1AHKA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
129
structure length
129
Chain Sequence
b'DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 5
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahkA00
1XWVA 3WEAA 5IJBC 2F08A 1WRFA 4G8AC 5IJDC 3B2DC 3VQ1C 3WEBA 5KWYC 2HKAA 3ULAB 1AHKA 1KTJA 3MU3A 3VQ2C 3M7OA 3T6QC 1A9VA 3RG1C 2E56A 3MTXA 2E59A 1AHMA 5IJCC 2Z65C 3FXIC 2Z64C 1NEPA
chains in the Genus database with same CATH superfamily
2A4ZA 3TBBA 4B9GA 3RTQA 3U2SB 1QRNB 4F7TB 4KROD 4LEEA 5KJRH 2IQAB 3WYRA 5IHHA 4J5VA 2VABB 1A3LL 3BCDA 4G43B 1GS7A 1MREL 3MRKA 4XPTL 3U9WA 3L6FB 2P48B 1I8KB 4AYMC 4PG2A 3WJJC 1UCBL 4NO2B 2YKLH 3FSAA 2YAHA 3DUHA 5F0MB 3RURA 5GHWL 1ADQA 3WELA 4ODSH 4OLXH 4X8JA 1CU4L 1FNGB 4KKLC 3HZVB 4F92B 3GSNB 4DP2X 4JFQB 3KPQA 1JZ4A 3E9TA 1MFMA 1H8NA 1MIEH 1QSFB 2BW4A 4JANB 5JHDE 1KG0B 3M1BA 1U92A 1WS7A 1DZ0A 1QI4A 2CJUL 4KH9A 4KKNA 2ZSWB 5AW6B 3SYPA 3TBYA 4ABUA 3SCMD 3BH9A 3WN5A 3BDXA 4X6DE 5C6TH 3SDDA 1PQZB 3WMSA 1BFVL 2IH8A 3D39B 4LP5A 2A6DA 1AZVA 3LKQB 5FW6A 1I8LC 2Z8SA 2H1PH 1NAKL 3SJVE 1RUAH 3DXAE 3GGWB 5B3NA 4I3SL 3V0HA 3O0RH 5DT1L 4F20A 3MODL 1A6WH 1IC5L 1OAJA 3BO8A 3M86A 4MNHA 3EFDL 1DQJB 1KLGB 4K55A 3FHQA 3PCYA 3N0PB 3MLXL 3IT8D 4IHOB 1BD2D 3UEQA 2WWKO 4EOWH 1IIIA 2JQZA 2HVJA 2FX9L 4R96B 2Y6SC 5IMKA 1PZ3A 1RULH 1H5BB 1I1FA 4O51A 3TBSA 1G9MH 4WHTB 2B8OT 2EDRA 4LCCC 5KANG 4WK0B 1E6JL 4MAYA 3ZKSD 3LN5B 1RV6X 1CXFA 1ZEAL 4JDEA 4LBEA 4B3EA 5D7LB 1JXFA 4JZNA 3LYRA 3QW9A 2W92A 2Q8AH 4Z95H 4B60A 1OB0A 1OLLA 5F7YC 4GS7B 4V2BA 2W88A 2KQMA 1CJYA 1B6UA 1SY6L 3KPTA 5EIIG 4FA8A 1GZQB 2DH2A 3WMPA 5J1SC 2NY1D 4NT6B 3EGDA 5BXFB 4FMKA 3DRQB 4JY6A 3M8OL 2XQYG 4L29A 2VDPL 2QBWA 2UZIL 3DPBA 3MLWL 2QLYA 4QRRE 4QXUH 3ARTA 4XC1H 3NCYS 4LKXA 2NUTB 1HU8A 2LR4A 2PLTA 4B50A 1J05B 3I6LE 1K5NB 4TQEL 1N12A 2NY6D 4ALAL 3NFNB 4IQHA 1RPUA 1A7PH 3G04A 4TTDD 4RVBA 4DUXA 1JPFA 1M9SA 3BVXA 2P28B 4PSRA 5ICUA 1IBGL 3K2MC 3UZQA 3WD5L 2NZ9C 5IHZA 4BDVA 2X2HA 4JFFB 4MVBC 1ACZA 4WUUE 3ILPA 4OD1H 5I19H 