3H2WA 3X11A 2K3HA 3VXQA 2ADJB 3D39A 2P8MB 4RISH 2LFGA 2DKUA 2ZOTA 3T09A 3P4MA 4A63A 5I1CH 4YVUA 4QO1A 4JFZL 3NN8A 2G9HB 3JQOB 1RU9L 4GI9A 1W72H 4W6WB 4OI7A 1XIWD 4EN3D 5HVWA 4JRXA 5E1HB 4JNXA 1T0NB 3KYNA 1A7RL 4ZI8A 5EOTB 1TLKA 2BK8A 4HHWA 2I7SA 1U30A 4OY9A 3OM3B 3TIEB 3S88L 1UD6A 4K0OA 5AUMA 3D0LB 3TZVB 5EC1A 1IGYB 2E6QA 4DKFH 2WVVB 4NNPH 3MV8D 3CIAA 4M29A 1C1EH 5F7EL 4L5FE 2IIJA 4OZHB 5GRJL 2V2WA 4ELKB 1U91B 4BHUA 1ETZA 2RA1A 4MA8H 4I88A 1J1OL 4JO4H 4O58L 4ZG1A 2OMBA 4AYBA 4AX3A 3VVVA 5LGHL 1ZE3H 4MXWH 5F7AA 4OZGA 4KHTL 4MMYB 2DBLH 4S1DD 5DGQA 3S36H 3I75B 2VR7A 4RNRA 3QIWB 1OM3H 5DQDL 2VC2H 4XP1H 2A3TA 4W68A 4XPFH 4QTHB 5C0BD 1GIGL 1IGML 3LZFL 4Z7VB 4JQIH 3KWVA 4R84A 3T8XA 1IIIA 2GI7A 5JQ6H 2W9LA 5I1LA 3BDYH 3QHTC 2QVFB 4GRWF 3OKOA 4YEEA 1FFPA 5HHPA 5EEUA 3I9GH 4QRUB 1GMEA 2VDLL 5DS8A 3ZDYB 4Z7WF 5I1HH 3QJHB 4LCYA 1AHMA 3IF1A 1OP3K 2GB2A 2HFTA 4XB8A 1BM7A 1I7ZB 2VWEC 3OZ9L 5KVGL 3D05A 3NCWA 5BNXD 2Y25A 4UT6A 4HDIA 4MNGA 4QNPE 2HVJB 2MCG1 3BN9C 3KPRE 3NTCL 3JTSA 3O4LD 4IMKC 4Z7QE 3N91A 2A6JB 3NPSC 2NW2A 4Y1AB 5E9DE 4LHUG 1MWAA 4RWYL 4G5ZH 5IIEA 4PJ8D 3EOTH 4ZTPH 1S78C 4WNSA 3R0NA 4PV1C 3VXME 5ABZA 2WXPA 2O6FA 1ONQB 3FQWA 1FO0B 4JANA 3RWGB 2A5UA 4NNYA 2FBOJ 1NFDE 5FF6A 3MLWL 3AREC 3V0VB 4R4FL 3H54A 4WLCA 4NKQB 1M71B 1TJIH 2EXWD 3FTUA 2Y1ZA 3T4YB 5GGSY 1SF3A 4NHUB 3SQBA 5EIQA 3VACA 3RZWA 3H0TA 3OKKA 2EEDA 1N2RA 5CBAB 5DR5L 3FN3A 4ANUA 3UJIL 4K8RD 2W9DH 2PW1A 2OA9A 3A3YB 2WBJA 2XXCB 5C0RH 1LWHA 3A4AA 3VDCA 1G9NC 3P3TA 1SHSA 1JF1B 3PL6C 1UWXH 4MCNA 3ARSA 4KK6D 2DQIL 3HMXH 4IU2A 4NBZB 1JXJA 4ZAKC 1FJ1A 4Q74A 3LIZH 5D7HA 2JB5L 1GTFA 1K8DA 3LKNA 4FERA 1D5MB 4UDUA 4UQIM 2CK2A 3GB7B 1T5KA 3LS5H 3LCYA 3HC3H 4M6MH 5BMFH 1H3TA 2ENPA 5ALBH 3FPXA 3LXAA 5DJCB 1BQ5A 1XGTB 3FNKA 4FXGC 4X4MA 3NH7L 5DYOB 2BXZA 2WXJA 5A7EA 2Z9TA 4ZO9A 4ORGA 2XTJD 3AMLA 2IQAB 4GIPD 4UV7H 2CD0A 5AB2A 4D8OA 3NIFF 4ZXBA 3G08B 1DBML 3RX5A 1SLUA 3DJSA 1A9EB 2QMJA 5JHDB 1GOGA 5JIHA 2BINA 4ERSL 2WWOA 1JN6A 4K7PY 3TCLB 3VRIB 4ZW6A 1S2EA 2VQ4A 2XVLA 3SDCC 4BK5A 3HR5B 2OMUB 2BNQE 3I6KA 4BELD 1QFUL 5HHME 4Y5VB 7TAAA 1BOGA 1G9NH 2ED8A 2GUOB 4FXLA 4GKZA 3VGAC 4P46D 2P24B 2RGSA 3B56A 1NCBH 3KWWB 5EG6C 5F1OB 3T77B 1MCOL 3EBHA 3ME0B 3HPLA 1OPGH 1QFWL 1AS6A 5J3HC 2W0FB 4KROC 2WTPA 2J73A 4ZQKA 3ORJA 5CEXA 1U4EA 3FU9A 5L88L 2FB4H 2FH6A 3ZSTA 5I8OL 5F7HA 4S1SL 1N0XH 4WWKB 2R1WB 2LABA 2JVUA 1NCHA 4WCYL 4HUXB 2VH5L 1CS6A 4UAOC 4OZIB 2OMVA 4K55A 5BRZA 2FUQA 2VERA 1ET5A 3LIUA 2BOCB 1ACZA 5E7FA 4I3SH 3SE4A 5DZ9A 3D0VA 4MDJA 3D69B 4F7CA 2DWDB 4UV4H 4IS6A 1Q9KA 2NW3A 3AWFA 5F6HI 4L8CA 4W9IC 3EIFA 5DMIL 1IC7H 3OMAB 3F7RA 4Z7OE 2IOIA 5I19L 3R18A 2FD6L 3D5OF 3TA4D 3BKYL 4FKHA 3DTUB 3S2AA 1MLBA 4XX1E 2X4RA 2N7AA 3FFDB 4GQZA 3TYGH 3U9PL 4JZNB 1YLBB 1U4FA 5F6IC 4LCWE 3U83A 2B1HL 1JZ6A 2NY3C 4OZ4A 1QRKA 3QPQC 4PJ7B 3T04D 3TFBA 4GH7B 3F12B 5JIKA 4XNZC 2MJWA 1BVLA 1I85C 1AKJD 2G5BA 4IRZL 4KKCC 4NM4L 3DYMA 4GRLD 2APBA 3THML 1MRFH 3ARYA 4U6TA 4M6NH 3VWJD 4G11A 2OTWA 4ELMA 2DN7A 1VFBA 2ICWI 5BJTA 2BOBB 1QSFE 2CZNA 1MVUA 3KYOA 3MBXH 4R90H 4RAVA 1KTDB 2DWSA 3B9KB 3PJNA 1LK2B 4UMSA 1XB8A 4NLAA 5ESVA 4NN7C 5FOBB 3L7EB 1GC1L 1NL0H 1XVSA 1T03L 1RUKH 1KBBA 3GZQA 4HU8A 5CUSL 5HI4C 3VCLB 4NKDA 2Y06L 1KOAA 2JELH 3MRLA 3V5DA 1MVYA 4TNVK 3PV6A 4F2EA 4HEPA 3QS2A 3T3MB 3BUIA 4H8UA 4PWIA 5GGQH 2J5LC 1Z9SB 1AI1H 5EIIG 3Q5OA 1ERNA 2AJUH 4HZ1A 1AGFB 4WTZA 3UTSA 2ZOLB 3QG7H 1A6TB 2VDKL 1J12A 3FB7A 2H41A 1V05A 3UZQA 4BH8B 4ZZFA 3O3UN 3VG9B 3NDZE 4FQPA 3WNLA 4EJ1C 1JK8A 3PUUA 4OLWL 2Q3ZA 1FVEB 5EHFA 5I18H 3H6JA 4ANXA 5ITBH 5I9QC 5K59E 1RZGB 2FJSA 4MD5B 1JV2B 2Q86A 3TVMD 1TPXB 1WBZA 3MLVH 2Y7LA 3BUDA 3EG9B 1ADWA 3Q8AA 1KG0A 2C3VB 4YHYB 5IV2B 1KB5A 1P6AB 3GXNA 2BC4A 4KDVA 4OBRA 1U3HB 2J57A 4KI5C 4Q6IA 4KNSA 4HP5A 3GPSA 3X2QB 1I1CA 4U3HA 3PG2A 2VYRE 4PRBB 1N6QH 3MJ9H 3H55A 5I66B 1Z0NA 3T0DA 4U1SA 3T0EA 1CGYA 4K2UH 2APVA 4DNLA 1ZT1B 3Q2NA 1IQDB 1RZFL 4OGZA 4Z0XA 5FW7A 3DIFB 2QQKL 1EIBA 2FX7H 1YMME 1Z9PA 1LGVA 4UBDC 4A2FA 3WFCL 3BYTA 4GRWH 3G6JB 4B27A 1X9QA 2D3LA 1BYPA 3K71B 1HH9A 2J8UB 3D48R 3MBEC 2VISA 4MAYC 2OTUB 3VUAA 1MFEL 3BZFB 3MRMA 2IWEA 3JUZA 3CLEL 1IBHA 1QUNB 2E7DA 1QSED 2F58H 2F5BH 4GW5A 4N8CL 2DLFL 1CK0L 5MEOA 1FV1B 4HYTB 4M48H 3P4LA 5B21A 4QAMB 2FK9A 2RD0A 1N59B 3P77B 3RB7A 3B34A 5A2BA 1VFAB 1C12B 3DUSA 3C5ZB 4I87A 2WBKA 1T3FB 1DFBH 3H2QA 4LZKA 1RUMH 3UMTA 6PAZA 5I74C 3DI2B 3IGFA 3U4AA 2ZF8A 2UVFA 4YDLC 3FYIB 1PX4A 4IOFC 2V2TB 2CBTA 1L9MA 3QUMB 1TTGA 2AQRA 5F3HA 2BHFA 3EZ8A 3PAUA 4K7FB 2G30A 4ADIA 1ACXA 1XX9C 4UIKL 3BSZH 4U6VH 1KXQA 5HGDA 3RWJA 1G6RL 5I17B 1QLEH 2NR6D 3QUHA 4TKWA 2Q8BH 5L8JB 2JKSA 2O61A 3L45A 4L1HA 2ZOUA 3E6FA 1D6EB 5B7FA 1H3PH 1O9WA 2PO6D 1O5PA 3Q44A 3KWTA 3P0YH 2XWJA 3QULB 1ROCA 4JHAL 4Z7UA 2EO1A 3KJ4B 5T1DH 2XKNA 1I8LA 5KYXB 4POYA 4X6FA 4NS0A 4G42B 3W0WD 