1AHKA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 5
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahkA00
5KWYC 3WEBA 1XWVA 3FXIC 3ULAB 5IJDC 3VQ1C 1AHMA 2E56A 2E59A 4G8AC 3MTXA 3T6QC 1NEPA 3B2DC 3VQ2C 1A9VA 5IJCC 2Z64C 2F08A 3WEAA 3RG1C 2HKAA 5IJBC 3MU3A 1KTJA 1WRFA 3M7OA 2Z65C 1AHKA
chains in the Genus database with same CATH superfamily
4ZFOB 5DD5H 4ZQTA 4PP1D 2A6IA 1TXKA 3LQZA 2ED6A 4AH2B 1XQ4A 3HHMA 1A7NL 4P4KB 4M93C 1AMYA 2X42A 4R4BB 5DC2A 2ZP8A 4OT1H 4B50A 5CEZD 5I1HL 1OF0A 4JY5H 4ODXA 4HAFA 4NQCD 1MW3A 5E51A 4GMTL 5E8EB 4G42A 3HN5A 3ARGC 5EBLB 5L2KD 2C9QA 4NENA 1C16A 2YA0A 1ZRUA 1BGXL 4FXGA 2YFNA 4BZ1L 2WLHA 3QHTC 3D12B 4AWJC 1AIFA 2RIKA 2GBUA 2FGWL 1SYVA 3WNOA 2X4NA 4HJGA 2P5EE 4P5TD 4XGZA 1QSFA 4RESB 4RRPA 1OTTD 4DEUA 2GHWB 2ZOOA 5CEYB 3RY6A 1UD2A 2Z7WA 3GSOA 5F7LB 5H35B 2K9UA 2WKOF 5IJKC 2B7DT 2XWEA 5I8OH 4HH8A 5KSAD 5CJXC 1KYAA 3SQBB 1KF9B 3BAIA 3VFOB 1N3NB 4AUUA 4QF1A 5I19L 4NM4H 2NX5B 4MA3A 1H6FA 1HU8A 4ZODA 2E75C 3ETBF 3C8DA 3HAEG 1LEGB 4ZSOB 4TVPL 3V0EA 5CMAB 4Z18A 4BSVA 4TUUA 4CC4C 1QR4A 5F3HB 1U2YA 3OD3A 2FHFA 5HYSB 4WGWB 1H15B 5D72L 4Y4FA 1RHHA 4Y1AB 1ZS2A 1L7IH 5MP6L 1NDGB 3MGTA 1X4XA 3CLEL 4IEFA 3NGBC 1ETJA 1I3VA 2WBWB 3NABH 1A5FL 4YX2L 1TQUA 5IOKA 5EO0B 2CDGB 4QHPA 2O5YH 4JCWA 4NO0B 4WWNA 2HP4A 1L9NA 2XG5B 4E9LA 2CLVB 3T08A 4MTMA 4BK5C 3IU3A 3NN8A 3ARFC 4YHKH 1INQA 1CN4A 4WLCA 2IALA 1Y6MR 4M7KL 4N28A 3V0WH 3PJSB 3LMJH 4Z7QB 5TTRA 1IM9D 4N2IA 1II4E 4LOFA 3B4NA 5ILTH 3SPVA 1FNEB 2NY4B 4OFPA 4KJYB 5GGVH 4PJAB 5JPMB 4QO1A 1S8DA 4TQEL 5FA4A 2VZOA 2O5NA 3TO4B 3L4UA 2DBLL 2XWTA 3VXUB 4LLMB 4XXCC 4TQHA 4YDKL 1KG0B 1R9FA 2OMWA 1MREL 2YD1A 4LPWA 3CXDH 1PIGA 5IW6A 3ISWA 1XGYL 2GUOA 2MTAA 3OHXB 2EEAA 2UZXA 4LGRB 5E2WH 2PCYA 5KBKA 4FQQB 2ZUVA 3CFCL 4GBXC 1TQCB 1WD9A 1XIWB 3VFWB 4MSWA 3ULUH 2JK5B 4U7MA 1S5IH 1OAKH 2A1WH 1YQVL 3DUHA 3U0PA 5F7EL 1OARL 1FNHA 2YPVL 3B9KC 4L48A 4OGXL 2BFVL 3S8GB 4C56E 4CGUB 1FFOB 3O0LA 2VXTH 7FABL 2JB6B 2W9DH 3WCYA 3C60C 2HT2C 4GT7A 1HHKA 2ZWNA 3UPAA 1OTSD 2W65A 3ATDA 5IQNA 4URKA 5JOPE 2IXQA 2C3WA 1X9LA 4R84A 1ZHLA 3L3OC 4GSDH 1RD6A 3UX9B 3SY6A 3PNWA 2WZ6A 4K23L 4TOYL 3L17A 1VZGA 2E27H 2BP5M 2DM4A 2MNWA 2A9NH 2ORBH 3GRGA 4X4MA 2JKJA 1NCWL 4YMPA 2XOTA 3EJJX 5EU7E 4J3OG 1FZOA 3QAQA 1BQLL 3IJEA 3H4FA 1MVUB 2FDBP 1YMME 2AV7B 1KJMA 2FK9A 2WANA 3DX3A 3FRPA 4PGJA 4PYGA 3JWOL 2P5WA 4U1SB 2XUWA 2EXWC 2K3HA 5DJXA 3WO3B 4GQZA 3BN9D 3K4DA 1MCJA 2NXZB 2OTWA 4TUOA 1PD6A 5FUCC 3Q43A 5GGSB 1ZXKA 1AO7A 1BXUA 4WI2A 1ORSA 2VM3A 3JV4B 2DQGL 4ZO9A 1SMOA 1NPUA 3KYOB 2BJML 2YQBA 2IGTA 1NL0L 2ADGB 2EXYD 3OR7B 2Z91B 1KXTA 3V4VB 2R2BA 4JFPB 3QQ9D 2BVTA 2YMXL 4OM1L 3PGDB 2V9QA 1T7VA 2DH2A 5EEYA 1N12A 1XR8B 3U6RA 4LRIC 3MRRA 4I0KA 5CN1A 5E1QA 4X9BA 4H8HA 3ABKB 1IMHC 3S2CA 1S5HA 2UWEF 4M93B 4KWUA 5IBTH 3W0WD 4CVXA 2C9RA 1H3UA 4RGOH 4HHAA 3QNXA 3FTWA 1YY9C 4YNYA 3MGOB 3P3SA 3VX1A 1RZIA 1BSIA 1L6XA 1MFNA 3ARGB 1L7TL 3MLXL 1Q72H 3LPWA 2J8UE 2F8XC 3N43F 4MJIE 3AU1A 1XZWA 2VABB 3D33A 2F54D 4G8IA 3RY5A 3MODL 2ICWB 4GRLC 4WWKD 1IGFL 3I6LE 4R3SB 4YR6B 5HY9A 4LLUA 4AEHL 1CMOA 4X4ZA 3P11H 2Z9TA 4XPTL 3B6SA 4Y4HD 1KTLA 3E6HA 5L6YL 4N0CC 1J88A 5C0CB 4NGHH 5JW3L 2N7BA 1PY9A 4LAQL 4ZMXA 1QZNA 1JHKL 2D3NA 3KWXA 2VDML 4HG4K 4HGWB 2FAUA 4LRNL 2Z7UA 1RK7A 4B53A 3JWNG 1DJWA 3CFQA 1R0AL 3I6SA 4PD4K 4LQFH 2KPNA 4R96B 4RISH 2D9CA 3MV11 4MD4B 4UZUA 4ODWB 5D71L 5A2KH 3CVDA 3LVEA 5I8CA 3CX5J 4D94A 3IBOA 4X7DC 1NC4A 4CC1A 4S0SD 2OPCA 2AKRA 1JE6A 1RY7B 4YSRA 4F7PB 4PRHA 1UM4H 2OCFD 2G3XA 3PHSA 4L8SA 1N0XL 3QT2A 1FAIL 2LOEA 4FN0A 4DW2L 2B8OT 3UGUA 2Q7YA 2R1YB 1URLA 2G9HB 3RZCB 2BINA 2OMUA 4EXKA 1SRDA 4PU2A 3ILQD 2DDQL 3DGDA 1X4ZA 4RZCA 1LNUB 3GK8L 3QDJA 1G6RA 3R7QA 4ZMTA 1ONQA 1GC1L 4JRXD 5EC2A 4IOIA 3L1OH 1KJ3L 5TH2B 4Q9QH 3M46A 4U1NB 3U30C 4JO1H 4F2MB 2RFXB 2V9TA 1L9MA 1F1DA 1NH6A 4X5WB 2FZ3B 1TSHA 3DIDA 4M61B 1WFIA 3BUBA 1IQDB 4QRTA 2MH4A 2I60L 2Q7NA 4N8VB 2AZAA 4R97C 1JYNA 3QZMA 5GPRA 1DJYA 1V55B 2O30A 3GHEH 5TF0A 3QUMA 1T21B 3MLRL 1L0QA 2Y69B 4QTIL 1H0DB 4FLOA 1OIOA 5FYJE 2FX9H 3KDPB 1Z2KA 2ZX6A 1OP5H 2VAAB 5JMOC 4U1GC 2V0AA 1M2VA 2VWEE 3BP7B 3PUUA 2KPWA 1CLYH 4H8QA 2WB7A 3O3EB 4PLKC 1KIUA 1C08B 5HJGA 4QYAA 1ETA1 2WTRB 4ZMNA 1N5YH 3MRNA 4KVPA 1A2YA 3MV7E 4FQ1H 4UTAL 1TJXA 3PDOA 5FUOH 5HHXL 2NNXA 3L95A 3ZHDA 5KZCD 2ZWLT 3WY3A 3B9KB 3GSQB 4HAKA 2GAZA 1FV1A 5ETUA 4KNQA 2YPKB 4V2CB 2W94A 4UIMB 3U9PL 2YAHA 4DP7X 1HHIB 2C5DC 2D4DA 3C60B 3CFBA 2B14A 2B1OA 5EC1B 4XMKL 3KBFA 2EKSA 4AQ8A 2OJZH 4K3EL 3NZ8B 3LKPB 1UT1A 1QHOA 3L3OB 1VGEL 3SDCD 3GI9L 1HH6A 4FZ8L 4JO4H 3GSUB 3IJ9A 3LQAC 5DHYB 1QG3A 1RVFL 3KPQB 4OJEH 2OTUA 5DYOA 1N4XL 3EOYG 4I89A 4HOZA 5K9JH 5DD3H 5ICYB 4I13B 3O8XC 4U3CA 4ZXBA 3GNML 3BRFA 1JXKA 4PJGB 2XICA 4BV1A 5DQ9A 1D5ZA 3EYSL 3ASWA 3SE4A 2BNQB 4MRCA 1OPGH 2ZUTA 4ALAC 4YFDB 5HDQL 3M1BB 2JJVA 1QOKA 3FF8A 3GGWB 5HJBA 4B0MB 2I9TA 5HPMB 4OKVB 3FSVA 3MACH 4L3EE 1NUNB 2IWKA 1RURL 3AXIA 4TMPA 2APTA 1DVFD 4TLSA 4E0RB 2A4CA 1R6VA 5EZIL 3K6OA 2BP0B 5E56A 4NRZA 4JG1H 1PS3A 4YWGH 1OB0A 