1NMBL 2ARJB 3KPPB 2LVCA 2P43B 3EH5B 3VI3A 4KRMB 3U7WL 3S97C 5C0RL 2WLIB 3OAYK 1KULA 5CJXA 4S1DC 2X1WL 2EUWA 1PZDA 3OJDA 1CGSL 2AQNA 5C07B 3QHTC 4OR1A 1ERNA 1HSBA 2WQXA 1GGTA 1U8JA 4GUPA 4UT6L 3K80A 3KLDA 3N0AA 4Q74A 5FYLE 5GRZA 4RX4D 1JV2A 3QJXA 3V0EA 5D7SH 2JJUA 2BS9A 5EU6A 2VLRA 3WDIA 5DK2A 3ULVC 3FN9A 4I0KA 4JY5H 5CAYB 1CLZH 1UFGA 3S4SA 4AJ0A 3B7RL 4IU3B 4GOSA 3TXAA 2VR6A 3RI5K 1KN2H 2EH7H 3B9VA 3IMWA 1JDAA 3MLPA 2BWQA 3IJ8A 4FQIH 3ZKXC 1A9EA 5JO5A 1PG7X 1KNOA 3O3AB 3NGBC 4YHLL 1RUQL 4N8VA 4PUBL 4PJFF 2N4IA 2R9HD 3HS0C 4JQXA 4LASH 4W9GC 3B7SA 3ZTCC 1AIFB 1HHHB 1O0VA 1AC6A 3LZFH 3DVFA 3EFOB 4WV1A 5FEBA 4FF9A 1CQKA 4GRLD 1TQBB 1NL0L 1PSKH 2ZXEB 4OZGA 3E8UH 2YA2A 5JORB 2PO6D 3Q6FB 1EGJL 1M1XB 2OL3L 5AVZB 4ZUTA 4D9LL 5L7XL 3MBED 5IHUL 3ESOA 4L3EB 4G70B 4W9IC 5BCAA 1OF2A 3GZKA 5IQ7H 5TJWK 2ZD0A 2VLJE 1WIOA 4PCKA 1BFSA 4F5CE 3RG1C 2DMHA 2R1YA 1OAYL 4N2AA 4DGUA 2WWOA 1JZ5A 1HXYB 5HGHA 3QUYC 1SJEB 2CJSA 5DJCA 4ZMNA 4KKPA 3PUCA 3NIDF 1IVTA 1EAOA 2XN9A 4JO4H 1UC6A 5AAWA 2H5UA 3LPWA 2NNAB 4OCSL 4OGZA 3VM5A 1BBJB 4O4YL 3QR1A 3ZIMA 3SE9H 3MRQB 5F8QC 1NCJA 2UWEA 1ZHNA 2WBKA 2J8HA 1D5RA 1DQIA 4OLUL 3PU7A 1V27A 3L4ZA 1FZMA 4N26A 4J8RB 3QUZD 3T4YB 3MNWA 3IETA 1MEXH 4AYFB 4P2RE 2VC2H 1V3MA 1XIWB 4L5FL 3D48R 3QZPA 1A7QL 4P07A 5AEAA 2ZWZA 5BRZB 3IWUA 4JY4A 1IQDA 1DLHB 1S7TA 3JWOH 4LPTA 4RMTA 4LAJH 4UQDA 5A2FA 3U7YL 2HFGL 1TVBB 4F15B 4BJLA 3M7OA 4K23H 3V5DA 3VXRE 3AM8A 2E0PA 2DTMH 2JB6B 1NDMA 1GHFL 4NZRH 2YHGA 3FFCB 4ORZC 3VRIA 2DQHH 3GHPA 5J5EA 4XP1L 3BW9A 5D96B 2DLGA 3P77A 4OZFH 1MAMH 1RZFL 3P3TA 3MLRL 5DC4B 1VCBC 4HJGB 4AM0Q 3NFSL 4YGVB 2E7DA 3TA3A 3CVIL 1LE5B 1RJCA 3K6DA 1ZLVH 5AVSB 5I6MA 4I3GA 5FM8A 5AAMA 3MROB 4YHIB 3ARFA 1I7UB 2YN3A 3QZOA 4AYBA 5A3IC 4KK6D 3QE5A 5AG8A 1T2JA 3QRGL 4XPGH 5C0CD 2ZONA 4ISVB 3KL3A 4ZPVB 2AI0L 1CDBA 3SDXF 1UB6A 1A8ZA 2VDOH 2W9EH 2HXAA 3ML9A 3P30H 3FYEB 5I1IL 1JZ8A 3H9SA 4XBPA 2GCYA 4I48B 1SYVB 1IQWH 5EOCH 1QA9A 1OIOA 2H2PD 1ROWA 4APQB 5CSZB 4B96A 2J8OA 5JZ7C 4MNQA 4N2OA 1BVLA 