2VSDA 1NAKL 4WWID 4UZGA 4XT1C 1I82A 1XR8A 3GJEB 4DGIL 3WE6A 5ID0A 3NRPA 1LVEA 3ULSB 4EMZA 4WK2B 4QIRA 3GIVA 2C7UB 2ZSWA 3BXNB 5KSUB 1HJCA 1Q0YH 5LAPA 3HBZA 2AERT 3UO1H 1TJHH 2NZ9C 3SY0A 4GXFA 4QLRA 1KELH 5FFLA 1NEZA 1FE8H 3EF7A 3IETB 3FDWA 5C0AA 4AW7A 5IJKA 1CTOA 3ECQA 4QWWD 4J7RA 2ZIDA 3TJEL 3JT0A 3ZRSA 2WO2B 4QYOB 1FNGA 1TVHB 4N0YH 2XY1A 1YECL 5EU3B 4GEIA 5DMJB 3MV7B 4WV1A 4L4TD 1J7VR 1E4HA 1YEJH 1UOWA 1ZLVK 4TSAL 1WVZA 1PQZA 2CKBA 1OAUL 5BV7L 3DUUA 5C3TA 1U8MA 5E8OA 5EDSA 4TLTA 3N50A 4R2GB 4NRYB 4YHOL 4QRPB 3JZ7A 5ITFB 1YYLH 4G6KH 5A6MA 2ZUUA 2BSDA 5DHVH 1L6XA 5DU7A 5C07A 4UT7H 1KCSH 3ZOAA 1NGYB 2H32H 2UYLB 3UAJD 3NJKA 1E9QB 2QQNL 2XN9B 1XF1A 1Y6MR 4JDEA 5FHBL 2F54D 2HN7A 1FL5B 3L5HA 1V5JA 5INCA 2OZ4L 4JPIA 1DANT 4TNVF 5LGJB 1B3IA 2L04A 3MO1A 5I75B 3HB3C 4RBPK 1WGVA 3ARGB 3A67H 1YPZA 4XGZB 1WE5A 3BUTA 5DYFA 1P4LA 4HUVA 1JXGA 3O2VL 1LO4L 3SKJL 1XF3A 4LLUB 5SWZE 1H6UA 3F04A 2BSRA 3QZBA 4AJYV 3FB6A 1X6NA 3CE1A 4GSRA 3TEYA 3MGTB 1C8QA 4ZMNA 3OXSB 4H8QA 4KXBA 3L81A 3HE6C 4KX9A 4X7SH 1FH2A 1EAPB 4AQ1C 2X10A 3PGCB 4E2OA 2UXGA 4I13B 3CZFA 5EU6E 4ZFFA 1FA4A 5G4OA 2WPGA 1L3NA 3QC6X 4TSBH 5LN8A 2CU9A 3HI1B 3EBAA 3UJTH 4OGAD 3IPBA 5KYNA 4P23D 3SE8H 3QEHB 3IDIA 3HS8A 3P4NB 1CU4H 5HYQB 1QR4A 2EC8A 3MODH 3VQLA 1E2ZA 4IRJA 4PWHA 3ZO0A 1SQ2N 5IFHL 1GY1A 3L95B 1Y18B 5F44A 3PWVA 5L7XH 1CE1L 2GFBA 2VXVL 3K5SA 3RJDA 1IZKA 4JHVA 1WITA 5EN2B 5HJDA 5L4MA 1H6EA 3UBFA 4NT6A 3RTQB 4YDIL 2VXTH 4PRID 3CPUA 5CU5A 5EO1B 4Q6KA 3NCEB 3HKFA 1LQBC 1Q9WB 4PRDB 5KVEH 2BSSA 3GK8H 4YAQA 4F7PB 1W6WA 2CGRH 3BO8B 1GAFL 2GG1A 1RZ7H 1QEWB 2IJ0C 4LOUD 3QDMD 2YD3A 4I85A 1ZTXH 4ODTH 1PDKA 4LSVL 4OVVA 3T4AC 4OD1H 1QBLL 4G7VL 4L37A 2Y7QA 4N0UA 3DK2A 1BAWA 1QA9B 1R24A 3QH3B 5BUGA 4YIQA 5D7IA 3STLB 1E4XI 2ZG3A 4E68A 4J6IA 2HVKB 2AJ3B 1UXSA 2C7FA 3UTPD 2GJ6E 4Z18A 3VXUD 2P80D 1UA6L 1GHFL 1OT1A 1RVFH 1OTSC 3RE0A 2GUYA 4DKTA 2F6AA 3HCVB 3M8OL 1TTCA 3NSYA 2HPTA 3MOBH 1G84A 1AR1C 2W95A 4PY7A 1NC2D 3OF6A 1FNEB 1DVFD 1BVNT 1YJDC 3O6KL 5JHLL 3KLSA 3I3EA 2A6DA 4Q97A 3SJVE 1SUJA 2X70B 5SV4A 2FRGP 3U0PA 4GG6E 3L16A 4NQEE 1F4YH 3QUYC 3L4XA 4HXAH 4I3RL 4XH2A 5HDOA 4KZDL 1IT9H 3UXFA 3P9WB 4JPVH 5IOPB 3BAKA 3MRFB 2O6CA 1CL7I 4D9QD 3ZKND 4M62L 5IMMB 5GJTL 4EN2A 5FPIA 3Q48A 2VDQB 5A2AA 4B7LA 3MA9L 3O9WA 4ZMOA 1TTFA 1SUHA 5IJVB 4RFNC 1P5UC 3VB9A 1D9KC 3ILDA 3N44F 4WWOA 4J8RA 3RNKA 5AG8A 3K4AA 4XN8A 4PJIF 1FSKC 2R29L 1HIML 4HWBL 4OT1H 3X12B 4DUXA 5FDWA 2DQDH 1R3KA 1CICA 1OP4A 3QB7C 1SFHA 2B4CC 3K6IA 1FYHB 3QQ9C 5D96C 3REWB 4XNAA 1WEJH 3IDYC 5I1DA 1U95B 2YQBA 3K8LA 4B0MM 1A3RH 2LVCA 4OFYA 3LXCA 4ZOEA 2A0LD 3NSCA 3T3ME 1GGIH 4F8QA 5KYYA 4W9CC 3BP6A 4WUUE 4NQUA 4FQIH 3VWKD 1YJDH 2G2NA 2R1YB 4NYLB 4YDZA 3LMJL 2CHXA 4BCYA 4WF7A 4JJOA 4PGJA 4OAWA 5DD0H 1ZXQA 3T6ZA 5F7WC 3I84A 4QRQA 2WZPD 2WSPA 1CVSC 4OCWH 2JQZA 1E4JA 1MLCB 1S7UA 5FYLH 5CJQL 5DC2A 3P9MA 4OCRH 5SWSD 1FN4B 3J7HA 4QHUA 4Y8AA 5GHWH 5MP6H 3LEVL 4HIHB 4X6CE 4QHPA 4MQXC 2UX6A 4HJ0D 3MRBB 2IANE 4OIIL 3ULUD 2JLLA 2FJFB 5PCYA 3SDAB 5BUAA 4Y2OA 2AKRA 2JFCA 5IJCC 2AS5M 2GJJA 5A2CA 1ZSHA 3L3DB 5I2IA 3MLYH 2B4CH 4ONHB 1YNLH 3C08L 3J8F7 1MEXH 4BFGA 1UJTA 2H2PD 3DX8A 5CLTA 1KJ2B 1PD1A 3HE7A 3ZL4H 1JZ4A 4XN4A 1S9XB 1E67A 1L7TH 5JLZB 1L9RA 4IHBA 4ZFGL 2VQ1A 4YR6A 1XZWA 5IB2B 1PSKL 4DQOL 4AM0B 1OWWA 1RHHB 4HKZA 4NGHL 4GG8B 2P46B 1LP9E 1A3LH 4QHMA 4M1GH 6PCYA 4YHPB 2CBQA 5EOCJ 3DPDA 4QOKE 1E6JL 1P7QA 1E3FA 1RK0A 5AWNL 4APQD 4AQAB 1AS8A 2GPZA 4DTGH 1EJOH 3TM6A 2C5DC 4K3DH 3WL9A 3X11B 2VN7A 3CSGA 3N42F 1IKOP 3QC5X 3GSNL 4ODXA 3D39B 4QY8A 1AZRA 2DQMA 3GEWB 4F1ZA 3P4MB 1E4XL 3ZDZB 4F80A 2NNRA 3VSUA 3N2JA 4QO1B 2J20A 3NN8B 2Y2YA 4U1IA 5CSGA 1EGJH 1EHNA 4JRXB 1VGKB 2BIMA 2XWTA 3RGVB 3QNXA 5F7LB 3KYNB 2D0GA 4XMPH 1BZQK 5E1QA 2ZWKA 3TBSA 1QRNE 2DH2A 1KCUH 3SDDC 5AUMB 2YGVA 4PGDA 1ZS2A 2P5EE 3ARDD 5EC1B 2JKTM 3QZWG 4NP4H 2DWTA 3O2DA 3CN0A 2HJLA 3IU3B 1WHPA 1XF5A 3K80A 2ZXWB 5GGRA 1ETZB 1G7LA 1GRWA 5TK2A 1CL7L 3KXFD 4CKQA 4DSYA 4UTBL 5J0BA 3FZUC 1AY1H 4E9RA 1MWOA 4OZGB 1NWOA 3GRWL 2PYED 3RGHA 3WHE0 3MREA 4KVCL 4IRSD 4RNRB 3GBML 2D9CA 1JDCA 4QHKJ 2FGWL 4TRPL 3APMA 3MLZH 5IVZA 1BFTA 1EFXD 1OARL 5DJ2A 1IJNA 3T8XB 1PZUB 3UEZA 2XQYA 5AVZB 1DDHB 5CJXA 5I1LB 3OKOB 2EDNA 1FFPB 1N12A 3HBQA 5FGCE 5HHPB 4DP0X 1BZEA 4U1NA 5DS8B 5DJ6A 3QIBD 4F7KA 3BFWA 2XUWA 3IF1B 3QZMA 4PTUA 4OGQC 5TH2A 5FV2A 1HKFA 2WCGA 3QR0A 4BGLA 1ET7A 1ZLWK 4P3DA 1HWHB 5KBNC 4HDIB 2RMNA 1QYGL 5AL0A 3C09C 4MNGB 3SIKA 3PIQA 3C60B 3JTSB 3NJIA 5IM7A 3GS7A 4JDTH 5D2NC 4FXKC 2NMSA 1MWAB 1FGNH 3CVHA 2Z7UA 5C0ND 5IIEB 3BSGA 4UQ2B 5IBLC 2BNRE 4J3TA 2NXZC 2RCSL 1JTOA 1MIMH 2BOLA 4AV4A 3LOWA 4JANB 3FQWB 3JYBA 4TQIA 3FN0L 2LU3A 4NNYB 1IVTA 2OMZB 3EYSL 4JPWH 5FF6B 5BS0D 1UWEH 1BZ7B 2C3WA 4BSVA 1AR2A 3CDZA 4CN1A 3UJJH 1PJWA 5CZXC 3QDJE 1BFSA 1V54B 2FSDA 3SQBB 4TXVB 3H0TB 