2J43A 1J8HE 4LCWA 3FU5A 1ZGLP 3QUYD 3LX9A 5I8KH 4S1RH 5JHDB 5J1SC 4XVJL 4QHKJ 4F7EA 3V5KA 2ZOUA 1BFSA 3CE1A 4JN1L 2Y5TA 3DX2A 4XXDB 5KYXA 1OP3K 4XRCB 4BCXA 3S35L 3WFCL 2UZYA 3GMNA 2E74C 2UVFA 2Z65C 5DRZB 3T2QA 2XG4B 5T3ZE 2DF3A 3I6KB 3GLZA 5DJ2A 4AEEA 2Y25A 1RP8A 4OD3L 1NDTA 5ID1B 2OMZB 4YSPA 5J7CC 5I24A 1I85A 4WI6A 4FTDA 1PX8A 4PLOB 5GS1A 2F0CA 5E5RB 1IAOB 3G5XA 1YEEL 1QI3A 3ZDWA 1XH0A 3DBXA 1L0XA 5D7LD 3T2PA 2AXGA 3WFBH 4DVRL 1OCOB 5I5JA 4CA4A 1RMFH 3O41B 4FFYL 3WNNA 2GK2A 1IBZA 3BZ5A 3MRGA 5DJZA 4WZ9A 1T1XA 1VEPA 1AVAA 1KN2H 1RSFA 2Y7SA 3C08L 3CLFL 3GD1C 3IB4A 3OKKA 1FVDB 2Z4TA 1LQBC 1RV6X 2VM9A 2WSDA 3LZRA 5IMOB 1A14L 3G6JE 1I9IH 2OLDA 3X13A 1ZLUH 4LZKA 1BQKA 5HI3C 1TFPA 4OJFL 5A2IH 3DSNB 4TL5A 2Y5EA 2CO2A 3DHMA 1MDAA 4WO0A 4TSAL 4XCYA 2DTML 3WEXA 2X4PB 5HHOA 1EUTA 5KVMC 5DHVH 3RWHA 3CZEA 1YEGH 3MO1A 2CM6A 5B1JC 3VFNB 2F58L 5AWNH 3D3VD 5TQ0L 1JWSB 3WNPA 4YXKL 4DGYH 2X89A 3H2PA 4M6OL 3WXVL 4HOMA 1JHLL 4GSXA 4OZHA 4ZAKD 3WN6A 4RGNB 3X1FA 2AK1H 1XB8A 5D1ZB 3IF1A 3O9WC 4HJTA 4U6XB 1YEHL 4K55A 4NT6B 2WV3A 2XC8A 5DR5L 3ZYZA 1P9MA 1ITBB 3QC5X 3CHQA 3FT3A 2BS9A 1NEPA 4OCMC 1M6OB 4G8GD 4HS8H 1TVDA 2R69H 3U46B 3R06A 5K39A 3ZZSA 5IVXA 5E08H 1PZ5B 5CM1A 4KX9A 2A0LD 3O11B 3TTYA 1BYNA 4X6DA 2QHLA 2PN5A 3G08A 4QAMB 1MCRA 1Q9KA 3U30B 5CCJA 3G5VA 3HUJA 1JRHH 3HPLB 5HHMB 1P7BA 2DY2A 5BS0E 3ELQA 2ZPKH 2HFEA 3KWVA 4R97B 1LO5B 4J1UA 5FYKD 4PGEA 3HCVA 1EZVX 4PJDB 1AKJD 2X70B 1EMTL 1WS8A 3GIVA 1A7NH 3O6ML 2XWBA 3PPEA 5KSUA 3IFOA 1J05A 1TZ8A 3NCYP 2Y72A 4IRJA 5F9WC 1CD1B 4PV8B 4XNMB 5I1HH 2CQVA 3V5DA 2BVYA 4GMTH 2WM0A 2IOIA 1JPGB 2XQYA 2FWOB 1UD6A 4MMXA 4ZUVB 4JUTA 4HJ0D 5M94B 4BZ1H 2VQUA 5E7BA 4G6FD 4W1TA 3T6XA 3D0LB 4JLRA 2FR4A 3FSOA 4LPXA 5H94A 1ZA3A 1J8KA 3MBEA 1AC0A 1OTUC 1OXYA 2AXFB 2EEDA 2R2EA 3OPUA 5E8NA 1IZKA 1IIKA 3QDMD 3TBTB 1DBBL 4FMKA 3EGSA 1UXSB 3VXMB 1NCDL 2CUAA 3HC4H 2ZONA 3VGHA 3IETB 3Q5OA 4LHUA 5FGCE 3C5ZA 5AW6B 1MFBL 2MKLC 1AZVA 5HGDA 1EAJA 5DZOA 2WJ5A 1AR1C 3ZDYF 2BERA 4IRZA 3ZRSA 4XMZA 3KJ4C 4ZMZA 3DA0A 3LS5L 4O5LL 4J8RA 4QXVA 5HYIA 3HR5B 2KUTA 5I19H 3VFGL 5GRVK 2OKMA 1ZIAA 1U21A 4OFDA 2XBDA 4NZ8A 5I17B 3PRZA 4L1DA 4TVPH 1UURA 3PXHA 1X9RA 4JHZA 2MTPA 1KWGA 1P1ZB 1UENA 2RD0A 1EPFA 4F27A 1UWEL 2XN9D 1UA7A 3I9PA 1XGPB 3LZOA 3SDXE 5MP6H 2O26U 4JPKL 3UAFA 5KVDL 3CLEH 3VFPB 3LNFA 3HJ0A 1A5FH 4YX2H 1X5XA 4YLBA 2NY7L 1UD3A 1NJ9A 1R3JB 5KG9B 1MCHA 4UYQA 2EDNA 1SOSA 4ZYKA 3JSSA 3Q13A 2NY5C 1JAEA 2YUWA 3O6FC 5F71A 4KAQL 5LAXA 4B3EA 1Z9OA 3JTTA 4M7KH 4JFDB 3ZMNA 4E41E 4HU2A 1EJOL 1R3KA 3S5ZA 4JQIA 2CD0A 3ZZQA 3MJ7B 3ECBB 3H53A 4A1RA 4H2AA 3T0BA 1H3PL 3AY4C 3ZDZF 4KH2A 1VSCA 4CMHC 4DKFL 2GC7C 5GRXG 4HW6A 1JCKA 5C07A 2DBLH 5FYLE 4YDKH 1WFMA 3UTTA 1MREH 3TO4D 3ZDXE 3FYEB 1XGYH 1H3GA 1NEZA 4UM8A 4WKZA 1ID2A 4PLNC 2ZX8A 2B5IC 1LE5B 3IKCB 1NC2A 3CFCH 4S0TD 4ZW5A 4G6ML 5IB2B 5D9SB 3QXWA 1DANT 3QDGA 2JJSA 4K71C 4EE2A 2GHZA 3MLPA 5AVVB 3H3PL 5GJTL 2XIBA 1AGDA 1ORQA 1PYWB 2CIKA 4PV9B 3TCLA 1YQVH 2H26B 3RFZA 3PL6C 3PE9A 3QEQB 1OARH 5BQ7B 2YPVH 2GKIA 2VR4A 1RUAL 4BFNA 4K9EL 4OGXH 4MQ7A 5DMKB 3WIHA 3RI5K 1PCSA 2BFVH 3ARSA 1IEBB 3VMOA 7FABH 3SQRA 2IG2L 4ZG1A 1K4CA 2HJFA 5C0DB 5I9QC 1Y0LB 2N4IA 4NQSA 4EQ3A 3BFOA 5LGHL 3F5WA 1H3TA 2XACC 4EN3D 5KSBF 1H8OA 3DHJA 3FOMA 4ISVA 2CIIB 1DE4B 4JFOA 1R46A 3KNBA 5AOMA 4K23H 3BVDB 4N3TA 4TOYH 2VISA 2OSLA 1NCWH 3KGRA 5F7DA 2BFGA 3DO7B 4N4YB 3GKWL 4LLYB 4MJHA 1BQLH 4YBLC 4XHJD 3L9RB 1KCKA 3IFNL 4Z7NB 4WW2F 4W6WB 3WYRA 1HYSD 4KVCL 2CHXA 5F7MC 3HS0A 1DDTA 3JWOH 4KO6A 4X5XA 2WYZA 3L7FA 3RWGA 3UEQA 3IDUA 1IGJB 3GEWB 4HT1L 3SE9H 2Z7ZA 3D39B 4H8PA 2D3JA 1JMXA 3HE6A 4ESKA 4MCZB 2YAPA 1TMCB 1DBAL 1Y6KR 3O9WB 3LZFL 3T4YB 2DQGH 2MQCA 2VN4A 4WU5A 3S9DB 2EVJA 3WNKA 1M7DA 1MFMA 2BJMH 4M62H 4XO8A 4CJ0A 4ZX3A 4NKMA 3KPMA 5BUPA 4GSUA 3VDBA 3DYMA 3IXAA 4HEPG 4AE0A 1WBXA 4AGPA 3BEWA 2XKNA 3KPRA 5T3XL 2Z31B 1JCVA 2YMXH 4OM1H 4KMTL 5E4EC 4LLVB 2KMWA 3G3LA 2ZX9A 4XBGB 4XN1A 2DWYA 4F2FA 1P7KA 1F97A 4ODSH 5HGBA 2F5AH 4X8GA 4ANVA 3BIAX 4YIQB 2R2HA 1FL3A 1IAKA 4LSQL 5F9WB 5ICXA 2WVVB 3OXRA 3O2DL 1XVSA 4YHPB 5E4AA 4YXHH 1L7TH 5GGRY 3U36A 2C9AA 3MLXH 5C0GA 3V4PB 3QEGL 5D1XD 3L3IA 3ZHNA 5EO1B 3DV6A 4KK5C 3ZMEA 1WZKA 3MODH 1RLBA 4UCFA 3VAEA 1BEYL 2AXHA 4YDVB 1IGFH 4HD9A 3NZHL 4AEHH 3CFIC 1ZA6B 5EUOE 2VLKB 4XPTH 3U25A 4LOUC 1EEZA 4G3YL 1E67A 5L6YH 3NSFA 1YN7B 3HLAA 4NKOB 2CKBH 4NDMA 5JW3H 2DQJL 1M9WA 4LAQH 4OLZL 1JHKH 4JHWL 1IE5A 1U3JA 4MWFA 1B2YA 4M4PA 5AOKA 2VDMH 1ZVSB 1AR1B 4LRNH 3KJ4B 3FZUD 3ALPA 3LB6C 4CUCA 4O58L 1R0AH 4G1MA 2J1KA 3ULVE 4FNSA 4MJJA 4P2AA 1A8JH 4PRAA 1P1VA 2I07B 1D7DA 3V5HA 2X4RA 4CVZA 1A1MA 2I26N 1WIPA 2XWJA 3D85A 5EULV 2NYKA 1P4IL 2GJ6E 2QLVB 2FIRT 5C0AA 3T0WA 1P7QB 3FU9A 2ZSVB 3DMMD 5GSRB 1NFIB 4HU8A 3BH9B 5K9QI 5E9DB 3HVNA 3LSOB 5AVZB 2HVJA 4JDZA 2W1NA 1N0XH 1HOCA 2GT9B 2IH3B 2PYEA 2J5WA 4Z7VE 4DW2H 3LEYL 1IGTB 4Z76A 2H2PD 1MAKA 4XE0A 1MHEB 3GXTA 1R3IL 2DDQH 3AS1A 3BAJA 4Z3FA 2VO8A 3RTQA 3B9EA 1AGBB 4L2YA 2Y1ZA 4XOAA 3HRZB 1GC1H 1XGZA 5DVMA 1TQSA 1KJ3H 3BMVA 4LEBA 1R3HB 4OB5H 