1E5BA 2V5RA 3EYSH 4H0LC 5CWSA 2AXGA 4JPVH 5ITFB 3NJJA 5D7KE 3VTTA 3REWB 4BH7A 4K94C 5EN3A 3B37A 2CO3A 5AOMA 1SJXA 2VDQH 5LBVA 1QI3A 4L4VE 1PX8A 3O8XD 2ORBL 1J5DA 1P6AB 1AQMA 4HJJL 3UP1A 4FA7B 2W0FA 5C3LD 2YSSA 2X5PA 1H3XA 5IVNA 5AVYB 3V4VH 4PJCB 2VL5A 3DHPA 4ZYKB 1AAJA 1ZV5A 3CLWA 3ZT7A 1QUNB 1JN6B 1O5DT 4N8PA 1D7FA 1W80A 4KTGA 5LBSH 2J1XA 4UTAL 3WFDL 4CJ1A 1E4WL 5JYMA 3BRGC 1GR7A 2ZCKL 3DX1A 4KPHH 4RAUB 2K6WA 4KWUA 3GJFK 3VJ6A 4JPWL 3NP4A 5EU4A 1NCCH 3F01A 3L9BA 5JIIA 1JG9A 2OXHA 2OYLA 5J9PB 1SBSH 3IGAB 3DHMA 8FABB 4ZO8A 3T9WA 3UZEA 1WTLA 1IAIL 1U91A 5C0DB 2CAKA 2IWEA 1QFPA 4PWEA 3LZOA 5D2NE 1B9ZA 1QFWH 3DDFA 3HFFA 5DRWA 4FFVC 4NQEA 1JV5A 4UNIA 3GI9H 1U9KA 3PGCA 2VM9A 1HINH 5DHVA 5E1IA 3UTPE 5IZ7A 2OX5B 2VQ4A 2QVFB 5FYLH 2VDKL 3GEFA 4FI8A 1C7TA 3SBWC 3SE8L 3UBGA 4KJQD 1JPSH 2XY1A 3TJEH 3VGBA 1Z2KA 1H3PH 2Z8RA 1X5FA 3UTSA 2VR3A 3F05A 4G2AA 5IJKC 1GYUA 1KENL 5DD1H 4D9QE 4PJXE 5BV7C 4UQ3A 2I24N 4EI5C 3FHAA 4IJTA 4FDWA 3WTUA 2AJVL 3NOIA 4OZIE 4NOFA 4TSAH 4J3UA 4YXHH 1GSKA 4Z0BH 2CA3A 3KVQA 2EVHA 4R7NA 4UOW1 3AWFA 3FO2B 5B1JC 3KD4A 4ODTH 2CK2A 3RTQC 3E1ZA 1FL5A 2F8XC 2X4TA 4L37A 1DR9A 2H3NA 1HSAA 4N68A 1MFEL 4G8GB 3GHEH 2ZOOA 3KPRD 5DD6A 3L1FA 5CEXA 2ZOTA 1BZ7B 4KHTH 4P3WA 1G7PA 5E2WL 2FD6H 4M5SA 4ZAKA 4PG2C 5IMLB 4P5RA 2P8PB 2KT6A 3STLB 2ZXWB 2XJLA 2BY2A 2EDNA 2B9AA 4NNXA 1FGNH 3O3UN 5DLMH 3V10A 2HT4C 4U6HB 2Y3NA 3RDTD 3ZR6A 3LKPA 4P2AA 1HWWA 1OO2A 3RKDC 3MLUL 3ZE0E 5L2KE 4PJEB 4P3DB 4EIZC 4WU5B 5SWSA 5HDQH 4D3CH 1KUMA 2AK4D 3U0PA 1WC7A 3IVKA 1A6UH 1J5OL 4WJ5A 1BCIA 1G5GA 1XDTT 4P2QD 1ETZA 5IFAH 4MJID 5ISZB 1I9JL 2QPDB 3OD3A 2RALA 4Y19A 5FF6B 4BXSV 3FL7A 4K07A 3KS0H 4JPIA 3ZYOA 2DI8A 3RVXD 3O2VL 4HKXB 4PJIF 3UPCA 3SGJC 1EHAA 2YGNA 2FH8A 3AC0A 5DS8B 4DZBA 5KJRL 1RZIB 4EI0A 3ARGD 1YMHA 5EPMB 4CC4A 2PYEB 1MHEA 2GTWA 4OB5L 4XWOD 1SHMA 1XB6A 2YGVA 1J9QA 3QORB 3SYQA 2FQFA 2YKLL 4F24A 3S3BB 4UILH 2DWYA 2Z35A 4GW1A 2BVPB 4MAYC 4K2UH 2LU3A 4ODSL 2X89D 1SMAA 4OLXL 3KL5A 4JEGB 1P2CB 4P5KB 2EXYD 2BPBA 4Y4FB 3GUTB 