3OKKB 1RLBA 4Q4EA 1N2RB 3O6MH 3SBQA 2TRHA 1PLAA 1WG3A 4HJSA 3EYUH 3E38A 3F6LA 4NZ8A 4N8VB 3WSQH 2V4LA 4LLWA 2VDOB 5I15H 5E94A 2PW1B 1BF8A 2WBJB 2CAKA 1YMHA 2ZT9C 3ZY7A 4E41D 3RZCC 4F58L 4BWWA 2LLLA 4IU2B 2JKIS 1FJ1B 5CJ8A 4AH2A 1K8DB 3AB0C 2X2HA 3LKNB 4YXLH 4UDUB 4DPRA 3O8XC 2WOYA 3ZR6A 1AGDA 2VJ8A 3EUDA 1BZ8A 2WNKA 5JO5A 4A7GA 5B4MD 1IM3A 2G2RA 1OE2A 5CCGE 1QWHA 5ISZA 5I0YA 1WDAA 1HXYA 2EABA 3FO9A 2YUWA 3VFMA 4PJCF 1I75A 1DBBL 5KAQG 1U6AH 4WO4C 4RGND 4W9DC 2JJTC 2YRPA 2ARJB 2CALA 4B95C 3D3VE 5IB1A 5DEZA 3G9AB 4KMQA 1JNNH 5DJ8A 5BW7C 1A6UH 4PJGB 1FPTL 5KBPA 1LO3H 4L1BA 5J4MA 1JN6B 1NMAH 1JZGA 2A73A 1XGUA 4CA4A 4URTB 1OCWL 4LSQL 4YXHL 5I8KH 4A2HA 5I23A 3IU4H 3GTTA 4YDNA 2CJTA 1NIEA 3I6KB 4NZRL 4Y2NA 1BEYH 4AEEA 1FNSL 1BOGB 3KR3L 3FONB 4QEGA 1UVQA 4GKZB 1IFHL 1NGQL 4G3YL 1JPTL 5JW4R 1RUAH 4NCC1 4OLXL 2E4TA 3B7RL 3QIUD 3HPLB 3IB4A 4JFUA 3ESOA 1SVCP 4PRHE 4KH9A 2UXVA 1H3GA 2HA1A 1J0ZA 4ZQKB 4ZTOH 3TFKC 5CEXB 4FQXA 4PRPE 3APFA 3Q8CA 4LGPB 1G5AA 2MNUA 1RIHH 3B7SA 4PJFA 3MOQA 5JW5A 1CLZL 4XVTL 1CLYH 3OMNB 2GAZA 4DPCX 2IALA 3RX9A 1F58H 4NQDB 5KVDL 5BRZB 3B7YA 2JJUA 3UAEA 4OM1L 4X9GA 4GQ9L 3D25A 2GIYA 2YS4A 1TZHA 3D0VB 1E2WA 4MDJB 4JFYA 4ODSH 2IPTL 4IS6B 1Q9KB 2IADA 4XXWC 7CGTA 4L8CB 3CHRA 4WGWB 1X5MA 3C87A 3B7UX 4FP8L 4K5PA 4F9PC 4PVLA 2DM2A 1NPJA 5I6XC 5DD5H 3CN1A 1MLBB 2Y5QA 5E2UH 3TIDA 1AIZA 5HI5C 3NCYP 2X4RB 5EU5A 3I3DA 3HI5H 4UT9L 3LYRA 2EICA 5I0WA 4ZW8A 1IC5H 1YNKL 3P73A 2GIMA 2X42A 2CXKA 4EXPX 4OZ4B 5I8EB 2N3JA 3O2WL 4XNBA 5ABAA 1DSWA 3NIGE 1NOAA 1OCZB 5LCVL 1GCFA 1BVLB 2G5BB 2ICWA 3K46A 3KBHE 5E6RB 4NC2B 4CU6A 5EBLA 5C7XH 2XXFA 3Q2LA 5F9WC 1JSYA 1SMAA 2B1AH 4MYWB 2F8OA 1NGXB 2A38A 2DJMA 2DZEA 2BY0A 2OTWB 5CZVH 5E8DL 4ELMB 3BWUF 1G6RA 1ODUA 5BJTB 1KZYA 3ZHFA 1MVUB 4MHHG 3KYOB 5MHSD 1HL9A 2JCCA 4UNUA 3JV5A 4JM0A 1T6VN 3KDMA 3NJLA 1XF4B 5DC9B 4AL8H 1GGCH 5I5IA 2IMNA 2XFGB 4TL5A 1KIUB 1KN4L 4P9MH 4OF7A 4LQ1A 3B3BA 5GGVL 4MHHI 3VXSE 3B4NA 1A2YA 3O3AA 1JE6A 3MRLB 4NI3A 3BKJH 4PJ8C 3CPLA 3V5DB 3E9UA 4JFPA 3PNWA 2WKOF 1RLWA 3PV6B 4I1RA 5GRUH 3FT4A 2BNQD 2G4EA 1XBDA 5I0DA 3WS3A 2AJXH 1HTYA 3QCVH 2UXTA 5HHMD 4JO3H 1KCBA 3UTSB 1Z5LA 3BWZA 3G6AA 3FB7B 4HKJA 5F1IB 5K39A 1F3JA 2AEQL 4HC1H 5DT1H 2EXTA 4XP9L 2BVQB 1XXFC 1U58A 1EZVY 5FS5A 4U0QB 1DN0A 1JHTA 3MV9A 4JQXC 4G80A 1CG9B 1X5JA 2Z4QA 2VR5A 4H1LG 3K72A 2EP6A 4JPQA 3GS0A 2Q86B 5EEWA 3CQQA 1CYGA 5T1MA 1GGBH 2EEFA 4EKJA 1KG0B 4R4NC 2UWEF 2N7SA 4N2CA 3BH8A 1KB5B 2BC4B 3QFJD 4Q6IB 1LEIA 5AW7B 3BEWA 2F53A 5KSVA 5IMLA 3FQ4A 1N5YL 1A6ZB 3T0EB 3TBYA 4G8GE 2NRDA 4KQ3L 4PCSA 3V55A 3A24A 2ZCLL 1ZT7A 4Z0XB 4I4WA 5FYKU 3GGWA 2JMRA 4MJ6A 1CE6B 1R5WA 3ZE0E 2HFFA 2MPAH 5KTEH 3VRLF 3HN5A 1A7NL 3VSQA 4PS3A 2X4PA 3GM0A 3TEWA 1HH9B 1AZNA 3HPJA 3BT2L 2E59A 3A6BH 1MRDH 2VISB 3MRGB 4L8DA 3MACL 1MG2C 1PD0A 3CQFA 3MRMB 4QGTA 2EVFA 4KVPA 3WFEH 1DJGA 5H4YA 5JPMC 1XZ0A 3NCMA 1XGYL 1PZ5A 2OULB 2Q10A 4O9HH 4NOFA 5E2VL 5MEOB 4FJ6A 2KL6A 3A47A 4N22A 4PY8I 5EZOH 4L3EA 3QXAA 3MRHA 1MCPH 3CZEA 4XWGL 2MCPL 1B4TA 1RJCA 4ORZC 4MNQD 5C08D 2XDHA 3RURA 2X6VA 1KULA 3FT2A 2CDEA 1CFVH 3FTZA 1W72L 2I60H 4JM2D 1B0WA 1ACYL 4WI4A 2Z35B 4PV9A 5I76A 4LT7A 3GMNA 4HWNA 3GI8L 3K7UA 3IKCA 4X7CC 5SX5K 4U6HA 3ULVE 4MA3A 4GQQA 3X3GL 1HOEA 2ICEA 2F08A 4NQTA 1FAIL 4H8PA 4L9LC 4JO1H 2ZPKH 5F3HB 4ZMLA 1C1EL 4UNVA 1G7MA 1HQ4A 4TOYL 3FTXA 2R27A 4XPBH 4JQVC 4MA8L 4YUEH 1KPVA 5HGDB 3GSOA 5DUMH 3IMRA 1IBDA 1UACH 4UU9A 4YBLC 2O61B 3V0FA 4JRYD 3E6FB 3W39A 5KVFE 4Z0BL 3R0MA 5IFJA 1QQDA 4Z7UB 3TP4A 2JV6A 2XKNB 4JJHA 4KAQL 1CTNA 4XPFL 3L2LA 1MCQA 1IMHC 3LS4H 4JQIL 4KUCF 1M1SA 4H8WC 4WU7A 5L8KB 4FG6D 5DGRA 3TA3D 1XR8B 1T0PB 4JO5A 2XKUA 4E9YA 3WE6B 5ID0B 3RX7A 1ZGLA 3VMOA 3GIVB 1TJXA 1RL1A 2CKNA 2ZSWB 5EIVA 1IEHA 4C83B 4V1DD 4XCCH 4LE8A 3CAFA 5JHLA 3ARBD 4GRLC 3SY0B 2O26U 4ZT1A 1NEZB 4NPKA 1OAKL 3C5SA 4NN5B 2BP8A 2WN3A 1GYWA 5GRZA 3MUGA 5C0AB 4FHJA 4OFPA 1K85A 2XXGA 2WQXA 2VCOA 2VNCA 2Y0SA 3ZGIA 1PZ2A 4F5CA 3DETC 5E6ID 3IDMB 4KJPD 4WV1B 5D7LA 1X7SA 4PGEA 4G5ZL 3NRQA 4HS8L 5A2KH 2CKBB 3D4YA 2OCFD 3DUUB 1U8MB 5E8OB 1PBYA 4LCIH 3FCTB 5HGHB 3WFZA 1DEEA 4PGCB 4EZLA 5EDXA 4TLSA 2UVEA 5D6DA 1H3UA 3FQUA 5H94A 2R29A 2FWUA 4ZO6A 1DJZA 3JVGA 3QUZA 4GIOA 5C07B 5FM5M 4GI8A 5JW3H 1BYOA 1UZGA 1YDPA 2XZCL 4N9OB 1MSPA 2X4TA 1BFVH 4JDEB 4JG5A 3F65A 3TZVD 1JRHI 4MJJA 5EU4B 4O2CA 2HN7B 5INCB 4M43H 2YARA 1RERA 1C8PA 4NBYB 4JPIB 3ZRCC 2BS9A 4LQFH 5HDQH 3ZE2B 2BMKA 3MO1B 4X4ME 4CU7A 1QLRA 3BWUC 4ICXA 3KYAA 4XN2A 3S34H 3IMVA 3H9SE 2OMWA 1YPZB 4J6RH 1FH5H 1P4LB 4HUVB 2YXVA 1I31A 4FLRA 1G7JA 1A4AA 2BSRB 5D1QA 2JI1A 4UYQA 1B6UA 3UERA 3FB6B 5DCCA 2GC4C 3QIWD 4YDKH 3HC3L 2J7LA 4X5RA 4AVIA 4TTGA 1XHHA 4ODHL 1D6VH 1ZLUH 1YEHL 2ZXCA 4XBGA 1CZ8L 3NJXA 5A43C 2X4QA 2WQWA 4MCMA 3CZFB 1HDMB 4ZFFB 4UV7L 4WI3A 1T7YA 4MJIA 4HOXA 5D1XB 2OJZL 4Y2DA 4UQDA 5D7SL 