1CXEA 2VB5A 5DJ6A 3ARFD 2HTLD 1MY5A 4IK6A 3TFKD 1E5ZA 1RZGA 3VXPA 2BVEA 4BE6A 4HS3B 2JSFA 4XTRD 4BRJA 4N2MA 4CMHB 1O0VA 2I60H 3E8UL 3TIDA 1RJLB 2EUWA 4XODA 5B1KA 2QELA 3MLRH 2X9ZA 1NEUA 2FJHB 1LVEA 1ZJAA 2K8QA 2NYZA 3IJ7A 2OMBA 3KCWA 3T3PE 4AL8L 1XF1A 2B5IB 3T8XA 3IFPA 4DZBA 1EXGA 4H1LH 4CADA 1QKZH 3DRTA 3E6FA 2G60H 2VKWA 3BE1L 2CPUA 3GF8A 3GC3A 3FSZA 3UC0L 3LKSB 5E9AA 5H4YA 4GBXD 3PU7A 4GG6B 4FXGC 4UTAH 2P8PB 5SWZB 2JI2A 3PL6B 4K2UL 3CFDA 2IPUG 1A3ZA 3TNNA 2BOBB 4QRUB 4ABVA 5BW7A 5HHXH 4WFFD 1MHCA 3T1FA 4BQ9A 2WAHA 2FVNA 1PZUB 4A37A 1JVLA 1YQ2A 3U9PH 5G55A 5I9QB 5HI5C 3AT9A 3TFBA 3MC0A 4XMKH 5GS0D 4NX0A 4K3EH 1RZJC 4U7KA 1VGEH 2HT2D 1JV5A 3GI9H 4GW4B 2ZKWA 3P3RA 4FZ8H 5LUMA 1JPFA 1UZ6F 4JE0A 5GRJL 1I8IA 1RVFH 2IV9A 4M4RB 2APWA 4YDIL 2XZCL 3EOAB 4P57B 4ZUTA 1G9HA 1N4XH 3VMNA 3MZGB 5J6SA 1G4RA 4PJCA 3GNMH 2ED7A 1FYTB 4F37K 1ZGLM 1S46A 5I75C 3TS8A 2CBMA 2N59A 1R33A 3NEXA 2C9SA 5DUPH 3EYSH 5ISZA 2FL5A 4FL4C 4OGAC 1I8LA 2NRDA 3RUGA 5FO2A 4KOBA 5GISL 3V10A 1BVNT 3RWCA 4Y4FC 2IGFL 3FO2A 2Y7QB 5IOPA 5CP3A 4P9HC 4QRBA 1W8NA 1LEIA 5AL0A 1RZPA 2MNJB 1FGNL 2EXWD 4URTB 3KWTA 3OG6B 1RURH 5KS9E 4C58B 5E1AB 3FCUB 4NC0B 4R7DA 4X6CF 3S7GA 5KTEL 1LWRA 5EZIH 1KWKA 5D7JA 4PRNB 3MLSL 4YFEA 2WVTA 4H26A 2VZ1A 3EZJB 4J3OD 5CEZE 4NQCE 3RVVC 5E4EB 5L2KE 1EFXA 3AREC 4O2EB 3QQ3A 3TYFB 3UJIL 1D2PA 3UTPD 1FG2B 3L9EA 3QORA 2YC1A 5GSVB 1X5IA 5CZRA 4NO3B 4OQ1A 5E7FA 5FOBA 2VR5A 2ITFA 2VMEA 5C0BB 3S35H 3UACA 3WFCH 4YSSA 1OOAA 2X6BA 1VEOA 4PJFB 2ZYSA 2XY2A 1AXIB 5KOVC 3U1SL 2Q87A 1JL8A 3BLPX 4M5SA 3FUKA 4AYID 3I9GL 2NNCA 4Q6YA 1FVEB 3F7VA 3D34A 5T1KD 5SX5K 4F58L 2OYPA 4QXTA 1B0GA 1OAZL 1RUKL 1TENA 5D4HA 3VO0A 1F2QA 4A6YB 4BQCA 4DVRH 1A4KA 2X4SB 3EUUA 1VGKA 4PRBA 2Z8RA 2W07B 2GYSA 4FFYH 1NM9A 4GRLD 1A3LL 1FZJB 4TN9A 1DFBL 3CLFH 3IAPA 3HI1B 3E9UA 3MOQA 4L4TB 1XF5B 4N2CA 4FNUA 3GBNL 5C0RL 4N0CD 3C5SA 3IWVA 3HZKA 3QHFL 5BZWB 2VSDA 1KZYA 3FN3A 1CICB 2OZNA 5ESQB 4Z8FL 2K3TA 4PJ8D 2K6YA 2PXYA 4HKXA 4OJFH 4RAVB 1A7RL 4ICXA 4D7BA 1YEIH 3CSPA 3PABA 4JM0A 1HNGA 1T7XA 2DQCL 3TEXA 1V8HA 2C3VA 3NFNA 2DTMH 3P1VA 4AJYV 3VXRA 4JVPA 4NZTL 2F58H 4EIZC 5BXFB 3UBXG 5TQ0H 3QXAA 1Q1JL 3WXVH 1S4IA 2XVBA 3VXSA 3WLBB 1JHLH 4JCLA 3MV8A 2E56A 3F6JA 4O51B 2APFA 5DRXB 5DR5H 1YEHH 1EDQA 2Z1PA 4JZNA 5EF3A 3O4LA 4DAGL 3SE6A 3CVHA 3KGTA 5E6UB 3VG9C 3PWNA 3CUPA 4IU2A 1PQZB 2HRPL 3H85A 4I3SL 4Y2OB 5F0LB 3T8VA 2IDSA 1OP9A 2MWCA 2DIJA 4ZX6A 1EH9A 1XWVA 3ES6A 1YEWA 1LP9E 5IMKA 1E3FA 3O6MH 3RA7H 3QQNA 1NPJA 2RTTA 1U8QB 1KIPA 4JHBA 4M7ZC 4KZCA 4X4KA 2I32A 2VXQL 2A6IB 4JE4B 4U49A 2WLMA 2VDPL 3LQZB 4NPJA 3TURA 3N42B 3CN2A 1VCBC 5EU3A 1INEH 1JTTA 4ODXB 3RX7A 3CZJA 3NJHA 3V6OE 3VM5A 3Q3GA 4LSPL 4G42B 4NCC1 1MWAL 5AVTB 4Y5XA 4NENB 1C16B 3A3YB 4FXGB 4XPAL 2I9LA 3LH8A 2JXMA 4PLKD 1ZK5A 1BBJA 1DBBH 1AIFB 4N26A 4CU7A 1NCDH 3MCKA 1SYVB 2X4NB 4XX1G 4A39A 2IH1A 4HJGB 1MFBH 4XGZB 1X6NA 4HP5A 1QSFB 2WNGA 3JTBA 3ZE0F 3ZT7A 5IREA 1M3IA 3W9EA 4ZW8A 3GSOB 4GO9A 3LS5H 4O5LH 4JM4H 1NUGA 1UJTA 4JFFA 4JG5A 2ZICA 4BFJA 4XVTL 4HUVA 3FFDA 2JQZA 2G4GA 3VXTA 4QF1B 4MA3B 4NO2A 1UWEH 1JF5A 3QPXL 1DSWA 4MNQD 5I75B 1I1AC 4PG2A 4A04A 1M9SA 3ZKQD 1FFRA 5DD1L 1YUHA 4BSVB 5KVDH 3D9AL 4FL4B 4JGUA 1JZEA 3O8XD 2VIRA 2NY7H 4M3JA 1L5GA 4Y4FB 1NCGA 1RHHB 4L8SC 4QTFA 2EUVA 3FQ4A 3MGTB 4IEFB 4B9KC 1QEWA 2BOLA 3T77A 2NY2B 3WUZA 1UB5A 1J5OL 2B2XL 2WOYA 2Y2TA 1NBCA 2UVEA 5E2UL 2CUMA 3P0VL 3EH4B 2G75A 1EJOH 2HRGA 3X3GH 1XSJA 4ONOA 3IU3B 3NN8B 4MB5A 5CSGA 5CEXA 1INQB 2IALB 3DDFA 1PD0A 1H3PH 1XV8A 1BD2D 3W0WE 1M7UA 5HDOA 2CCVA 4DKFH 1M42A 2V8LA 1DLFL 2CO6A 3BKML 3SPVB 3CDFA 1OE3A 1MFEL 3MFGB 4XAWL 5AVXB 4MD5A 4MXWH 4Y7MA 4QO1B 4PW4A 4GUOA 1S8DB 1ZCRA 1J5DA 1HINL 1CBJA 1JV2A 1PAZA 1QVOA 3DVNA 2F54E 5FA4B 4C59B 1IQWH 2XWTB 4PJ7A 3COOA 3E3QC 4HMCA 2YBRA 5HP5A 1JD7A 2OMWB 1ZWIB 1E4WL 5IW6B 5I0YA 2GUOB 2UZXB 5BVJA 1U33A 2ZX5A 5FXCH 4NUMA 1YUKB 3V0JA 3QQ4A 5LG6A 5ADPL 5CHNA 3ZGIA 3UEZA 1JZ5A 4MSWB 1RUAH 1X7QA 4K9EH 4M03A 3T0ED 4LARH 1F8TL 2DI7A 1KCRL 3EYOA 4N2HA 3U0PB 3SYQA 3OGOE 5K33A 4K7PY 2IG2H 5GGRA 5C2BL 2LW3A 1KENH 1WV7T 5LGYA 3ZE2B 4Y16A 2EC9U 3QYNA 4K15A 3HFML 3CGTA 5LN4A 5JIMA 1NANI 3BSHA 3PGFL 4WHTA 3KXFD 3FTGA 4G6JL 3Q8EA 1HHKB 2W65B 3ARZA 1T1WA 2IXQB 4OZFH 4AQ8C 1ZHLB 2Q76A 2EILB 1S9YA 3DX7A 2F74A 3PNWB 3AM8A 3S5LB 4V33A 4HOXA 3TEYA 4KVCH 3KVQA 1HWHB 1P84K 3VQLA 1FZOB 2ZCLL 3IJEB 2FEDC 3UDWA 1KJMB 4HT1H 3FRPB 1TEGA 4GUCA 5D2LE 5AAMC 4V11A 1SPDA 4Z7WA 1KEGL 1MCWW 3SE4C 1OLLA 2P5WB 3MRJA 4UQAA 5LGJA 5DJXB 3LZFH 1HZLA 3RL2A 3QA3B 4FEIA 3SBWA 4M6NL 2OTWB 2YN3A 4TUOB 4W6XB 3SJVE 1AO7B 2CBTA 3LZNA 4FG4A 3UGXA 1NDMA 1ORSB 1QUNA 1WE5A 4OF7A 3VG9B 3TT1L 2F1BA 2QQLH 1JBJA 4KNTA 1YJDL 5T3XH 3TBYA 4KMTH 4A2FA 2WP3T 4MBRA 3ZHKA 1KXTB 4YZWA 1UOWA 2R2BB 4A7SA 2QZ5A 3ET9F 1CC3A 3ZTDC 3GXNA 1GPOL 5DMYA 2R56L 5DFTA 1T7ZA 4PSRA 3VTTA 5JIDA 1KMGA 4AIXA 1KT2A 1O75A 4LSQH 3U6RB 1MRFH 3MRRB 1NIFA 5IEKA 1YC8A 3UTZA 4XN5A 1OAXL 3DV4A 5J13C 3VWKA 1MFUA 1S5HB 3P77A 3QEGH 1WF5A 4CVXB 2FLMA 3R0NA 4BFIA 4HHAB 3QNXB 4L8CA 