3S5LG 3VI4F 1LEIB 2W91A 1DANU 4RGOH 1XD1A 5C6TL 2V2WA 3WCYA 3W0WE 1L9RA 4O5LH 3SDAB 4HS8H 2H41A 4QRPA 3MCKA 5D7IF 3V8OA 2BXZA 3UACA 3UIYA 2D73A 3KXFA 5L4JA 1RUAL 2AQTA 3B2PA 9CGTA 1S7WB 4Y16A 2GABA 1MH5B 1N3NB 2F53A 3O0RL 4OCWH 5J0BA 3NG5A 3VXQB 1A6WL 2R2HA 1KTDB 3B34A 2FQGA 2DQTH 3J07A 3TBVB 4AZ8B 5I16A 4Z7NB 4L8DA 4EOWL 1J8KA 1QTSA 4Z7UA 3WKNA 4BFGA 2VLKE 2Y5TB 1RULL 1NUNB 5HYEA 2F54B 1G9ML 4PRNB 4U4IA 4NQXA 5D1XE 3RB5A 4C55A 4GI8A 2EIKB 5IBLD 1U8NA 1BVNP 4C4KO 5DC0A 5IUCA 1IAIM 1UTDA 3X1EA 4B3VA 3H0TA 4C83A 1UB5A 1OM3H 4HIIB 1KTRL 5FYJU 3PWJA 5GSVB 2G30A 5DJXB 3WTXA 4LGPB 3BH8B 5BRQA 4QHNA 1CZ8H 3W37A 4QXUL 1XZ0B 3AWGA 4HVBA 4XC1L 2GJ6E 1IM9D 4X8XA 3LHAA 3MRDB 5BJTA 4QHMB 4QRQA 3SCMB 3WUWB 3EGXA 2I9TA 3UPAA 2ED7A 4ONHB 3CK0H 1RZ8A 3QPQC 1WFTA 1RHHA 4RZCA 1A7PL 1I82A 2Q3XA 3JV5A 1U41A 2YAOA 3SKNA 4IGBA 4JQXC 2DMCA 3O3EB 2YIHA 4EN3A 2Z7ZA 3IWVA 5E1QA 2PCPA 5H94A 1E9PA 2X3CA 3BP5B 3OR6B 1R3HA 2GBVA 4J3OF 3CH1A 3MNVA 3IRZA 3P0GB 1QSZA 1CICD 3OZ9H 3UCQA 2X4PB 3K1DA 1BD2B 4OD1L 5DD5H 5I19L 3GXNA 4KQ0A 3K1KC 4MMXB 3X1BA 3B6SA 1L9QA 1X5MA 2RQEA 4OSUH 5DFVC 2ZXCA 2OAAA 2VZ3A 5I30H 5IM7A 1FZJA 3WS3A 2JKIS 3RWGA 3PHOB 3RWDA 4U49A 1BVOA 1S7VA 3QSKB 1FYTA 3SKJH 2IOOA 4CBPA 1MOEA 1TZHB 5JQHC 5D7SL 5KVGE 1ZHLB 4RISH 5LGHH 4JY5L 2WUCH 1CLZL 1JWUB 3SY6A 5J13C 3OLDA 3O9WB 5AAWC 1TTRA 3T0EE 1OSZA 3CXDH 1KN2L 2EDLA 2EH7L 4FQIL 3NJLA 3FFOA 4HX1A 5FV1L 3ARED 3FU9A 3GBDA 4OLWH 1OQOA 4GAAA 1IFGA 3LZFL 1ONQB 3VFNB 1O5PA 3NIGB 4QPEA 2BSBA 2J8UB 2I26N 1KTKE 4DGYH 5EC1B 1PSKL 4DNLA 1RIHH 3DMMA 4HJTA 3E8UL 4X2UA 2NY6B 3G6JB 2HJLB 3DDGA 3CTTA 2P5PA 3RNKB 3GO1H 5CD3B 3CDZA 4PBVC 3L7EA 3H9HA 1BZQK 1WFUA 1O9WA 5IQ7L 1IKOP 1T4KB 2WW8A 3D69A 4OD2B 3EADA 3BP6A 1FG9C 1NUGA 1W2KT 2ZTBA 2ZUQB 3E38A 2C9RA 1P4UA 2CIKB 2QDVA 4MJJA 4CGTA 1FNEA 4TN9A 3OR7A 3AM8C 2TRYA 1UD4A 5IVXF 1TSHA 3WIFA 4X6DF 3MQIA 4JO4L 4UT9A 1P9MA 1Q38A 3GIVB 5MEQA 1MG2C 2JKWA 4G42A 2F7QA 4JHBA 4NN5C 3IFOA 2IDUA 2WBWB 1FC2D 2WXKA 3LEVH 3B5HA 3L3GA 3SE9L 1YUHA 