5FYJH 1J1XL 3SO3C 1KGWA 1KJ3L 1YAIA 3AZUA 4BXVA 8CGTA 3MUJA 4IRJB 2AI0H 4LPXA 3ZU8A 4KZEH 1LDPL 5H37G 3V0GA 3PWVB 2GFBB 4Y4FA 2VLRE 4H44C 2J4WH 2QPFA 1KB3A 1UCBH 3BESR 1UOLA 3R1GL 3UYPB 2VO8A 3OKMA 4Y1AD 1RZJC 2EE9A 3O6FC 5F7KC 5JIMA 2BSSB 4PVNA 4PS7A 4TULL 5C97A 4OFIA 4YAQB 1PG7X 3DRTA 3JWOC 3GSNA 5AOZA 1KC5H 4P3CL 3MRDA 1BBDH 1PDKB 1FL3A 4L3FA 4L37B 1QI5A 2Y7QB 4N0UB 2EE0A 1R24B 2DQTH 4YIQB 3VFRA 2CCWA 2DEXX 4BV1A 5D7IB 2C4FT 3LTVA 5BRQA 3MLRL 1UXSB 2H1XA 1NSNH 2F5AH 4UTAL 4JZJC 1B0RA 1QWUA 3MAWA 1EO7A 1MQKL 4PY7B 4KNQA 3SCMA 4X42A 4NJAH 1PNDA 2VZUA 1ZLEA 4UV4L 1KSRA 2ENJA 2DYRB 2F8VA 2Y1AA 5MENE 2A6DB 3ENEA 1F4HA 3QXWA 3GXMA 3MSPA 2ADGA 1EEZB 1RZJH 4B9GA 3WLWC 5E2TH 4KK5C 4UTBA 4XH2B 3WELA 3RWIA 4AKOA 1KGXA 2MHAA 3JWOH 3N1MC 3OLDA 1X7QA 3GRWA 1E5BA 2R0LL 4FA8A 4DH2A 2CNYA 2BRRL 3O9WB 4KMLB 5A16A 5JIQA 4IIQC 1RP8A 5A1AA 2AQQA 3OAYH 3KVQA 1RMFL 3I6LD 3HN8A 3CXHK 3CN2A 3ULUF 4J8RB 3RNKB 3G5VA 4MXQD 5EUOE 5FDWB 5JHDD 1R3KB 1FF5A 2R4RL 1N5AA 5D7EA 1UWGH 1PZ3A 4JKPL 4MBOA 3RIKA 5C2BH 5I1DB 1EMTH 5E51A 2P43B 5KS9F 4EF3A 1OK8A 3BP6B 3MBXL 1EDQA 1T0MA 2XETA 3RDTA 3V6BR 4EDWH 5LQBL 4QHLA 5DZAA 5K9QG 3LDBC 4HSAC 1UWFA 5E1AB 5C6TH 4WI2A 4RFOH 4H1LH 5E5RB 3NK3A 4OAWB 3RIAF 4QRQB 1NDGA 3Q5TA 4WEBL 2KS0A 3X13A 43CAA 1S7UB 5K9QI 5KSBE 1TETL 4TQ8A 2HWZL 3L17A 3EFDH 1AZVA 3VW3L 4LIQE 1FNAA 2EKJA 2QHRH 4WWKD 4OD2A 1W2KT 3F58H 1OAZL 4JZOA 4GMTH 1ZHKB 2PXYC 1Y1UA 1THCA 3P69A 2F1EA 1IC0A 4GQRA 2SODB 4IDJH 4GT0A 4Y2OB 3HA0A 2X3CA 2AKRB 5A3ID 4FOMA 3UAJC 2ZXGA 4TVUA 1OW0C 3IDXH 5I2IB 1T20A 4AJ0A 1AFVL 5E9NA 3BPLB 1WC7B 2OJEA 1DLFL 3EOBA 3GINA 4OCLC 4N90D 4W4OC 3RKPA 3DX8B 2JKWA 3HE7B 4ZYKA 4CMHB 2CPCA 1FUNA 1LQSR 5CLYA 3ATBA 3B9VA 2VQ1B 4YR6B 4PJBA 1FVCA 1WRFA 1GGYA 2B5IB 4HKZB 4ZJ9A 3VD5A 1JYVA 2YRLA 3Q1EA 4JY6A 4QHMB 1OM9A 1UXMA 5ID1A 4CW1A 1ZAGA 1GZHC 4DN3H 4X6DF 3GJFA 1P7QB 4DFHA 2NYYD 1RK0B 1E27A 4KXZH 1KT2B 4G8IA 4KY1H 1SN2A 2QHLA 2VERN 3QI9A 3MJ9L 3WL9B 4FQLL 5FDYA 4LARH 4ODXB 3AM8C 4QY8B 2ZUQC 2J6EL 3TC9A 4IHOA 3OHXB 3U48A 1ZT4A 2FX7L 4NQED 1NH6A 2CLRB 3S97C 4U1IB 4OGAC 1Y6NR 3B2UC 5F0LB 5B38A 3L9BA 4YEFA 3AJ7A 4K3JH 2NQCA 2EXYC 4P2QB 3RB5A 3BZ4A 1INEH 1NC4A 2DAVA 2XWTB 2MRYA 2IVFC 3QNXB 4W9FC 4XVUD 4XMUA 2O30A 1N6VA 5FUOL 3NVQA 3FK3A 3T2NH 2CWRA 3WXWL 1SNRA 3TBSB 1OGSA 1E6OL 1BQUA 4DO4A 3B9KD 5ESQA 3ARTA 4YGAB 4PGDB 4HG4K 1SBSL 3L4VA 3OZKA 3RVWD 5ACZA 1XL6A 1YEDA 4GAJL 2EDDA 2OMTA 3DJ9A 5CLZA 4Q2ZB 4LBEA 4X99A 2HJLB 5HHOE 5J11C 3TJHC 3AROA 4M48L 5HDBF 1XF5B 3TN0B 5GGRB 4EIUA 2KUTA 4G6JL 3PP3K 5EC2A 1G7LB 4AWJC 4G6AD 3P4OA 4OD3H 1P84K 1ZD6A 2WP3T 4ONOA 2VZVA 3N6YA 2PCFA 4NIYE 3U25A 4X9HA 3PF2A 2L4OA 5IGXH 1E5UI 1KFGA 4H4NA 4XZ4A 5FGRA 4JFWA 5IW3A 3LV3A 3T2LA 5IVZB 5DJ2B 2WO4A 2HLAA 4Z7UE 1M6UA 5D2LF 3CZJA 1HZKA 3CC5A 4G72B 3OKDA 4U1NB 1FNFA 5DJ6B 2Z4TA 2JKRM 5F96L 4K5MA 4PTUB 4KRPB 2V5TA 2V5YA 2ED7A 5AAWC 2NXYB 5D9SA 3BAWA 4PH8A 4P3DB 4RMWA 2B2XH 2B16A 2B3IA 1E5AA 4KKAD 4J3SA 2WZ5A 2X2UA 1U3HD 2AK1L 4ESKA 3N5AA 1JD7A 3PIQB 4U4IA 3WFBH 4PJEA 2QPSA 1CFTA 4PB0L 1KIQA 4FD0A 4NSKA 5IM7B 1B4RA 4JEGB 5HDRA 2AJVH 3WD5H 3AXLA 2DIJA 4UT9A 3CVHB 2VO5A 2R0KL 3C6LA 5L0QC 3QXDA 2VR3A 3VFNA 2BZDA 4JCMA 4S10A 2VW4A 2VDPL 3GYRA 4H40A 4QAWA 3L5XH 3WMSA 3IJHA 1MG3C 1HYRC 2BVOB 2C1OA 1TJHL 1VEMA 4BSVB 3CDZB 1YQ2A 3WNIA 1KELL 5HYFA 1NUDA 1RZ8A 4I0KA 4KX8A 3Q43A 4MNHB 2W65A 1WISA 4X6BA 1YYMH 2MOVA 2JK5A 4XNMA 1JZ8A 4UCFA 1JCVA 2CO7A 4F9LA 2CR3A 2WQVA 4GO9A 4LLWB 5E94B 1ZIBA 2OZNA 2NY6C 1DVYA 4LDEB 1YMHB 3KDPB 1UENA 2MOQA 3C5ZD 1F11A 1QUPA 5JR1H 1ZHNA 5E5MA 5HI3D 3EXLA 5HP5A 1YYLL 2QR0A 4AH2B 2VSMB 1HYSD 1QRND 3OSKA 4HUUB 1EA9C 2DD8H 1CF8L 1K8IA 4BK8A 2E7LA 1AGDB 5JO5B 3UP1A 1RV6X 3IMWA 4A6YL 1IM3B 2G2RB 4FG2A 5ISZB 5HTSA 4N2HA 2MQ0A 3ULUC 5B8CA 2VDKB 1HXYB 1WIPA 4Y88A 4Y4KC 4LP5A 4QNPF 1JXKA 3HBPA 3VFMB 1KN2H 2OI9C 3NFSH 1HHKA 1KCKA 4JY4A 1QPPA 4FQCH 1A64A 3CSPA 3HFFA 4G7YL 4X8JB 4U1GC 4YSPA 5GRVK 5KBKA 2K1MA 2BXYA 5IB1B 4JGNA 2XG5A 5DJ8B 5BOJA 3VQMA 2DI8A 2VR8A 4YO0A 5AALA 6FABL 2ZJSL 4M7ZB 5JIDA 2A73B 4ILDA 1XGUB 1DBKL 3DX1A 5LBSH 9PCYA 4H20H 1NAMH 4DOHB 4BKSC 3DURA 3BJLA 3WGUB 3HTLX 1HX0A 4NNXA 2CE6A 2WCPA 1Y0LA 5DURD 1WTLA 2ZCKL 4ALAC 3GMQA 3ZUCA 2VN3A 2YMXL 1T2XA 3GF8A 1UVQB 3H53A 4DPBX 1B4JH 5ANMA 2WYHA 1Q72H 1A47A 1HH6A 3X14A 3PAZA 1VJSA 3GTNA 1CFQA 3UJTL 5IKCA 4OLYL 2B59A 4AEHL 3FSVA 3MFGB 3GNMH 2EC9T 3EJSA 4LASH 2R23A 4HU2A 4FQXB 4FDWA 3ULUH 2H1PH 1D7DA 1WZMA 2NY0B 1XSJA 6TAAA 4ZSOB 3BZEA 4PJFB 1DJWA 4EDXA 5FUZH 3ZYIA 5JW5B 2GAZB 5IESH 2IALB 2ZNXA 3TO4C 5IBUB 4A67A 4PYGA 1HCFX 5IQNA 1PD6A 5JXAH 1H5BC 3KGUA 1N4XL 1IGIL 4RA0C 3QXUA 4CC0A 2FNBA 2I27N 5D7KE 1U8NA 4EVNA 2OLDA 3D25B 1T22A 3MV7D 2W0LA 5KVEL 1TZHB 2VUKA 4JFYB 1BPVA 4FNQA 3CVIL 2IADB 3BLKA 2F74B 4I18A 4R2GD 4QRPD 4ALAH 2XJKA 1ZTXL 2KPWA 3L4TA 1MHCA 2X4SB 