2KERA 4YNYB 1RZIB 5HI4D 4DFHA 2HKAA 4YHZH 1UM5L 1RAMA 1BEYH 1I85C 4L5FH 4I9WD 3WTYA 3D48R 2HVKB 5GS1C 4JN2A 3NZHH 1H9DA 3AU1B 2J5LC 1J5CA 1UACL 4G3YH 1KY7A 4G8IB 1OTUD 3EZ8A 3FN9A 2DQJH 3QJZA 1ASQA 1O7DE 4OLZH 3QUXA 1JG9A 2VLJD 1QI4A 4H8WL 1TLMA 4FQLH 2YZ1A 1KGJA 4JHWH 2C3HA 4LLUB 1QFHA 5HY9B 4PBXA 3B6SB 2ROXA 2B39A 1KTLB 3E6HB 4MJ6B 4XT1C 2YN5A 1CFMA 4YVNA 4O58H 1PEZA 5FA3A 4P2RA 4UNVA 4RWHA 1YNLL 3IDNA 4QXUL 2FJFA 1DQLL 1EZLA 2AC0A 2B4CC 3IU4L 2WWNA 3MUY1 4PWKA 1P4IH 1U8OA 5IROA 2DWSA 4C55A 3IMUA 2N7SA 4G7SB 2V6HA 5I8CB 4JGNA 3H9ZA 1HE7A 4IBLT 1NC4B 4Q9RH 3LEXA 4PG9B 2CLRA 2XQYK 2AKRB 3LEYH 1SEBA 2IWFA 5EH1A 4PRHB 1FO0L 1ZANH 5EOQL 1PZ2A 4L8SB 4MQSB 4LGPB 5GZNA 3KJ6L 1TZGL 4LSVL 1T6WA 3ESVF 1TEFA 2J57A 2CGRL 4NWTL 2OMUB 4P23D 1X5LA 3O2DA 3U1PA 2L3BA 2IDCA 2JV6A 4RZCB 3SKJL 3VD9A 4CU6A 1LXMA 4G83A 3QDJB 4CW1A 1G6RB 1I1YA 1WFJA 3O6FD 1ONQB 5EC2B 1NOLA 4N2KA 4IOIB 5GGTL 4GAYA 3HG3A 1PY4A 3D5OF 2LQRA 3DXAA 4PWHA 5ALCL 4MDJA 3VGFA 3CFTA 1KTDA 2BWQA 5FIEA 3WN5C 4QRTB 2X0UA 3QUKA 3PQYA 4AL8H 4OZIA 1OWRM 5J8OA 5D7LE 2BSTA 2FTAA 4JFXA 3K6SA 2FEJA 4XC1L 3QUMB 4WO4A 3MU3A 2EAEA 2YWZA 3BE1H 1F02I 5LVEA 2YOAA 2Y2YA 3CSFA 2VH5L 2CJUH 3PS6A 4CSTA 3UC0H 2WXIA 1M2VB 4XBMA 4YDJA 4F92B 3X12A 5I0WA 5IM7A 2V2TA 4K2UH 3D52A 3CVCA 1KIUB 1D7FA 3GXPA 3RVXD 3S36L 4RA0C 5KVGH 3F04A 4JFZH 4PJEE 2JFCA 1BYOA 3MRNB 4LK4A 5DUML 1M1SA 4ANWA 1KFGA 5L4JA 2XWZA 3B8SA 3PDOB 2JQMA 5F44A 1E5YA 3L95B 1U3HD 5IJCC 4N1EA 4LNRA 2GAZB 1FV1B 5ETUB 1B4LA 3C5ZC 2HYMA 3UTSD 1OGAD 4Z7OF 1T5KA 3BVTA 5DD0L 2Y3NA 4OQTL 3RGVD 1B90A 1OGTA 2XKSA 3CFBB 3L4TA 3D3VE 1WDAA 2E4TA 3JBG7 1RIHL 1YYLL 4FYSA 5GRJH 2VJ8A 4MYPA 2EKSB 2VC2H 2ZXDA 3SQOL 2CH8A 3GRWL 5EEXA 25C8L 1HH6B 2Q3ZA 3REVA 1AQMA 3LS4H 4QRSA 3KZ8A 1C5BL 2IOOA 2OTUB 1J7VR 1ED3A 4G8GE 5D6DA 4F3FA 1FNFA 2VZUA 3F7LA 1A6AA 3N1MC 2BIPA 2BY2A 5GISH 2J4WL 2XFGB 4ZXBB 5JDJA 1HH9A 5DQ9B 1D5ZB 3KPLA 1FGNH 4HD5A 1GKOA 5HVHB 3OZ9L 4DEPB 5KTEH 2I9TB 3MJWA 5FYKE 2NY3C 3FB6A 1T6VN 3BGMA 2ZUUA 4JM2F 3MBXL 4NRZB 3RKPA 1S7XA 1ADWA 1H6UA 3C2SA 3KLSA 3FO1A 4M48L 4M00A 3PCYA 1T03H 4LCWB 3UJIH 3TTSA 3JV6A 2PW2A 2P1YA 2DQ6A 2ZWKA 1JNNL 4QUOA 2BP8A 4WENB 1R75A 2IV8A 1RZKH 4F7EB 3V5KB 2EYTA 2Y5TB 4P2QA 1M53A 5C0BD 4IQHA 3U1SH 5KYXB 2UZYB 3V0GA 3GMNB 3I9GH 4K3JL 5GHWL 5BV7L 3G9VA 3EADA 3PDDA 3ZU8A 2HB0A 5DJ2B 4F58H 1NOFA 1OAZH 2EINB 2KDGA 5CGTA 3HNSL 1RUKH 1XL4A 2JJSC 3RKDD 1U58A 4NBYB 1MAMH 3RFZC 3WD5L 5GS1B 3F7KA 2XZAL 1HEJC 3G5XB 3ARTA 1SQ2N 3DPBA 3FTXA 3QR2A 3DBXB 4F57L 4K5LA 3RIAK 5JPNA 3JWDC 2AXGB 1A3LH 4LL4A 3C8KA 4OJDH 4NPKA 2NX5E 5T1LD 2OMYA 4BFOA 4LOUD 5LJYH 3MRGB 5DJZB 1T1XB 4H2CA 4XVOA 2J1YA 3QHFH 1EZUA 2EDOA 2FX8H 1CGVA 4Z8FH 2WQWA 3OKKB 1GYAA 1WBZA 4AITA 3DRQA 4MCMA 5BOJA 4M1CC 1A7RH 2CXKA 2AJSL 2QPSA 4Y1AE 3X13B 2PWFA 2DQCH 4QLWA 4ODHH 4GLRI 5J5EA 2EE0A 3W11D 1TITA 1QRND 4JGJA 5AW8B 3FB5A 5I1KL 3R7RA 4EF3A 5IHLB 5D55A 3MRFA 4ODBD 1FFTB 3IMBA 4JPVH 1Q1JH 1LDPL 4JUSA 2FBRA 4XCYB 4MAYA 3WEXB 1I1RA 5F8QC 3QZLA 4QJ5B 3GUFA 5HHOB 3HS0C 5EWIL 2B1AL 3RWHB 3MO1B 1FCCA 3W5NA 1O6TA 2YBGA 4ENED 5FS5A 3PJLA 1UH2A 3MNVA 4FLQA 4MKTA 4OZHB 4KJWC 2WN2A 5F9AC 1G7QA 3PDGA 1X9UA 1CGUA 3IF1B 4JX0A 4DAGH 3ZRCC 2V8MA 1XO8A 2H7WA 3FT3B 1MLCA 1X7TA 1BJ1J 3OJ2C 2EQDA 2HRPH 3P2TA 5IVXB 4I3SH 3R06B 2ICCA 5K39B 4X8JA 4AYEC 4DP0X 3IVKA 2GITB 1OT4A 5DDHA 4XPGH 3TJHC 5D2NA 5AVYB 4O02A 4X6DB 4AXWA 3G08B 5ACZA 2WZ5A 1KTBA 1Q9KB 4DEWA 3G5VB 1Z5LA 3HUJB 4NP9A 2HFEB 4A2LA 3CH1A 4GNKB 4J1UB 1UD4A 2VXQH 3Q9PA 3HCVB 1JVKA 4NKDA 4PGEB 4BDVA 3SPHA 2VDPH 4AC4A 3BD5A 3G9AB 3GIVB 5KSUB 1LO4L 2XWBB 3IFOB 1J05B 3MREA 4IMLA 4IRJB 1NFDE 4ZFQA 3V5DB 4LSPH 2HFGL 4MMXB 2GC4C 5K59F 5BMFL 3QVAA 3CN0A 4JLRB 3L5HA 4CKVX 1BLNA 2FR4B 2QKIC 1SLXA 1ZA3B 3MBEB 3OAZK 3T3MB 3HVDA 2Q2LA 5E8NB 2R2EB 3JT0A 4XI5C 4NPYA 3EGSB 5IBLC 4EUPA 1MWOA 3IMVA 5JORA 3U4BL 2WBJC 2V5TA 3JWOC 4LHUB 3C5ZB 1MCWM 4LBAA 4LASH 2QVTA 1P84J 2OA9A 5TE6L 4NN6B 5HGDB 4OVUA 5HI5D 3OQRA 1NBYA 3GMOA 4FQXD 4XVTH 2IH8A 2VT0A 3Q8FA 3BPCA 3VFVA 4J8RB 1BFTA 2ZAIA 3OB0H 4XX5A 3RVTC 2XYCA 2ZG2A 2K0RA 3DJ9A 4ZFOL 3QPXH 5CIPH 1BDYA 1E30A 1DO5A 2EYSA 1PW3A 1AGFA 5DD1H 4AYBA 2EIBA 4RIRA 5J56B 1A6TA 4QJ4B 2ZG1A 5JXEA 3VTMA 4KXZI 2DL9A 1BOGA 5JQ6H 3IMTA 2Y1YA 3F00A 4F1SA 4H7VA 1JS4A 2B2XH 3IDIA 1J5OH 1SXNA 2WWOA 4JRYA 3CMGA 5E2UH 5HGAA 1NJ9B 3P0VH 3QULA 4XMWA 1J0KA 5LNDA 3ZRFC 4ZYKB 2NY3B 3RTQC 1WSST 4KKQA 4HKJA 1QFWI 2J8HA 2QVIA 5LAXB 5EIVA 4MXVF 3JTTB 2JCCA 1MH5A 4IOFD 4D2NA 1QNIA 1MWAA 1R3KB 2DQFA 4KHXL 1DLFH 3QUZD 3BKMH 5LCVA 1E2VA 4X9IA 4E9SA 2JE8A 4GS7B 1MFEH 4NWUL 3A4FA 1F58H 4XAWH 4K3GA 3RVVD 5C1MB 3UC2A 3DKHA 1HINH 3ARED 5C07B 1F90L 1IJNA 1IAII 2VXVL 4LE8A 1N2RA 3W1ZA 5GRYA 5IG7A 4N68A 3UTTB 1E4WH 2WK2A 5C3IA 1FHNA 1NEZB 4UM8B 1UWXH 1TYEB 4WKZB 1QPPA 1EDHA 1GJWA 4LIQL 5IQOA 1NC2B 1CVSC 2NR6C 3MVSA 3NVQA 3QJSB 2YUZA 1ZV9A 3B9VA 5ADPH 1PZSA 3QDGB 4HWEH 4F8TA 1AGDB 1ORQB 3TCLB 2CIKB 3RFZB 3SDDA 2AP2A 4D3CL 1AS7A 2AS5M 5BW7C 2H3NA 3RG1C 2P42B 1ECYA 5JOEA 1D7BA 1VERA 5C2BH 1T1ZA 4MQ7B 5CCGE 