3OWRA 4HK3J 3TA3C 1KN4H 2OMZB 5ETUB 5AAMC 4ZG1A 3ARFC 3MRNB 5IBTH 3H4FA 3PPEA 4Q9RH 5DS2A 1MEXL 4MZRA 1NGYA 3REVB 4BGDA 5JW5A 2VC2L 2G5RA 2EDBA 2IALA 3LNDA 3ZDWA 1CLVA 2Q6WA 1Q72H 1ZKAA 2F6AA 4YWGH 3N42B 1NBCA 4MA7H 1ZIBA 1B4LA 3J7HA 3C2SA 2NLJA 1N5AB 1OAQH 3HRZA 3JWOL 4X6EA 4JFPB 2QV4A 3TV3L 4RMBA 5D1ZD 3MV8D 1ZSDA 4XNAA 4YEEA 1TFHA 3E80A 1YHPA 2CPCA 4K23L 5I76A 3E1F1 2PO6B 2DTML 1XT5A 3CZUB 4NZRL 2EIMB 4WNQB 3D6GA 3MBEB 5CEZE 5GPRA 1UEMA 4MD5B 5ERWB 2DQHL 4XPAH 1RJZA 3DOSB 3OTTA 2VLLB 2F2HA 2JH2A 4X0KA 3P0YH 1MAML 3VXSE 1QLFA 4N6QA 2OM5A 4MDJA 5EO0B 3EXLA 5E8NA 4AYSA 2CKBA 3O6FB 4YBLB 1Q0YH 1HOCA 3FU7A 1YJDC 3Q2LA 3VMOA 3GMMB 4UOW0 4RMWA 4H20H 2XG5A 4NDMA 4GLRH 4RAVA 4XPGL 4BQCA 1D6EB 1I9IH 4IOFD 2JTDA 4I1RA 4E9XA 2XICA 4R7XA 2LU5A 1N67A 2VDOL 2CKNA 4J3VA 3RVVD 5KYNA 1CDHA 2D7MA 2W95A 3P30L 4Y2OB 2VDPB 2NUPA 4NRYA 5I71B 4FOMA 4OIAA 4RMSA 1IQWL 4Q14A 3FQ1A 1E6OL 4J1UA 1D9KB 4PB9H 1JGEA 5CZXC 4A2MA 2VLME 3QUZB 5KSVA 4AGMA 3FOMA 3WKPA 4WSGA 4JFXA 5F7KC 1EMTH 5DWPA 1CD0A 3WJMA 4J3OD 5AW4B 4GUQA 3C12A 1S3KH 2E75C 4JPVL 1INQA 3O3BA 3CVHA 3IDGB 4E9WA 1RZGA 2A0LC 5A6LA 4P5MB 4RGNC 5K1NA 1U30A 5CCJA 1KEGH 2GBTA 3GSUB 4JAMA 3ULVE 2VDQL 4QAMB 1Q9OA 2BIPA 2XN2A 4QHPA 1PY0A 4PJBA 1FIEA 4BGLA 2CIIB 4H4NA 1KIUB 1P7QD 3V4VL 1SQMA 4XNYH 3GZPA 1SOQA 2XFGB 2ZIDA 3MNZB 4HU8A 1ESOA 2DTSA 3O2DH 4F37K 5LBSL 3MUHL 2WY3B 3FHEA 1FGVH 2DWEA 3TFKC 4KPHL 1JF6A 4NJ9H 4Z5RB 1NCCL 4UV4H 3NESA 3ETSA 1OCOB 1SPDA 4WHDA 1SBSL 5H8DA 4XMVA 1KIQA 2MMXA 4AIZB 5FPIA 5T1KA 1GTFA 5C0CB 4G83A 5DRNA 4KV5E 3NBNA 5EBWA 5MENE 2LGNA 4LQFH 5E03A 1QFWL 4N5EC 1B9KA 5IVZB 1JZIA 3GI9L 4EIBA 1EHNA 2FT7A 5E94B 4WWKB 4AQEB 4IW4C 4BD4A 4X4ZA 1HINL 4Y4HD 4R7DA 4RBPK 1BGXL 5FYLL 1E3XA 4FQLH 1JPSL 3EYQD 3TJEL 5EZLB 1D3CA 2JE8A 1H3PL 5KVGH 1N6QL 4MNGA 1EK3A 2ZP8A 4RQQA 4HUVB 1MJ8H 5DD1L 2GSIA 4TNGA 4CSSA 4ANVA 2YK1H 3NH7H 3ARDA 4FEMA 3BUDA 2B1HH 1O9VA 3ATFA 3HMWH 5ECJE 4TSAL 4YXHL 1YPZE 5C0AE 4MLSA 2CALA 4Z0BL 4M7KH 5TK2A 1QFOA 3QHFH 2WP3T 3SJVD 4DKDC 4Z3IA 