1UQSA 3DVFA 3BMWA 1TG8A 2APFA 3E8UH 5HYEA 3HI6L 5D72L 3TIDB 1W72A 2I9LA 1X6LA 4JDVA 4JRLA 5CZKA 5EU5B 4OGYH 3GKWH 3GQFA 4BZ2H 1JFQH 2XN9D 3WEBA 4JFQB 1RI8A 5BOZG 2MEJB 3P73B 1YN6A 3DV6A 3DX9A 3GUTA 1R3HA 3O45A 3MOBL 4EI5A 1XCTA 1VCAA 1ETJA 4J3OG 1IFGA 4IMLB 1OT4A 3ARGD 4MYPA 3CDGA 1W6LA 2ICWB 2ZTBA 4UIMA 4F57H 3GIZL 3KPSE 5EBLB 3GI9H 1HE8A 1ED3A 1OF0A 4NC1C 4ZQTA 1KY7A 2QSVA 4XRCA 2FTAA 1NLDH 3E6HA 1G6RB 5AD0A 4HW6A 3QHZL 4TVPH 3W38A 1IC4H 1AXSA 5GGVY 1MCBA 3DWTA 2N4IA 5E8NA 3ZHLA 3KDMB 2AEPL 2ZUWA 3ILEA 5KVGE 3RKDC 4JFFE 4Y0GA 3FU3A 1WZ1H 2H6PA 5TF1L 3V0HA 3W3BA 1KEMH 4JQIA 1HEZA 4BJLA 1A2YB 3O3AB 2M1KA 3CPLB 4JFPB 4FQ1L 3PNWB 3SYCA 4A7QA 3FT4B 4OB5H 3P11H 4MVBD 1T7VA 3IRCA 2YAOA 2LTQB 3HLKA 3TEZA 1Z5LB 3G6AB 3QJXA 1RZIA 3PFUA 4HKJB 5K39B 1F3JB 2JXMA 1EO8L 1OP5H 3RTQD 1LL1A 3JWNG 3MMEA 2OAAA 1U58B 1DN0B 4M5TA 4P05A 1JHTB 3MV9B 4G80B 4ADJA 4CVUA 2Z4QB 3U7YL 4ZMXA 2IGFL 1RJLA 2WXNA 3U30C 4EO5A 5I0ZA 4GS7C 4JJ5A 4PRPD 5C9JA 3K72B 1WFOA 4WVRA 4W4NA 1Z2KA 2NDGA 4Y1SA 3HR6A 3ETTA 5T1MB 2NR6A 2FZ3B 3QJZA 5FO8B 3BH8B 3L2NA 3L4CA 3CDCA 5AVTB 5GZND 3FULA 4XMXA 4OCXH 1IGFH 3D1MC 4I0PD 1LEIB 1WF5A 3BEWB 3LZOA 2F53B 3TBWB 5IMLB 5KSVB 1QFPA 1ZSDA 5DXWA 3TBYB 3UTTE 5L6YL 5KANG 2CDGB 1HZHH 4JM2F 1ZT7B 1YNLL 2E7BA 4I4WB 3GGWB 4MJ6B 2EKSA 5CAYB 1R5WB 4YQXH 2HFFB 2J6WA 1JZ3A 5HD8C 1I9RL 3OG4B 2C8NA 5KANI 4KPHH 1NCTA 2OP4H 3HPJB 4OV6F 2ROXA 5IF0A 3FHEA 4ANKA 2M2DA 4L8DB 1PYWA 1ZWIA 3RI5F 3U1PA 4JM4L 2B8OT 2ZX8A 1FORH 2ZUSA 4ZW5A 3LIZA 4EUPH 2XOTA 4EBQH 1XZ0B 2HTLD 4GRWE 1PZ5B 4NERA 2YD4A 3BKCL 1L9PA 3K8MA 3KH3A 2NX5E 2DI9A 5EWIH 4L3EB 3EH1A 3QXAB 3MRHB 4AGMA 2EIMB 4PI0A 2ZYRA 3K4ZA 3TTSA 1U0QA 4U1LA 2WW8A 1W8OA 2FBRA 1X9UA 4KKLD 4PCTA 3AREA 3FT2B 2CDEB 3M1BA 4QCIA 3QK0A 1MQ8A 4QXGH 3UIYA 1EGJL 4L5FH 3ZTCC 2E0PA 5E9AA 4PV9B 4XZUA 3B3IA 5I76B 3GMNB 3TONA 2DDQH 3U4KA 1INDL 2PP9A 3NA9L 4U6HB 3LKOA 4J23A 4MA3B 4D3CH 2WXLA 3KS0H 2ICEB 4PJDE 3WUWA 1W0VA 1C5BL 2BIQA 3K2UH 1AO7A 2ODHA 4FQQA 3VFTA 4OFDA 4NP4L 5D55A 1C7TA 4N0CD 3DDGA 4OJYA 1G7MB 3UG3A 1HQ4B 2DH3A 2YXMA 1DZBA 5JNYA 1SXZA 1U8PA 2XN0A 3AUVA 3EYQD 1DQQA 1OIOA 3MXVL 1KPVB 4HPYL 1XSOA 1YEIH 3GSOB 3QEQA 1PG7H 4UU9B 1B9ZA 2ZX7A 1JJUA 5CCHE 3GSRA 3GSQB 1AQ8A 3A6OA 2K6YA 3W39B 3ZXAC 3BVXA 1DCLA 2ZWNA 4FXGA 2VDRH 2H6UA 4DKEL 3SDAD 1SLXA 1IRAY 2CRZA 4N0RA 1KGCD 3WHXA 3FTVA 2AQ3A 4WU7B 1KXVA 3MN8A 2KKQA 2FDBP 1U93A 3L2MA 4DP9X 5I30H 1O6VA 1ZGLB 2ESVE 1DUYA 3CNKA 1KPRA 4D9RD 3VGBA 35C8L 3KPLA 3SDCA 4K3EL 5HJGA 5KN5A 4O4YH 5AYQA 1JGEA 5DWUH 4AYEC 1TUPA 4F33A 1B2WL 4ZS7L 3C5SB 2BP8B 3N41F 4RX4D 1HNYA 3L3IA 3MUGB 2C9RA 1MFMA 3KL3A 5CP7A 3NIFE 1SQMA 2G5RA 4KVNL 3D39D 1OK0A 2VAAA 4I9WE 5D7LB 1BXVA 2J1WA 4PGEB 4Y16A 5HGBA 1XB3A 2R0ZH 3LHPH 5GRVL 2WXQA 2Y36H 4F37K 2UY6B 2V6HA 1OE1A 5EZIL 5DD3L 3QDMA 3V4VH 3A23A 4KFZC 3BE1L 1DEEB 1MIML 2NY2C 1S9VA 2AK4E 3ZDWA 1X5IA 5F9OL 5F21B 3FQUB 4JRXD 5H94B 5HYJA 3QUZB 2DLHA 2X89A 2HMIC 3QG6A 1JWSB 1RHFA 5TFSL 1H8NA 2V17H 1PFCA 2X4TB 2K3TA 4M7JL 3ZDYF 3VJ6A 3TF4A 2KDGA 1SDDA 4CC1A 4O2CB 4DAGH 4ENED 2W91A 1T6WA 3TCXA 1H8LA 2C4XA 2OFQA 3GBEA 3POCA 4QKTA 4M6AA 2C26A 3GD1C 3QFGA 2AXHA 3II3A 5I15L 1QLRB 3JVFC 3TT1H 2OMWB 1UOKA 2XWXA 4HFWA 5IHUH 3E0GA 5DWPA 2X6BA 5AVUB 1U9KA 4MB4A 1G7JB 3ULVD 4FL4B 4B9ZA 2KLSA 2LLNA 2IOMA 3DBXA 4C4UA 1DBAH 1NM9A 4RDQF 4YGVA 4WW1A 2IFFL 2O5ZL 5C70A 2YMTA 1P4IL 3FO0H 1RUPL 4N1EA 4W81A 4XNUL 2EH7L 4XBGB 1PEZA 1UEYA 5EFIB 2PTTA 4FA7B 4ECNA 3EXJA 3RWFA 3ABKB 1S7TA 3U6XS 3ZQWA 4KDTC 3ILPA 1P1ZA 1U6AL 4MJIB 5L2KE 2G3NA 3BAJA 2P9RA 3OJ2C 4HJUA 4ZOBA 4XPTH 4JFEA 3SDXA 1ZMYA 3DMMC 3O3DA 2E9IA 1TEFA 5EOQL 1FL6B 3US9A 4X4YA 1Q8MA 3MBWA 2K6WA 4Y4FB 2YAFA 2FHFA 4KQ4L 5HGGS 2AXJA 4KRMB 3C60D 2R2EA 3I50L 3WY2A 4FF9A 3MRPA 3QCTH 3OKMB 4BFFA 4OQTL 1I9JL 3M6DA 2G60H 4AV0A 4XMKH 4XP5L 1LJMA 2H9GA 3MJ9A 4UQ3B 4D9LL 3ABZA 4LXFA 2YWZA 3DRTB 4J4PA 3GSNB 4KHXH 3CXDH 5LBVA 2OTPA 1SLWA 3DO4A 3MRDB 5BXFB 4J2XA 1FL3B 3HFML 4WFGE 1I1YA 2AABH 1UH3A 1D5BA 4LSRH 5DC0A 3VI4A 2HLFC 4A66A 4ZNEE 5A6IA 3SBRA 2PR4H 3CBRA 1OGTA 3II2A 3GSWB 1RIHL 4N5EC 1ZVYA 1BP3B 4J3VA 5CIPH 3RGBA 4PG9A 2Q6WB 1B0RB 3RBSA 4R83A 4Y9EA 1I1FA 3UEQA 3SCMB 4M7LT 2WBJD 3P40A 3RWEA 3BD5A 4OF5A 1KFAH 3RU8L 5CHNA 2HRPL 1AQMA 3I74A 1P6WA 4TNWK 3MYJA 5FW8A 3ROLA 2ADGB 4IBQA 1UM4H 4S1RH 2R2BA 2HUHA 2MHAB 1X7QB 2FLBT 1X5XA 3KGSA 2YAMA 2FWOB 2DQCL 4GEJA 4GSDL 4U0RC 3ESUF 5A16B 2JCCE 1R19A 3CD4A 3FMGH 2WIIA 4ZXBD 1XSIA 4FG6C 3TA3C 3CFQA 1GY2A 4PWEA 4V11A 5KJRH 3G5VB 4L23A 3MBEA 2YQGA 5IQ7L 2VMCA 1N5AB 4E42A 1LXMA 5TE6L 5IVXA 5A40E 4Y5YC 4E9TA 5B7MA 3ARBC 1AC0A 3RDTB 1N64H 1T0MB 3GZOA 4L1TA 3SGKC 3KLAA 3APDA 1TZOA 3N1QC 4P5TC 4RMUA 4YHIA 3SOBH 3ARDA 1G4MA 3OB0H 4OCYH 5AZ2H 2EYSA 1NDGB 3X13B 1WWCA 43CAB 5E6IC 1OAYL 1YSOA 3IAPA 2GEEA 5DMYA 3BH4A 1R5VB 5C09A 2WWMC 4PW4A 4BFBD 2FYVA 