4BM7A 1WAAF 1G7PA 1GZHC 3WKYA 3HFMH 12E8L 3PGFH 3Q48A 4XHQA 1PIFA 4HLJA 2NYYC 4G6JH 1K4CB 2HJFB 3QYCA 4FNTA 1DVXA 1PX4A 4NQSB 3F5WB 1TTCA 3L54A 4ISVB 3FOMB 4KZEL 5T1MA 1PL3A 4JFOB 4OM0L 3KNBB 3ZE1B 1MCIA 2WUCL 2VISB 1RFDH 1XR9A 2OSLB 1L9TA 1FNGA 2BP3A 4UB0L 4ZS7L 1GC1C 5F7DB 3SCMA 4EIGB 5B3SB 1SEQL 1WH0A 1WC7A 1M56B 2ZCLH 5L7XH 3ARDA 4H1LG 2N1KA 3EF4A 5IVNA 4WTXA 2WLLA 2VCOA 3HS0B 4Q2ZA 5JW5A 4X5XB 1I8LC 1Y7VA 1QEXA 3L7FB 3RWGB 5CILL 2OAAA 1SN2A 1INDH 2IH9A 4M6NH 3HE6B 3BDYL 4MDRA 5EN3A 3FDWA 3EFDL 3MRLA 1AI1L 2LU5A 1SVCP 5I15H 3ZLQC 3TT1H 4GIPD 3AMLA 4WU5B 4Z7QF 5D7JC 2AK4A 3GSXA 1IAIL 1M7DB 3OMIB 4H8UA 4JJOA 4N2OA 1L6PA 1DSYA 3FMGL 4NKMB 4ODVL 3KPMB 4PJAF 1DVTA 1JFHA 4U6HA 3IXAB 4KI5F 4MXQD 2A2QT 1WBXB 2ATPA 3BEWB 2XKNB 4TF4A 3KPRB 1W15A 2PO6D 2R56H 2CA3A 1SXBA 3ULUD 3LD8C 1P7KB 3KPTA 4PMEA 4WFFE 3O2WH 1OAXH 3MV9A 4B60A 5HGBB 3AQYA 3DSFH 1XCXA 2R2HB 4B41A 5EU6A 1IAKB 3DX8A 5ICXB 1MFDH 5FWRA 1EIBA 4IJ3C 3OXRB 5BNXD 1TZOA 4W4OA 1EHAA 4UM9A 3U36B 3ORJA 1KBPA 5C0GB 2VQTA 3GS4A 1NANH 2B15A 2CAKA 1AACA 3S35X 4OVVA 3DV6B 1UACH 2AF2A 3EYQD 4HJJL 4LLAA 2AQRA 5KYUA 1BZEA 5EDSA 3ZKNC 2EZ0D 3OZKA 3GI8H 3O6LH 3DX1A 5J0BA 1EEZB 3HLAB 1L0PA 4NDMB 2WQ8A 4QHKI 2OL3A 2VR6A 1YNLH 4MWFB 2LGNA 3V4VL 4QXUH 3EGXA 1DQLH 3LEVL 3IU4H 4X7FC 5EV7A 2YRBA 4EI0A 4G1MB 3WE6A 1ZLWH 4YQXL 2ESVA 2PXYC 3FUHA 4PRAB 1L0YA 4OCSH 5EZLA 2NUPA 3V5HB 2X4RB 3IGAA 3IJYA 4CVZB 1AG0A 1A1MB 2XWJB 3T0VA 3D85B 3ZTCC 3DDGA 4JR9L 5C0AB 5E1GA 1ZXQA 1T7WA 3IAGC 2BVPA 3HC2A 1J18A 1FO0H 5FO8A 5I1JL 3VGBA 2X3CA 3OMAB 5EOQH 1I1AD 2HVJB 4JDZB 2JH2A 1S7VA 1HOCB 2PYEB 3BKCL 3MJGX 1H3WM 3KJ6H 1TZGH 3OBAA 4LSVH 5IB1A 3T4AA 3F6IA 4Z76B 3VI4E 3FH8A 1HL5A 4NWTH 4QY8A 2A73A 3UTPE 3EH1A 1Q0YL 3JYCA 5D7IA 3SKJH 4MQXD 5KJ4A 4KFMA 5CLXA 4PJ5D 5GGTH 2EH8L 4XN9A 1Y1UA 4FTVD 5MERA 4NUGL 5ALCH 5DJ6B 4I18A 4HDIA 4WFGD 4B7IA 5DMIL 5KJRL 2IWEA 2VZVA 3PWLA 1RZGB 3CZLA 1CTOA 3K8MA 4R0LA 3IJ8A 5D7EA 3VXPB 5DVLA 1XB6A 3TIDB 2J20A 2Y3AA 4KKLC 4Q9BA 4DGIL 2OFQA 4IU3A 3UG3A 2V3DA 3I02A 3KAAA 1XDTT 2BDNL 4XC1H 2ZUWA 3KPSD 3NMEA 3TN0D 1OAYL 1YPZA 4PI0A 3BLBA 3FTSA 1EDYA 4IKNA 3DTUB 4MB4A 3T8XB 3IFPB 4DZBB 4A68A 4XMPL 1BG1A 4CADB 3DRTB 2BC4A 3E6FB 1BZ8A 5HYJB 1CF8H 3NCEB 5AZEL 3S36H 5DURB 1BJ8A 2BNRA 1TEYA 4Y4KD 3QPQC 3L1EA 4UNUA 5D4QA 5DUMH 1MCPL 1JVOA 3Q9QA 5M95B 5DA4A 4J3TA 3KPPA 3CFDB 3TNNB 4IBWA 5F89A 3ELAT 2LU4A 1MHCB 1IGML 1NQBA 3T1FB 5IK3A 2XFXA 1XBDA 5GQBA 3AWGA 1KSRA 4X7TA 3ATFA 2O5ZL 3MBWA 3KWWA 5DD0H 4GXUN 4OQTH 2YO3A 4N0FA 1JGIA 5A16A 4R5VA 4A67A 1RIHH 1YYLH 3B2MA 4GAAA 1F4AA 2XTLA 4JKMA 3GRWH 4J23A 25C8H 3NCWA 1JV5B 5DZVA 1IC5H 5SWSA 5J12C 3F65A 1JPFB 1BFVH 1I8IB 2RGSA 1C5BH 4YSCA 2X09A 2QJDA 4ZUTB 4L1BA 5EZJA 3BVWA 5E8OA 1ZT4A 3JTSA 1GRWA 2J4WH 4PJCB 3F62A 2VM4A 2WOBA 5DMGD 1JN6A 5ISZB 2YD9A 4N8CL 2FL5B 4JY4A 3RQ3A 3K3QA 3N40P 3RUGB 5EF0A 3WOVA 2FEDD 3X17A 3RWCB 3FO2B 5IOPB 5LDUA 1LEIB 1BQHA 4TS6A 5IKCA 3LAFA 4MNHA 3IRCA 2ZNXA 4F7MA 5IBUG 4R7DB 4PJIE 1AS6A 2CK2A 3VFTA 4W9DC 4WEMB 5JQHC 4Y19A 5C2UB 3MBXH 4GW1A 3WTWA 4MS8D 4F7KA 2DI8A 2JLPA 2V17L 5ITFA 5I6PA 4H26B 5JW4Q 2R9HC 1UOLA 4N1CA 4TNWK 3RTLA 4W68A 1JNNH 3T04D 5IMLA 2GFBA 1PFOA 1Q1PA 1BX2A 3DUUA 2CG9X 1EFXB 4NRYA 1YAZA 1RJZA 3QQ3B 4J3WA 3SO5A 4BHUA 3O45A 3QORB 2YC1B 3LD8B 3BVUA 5FOBB 1LWHA 1CG9A 4POUB 1VENA 4DK6A 3H3KA 5BV7H 1QFWM 3OQ3B 1HN1A 1Z9LA 3QG7L 4M1GL 1D5BA 1O5DT 2EADA 3HI6L 3GPEA 4IJ3B 1TQTA 4BJLA 1X4YA 3HNSH 4UAOC 1E2ZA 4LVHC 2XI9A 3T0XA 2N3JA 1NAMA 3F7VB 3BQUA 1GTNA 1QSEA 3WD5H 2CM5A 2XZAH 4QXTB 1B0GB 3FAWA 1IAIM 4FA6A 5AB0A 1A4KB 4E5XG 1GA2A 1VGKB 3S4SG 3PREA 2HZHA 4PRBB 2MFNA 5JIHA 4G59C 1MAJA 2CRMA 4GI9A 1EBAA 3BGFB 5JHLH 5KVEE 1MY7A 2AJXL 3QISA 2W60A 4Y16C 1NOAA 1UQSA 1P0SE 1BM3L 5D1ZI 3Q2CA 3C5SB 2AJSH 2WQVA 3HZKB 1AD0A 3HB3C 3ISRA 2PXYB 4HKXB 2QT6A 3KPOA 5I1KH 3UYPA 4AENA 5E4OA 3RPBA 4E42A 3AM8C 1CE6A 3OLIA 3PABB 3QIBD 4PJGF 3KLHC 1LDPH 2C3VB 1A1NA 3F2LA 3NFNB 1U3NA 5EU4A 5A3IC 1BQUA 5EWIH 3VXRB 4YAQA 2FO1A 3K2UL 1G7JB 4RX4A 3A6CL 1GVIA 3QXAB 5EB9A 1BD2E 4WNQA 3UDWC 2EDWA 3VXSB 2VUKA 3MV8B 3D2TA 4JO5A 4KDTA 4DP5X 1KCBA 3Q5TA 5HTSA 1F6FB 2V5YA 5AOLA 1RUPL 2Y6SC 4PJXE 1CDIA 3SBWC 2IAMD 2O6CA 4JZNB 35C8L 1IKNA 3O4LB 2CE6A 2EEXA 3HBGA 4RCAA 3FT4A 2EDLA 2DJSA 3CVHB 1DCLA 3PWNB 3CUPB 4IU2B 1OK8A 4UT6H 1XF4A 1F4YL 1WZ1H 1OKEA 2P3YA 1VZHA 2CO7A 2P5EA 2A38A 2BZCA 3IMRA 2JJTC 3ZIYA 3HE7D 1HHJA 3TASA 4K9EC 5FDWA 3ES6B 5H2BA 3UIZA 2NXYC 3LRSA 5IMKB 3Q8AA 4PP2A 4UOW0 3AC0A 3WMSA 1KIPB 4G9DA 4NQDD 5IB3A 5ANME 2DQEL 2PPDA 2NW3A 2HFGH 3A4AA 4AGLA 1RUQL 4NOBA 2F5BL 1MZYA 3VWKC 4GO8A 2BMKA 2HWZL 1U8LA 2WXHA 5DHMC 2ADFH 3FULA 4OIBA 2BY0A 5EU3B 3KXFE 5I30L 1G4MA 3MOBL 3Q3GB 2YEZA 1OW0A 2OZ4H 3HMXA 3N1FC 4X5QA 1IGYA 3ESUF 3I3BA 4Y5XB 2YRLA 4PIBA 3VTAA 2WP3O 2I9LB 3ZX1A 2JXMB 5L8LB 3CDCA 2IPUK 1BBJB 2NTFA 3MCKB 3L1FA 4OBSA 4GLRH 3U4BH 3IYLW 1MI5A 2IH1B 4NKIL 2QQNL 2Y5QA 3QUXC 5TE6H 5I1GL 2XWXA 4HFWA 1AAJA 1FC2D 3H7LA 3BI9X 3W9EB 5F7FA 1CK0L 4HLEA 3DROA 3TV8A 1UZGA 5BOPA 3LN9A 2HAZA 3DOSA 2I24N 2K45A 