4ODTL 3L3HA 4U1NA 4YDZA 3CIQA 1XGYH 3PWPE 1HHKA 3GHEL 4PGBB 5LGJA 4CC4C 2GJPA 3FQUB 3BQUD 4HUKB 4HWBA 4KHTL 5ENWA 2FD6L 4BELD 4WF7A 2GTQA 5LNGA 1XR9A 4EAEA 4ZFFA 5BOZG 4X9BA 4PJFB 4A38A 5IB5A 2E7LC 1E8ZA 1AGDB 1FGNL 2AV1A 3MRMA 5DLML 3QUMA 4QIRA 3VWJA 2CDGA 3ZDYE 1G4RA 3M45A 4UIMA 3I75B 1FSKC 3ZKNC 1J5CA 5HDQL 4D3CL 4FP8H 1JHLH 3HJ0A 1A6UL 5JIPA 1CFNB 1E67A 1OSPL 4MX7B 1F13A 4R2GC 3T6VA 4ENZA 3FSZA 5HYSG 5IFAL 1LQSR 2EIJB 3AXHA 3RY5A 3HCVB 4PLOB 2EDOA 5IW1B 4HT1H 1AP2B 3LZPA 3F7YA 3MBWB 1QWHA 4KU1A 1ZVSA 4NRZA 2ZKMX 4Y16C 5C3TA 1Z0MA 1BF2A 4GY4A 1G6VK 2WO2B 3AT9A 5BZDA 1M7DB 1BZ8A 4BUHA 2TRHA 3I6LD 3NIDB 3FU0A 1Z9SB 3C6LB 1U2CA 3LN9A 2G0LA 4H1LA 3R7RA 1NDTA 1EXUA 1WHPA 1HYRC 2QSQA 1AMXA 1NAMA 4NFCA 1MLCB 4XNMB 4UILL 4N25A 4CA4A 1CURA 5EOQL 4K2UL 1WBYB 1NCWH 3FTUA 1LP9E 5JHLA 2ITDA 4JM2D 4CMMA 2F19H 1E9QB 1KPRB 1T22B 3CN4A 2VIRB 4U6YA 3DC0A 5HJ3B 1HHIB 4OJDH 5GS0C 1TKWB 3OLGA 4YPJA 2GVYA 5FOBA 5C0BA 2V5TA 2FE0A 5LBGA 2APWA 4A6YH 3ARBB 1J8HB 2CU9A 3FQWA 3QFJD 3EAKA 4NN7C 3UJJH 4BK5A 4EXKA 4PVBA 4O5LL 5DMGD 4HS8L 1RQ5A 3LNGA 2YRBA 4GG6E 4ZUSA 3GMLA 1J10A 5DFAA 4BHUI 1X9QA 4L1BA 1JCVA 1IFHH 4U1MB 3PABB 4Y1TA 4OCWL 1A22B 3OQRA 4BCYA 4GBXA 2EICA 1LNUA 1FJ1A 2AK4B 1H6TA 5I18H 2DQTL 4PIBA 4DSYA 1IAOA 1HNYA 4KRPD 5GS1B 3WO3B 1XH2A 4S0TD 2FSEA 2ZUVA 4KZDH 1R0AH 1MCHA 4TQIA 3TZVA 4IGBC 3F5WB 1ILUA 4YE0A 1MFCH 4FULA 3KYMB 4OQTA 3SKOA 1BYPA 4JGUA 4NAJA 5EEZA 5ALBH 4HH9B 5J8OA 4DOHE 4JHZA 4ELMA 2AEPH 1SEQH 5F44A 2GBAA 1ZV2A 4L3CB 4OAWB 1F4AA 1U8CA 2EYTB 5IQ9B 4KI5E 3WLBB 3C5ZD 1QFWM 1OM3L 5DI8A 3SDCA 5DJ8A 4FTVA 4XVUC 1DO5A 3F00A 5KSAD 3UTTE 2VLJD 3ETTA 3UGXA 4GW4A 5AB2A 2N3JA 1CZ8L 1ZT4A 3KLKA 4G9DA 4IHBA 1J9RA 4FQHB 3QDGA 2VMJA 3BKYH 4PJXF 3B9KB 3FN3A 3X14A 2CXGA 32C2A 4XWGL 3TPUA 3PL6D 1V55B 1FORH 2Z4QA 2BNQA 4ODXB 3CK0L 4OZIF 1OAKH 2EDMA 3A23A 1ET5A 4P46C 2V33A 5CCKH 4XZ4A 1EANA 3RE0A 3ETBJ 5FKPB 4MCYB 2XPYA 3K6IA 1D5XB 3EZ8A 2VDKB 3VSTA 5T1LD 3K71B 3GSWB 4ZXBA 1F11B 3GSXA 3BMWA 2O4EA 2YPLA 4UANA 3DMMC 