4GBXC 1GJWA 4OD2B 3BMVA 1F8TH 2AJXL 3MLUH 4AY0A 3BPCA 4UILH 4JZOB 4PJ7F 2DIAA 4Q52A 3CCHA 4X7DC 2X7LA 5EZLA 5I1JL 2NY1B 4MA7L 3V10A 4CMMA 4NQDD 2Y3AA 1TEYA 5BRZD 3FTWA 3EGXA 4HC1L 1O5DT 4F37F 2Q7AA 2VXSL 1T20B 4BFOA 1CLOL 3NG5A 2OJEB 3EOBB 1TEGA 4XBPA 4FTVE 3NJVA 5ACMA 4ZYKB 1VFUA 1KXHA 4BZ1H 2D7TH 3RVXD 4PJAA 3V4PH 2P8LA 5GS0D 1AXTH 2DICA 3B8YA 1FVCB 3LN9A 3VMPA 3DXAA 1U33A 1FZOA 4JY6B 1BD2E 3GSVB 1AJ7H 2WUBH 4OF0A 1MIEL 2HJKA 5HXMA 3GJFB 1S5IL 4G8IB 5DHVA 1ZDQA 3QI9B 5DQ9A 4JGJA 1ZA6A 1K4DA 3QIWC 1J0KA 4FFWD 3DSFL 1JUFA 3T3MF 1JGLL 2J71A 4B6ZA 4ZMVA 4BE5A 1N68A 3GM8A 3MCG1 5ADPH 3MUUA 4IHOB 4PPTA 15C8L 4RA3A 4WI0A 3AW5A 2H3NA 5TE7H 1Z3RA 4HULB 1ZT4B 1HWGB 2GBTA 2Y5EA 4J3WA 3RP1A 3ZDXE 4A7TA 5B3JE 2VN5A 1WWBX 3CHPA 5CGMA 4NUGH 2I32A 2L0DA 2FSEA 5B38B 5F70A 2Y23A 3C9NA 1NCJA 1TNNA 1XD1A 1U8KA 3BZ4B 1JOIA 1NC4B 3B5GA 1ZEAL 4YPGA 1LE9A 2IV9A 1SDYA 1NKRA 1NINA 2D4FA 3U7AA 4F8NA 5ACZB 1YEDB 2N59A 1RQ5A 2OMTB 5T3XD 3G3LA 4LBEB 4X99B 3QQDA 4D0BA 5GS2D 4Z1PA 1B88A 3CHQA 2HT2D 2IDSA 2N1TE 5EC2B 5EPMB 2K9FB 2H4EA 3DOSA 1OTTD 3P4OB 2E6PA 3IBEA 1QBMH 2PCFB 4GYBA 2I60L 1HL4A 4G7SB 3UTSD 3ZKSD 4PJHE 3ZT6A 1GCYA 4IBZA 1LP9F 2XWZA 3LV3B 1U8CB 4OLEA 4HZAA 2X4OA 3I6SA 5FA4A 4P57A 2WUCH 3NGBB 4UNIA 3VI3E 4Q9RH 2HLAB 5CKAA 3X3FH 3CC5B 4BA0A 4JDZA 2WXIA 4WFFE 3OKDB 3TASA 1IQWL 3K0YA 4XP6H 5BO1H 1R3IL 1T5WA 4LAQH 5D9SB 1XGQB 3LXBA 1MJUL 2EDKA 2D31A 3GXDA 4L4VA 1FCGA 3RYMA 2XA8H 1SM3L 3VD9A 3OR6A 1H6TA 1BM3H 32C2A 7FABL 3ZBMA 4X7TA 4AQ1A 4Z76A 2I69A 4PJEB 1CFTB 1QP1A 1KIQB 3RIFK 2HJFA 4RSVA 3T0ED 3V0AC 3AXLB 1ASQA 2P5WA 4G8EA 1D5IL 1XD0A 3C6LB 1RSYA 4UAHA 3S3SA 2OQJA 3CK0H 3QXDB 4U2YA 4F5CE 1VRSA 3VFNB 4RH4A 3BISA 4PRAA 3K6DA 3D4ZA 4RGMC 5DD1H 3IJHB 4NXKA 4HV8A 4MXQC 3GS4A 2C1OB 5T1LA 4DGVH 2H0JA 4J3XA 3D08A 1RZ8B 3MCLH 4M5YH 3EYOA 9CGTA 2W65B 4N2NA 4X6BB 1KWKA 1T04A 3AG4B 4XNMB 3NJHA 4N8PA 5GS3A 2CO7B 3DROB 5D4JA 4C4BA 1NIDA 5FV1L 4YDVA 4EEEA 1II4E 3I2CL 5TPWH 2NNFA 3T4AA 3QBTB 3PJSB 1RZQA 1A7PH 1F11B 1WTGT 3VG0L 1ZHNB 5E5MB 4KXAA 1ADQL 2QR0B 2ZOWA 2JWYA 3IGLA 1A6VL 2QQLH 4U1JA 5I71B 4QRRA 5E99H 1QBAA 2R7EA 4H8WL 4NUJA 1RURL 4RAUA 2DMKA 4WWKC 2QGEA 4DQAA 5D1QE 3Q6FB 4NO3B 4NIKB 2H45A 4R0LA 3RFRA 5B22A 1T2JA 2P4AB 5LXGL 2Y9RT 1T1XA 4LOFA 1JVOA 1FRGL 3LEYH 4M9PA 4CILA 1KV7A 1M53A 1YVLA 4J3UA 3TPKA 5A3IC 3GMOA 1HHKB 1HU8A 2OV0A 2ZUVA 1J1PH 4JPKL 3MLSH 4JY4B 4NOBA 4Y9FA 4ICWA 4RLDA 3S34L 1BG9A 1IAKA 2QKIA 5H35A 4J6RL 3QUYA 1FH5L 4YO0B 5DHYA 4JUTA 4ZFZB 1BQLL 2NZIA 1F4XL 4U7KA 3DURB 4U2ZA 4NNXB 1VSCA 1Y0LB 3EUUA 5FCUH 1S7VA 3GMQB 3QUXC 4H26A 4ES8A 4L4JA 1P5UA 2DM3A 2HKFH 3AG1B 5JPNC 3NRFA 1WPCA 3J2PA 4HIEA 5ANMB 2ZUTA 3VYOA 1Q0XL 1H9DA 1X9RA 1HH6B 4KBPA 4Q89A 3X14B 1PZCA 1S3KH 4AK2A 1Q94A 3REVA 2J25A 1CFQB 1U41A 5IQ9A 2DJ4A 2B59B 2FIKA 2R23B 5FYJL 5CCJA 1YNTF 5KJ4A 3NSJA 4IJ3B 1IE5A 3BZEB 3V0DA 4EDXB 2CCLA 3NSXA 2E3VA 3FCBA 1A6PA 4GAGL 5C0AD 2ED6A 3SPVA 2J4WL 4KGJA 1OSZB 1JGUL 3QUML 5C0CA 4FADA 3QHFH 1HXMA 1NBVH 4HJJL 2A9NH 3EJZC 1U8NB 4EVNB 1T22B 4Y5XC 3S3DB 1BZOA 3BD3A 4ATTA 1JWUA 3NZHL 1PIGA 4XCNA 4F7TA 2I26N 2XIDA 3GRBA 1JPST 4I18B 3AG2B 4GXUM 4DN4H 2BJMH 5K33A 1FZMA 1MHCB 2BS8A 2AGJL 2YAEA 1YEGL 4QXTA 2X6AA 5C07D 2JJSC 4N1HB 4FHKA 4WWPA 4PN6A 1W72B 2I9LB 1EGJA 4JDVB 4PG2C 4ZX3A 1YQVH 3V5HA 1IVLA 4I2XA 4LLMA 5E56A 1GW0A 2YGNA 4UTCA 4FFYL 5TQ0L 1YN6B 3DV6B 3DX9B 3QFDA 3GUTB 4X4XA 1J88A 3O45B 4EI5B 1RIVH 1XCTB 3L3HA 4R7NA 3RVTD 1L5GA 4NHCH 3CDGB 1JHLH 1PZSA 3V9FA 4AVKA 1TDQA 4LCCA 4K5LA 4UIMB 4A2DA 1ED3B 4OCSH 2PWHA 1TZIA 4A7SA 4XRCB 1IGJA 1TPXC 4OZFH 5I1GH 1E8WA 1RZJL 2UV3A 4XCEA 3UL4A 5E2TL 5AD0B 1J48A 2VR4A 3INUH 4GQPH 1AXSB 4LK4A 5FC9A 3RL1A 5E8NB 4YHYC 3IN0A 4KKAC 2HRGA 2EVGA 3WNKA 4C4KT 4E9XA 3S4SA 4E0RA 2VC2B 5IROD 2H6PB 3W2DH 1GZPA 3AT0A 3CVDA 4IU3A 2A1WL 2AV7A 2D2OA 5DDHA 1XCXA 1QW8A 4OKVA 4ZD3H 5D1XD 2A74C 4XO5A 1AQKL 3MV8E 3L1OL 5AZUA 3QJSB 3N1PC 5D5MA 3WNJA 1ZTMA 2B08A 3FQRA 4IRJD 1UWGL 2X1OA 4JFSA 3RIFF 4XOBA 1OAXH 4JHWL 3SDDA 1WFMA 3GDCA 3O6LH 5FYKD 3FSAA 1RZIB 1Z9NA 4WHYG 5IFAL 4ACPA 2W9EL 1Y07A 5DJYA 4PGZA 2JXMB 2WVUA 1MREH 3LZQA 3NUKA 3B7TA 3VX1A 4UM8A 2WKLA 4HIXH 4NQQA 3BAEH 2OL3L 5C0BE 4ABWA 5B1BB 2MTPA 5D1ZC 4L3CA 4XCYA 1CGXA 1RXLA 1RJLB 5TQ2H 1NGWA 3ZHDA 3RUGA 4JJ5B 1S7SA 5C9JB 2CM5A 4AGOA 4W93A 4P5MA 3FOMA 3UAAA 4NZTL 4X6EA 2IFGA 3NIGF 1NOLA 5A2LH 2P8PA 1MI5A 4PJBE 3ZKXC 1ETA1 3VM7A 4LLQA 1HYSC 2CSPA 4D7BA 1CDUA 1NCGA 1UWYA 3NCXA 3RNQA 4PVMA 1ZSDB 2VDML 2DL2A 2ID5A 3TEUA 3BCFA 1ZANL 3TOPA 3LRHA 4NQCA 1VEPA 1UGNA 3O4LE 3QPXL 3OF6D 4KRLB 2EKSB 2FEDD 1SJEA 2WTRA 3BGFC 5KYUA 3KBPA 3IMTA 2CK0L 3BP4A 5EEVA 1GR7A 5CCKL 2G3MA 4XN7A 3Q2VA 2F7RA 2QADB 5IF0B 3ZPDA 2ZD0A 3KCWA 1ZWIB 1KJVA 2B7DT 4F2MB 3T3PB 1R34A 3V8CA 1TJGL 3NPSB 2LAGB 2GJRA 5D2NA 2DEWX 4YXKH 3E1ZA 4FXKA 5I1IH 1CGSL 1NCDH 4HH9A 