3FQWA 3TA3C 2QZQA 2R51A 4JFFB 4BFRA 5D6CA 3U2JA 4HUVB 3FFDB 1YCSA 3EF7A 1CGYA 2F2HA 3GXFA 3VXTB 2DRUA 3BQVA 5IROC 3GBML 4LDLB 1WA1X 4FKHA 1X5AA 4NO2B 4YHML 3BZFA 5FW6A 2VAJA 1ZS8A 5KW9H 1S9XA 2VDQB 4WHCA 1FORL 3BHBA 1ZLSL 2P47B 1YUHB 5TK4A 1X5HA 2VIRB 2F7PA 3LTVA 3T2LA 1BCIA 1L5GB 3WJJA 4JRFA 3FB8A 3US0A 2GJRA 4OFQA 4R9HA 1GMIA 2I25N 1QEWB 3SZ6A 1T66C 4ADIA 3T77B 2H5UA 3OSVA 2FQFA 1UB5B 2H8PA 3V4UL 3HRPA 2CBPA 2WWKT 4Z23A 2G75B 4G8EA 3I50L 3Q44A 4KHXH 3Q2NA 2Y7LA 4IIZA 4WI9A 3FW6A 1GGCL 2JKIS 4LFHG 4ZOBA 5CEXB 4N2FA 4NWUH 3I3EA 1A4BA 1YMHA 4PRPD 2OCCB 1EJ8A 1Z5YD 4PJDF 2CO6B 1PKQE 2ZPKL 1F90H 4RBPH 2VXVH 5IEHA 1UVQB 4UINH 4MD5B 4C56A 1V3LA 5FAAA 3LQAL 3PP4L 3TVMA 5KBMA 4GG8A 1JV2B 1QVOB 3MKGA 3DVNB 2NDGA 4EI5A 4PJ7B 3V7MA 5JHBA 1ET7A 4LIQH 4WO4C 2GBVA 2VLJE 2YBRB 4KXBA 2F68X 4N9GA 5GRWA 4D9QD 1DHKA 1MQ8A 5BVJB 3N3EA 3QIUD 5DHEA 2LFGA 3ZDZB 4ALAL 1DQDH 1W0WA 3L9BA 3CDYA 4D3CH 3QQ4B 3S37X 2XZQH 1Z7JA 5CHNB 2E4FA 4OLEA 1X7QB 1YMMA 1Z6JT 4V1DD 1J0YA 2OP4L 4I0CC 2TRHA 2X5PA 5I76A 1WA2X 3VI3A 3EYOB 12E8H 4TVPD 2QBWA 5F1SA 3VD5A 4U3XA 2C8NA 1ZLVK 1F13A 3FSAA 5GGRB 4LOEA 2VERN 3WXWH 4QXGL 1JWMA 1PBYA 3AU0A 4Y16B 5CKGA 4KK6D 4R4FL 4AX3A 4WHTB 3MTXA 4OM0H 4G82A 3FTGB 4KXZH 3ZGHA 3IJHA 2RALA 4WWOA 1R47A 1UFGA 2WUCH 3NA9H 3QNFA 4ZPTA 3WIIL 4DKEL 3HHSA 1ACZA 4UB0H 1T1WB 1T5XA 4ZS7H 3HB3B 5F96L 2Q76B 5H37A 1QHQA 2YEQA 3WY4A 1S9YB 3DX7B 2F74B 1MJJA 4HCIA 3E9TA 3AG3B 1H5BA 5DA0B 4PGDA 1WAAA 1D9KD 2RB8A 3NIDB 5CJ5A 4TL4A 1QFWH 4ZNEE 5EEZA 4Y0GA 5F7WC 4B0MM 4Y9EA 4LF3A 4RMSA 2ZNWA 1OAUH 4J4PA 2VN3A 1FZKA 2Y22A 4F1ZA 4Z7WB 2DMBA 4NZUL 4WHDA 1OHQA 3BDYH 3C2AL 5LGJB 3MRJB 1BM7A 3EFDH 4YE4H 1QA9A 1AI1H 3Q7JA 4AL8C 2VSKB 5KN5A 2NTSP 2K6WA 4JHUA 1IAIH 1KTRL 5D1QC 1DZBA 5K9QG 4R2GC 1NDMB 1QUNB 3FMGH 4ODVH 4ELKA 1KUMA 1CVRA 1N64L 4Y5VC 3HS9A 2C7FA 1SDAB 4MJIA 3L2LA 2VZTA 3TBYB 5TE4H 3C5JA 4FQHA 3TJHD 5DFWH 4JEGB 2NXYB 1CU4L 2HUHA 5KVFE 4LEEA 2TSAA 5EEWA 4GG6E 4PH8A 4PWEA 2NT1A 1KT2B 3ARBA 1O9VA 3QZNA 4JFQA 4ABQA 5AW9B 5IEKB 3DV4B 4N5UA 3VWKB 3QIWD 3P77B 5DGQA 3QWQB 1OGAE 5HJDA 2GJJA 4Q74A 3UTSE 2Z6FA 1PY0A 1UA3A 4AKPA 4BFIB 4L8CB 3R8BB 3EH3B 3STLA 4HWUA 2HRHA 4P99A 4PS4L 4LP5A 3NESA 1AHMA 1EXHA 1V3MA 4NZDA 4UT9A 5CS7A 4JN2B 1YC7A 1E5UI 5JPNC 4YSDA 4U3HA 2VDNB 2IC2A 4BZ2A 5B22A 5FFLA 4X6BA 5JIIA 4FJZA 1AXTH 3QUXB 5DK0B 3FQ1A 3RDTD 3VRJA 2CK0H 3L3DA 3V4VH 2QVFB 1E43A 4F9PA 6PCYA 2WBJD 3LEVH 5K1JA 2P80D 3WS6C 1IO4C 3OR6A 5FA3B 4P2RB 3H4HA 5J06A 2GEQA 4ACTA 4MHHI 3IDNB 1X6LA 1OT2A 2FJFB 2IPTL 4KTGA 5B39A 4WCYL 3VD2A 1T4WA 4Z7NF 4L37A 4JR9H 1QQDA 1U8OB 1T2JA 1IAMA 4Q6IC 2D31A 4WSGA 2L04A 3VB9A 2GI0A 2VLRD 1BZ9A 5IQ7L 3BKCH 2VXUL 1WZAA 3LEXB 1F41A 2Q7AA 2CLRB 2ALAA 4P5KA 3WIAA 4PVBA 1A6PA 1X5ZA 1Z3GH 5EOCL 1Q0YH 1MRDL 4KRNA 1XHHA 2NQCA 2YS4A 2X40A 3KGSA 2DQIH 2F1EA 3UOAB 5C0NC 1IV8A 5C0BE 3C75A 5DVKA 3RTQD 4DPBX 4DP8X 4NUGH 5DRWA 4CW1B 1I1YB 5CUSL 4PJFE 1E8YA 4P4RA 1BFOA 3WKML 5CEZL 5KJRH 1JF6A 4TTGA 3MV7A 4E9TA 5D2NC 1DQVA 4GAYB 2NDFA 2EICA 3L7EA 4TSBL 3DXAB 1NBVL 4MDJB 4NP4L 5CSZA 2G4EA 1ZT7A 2YUXA 4G9FD 4NEHB 4WSKA 5GZOA 1KTDB 2BDNH 4AVJA 4NZFA 1OAYH 1R5WA 4KXCA 2KBGA 3QUKB 3PQYB 4OZIB 2WTPA 3LNHA 3PAVA 2BSTB 1IM3A 1T0MA 4JFXB 3K6SB 3INUL 2Q10A 4NM8L 4IBZA 4WO4B 5MI0C 3DETD 4XMPH 3SBRA 5JYMA 3N55A 2BHUA 4PBWD 2P8LA 5AZEH 3N0AA 1L9RA 3IE9A 1SN5A 3MZTA 2NR6D 4YDJB 1MCPH 3B2PA 3X12B 5IM7B 2V2TB 3NRPA 4NQUA 5A2JH 3L4WA 5DZNA 5KBNC 2NZIA 4OCYH 1HL9A 1KPVA 1OGSA 1IC0A 3S3BB 2ZXEB 2O5ZH 3SDAC 4DUVA 4HUUA 1QRNE 1GGIH 4F8LA 4LNRB 2ZE0A 1IGCL 3ARRA 3V9CA 1WPCA 2ZP0T 1IBHA 1LGVA 4L3EA 1PTZA 4LP4A 2NYYD 2QSVA 1NIEA 2VJ0A 1OGTB 4FYTA 5I5IA 2JIXD 5C09D 3UPRA 1CIUA 3ZL4H 2K70A 2CSPA 5GRVL 4Y2DD 4QRRD 1J8HA 2O5XL 3QHZL 5TD4A 3REVB 1HZHL 5D8JL 2GW5A 3OKNA 3P3YA 4QRSB 2H0JA 3NT0A 1ED3B 1I9EA 4EKXA 1RK0A 3SE8L 1A6AB 3C6LA 1W8EA 2CALA 5HDBE 4KTEH 2FQDA 3M1OA 3QWOA 4Z3JA 4MZ2A 1HH9B 4KQ4L 1QLEB 1CGTA 1HILA 3KPLB 4HIQA 1LMKA 1V7MH 4W9CC 3QCUL 2PETA 1M4KA 1U91A 2H6OA 3VRLE 5I2IA 4OCRL 3SGDI 1Q9LA 4K4KA 3E7JA 3FB6B 4PWFA 5LBGA 4R2GB 3GLEA 3S4SA 2V17H 3ZYOA 3BGMB 1WAPA 2BNUA 5D7JD 4JZJA 1S7XB 3WFDL 1Y18A 3FO1B 4N22A 4NZRH 2NSXA 4YDMA 1CDCA 1X5YA 3JV6B 2PW2B 5L9DL 3H42L 4QAWA 5AVUB 2BP8B 4WEUD 1BEXA 1SLUA 3NP3A 3K8KA 4Z7UE 5E4IA 2EYTB 2OK0L 1GH7A 4PYHA 1BZDA 2YK1L 4M1GH 3QG7H 4P2QB 4U05A 4W9GC 5F0MB 5C7ZA 4QEGA 3VMPA 1SJEA 3HI6H 2X9YA 3HOGA 3L2NA 2H0PA 3C8HA 4Y9CA 3G6JA 1GR7A 3S6CA 1Q9OA 2HJLA 2ZT9C 4UT7L 1ZGLA 4OTXL 3SGKA 3KMDA 3NJFA 4YS4A 3FUMA 3HNTH 2AMUA 3F8UB 2R27A 1U58B 5DK2A 1JNLL 1H19A 1PLAA 3MAWA 4POZC 2PPCA 3DBSA 1G9ML 4OF8A 2IGLA 4PGCA 3SDDC 2Z0UA 5BVPH 2A6JA 4DN3L 2E8YA 3DPBB 4WQOA 1UZ8A 1DDHA 4XMVA 1IBYA 4LNVA 3TWCL 6CGTA 5ICZA 5KEZA 5JPNB 4WTZA 4M7LL 5AB1A 3C8KB 2AJXH 3ZKND 7TAAA 1D6EA 5IJVA 2OMYB 2AXJA 1BM3H 4W9HC 1I4FA 2O6EA 3DUSA 1F3JA 1VFOA 4ZW6A 1CDUA 4CILA 3ZO9A 4GRWB 1WBZB 3DRQB 5A2BA 5DC4B 5FV1L 3V0AC 3V7AG 4X9FA 3NZUA 2PCXA 4W9ZA 3JXAA 3SCMC 3KG5A 3QXVA 2VDLL 1OK0A 1T3FA 3K2UH 3FB5B 5BS0A 3A6CH 1A6VL 2DICA 