3OZ9L 5DUPH 5GGSY 2HTKC 3OXSB 3MDJA 5DD5L 5GISH 4X99B 4Y5YB 5IEKA 4OSUL 4Q6YA 1B0GA 2OMUB 4NAMA 5I30L 5D6DA 1XFPA 4WENB 1IEHA 1OSYA 3GSVA 3Q5TA 1UA7A 3K5RA 1I4FB 3MV7A 3APFA 3EDEA 2J57A 3SKJL 3ZE0F 1BYNA 2G0KA 4AH2A 4WO4C 3DOHA 3IDYC 1SGKA 1VFBB 4BH8A 4E5XA 4DO6A 1EO5A 5DMJB 4RISL 5LGHL 4EJ1C 4PV8A 4TNVK 2WUCL 3QS3A 4FNPA 1KGIA 4XCNB 1P9MC 3ZRCC 5DK0B 4QJ4B 1N6VA 1S7QB 3CXDL 1QD0A 2P24B 3BGFC 2R1WA 5C08D 2BVQB 1A6ZA 1J1XH 1HCYA 4LCWA 2GIXA 3FQYA 2IWFA 4QAWA 5HGDA 4B9IA 1SHXA 4OLWL 3U4AA 1WH0A 2EVFA 2HTLC 3EO0B 5C97A 5FUCC 2Z8VC 1U3NA 1QTPA 3LIZA 2HFEB 3KPLB 4X8CA 3B2DC 4NENB 4DGYL 2J1YA 4HLZH 1R24A 1G7QB 2DN7A 2WXLA 4JKKA 4HHAB 2QKIC 1RJYA 1RIHL 1BIHA 1TNNA 5IB1A 4OI9A 3HUJA 4QOKD 5CLWA 1YY9D 3W5MA 4A67A 1A2YB 1O6TA 4KXAA 2E27H 1R5VA 1HYSD 1EA9C 2ZKXA 1MUJB 5A16A 1R5IB 4WRLA 4ZW3A 1MAJA 5DQ9A 5CJQH 2WXPA 5AB0A 2BRQA 4TNFA 2K8QA 5HY9A 1QACA 3C5SA 4FKEA 1MVUA 3ZY7A 3QT2A 1QHOA 2QQKH 2KZ1B 4G71B 2VAAA 3LEVL 4HG4K 3KYAA 1A4JA 3PNRB 4PREB 4X5QA 2H8PA 9PCYA 1KN4L 2Q5BA 3PHSA 3RWHB 4G6AD 5GRYA 3OB8A 3FOLA 1GJWA 3QC5X 1I1YB 3FCGA 5DGRA 5IBTL 3Q2NA 1AYRA 1AY1L 4OF3A 4C4UA 4Q9RL 5DYOA 3SBQA 4YDJB 1MG3C 3SD5A 2LQRA 2ED9A 2WNWA 1T03H 5DJAB 3O3DA 3MRPB 2UVFA 1X7TA 3TBWB 4OF5A 3CDFA 5DC9B 1Q72L 4YWGL 4BSVB 1GYCA 3AQYA 3H53A 4MA7L 4NPYB 4C54A 2EYSA 4QDGA 4X5WB 1OAQL 1XCQA 1KBBA 3S88H 3QQ9D 2NDFA 4KBPA 4PRIB 5F93C 1A7RH 1YY8B 5IQLA 3VI3E 2C3VA 3HE7B 1BQHA 2OQJB 4PJIB 4YVNA 5FO7A 4P4KB 4K94H 4BA8A 2WAHA 1W9XA 3CPLA 4NGHH 1X5IA 3LDBC 4M48H 3TTYA 1I7TA 3BFOA 4NKOB 1OL0A 5ICZA 4TYUA 4YSUA 2QGEA 4FKHA 3WNOA 3E3QC 2EIZA 4XPAL 2YFNA 3FQTB 5BZXA 2WJ7A 3P0YL 4K5PA 1JK9B 3UTPD 1LDPH 1BXVA 1JK8B 3FH8A 3NFPA 2UYLB 2J12B 4ORGA 1B0RA 4FZEH 3V4LA 1EAQA 1Q0YL 3GJEA 4NZUH 2I69A 2WVVA 3VI4B 1MNUH 2TSAA 4D9QD 4H20L 4PD4K 4GAJH 2QFPA 1HCVA 1I9IL 3ESVF 4NWTL 5B21A 1J8SA 1SUJA 2Z64C 1NFIB 4LLQB 2R0LH 3QDMD 5D7IB 1U8KB 2O30A 2C9SA 4JPKH 4OZGE 3QEHA 5FM5O 1KYFA 2X28A 4KQ3H 4MD0B 4Z18A 1ZS8B 3IMRA 4X9HA 1UUNA 4PB9L 1KTJA 5A7EA 1ZCRA 1DVFA 