4LGRB 2YK1H 3LB6C 4PW3A 5E2WL 2MKWA 3U1SH 5HY9A 3O9WD 3KPNA 1ITBB 3IJYA 1DJIA 1D5ZA 1EJ6A 2P8MA 1KXTA 4AKPA 1ITCA 1USQA 4LEXH 4X9FA 4A2EA 2VLJA 5GGTL 5ILTH 4BEIA 4U1LB 1GPOL 1FDLH 3TH4T 1EZSA 4P9HL 3AREB 3M1BB 5FX3A 4QCIB 5LUMA 3MOAH 5C3LD 2J8HA 25C8L 3ILQD 3B3IB 4XZUB 4L0ZA 4OFYD 1CC3A 4TUJA 2YD8A 1A14H 5ICXA 3LKOB 4G7QB 5CGBA 1RUQL 1OZUA 3WUWB 3TIEA 1UEMA 1W0VB 3LSOA 3TV3L 1S7QA 1AO7B 3IXAB 4FQQB 4W9JC 3VFTB 1OGAA 1F6AA 4NRZA 1SF5A 5KBLA 4OZHA 1JL8A 5E00B 4GKSB 4MS8C 4ODUA 5JNYB 3UG4A 1H0DA 1U8PB 4PWJA 1MHPH 5AAMA 2XTJE 4D7PA 4HMDA 1DSYA 2Y3NA 5JDSA 3O8XA 3GSRB 4R2GC 4AE0A 4MMYA 3S37L 3FTGA 1E8XA 2I7OA 1G1YA 4IBVA 4B5ZA 3D51A 4FXGB 3ZDZF 3I75A 2VDQL 3MRCA 5EF0A 4ZX4A 4PJIA 4XVOA 3U7WH 3FS9A 2ZSVA 1UXWA 3JV6A 4WO4A 3WHXB 4G1MA 4R26L 2JJTA 1HQRA 1BMGA 3ARWA 1AZCA 5BW7A 1FP5A 3HE7D 1U93B 3AXIA 1DUYB 1KPRB 1JZ5A 3KPLB 4WY7H 3SDCB 4PGBB 3CH1A 5KN5B 2QFPA 4KK8D 1JGEB 5C6PB 4F33B 1P7QD 2OSWA 4ONGH 1YEKL 3L3IB 1SOQA 3LRLA 2BFVH 3VGAB 3D2UA 4PJCE 3EBGA 3BKMH 2TSBA 5CP7B 2HLEB 1C16A 2GSIA 5CD5C 2DLIA 4Q9QH 3FQ1A 3WD5L 2VAAB 5DRXA 4OZGF 3ULVF 4Y16B 1S3RA 4HFUL 5HGBB 4KROB 3QORC 1ECZA 3VE0A 4YLBA 4PY8J 1KV3A 2XZAL 5EA0H 2FT8A 3IPFA 3MJ7A 1FGVL 1YEEH 2IC2A 2Q20A 2R0WH 2X28A 5F2FA 3CHXA 5HYJB 1ILUA 4UAOB 3BQUC 2KZKA 3QG6B 4YNYA 4G71B 4MVBC 3CFUA 3J27A 5CSZA 3ELQA 3VJ6B 2AXWA 2XY2A 1RULL 3EDEA 5DRNA 1SDDB 3V0JA 5CBAA 1KJ2L 4N8VG 1UYWL 4XXWA 4PUBL 1ZDSA 3NAAH 5AOKA 1AIFA 2E27H 2EUVA 1ZV9A 3IBOA 1XQ4A 4F9PA 4L2LA 2HPOA 3DTDA 4IW4C 3BP5A 4K9EC 1SJXA 1YEFL 4WGKA 3KPMA 3DBXB 3GB7A 4XPGH 3V4UH 1RJZA 4YGVB 4Y19B 4WW1B 5GZNC 3VQ1C 4F1SA 4AQEA 3QCUL 4I0PC 12E8H 1N8OE 2PTTB 1JPSL 1JZDC 2W8CA 3RWFB 2C4FU 3LKPA 4HJGA 1VACA 4XNZB 1S7TB 3N06B 4HC1A 2J8OA 5IEHA 4HLEA 1P1ZB 4TSCH 5FIEA 4H2AA 3HNVL 1WAAA 3QQXA 3ETBJ 4U33A 2XZQL 4KRPD 4JFEB 2NXYD 1NKGA 4JVPA 4X4YB 2HRHA 5L9DL 3SGJC 3MBWB 3HR5A 3PP4L 2DYPB 3FUIA 4NN7B 2R2EB 3MRPB 1DLHA 3QYCA 4Y5VA 2D03H 3CDFA 5AOJA 3CWGA 4M9OA 1FVDA 1B6DA 2H9GB 1GYUA 1GVIA 4MLSA 3T77A 1MVFA 4P48A 4KQ0A 1OD9A 1BAFH 1RFDL 2J5LB 1ZKAA 1AQHA 1I1YB 1AXIB 1M1XB 3FXIC 3S36X 4OGXL 4W1TA 2YZ1A 4K23L 3VI4B 5JIPA 2E7HA 3QZNA 4HX1A 3V6OE 5FKAA 3LPPA 4Z7WB 4KTEH 3WKMH 5EOCH 4UOQA 5IESL 4S1QH 1KYUA 4JQXA 4B97A 1G7IA 2R4SH 3NDYE 4OZIA 5I9QB 1NGPH 1NWPA 2MKLC 2NPLX 3GPEA 3HIZA 1I1FB 3DBSA 1AE6H 4YSQA 3QNYA 2PP8A 4G70B 3N04A 2BIOA 3G6DL 5DZNA 3U4BH 2IF7A 3OWRA 3I85A 3D69A 3RWEB 2H47C 1E5ZA 2XPYA 3HC4L 2ZKHH 5CHNB 4MKTA 1U3JA 2B77A 1UA7A 2X41A 3OMIB 4AGLA 4ALAL 4UT6L 5J9PA 3LZRA 3ROLB 4CAGA 3Q2WA 4P07A 3NEXA 1LDSA 2DMHA 2LGNA 2R2BB 3CZNA 1E4WH 2EIEA 2HT3C 1TTBA 4APXA 1SY6L 3SPIA 1IM3D 1MWAL 3FFDA 5J1SC 2Y7MA 5ISZD 5ADOL 2GY7B 2EUWA 3FFCA 2UZPA 5DFVD 1PGRB 4KKBD 1MAML 3P3YA 2WIIB 3PWLB 1SEQH 4YSCA 4DVBA 2ZUXA 2EDFA 2ZCHH 3F12A 3HUJA 1QSEE 2AJYH 2P44B 1T5XA 3OJVC 1K5NA 1BG1A 1MPAL 1V7MH 2KZWA 2YPVH 5MEQA 4H8HA 4BQCA 2DBJA 3MBEB 4MAYB 2CRMA 5I24A 4AYMC 4E42B 1PY0A 2BM3A 1SJMA 1ZV2A 4LCUA 3D2TA 5T3ZD 5IVXB 4LVHC 1MHEA 2YPKA 2DQGL 5JPMA 5HYSA 1QLEB 2B1OA 2O5YH 1HL5A 3SGEI 1KBGH 3HNSH 3FUFA 5LG1A 3W5NA 1WCQA 1LWRA 1P7BA 3KLAB 4YHIB 2V2XA 4LBAA 2VDOL 1KTBA 4Z3HA 4GMSL 3VRLE 5M95B 1MFDL 2EYSB 1CTMA 4QTIL 4AK1A 2VMFA 3BJ91 1DQML 3H85A 3LRMA 3WNOA 1QNZL 2IEPA 1CWVA 2XNAA 4HEPG 3R4DA 5I0XA 5C09B 5I74B 4FQXD 3VFGH 1WZKA 5MI0B 4EOWL 4U3SA 2NY0D 1RAMA 4ELDA 3QS3A 1IGCH 4WTZG 4YDLB 2GBAA 3BPCB 2C9QA 3CCHB 1A6TA 2X7LB 2UX7A 4CMMB 1QKZL 4G82A 3UIZA 3EGXB 1G1OA 5EBMA 3WJLC 4BE6A 3DTXA 4XOEA 2OJ1A 3OB8A 3HZVA 3RDJA 1N70A 3E8VA 1A5FH 3PXJA 4F93B 4XBPB 4ELMF 2CG9X 4AJVA 4P2RA 3VRJA 4JG1H 1HK6A 3KYMA 5HSFA 6CGTA 4PJAB 2BHUA 2P8LB 2X12A 4PP1C 5K5YA 2OYMA 1E65A 3DXAB 3T6XA 4O2EA 5I6KA 5JW4M 1FZOB 1SXNA 1OANA 3BVNB 2Y6TE 2C3VA 2HJKB 2AJSL 1ADQA 1RZKL 1K72A 5EUOF 3QDAA 2NOYA 4E9LA 5KEZA 3ULVC 5T1JA 2YIHA 4M1CD 5DHVB 3SSGA 3QJVB 5DQ9B 3RA7H 3ALWA 1RPUA 1ZA6B 3K81A 2V9TA 1K4DB 2I07A 3VSTA 4Z8FH 2H32B 1DEDA 1JUFB 2YO3A 1XMWA 1EVTC 4YHMH 1OAQL 2ADIA 4WI0B 3U2SA 1DQVA 2H3NB 4OLUH 3EO1A 3UABA 2J44A 4UQBA 2Z1PA 2N56A 5DS1A 2LV4A 1QNIA 2F61A 4L4TE 4P0DA 5FR3A 2YEZA 2FSEB 1RK1A 3WFDL 3C9NB 2OYLA 4G9DA 3P2BA 4KPHL 3RG1C 1KYDA 2OP4L 1M9SA 2GW5A 3N1GC 1KZQA 1U8KB 3N43B 3VA6A 2J8UA 4F3FA 2JI3A 4PS4H 3T0BA 4NWTH 1LE9B 2QV2A 2VW7A 2DTMH 4K7PH 4A39A 3DRQA 1UM5H 5DZOA 3FSWA 1PJ9A 4CADA 4ODVL 2JQMA 2M83A 4N28A 4PJXA 2AXGA 3QQDB 5HVGB 4D0BB 1AO7E 2F54E 3PABA 4XVSH 3ULVH 3NYKA 4GINA 3CGTA 1I53A 3Q0HA 2AEOA 4PJ9C 1F02I 4DK5A 1X44A 1A02N 4L5FL 3QEQE 3DGCR 4GY4A 3ATFA 3CUPA 3ZMRA 2E9GA 1JG9A 5BVJA 2OSXA 3LNFA 3B5HA 5ECGA 2GBVA 3IJSA 1PX8A 3AQDA 3MU3A 1LE5A 1TNMA 2VTFA 1QTYT 2ZKMX 3IMSA 5FHAH 2GI0A 2EE6A 5FA4B 4ZDHA 3HB3B 4P57B 3SDYH 4C55A 3MV9D 3O81A 3QUMA 4LRNL 5KVFH 4JDZB 1MJ7L 4TS6A 3ZSSA 1U2CA 4HPOL 4LAJH 3HZKA 1OALA 3U82B 3OJMB 5IVNA 1SFDA 4W9EC 