2LLNA 2PNDA 2GTWA 3MRFB 1KXQE 1B4JH 2JKSA 4MAYB 4A2MA 4LCYA 5E6ID 4JFUA 5FK9A 5JHAA 5DT1L 5B3JE 1QUPA 1HCFX 4KRPC 2QSQA 1FF5A 1RUPH 2WO4A 3ALWA 3GS0A 2H1PL 3IN0A 4PMFA 4YDLC 1MEXL 3RNKA 4A6YL 2A9ML 3MNVB 3NFSL 3RI5F 35C8H 1LEKA 1G7QB 2FGZA 4RDBA 2AJZA 2E3VA 1CQYA 2R0ZL 1MLCB 1FDLH 2Q2EB 5FUZL 1P4LA 4X8JB 2W9EL 4X6FA 3IVKB 1F4YH 5A7BA 2WXNA 4BD4A 1VDGA 4HIHA 4PRDA 1MJ7H 5DDHB 2BIQA 5D2NB 4O02B 3H9HA 4AXWB 4PM1A 2X2HA 3BVNA 4Y9BA 5ACZB 3WDHA 1SHSA 1SBBA 4XWGH 2MQ0A 2OW7A 5D96C 3BEVA 1Z5LB 4AQ1A 4PJFF 1DN0A 1ES0A 2UY6A 4C57C 3CH1B 1LMIA 4BA8A 3KE0A 2DBJA 4NKDB 4BDVB 1JZ8A 4ELME 4KJPC 3Q1EA 4QRQA 3MLYH 1RUQH 2F5BH 3L1GA 3MREB 4IMLB 4Y2NA 2HWZH 2IDTA 4W6YB 3WGVB 2X6MA 5I30H 4XMXA 2HJKA 3MOBH 4W4OC 1BVOA 1LJMA 1B2WL 5T5FA 1KLUA 1NTDA 4P05A 3ZUNC 4PEEA 5B21A 1BLNB 1ZSHA 2X4QA 3QPQD 1EO8L 3I85A 2VDOB 2VLLA 3OKDA 3SDXA 3WUWG 4YHYC 5LAPA 3DJZA 1THAA 4NKIH 3CMOL 2QQNH 5I1GH 1D5XA 2ZUQC 1KBBA 2ZD0A 2BXYA 4NPYB 4EUPB 3H8NA 3CN1A 5JORB 1UWGH 1PLCA 5MEQA 3HW7A 1VHPA 3HMWL 2Z34A 4AEIL 1OOWA 4X50A 3GDCA 3TBCA 1NBYB 3GMOB 4OZ4A 1CDBA 1CXLA 2HT4D 5J6GA 3N85H 4I0PA 2BVOA 5T5NF 3BPCB 2IBZY 4IDJH 2CUHA 2FWLB 2Y7MA 3VFVB 4E41A 5ACLA 3GBMH 3KS0H 3H9SD 4JFFD 1K8DA 4YHMH 5BZXA 5C8JA 2Q8BH 2EYSB 1BXXA 1JYXA 1YJDC 1FORH 2V7NA 3F7RA 4PJBE 3UXFA 3MR9A 1AGFB 1ZLSH 2EDYA 4RIRB 5DVPA 5E6SB 1A6TB 1YEFL 3MTRA 5TDNA 1HAUA 4KPHL 5CGBA 4U3SB 3EDFA 5MEND 2KZWA 1BOGB 5K1VA 3J07A 1G87A 1Z1WA 4AM0A 3WMQA 4NCC2 3OAYK 3IDIB 4JRYB 5ANHA 3F58H 5HGAB 3QULB 2BS8A 3I50H 2DYRB 1L9PA 1JZFA 1MJUH 3T6VA 3US1A 2B59A 4HKJB 2YMOA 4Z3GA 1GGCH 5JHMA 5DJCA 3GTNA 2JCCB 1GYVA 1MH5B 1VA9A 1MWAB 2W5PA 1RCYA 2DQFB 4RMWA 4P04A 4A55A 4Z3IA 4FG6D 1RZJL 2ZP9A 3HN8A 2R9HD 3LCYA 4F33A 4FQCL 4R0LC 1QO3A 4HKBA 3TH3T 1FP5A 3GSRA 4FNLL 3U0TA 1C5CH 3LQAH 3PP4H 3BAYA 2EH7H 2NY0C 4H8WC 1CTNA 3N42F 1N2RB 1E28A 1P4BL 3OM3B 5IG7B 4DESA 4R4NC 2EDKA 4IRSD 1ZIBA 4PLJD 4H44C 4LQ1A 1TTUA 3QZWG 3SOBL 2DYPA 4HUNB 4P2OD 3VYNA 4AM0Q 4BCYA 2VQ4A 1DJIA 4ALAH 3U2IA 1COBA 2QMJA 3MA9L 3G6AA 4NXKA 1ZE3C 4OF0A 1NBZA 4PPTA 1MCBA 1ID5I 4O4YL 4GO6B 3SDDB 4RVBA 4BE5A 1T89A 2X41A 2HKFL 2H3NB 5DJAA 3T1WA 1T1ZB 3GMRA 3NIFE 4WI7A 2JKTM 2QSCL 4N0YL 4DK5A 2D7MA 4OD1H 4R4FH 1G7PB 2FBJL 5TE7H 4IJTA 1AZZC 4ZW7A 1VFMA 4JREB 4XX1E 1MCSA 3S36X 4YGAB 3H1ZA 4DKEH 1PGRB 5F96H 2JKLA 1CGXA 5T1MB 3BPLC 4UQCA 4Z7AA 1FLRL 4IMKA 4HPHA 5H8DA 4QT5A 1XR9B 1S9KC 1E4HA 1FNGB 4AYDC 2CZNA 4O9HL 4OCXL 3SCMB 1VZIA 4L3AA 4IGBA 1WC7B 4QLRA 3PV6A 3ARDB 3FFCA 3PLYA 3FU0A 2VDRL 3VWJD 5C0EA 1FGVH 1AOHA 1REIA 2WLLB 1TJMA 4FTVE 5JW5B 4N0UE 3C2AH 4Q2ZB 4XBEL 4WFGE 4NNPL 4GUPA 2L7QA 4NQTA 3FQXA 4HJSA 4RFOL 3VGGA 4YDLB 2QL1A 2KZKA 4CN4A 2D3LA 5I0DA 4L05A 1OANA 3M17A 3VA6A 4PY7A 3MRLB 2E46A 2Y6SD 3NSCA 4IBTA 3TF7C 1RL1A 4MA7L 1N64H 1F2XK 1EHKB 3B43A 3KPSE 4RLDA 3RBGA 4PREA 2W8CA 4NFCA 2AK4B 3GSXB 3MROA 3P4NA 1K6QL 2ERJC 3BRDA 2XV3A 1UOVA 2ILLA 3HA0A 4U6HB 2E8ZA 2G2PA 3NSJA 4U33A 2ATPB 5EUOA 1B0RA 3D51A 1CU4H 1HL4A 2WD0A 4DH2A 2WSKA 5BPPA 1OP3H 4F37F 2W0PA 1GAFL 2J55A 3EJYC 3MV9B 4OF3A 1TNNA 1UXWA 3O3AA 4JANA 4P3WA 3UAJA 3B3BA 4JM2C 1FAKT 5EU6B 3DX8B 4EDWL 3PAUA 3H0TA 5KSVA 1JI2A 3REWA 2DM3A 4PS4H 4LBEA 2VQ1A 1EGJA 4QKTA 4UM9B 1NCCL 3VCLA 3RWDA 3BQUC 2GJ6A 1LILA 1Z66A 3D2UD 3GHPA 4AI7A 3QG6A 4XOCA 1Q90A 1CLOL 3TZVC 1WLHA 3ZE2F 2P24A 3PAZA 5KYUB 4Z7VA 4JDTL 3CU7A 3GSNA 2Z92A 1PLGH 2F15A 3D4CA 1EVTC 2QPEB 2R15A 4OI8A 1T2QH 2LABA 3BVVA 3V95A 3VD0A 1AZRA 2QFRA 2OL3B 4N6RA 1U8PA 2A77L 2XVLA 3LRKA 2IPTH 2VXSL 3EGXB 3STZA 5CU9A 4WCYH 3PWUA 3E8VA 1F0LA 4HWBL 2DJMA 3WE6B 3TA3D 4L0ZA 3D25A 2ESVB 1LDSA 4FFZA 4OFYD 5EZLB 2NUPB 1BPLB 4XNZB 1Y0LA 3IGAB 3IJYB 5IQ7H 3B5TA 2VXUH 5DD6A 3K0YA 4JBSA 5FM8A 3DIVA 3V4PH 3M8OL 2BOCA 4QRPD 4EDXA 5FO8B 5JOFA 1LE9A 4L18A 5T3XD 3ESMA 2QPDB 2WB1A 1S7VB 2DIAA 4Q7DA 5DEJA 4GKNA 1MRDH 2RQEA 5IB1B 3T4AB 4KDTC 4G43A 3SKOA 1MF2L 4ANXA 4U4IA 1UWYA 2A73B 2FECL 4QY8B 5IJDC 4CBPA 4PB9L 3UG5A 5BV7C 1DTUA 5D7IB 1FH5L 1AQHA 1DJHA 2R0KL 1ETB1 4P2YA 1IKNC 5CUSH 4ETYA 2QDVA 5DO2C 3WKMH 4YO0A 2I7OA 5BRZD 4DO4A 4OD2A 4QPEA 1K4DA 2QPUA 4OSUL 1Z3RA 5MERB 4TSBH 5LBVA 1NBVH 4I18B 4HDIB 3RVWC 3QJTB 3PWLB 4ZX5A 3DIFA 2AAAA 4R0LB 1DSFL 4XC3L 4GIAA 2LU7A 3FHAA 1TJGL 3GMMA 3NRQA 2B3RA 4YDZA 1MIML 5GGUA 5JLZA 2NY0B 4PN6A 4WNSA 4IU3B 3I02B 1J12A 5AG8A 1O6VA 3BIKA 1OCCB 1YPZB 4LVNC 4XXWA 3GQFA 1ZAGA 2GVYA 2VMDA 3QJHA 1A02N 4OZGE 1PJ9A 3WO4B 3ZL1A 2X05A 2ENJA 3PHOA 3NZSA 3EO9H 1BWMA 1R17A 2BIHA 4U0RC 4X9GA 4FD0A 2BC4B 2YMTA 2HMID 3JZ7A 3D4ZA 2Y36H 1WTLA 1UJ3A 4NLAA 1OW0C 1N68A 1DANU 4RRPM 3KPPB 2N56A 1S2EA 5F89B 3HR6A 5IK3B 1IGCH 2XFXB 4DT2A 3EYUH 1G6RL 4X7TB 4BK4A 3VU1A 3UYRL 3MBWB 5B4MD 5KS9A 3KWWB 1ERNA 4N0FB 3L3HA 1JOIA 1AMXA 2QVKA 2E7CA 3JVFC 4GXVL 4G1EA 3FN0H 3ETTA 2DQDL 2G2NA 4YPGA 3SPGA 5T1JA 3QHZH 5SWSB 1HZHH 2H4EA 5D8JH 1JK9A 2K6ZA 2AQNA 2WYIA 3SE8H 3QUML 4NJ9L 5E8OB 5EZJB 4WWPA 5L2KA 2A3TA 1ZT4B 3HBQA 3JTSB 1JJUA 1IBFA 4KQ4H 3DK2A 1JN6B 5KVFH 2APSA 4JY4B 1H6EA 5FWQA 1OCWL 3AADB 3II2A 3Q06A 3QCUH 1NIDA 1R5IA 4Q97A 4P5TA 4X6DE 4OCRH 1BQHB 5IKCB 2VGLM 1EVUA 4MNHB 4YPJA 4DN4L 4F7MB 1A6ZA 4UQ3A 4C47A 3VFTB 4Y19B 3C09C 2P4AB 3SN6N 1BG9A 2C4XA 4NQDE 4GW1B 5I1DA 5D1QD 1ZY9A 5KSAA 4DGVL 1TJHL 5ITFB 5EIIA 1XGQA 3H42H 5IMLB 2GFBB 4AEFA 4X8XA 1BX2B 3DUUB 3EBAA 1NCAL 2OK0H 2MOGA 4NRYB 1RJZB 2ZKMX 2YD4A 3NIGB 3O45B 2D3VA 2X88A 3GLDA 1CG9B 3TVMC 5IHHA 1I9RL 3ZQXA 3H6JA 4EI5C 3IGKA 4M8VA 1D5BB 4OTXH 4Q89A 1WA0X 3IM1A 3DC0A 1F3RB 2WWKO 1BXAA 4BFBD 1P6WA 2G2RA 1NAMB 3BQUB 1YVLA 2A9BA 3VFUA 1CYXA 1G9MH 1QSEB 4E36A 2HUEA 1RJYA 4AGOA 1FL5A 4DN3H 3P4LA 4Y1SA 1FPTL 3TWCH 3R1GL 4MA1C 4U6TA 5CR8A 5KANI 2GQHA 3LKRA 4M7LH 3NSYA 3CBJB 1IM9A 2HLFC 3CQFA 3ZTEA 4KO9A 3I9IA 1B6DA 5TF1H 1AFVL 1KACB 3X14A 8PAZA 3GHBL 4I3RL 4UTBH 5HHVL 5CD5C 2W60B 1TCRA 6FABL 1UUNA 4BSWA 1J9CT 1UQSB 3TCTA 5FKAA 2E7LC 1L3NA 2KQNA 1AD0B 1ITCA 2CA4A 4LP8A 4WU7A 4ANKA 3LV3A 2XV0A 4IBYA 1GGBL 3VQ1C 4KGLA 1E6OH 1S7UA 3KPOB 1HESA 5DI8A 3UYPB 4AENB 3ZR5A 4E42B 1CE6B 1H5BC 3SGDH 4OLVL 1A1NB 1HFUA 2C3XA 3MRIA 5LXGH 5EU4B 4W9IC 3VQ2C 5HD8C 1LP9A 4YAQB 5DT1H 1ZV5A 5G4OA 2KH2B 5HHQA 3ECWA 4I87A 4ZO8A 1XB3A 4QNPF 4WNQB 2H1PH 3TBWA 4W81A 4I5BA 1MEXH 2EYRA 4GKOA 4A6YH 4HK3J 5B7FA 4PRPE 3NFSH 1XSIA 4GXFA 2K78A 4OIFA 1SM3L 2HX8A 4U6VH 4O00A 4FKEA 1ZV2A 1JSYA 3VUAA 3V6OA 3UAAA 3CN4A 3JYBA 2WN3A 4EBQH 2QSTA 1CGWA 2W9EH 1NGZA 5F1IB 2ZCKL 1QBML 3FT4B 4OU3A 3FB7A 3UTTE 2XXFA 1XCWA 1XF4B 4D9QE 1RIUL 1LK2A 1U4EA 2NNAA 2CO7B 5FOJA 2WTOA 2P5EB 2M2DA 4YLCA 5IT2L 2X6CA 3HG1D 1HHJB 5FDWB 1WGVA 4TQIA 3WTTA 5H2BB 4OBRA 3LRSB 1T5WA 2OCJA 4JAMA 2E6QA 4NUJA 4PP2B 2VKXA 4M1DL 3WEMA 4LVNB 4IHOA 3ARBC 4G9DB 4TVPE 5IB3B 4YDNA 1WZMA 8FABA 2NW3B 1O9ZA 1B2WH 2NY4C 2WCPA 4KTDH 1DBJL 3CK0L 2QEJA 3B2UC 5JPMC 2BMKB 1U8LB 3N91A 3PY9A 2BM3A 4POYA 4IKJA 4TUKL 2YEZB 1EO8H 1IGYB 1I7TA 2HFFA 4AQEA 3CMOH 1IX2A 4WNJA 1SXAA 3AB0B 3TM6A 5J3HD 1QPKA 5DZAA 2NTFB 2DQTL 3AS3A 1DL7L 5CLZA 2AZUA 1MI5B 3SDAD 1BAFL 1WIUA 4AEIH 3HMWH 1J9QA 4DO6A 1OALA 1TQBC 4HFWB 3U7WL 1BMGA 1M1XA 2V3EA 3DROB 3QWNA 4JFED 4NBXB 3S48A 3DOSB 4NSKA 1L9OA 3QO1A 1FN4A 3FQWB 1FBIL 5D6CB 2D03H 3W0WA 3Q0HA 5DZLA 1EEUA 4D7PA 2P7TA 4ZDHA 3RU8L 1YEFH 3ZKSD 4ZK8A 3BZFB 1JXGA 1ZS8B 2OMXA 4KROD 4KPHH 5B38A 1S9XB 3BHBB 2PP7A 1WIOA 4OZHF 1AHWA 2A4ZA 2F54A 1U8HA 5C3TA 1FIEA 3L4VA 2UUDK 4WWKA 3FB8B 2BSED 3EYVA 4A7QA 4ODTL 3ZTJH 15C8L 2WSPA 4YFLI 5IVXF 4NCDA 4Y4HA 1OE2A 1QFPA 4I48A 1B9KA 2H8PB 4WJG3 1V5JA 4JRYD 1K8IA 5AAWA 3C09B 4YHLL 4WSJA 1MG3C 4S10A 3UTQA 2CNYA 4G8EB 4X6DF 5AVSB 3NA4A 4FE9A 4F8NA 1F6LL 2C7UA 3HUJF 4O2FA 1RZJH 3ZO0A 1JP5A 4NHCL 4UDUA 3HTLX 2YPLD 5D70L 4DUWA 1YMHB 3QXUA 5BQDA 3ULAB 3EJSA 3X11A 3MLTA 3EBIA 5IEHB 3VA2C 3JQOB 1P4BH 1Q0XH 1R24A 4C56B 3TVMB 4GG8B 3W9DA 3OV6A 3SOBH 3PWPD 4FFVD 4PTTB 1PZCA 4EI5B 3WHE0 2Z35A 3GSVA 4GAGL 2J8OA 4J3VA 2I69A 3DHUA 5DXWA 3LVTA 1KIQA 4N9GB 3MA9H 1MRCL 1D6VH 1N59A 2R2CA 3RWFA 4DNLA 2ADIA 4GXUM 1FNLA 4LU5L 4PS3A 3T3MF 1W0WB 2QPFA 4M9OA 2AV1A 4MGXA 4M8UA 4N5ED 3TEUA 4BUGA 5LN8A 2I5YH 3QWRD 4JRXA 4L4VD 4MA1B 1KPUA 1YMMB 3RGBA 5D2LA 2QSCH 4XCEA 3WKQA 1KEMH 5I76B 3VI3B 1JI1A 2FBJH 3L5JA 3GWJA 4ELDA 1GTFA 2VLRE 1TZAA 4LL9A 4JQIL 2HTKC 4MRBA 5AW3B 1JWMB 1A6WL 1GOGA 2PWGA 3KWUA 3T5WA 3B7SA 1AP2A 1FC1A 1FLRH 2XQBL 3AG2B 3WJMA 3IJHB 3L2MA 4LDEB 4ZPTB 3HHSB 2VZ3A 4N2EA 1T5XB 4RFNC 5F70A 4OCXH 4G5AA 5F0JB 2X10A 3VE0A 4LPUA 3B34A 1AGEA 3BUIA 1MJJB 1H5BB 2AEWA 4FMVA 3CSTA 4PGDB 4P3DA 2PABA 1SN0A 3QFGA 1RKRA 2YEVB 3JV0A 1NPNA 3KVDD 3LXUX 4XBEH 2G3MA 4NNPH 3C6LC 5DWPA 5I1EL 2EDMA 3MYJA 4LF3B 4JG0L 4RFOH 1JWUA 4IW4C 3UH8A 1FZKB 1EXUA 4OJAA 5GJSL 1WT5A 4D9RE 4KRPD 3D30A 4J12A 1QA9B 4G9FE 3LIUA 3QEUA 4XMTA 5TK2A 5KN5B 2I7SA 3KVPA 3EG9A 3JWDL 2QGCA 1TTAA 3WIHL 5LDSA 3FRUA 1K6QH 4ELKB 1ACYH 3RJDA 3HBZA 2J8UB 4AGNA 4MJIB 3SDCA 2X2YA 1UC6A 3B2DC 1NFAA 3C5JB 4FQHB 3RZCC 4L2LA 4W9EC 3CBRA 4EJ1C 4HXAL 1A22B 4AE1A 4KQ0A 1T4KA 2F53D 4XH2A 3S34L 4YFLF 1GAFH 4B96A 1CFSA 3ESNA 4N8PA 5GRUL 4TNEA 5CZXC 3O3BA 4GW5A 4ZUSA 4GSRA 8CGTA 3DO3A 1WQVT 3BKYH 3ARBB 3ULSA 4JFQB 3P0GB 1I9JL 3Q1SL 3VSTA 4EDWH 1GKEA 4KJPD 3ZPDA 2YKLH 1MLBA 5DEFA 3KLKA 3T2OA 4X9YA 3SGKC 5SX5H 1XSKA 2YOCA 4UDTA 3STLB 1DVFA 2NQ3A 5LKNA 2WQAA 5C09E 1WFTA 3VM7A 1DBML 1H3VA 1ZTMA 1WZLA 4APQD 1KC5L 2ZOKA 1ZWIA 3PIQA 4QRRE 1KBWA 2DWTA 1HSAA 4ZUUA 2RQ8A 3QUYA 2ODIA 2HN7A 4X6BB 2A77H 2GCYA 1JPST 3VRJB 3L3DB 3BJ91 1TQBB 3B37A 2Z8VC 3WTVA 3A67H 3MUZ1 1Q4NX 3ZE1F 3SKMA 4PRID 1NMCB 1N19A 3FTZA 4AQZA 3OR6B 1XGTA 4FZEL 5I16A 1HWGB 2FT7A 2YQGA 2C9VA 1Q94A 4F7CA 2IAND 5B39B 2IMMA 4XB3A 3OC5A 5BRQA 4L37B 5DMJB 1QQDB 2O93L 3AS2A 2AI0L 2D31B 3M8OH 1RIVL 5HDWA 3WIFA 1BZ9B 2A74A 1OP4A 4Q8BA 1HI6A 2OSYA 4RMQA 9CGTA 3LRHA 1UOKA 2Z93A 2OXGA 1X5KA 4HSCX 5D7LA 2DEYX 4HEME 4A7GA 2OMTA 4P5KB 4PB9H 1FL6A 4FNQA 3RIAF 2P28B 1FH5H 1HDMA 1AE6L 2EUXA 2DM7A 4WY7L 2K1MA 3GJEA 2HRLA 3BW9A 3K46A 4OSUH 1KCVH 5DRWB 4PR5A 2XXGA 3HHRB 1BFOB 2L8AA 4P4RB 4PJEA 2C3GA 4I77L 1DSFH 4X80L 1J0HA 1L4IA 3MV7B 4U2ZA 3QA3A 4XC3H 3EHBD 5C6PB 1TJGH 5FO9A 3L7EB 4JPSA 1MIMH 1SMDA 3CLWA 5F88A 5CSZB 3OKEA 3BDXA 4UOZA