2X6CA 3VU2A 4I77H 3DX4A 3WIIH 3V6FA 2FE0A 2D31B 4L4VB 3BP7B 3OR6B 3PWPA 32C2B 4JFDA 5JOFA 4YHKH 3BRGC 2YPLA 1TCRA 2JH2A 4X7TB 4AQ1B 4Z76B 3LQAC 5T3XL 2F53D 2HJFB 1OHZA 4XN5A 1XEUA 2P5WB 1EHKB 1AHKA 4G8EB 2K0RA 4FNLL 2UZYA 2FBJL 4FFYA 2OQJB 2EYTA 2DQEH 2VGLM 4MFHA 5LN4A 4Q9CA 2XWBA 1HEHC 3GBDA 4ZXBC 2L3BA 4OR1A 4PRAB 1E50A 3BXNA 4JE4B 4KTGA 3D06A 3PNRB 4FQ2L 3ZVVA 1FYTA 3GZKA 4HV8B 4AYFA 1NIBA 3PPEA 1NEZG 1YUKB 5T1LB 1R47A 3QDME 3VH8A 4AKQA 4XMTA 4LU5H 2YAQA 1VKXA 2R2CA 3S35L 3IETA 5EORL 4MMZC 4LSSL 3EYOB 1C5CH 4WKZA 2Q3XA 3GKZA 3O6FA 3AGVA 3CLFH 2EDWA 2Z31A 1L9OA 4QYOA 5CMAA 3MV01 4P06A 3GXUB 1T04B 3AY4C 2UWEA 5EU3A 3UTPE 5J6HA 5J8OA 4YDVB 5E5UB 5GQBA 4TUOA 3VXUE 1A7OL 2EDHA 4FEIA 4L3ED 1HSAA 3T4AB 2VL5A 4TPRL 1UT1A 3H3PH 4Z7UF 1MDTA 3LQAH 4NRYA 4HEMA 1PKQA 4XC3L 3VO0A 4KJWC 4KWUA 3C2SA 1CXEA 4U1JB 1Q1JH 4QRRB 4DP1X 4MX7A 1OVZA 2R7EB 4NUJB 5E4OA 2EC9U 4RAUB 2EILB 5IEKA 2A6IA 1JNJA 4WUKL 4R0LB 3OV6A 1QR1A 1AR1B 2P52A 3PWUA 1T1XB 2ZWLT 4BKTC 5AZEL 3MLXH 1NMBH 4WHDA 2UXFA 3GMOB 3FQXA 4XXCA 4D9QE 4GAFB 5LGJA 1DBJL 5G4NA 2OL3A 4TVSa 3SE4C 4TQHA 1IAKB 5H35B 4L05A 3QUYB 1IBGH 5DHYB 3Q2CA 4IK6A 4MQTB 3RVXC 3E3QE 4J27A 4PB9L 4QT5B 1N26A 4KGLA 3SDXE 3HG1A 3WTSA 2QV4A 2VLMD 3KS0J 2D7MA 1S7VB 2FHCA 4QJ4B 5GS1C 4IIQA 2H6OA 1P5UB 4BSJA 1D9KB 1HVXA 4BFKA 4ETYA 3MUZ1 4NO5A 4HIEB 3PGCA 1AZBA 4GXVL 4XTRD 4UMGA 5J9PB 4PV8A 3REVB 1FSKB 1UG9A 3HI1A 3T6QC 5IQ9B 4FNPA 5D96B 4GOSA 2FIKB 2A7BA 4N2BA 4XPTL 3PWNA 3BSHA 1OCRB 2W92A 5HYQA 4NWUL 3Q7JA 2ORBL 1J9SA 3I02A 1MAKA 1YY8A 3LN4A 1OSPL 1DJHA 4FYRA 3W56A 2XICA 4JO2H 5J6GB 3SPVB 3X1FA 5F1KC 2ZCZA 1NTDA 4FZEH 5C0CB 1YPZF 3O4OB 3GWJA 3RTQA 1HXMB 3QCTL 4K5OA 4MSWA 2DM7A 1G87A 4Q6YA 5IQLA 1Q9WA 2VXQH 5D7LD 3TT3H 5GS0H 2DQHH 3RL2B 3ATEA 4XCNB 4F7TB 4KHXL 4LVNC 2G3ZA 3AQXA 4JGUA 4QR7A 4RZKA 4DT2A 3PXLA 3A6CL 4F15B 4POZC 3HAEH 2ZP8A 1FZMB 5GGTA 4BH7B 3TX4A 3PFQA 3QUZD 4NUMA 1D3CA 2O5XL 4DZ8A 1OW0A 2HVKA 3DGDA 1DO6A 4I2XB 4W4OA 5CINH 5FA3A 4X4XB 4RGOL 3L3HB 3MPCA 3GHBH 4R7NB 3QQ3A 4G43A 4RAHA 3AQZA 4W9KC 3C6SB 1L5GB 3WAKA 2WLKA 1CXIA 2MTAA 4LCCB 1NLBL 4MASA 4HMEA 1GZHA 4TM9A 1TZIB 4YZWA 5I73B 3ZTJG 1IGJB 2YXFA 4OTXL 2OR7A 1D7FA 1NZRA 1DJYA 1JNLH 1B0GA 1R6VA 1VGEH 2BNUB 4XCEB 4F8OA 4Z7NB 1L9NA 3RL1B 1CBJA 1J8HA 1KCRH 2BSCA 3AM8A 1E0OB 4NO2A 1BGXL 5HHXH 2XQYK 3AACA 1K6QH 4Q6IC 4D8PA 2WJ5A 3S4SB 2CO4A 4E0RB 4HQQH 1DUZA 1E43A 1PLGL 1GZPB 2YOCA 1PU0A 5JYMA 5DDHB 4OKVB 4U6YA 4MJID 5D7IF 4Y2DD 2CXGA 1AYRA 2VZSA 1JVLA 1QMUA 5KJRL 5I6PA 5D5MB 1EXUA 2YBGA 3FQRB 3IS0X 4KUZL 3REWA 2FAUA 4YL4A 2ICES 2CO6A 3QEGH 3KXFE 2E9JA 1P2CA 3PQYA 3SDDB 2F19L 4Y4FD 3UCQA 4HG4J 1V7NH 2G75A 1UFUA 3QRGH 2F0CA 2NLJA 2WAHA 2XBDA 3EJYD 5DJYB 3M86A 2BW5A 2PYEE 1H9VA 2YFNA 2NNAA 4N24A 4UM8B 4LIQH 5DZLA 1EZVX 4B3EA 1JZ7A 2VQTA 3QDGA 3IKKA 4L3CB 1VESA 4JG0H 4XCYB 4MQ7A 1P84J 2HKHH 2Y6SD 4UOW1 3RUGB 3FUHA 4ENZA 4P5MB 3FOMB 4FGMA 1F1DA 1KB5H 2L7EA 4X6EB 5EN3A 1WK0A 5F7DA 2P8PB 3FU6A 4G6FB 2VJ0A 1MI5B 1LD9A 2C9SA 2WXOA 3SPJA 1DN2A 2WXKA 1JGVH 3KL0A 4LLQB 4AUYA 1CBVH 3MLUL 3MUHL 1MFAL 3FU0A 3UTOA 3IJEA 1KF9B 3T08A 1NUGA 2VDNH 2CJSA 2Z91A 3QJOA 4KO7A 5HDBE 3RNQB 4AYGA 5T33L 2XVBA 3W82A 2IDFA 4LP8A 1CPUA 2IAMC 1WBYA 3ARXA 3SCMD 2DLEA 4TQEL 4U4BA 5K9JL 2VZTA 5AAWA 3J07A 1KJ2A 1R0AH 4XO8A 3PGFH 5A6LA 1MJ8H 1ZS8A 3LD8C 5KYUB 4BZ1L 5JLZA 3BP4B 1HAUA 1AXTL 2YA1A 2F2HA 2WNWA 3M1OA 3C09B 4QJ3B 4AIOA 3S3CB 1KJVB 4E36A 1AJ7L 3SOTA 3PV7A 4YBQC 2CHWA 5D2NB 3CIQA 4FXKB 4RSYA 4HH9B 5D2LE 3FUDA 1TLMA 5BS0E 3FAWA 2XA3A 3SYPA 1R46A 5F9AC 5LJYH 4HF5L 1ZE3C 5HY9B 1WICA 3KPNB 3W9EA 1E3XA 1I8LC 2D7OA 1D5ZB 3IJYB 3QO1A 1KXTB 3V52L 2NXZB 2RIKA 2KBGA 5DK3A 2IQ9H 2NQDA 3SQRA 1DL7H 1OTUD 3EF4A 3K2MC 2VLJB 2PABA 4L9DA 1W9XA 4H5SA 3RFZC 3KYKH 1K2DA 5KBMA 3AS2A 3MYZA 2G0KA 4I8DA 4DO5A 1FFQA 1M3IA 4AG4H 1A0QL 2NTSP 1VGKA 4FLOA 3RGVA 4I89A 4E41E 1HINL 1RPQA 4TUJB 2H7WA 2EH8L 5ICXB 3RDTD 4QHNA 3ATDA 4EKXA 1P9MC 4XNYL 1MDAA 3LSOB 1S7QB 1SVBA 3NQIA 3Q1SL 4K94H 3R06A 1OGAB 1CVRA 2FYYA 1E7UA 1F6AB 4NRZB 3HLAA 1MCHA 4OF3A 3IU3A 5KYWA 3O0RL 1G7HB 4B9PA 3D12B 4ODUB 5I1EH 4JK0D 4U31A 1H0DB 3T5WA 1E5CA 1IKFL 5LGKA 3EJJX 2WZ6A 3H9ZA 3AB0B 4ZUTA 4MLIA 5E08L 5JDSB 4RGNE 3O8XB 3OL2A 1W8EA 1C5DA 4JB9H 4E5XA 4ZW3A 3FTGB 4HUWA 4PLJD 4RZCA 1CD1A 1MCIA 5EF3A 1DQLH 3MRCB 2NY1D 1CDYA 4PJIB 1QFWI 2YD0A 4Y4KA 4YFDB 1ULVA 3UC0H 3ZE1E 2ZSVB 3QP3A 1UXWB 3JV6B 2WLLA 4WO4B 5M94B 4G1MB 2XQYG 3G7TA 5DJZA 1HQRB 5ES4B 3GLZA 4NJ9L 1DDHA 3UADA 2E74C 4X8XA 1IUZA 1KLUB 1J0HA 3SKOB 1IBYA 4PQXA 4D0DA 1S7WA 4M8QA 1JZIA 3RVTC 1I3GH 2W1NA 4BUGA 4XHQA 3CH1B 3HG3A 4ONFL 3KJ6H 3WY3A 3VXRA 1A9BA 1Q38A 4HXBH 4XOAA 4OSUL 4WIQA 1VHPA 1OWRM 3AITA 4RMRA 4AEIH 2XRAH 1MXDA 1T21A 3C60A 3D2UB 3QI9D 3QAQA 2V7NA 4P4RA 4OLZH 3ES6A 1C16B 2GSIB 1SY6A 4MB1A 1U92A 5T5FL 1I1AC 5DRXB 3HNTH 4OJFH 3FHAA