1EMTL 1NC4D 1HJBC 4JB9H 3N40P 2B14A 4JRXD 4LOFA 2WXFA 1OTSC 5FDWB 1S3KL 2WLMA 5I0YA 5DURD 1S9XB 3EHBC 3NSXA 1OGAB 4P23B 3TESA 1PZCA 3ZE1E 4Q4IA 3VGHA 3GKZA 5ANMA 4PBDA 1KEGL 2UUDH 5D1ZB 4F8NA 1WEJH 1OW0A 2NR6C 4NQUA 2BHUA 1OHQA 2DAVA 2OSYA 1CL7H 1XV8A 2KL6A 1AGBB 1KT2B 3PWUA 2OCFD 4XNYL 2CO7B 2BXYA 4JGNA 1G7MB 2UWEE 3F84A 4QKXB 1DDHB 3O2DL 3ARDC 5DXWA 4B9CA 1UJ3B 1MI5D 3HE6D 3D0VB 3C08H 5D7JD 3VD1A 5TD4A 3D25A 2OXGB 5DO2C 1FGVL 1CF8H 5CEYA 1DJHA 4NJ9L 3PJSB 4UV4L 1AGFB 3JTTB 3ARVA 4BHUA 1L3NA 1FNSH 3MLVH 1DVSA 4HJ1A 3VFWB 3DO7A 1TEYA 3QZLA 4L3AA 1FVEA 2JIXA 1AO7D 1NIEA 4LQFL 1CYWA 4W6YB 3QEUA 2NXZD 5J89A 1M7IA 1HH9A 3OKDB 4HLZG 2HX7A 4ZI8A 1LEGA 1Z7JA 2WAQA 5CGBA 1JTOA 2QVMA 4P04A 3VWJC 4FQLL 4IBLT 4UTBH 1IBZA 1DE4A 4C56A 4UZGA 5KVGL 2O72A 5HGGS 1T1XA 2MOVA 3D85D 4MA1B 3W11C 3NABH 1MJ8L 1UM6H 1TQVA 2WP3O 1KGXA 5IVOA 3FUHA 3AB0B 1XGQA 2YK1L 3NH7L 4H88H 1QBLH 4JFDB 3W0WD 3OKMA 1RSYA 2B1HL 3ZMNA 1A6AB 2NNXA 1UGKA 3HMWL 4M7JH 4WZ9A 2UY7A 4UBDD 1TJHH 3IJEB 4LL1A 3W39B 4AIXA 1WZKA 2E6QA 1H19A 3KBEA 4M7KL 3QHFL 4Y8AA 1H15B 4ZO9A 1RIVH 1CTOA 3TNMA 4JFEE 4MQXC 4G11A 1P7QB 1IGYA 5IK3B 1XGUA 5KTEH 2ZWSA 4FCHA 2FGWH 1XGYL 5I8EB 4UINH 3TLRA 1XAUA 2GQHA 2PNDA 4AXWA 1IC4H 1W72B 3HPJA 4AYEC 3WAKA 3ZTJG 5JQ6H 1N59B 4GP8B 2VLKD 4KKBD 1N4XH 4PGDB 1XCTB 3QR2A 4N90E 1T5WA 3P2DA 1P7KA 4MNQE 2VERA 3L4UA 3LZQA 1BQHG 3D4YA 1FYHB 5TE7H 2GJZA 4JQVA 2G3MA 3D5OF 1T1YA 3MJ8A 3WHE1 5LJYH 4X8GA 3W57A 2R15A 3CFJB 1LWRA 4OJAA 3UC0H 3BZEB 4XCYA 3VD0A 4FP8L 4BK5C 4JO2H 4F91B 2V2TA 4IMKC 2CRZA 1ZANH 1FV1B 2K6ZA 4K7PH 3QDHA 4L2YA 4TUKH 1FFQA 1U8IB 4Y4HB 3TO2B 3UDWC 4F8TA 3PGDB 3ZKMC 1KFGA 4HT1L 3S9DB 3QI9A 1CBVH 2FJUB 5I18L 4M7LH 4F2EA 5JHDB 4GBXC 3DTXA 2DJ4A 2UY6A 4QRTB 4ETYA 4P57B 3RX9A 5L8KB 5IVXB 1JFQH 1TQSA 2BSCA 1G7JB 3EUDA 4X6DB 1RFDH 4NO3B 5B8CA 2A9MH 4A2GA 4QXTA 4KMQA 4IJ3B 5ACZA 4LE8A 4OZFB 2CCWA 3TZVC 3KEDA 1TLMA 2P47B 4N8UA 3SJVB 2YBGA 1JPGA 3DXAB 3TP4A 2JTYA 5D1QD 1F4XL 2XUWA 4I5BA 2F19L 4MGXA 2Q0ZX 4JDVB 5DO8A 3AT8A 5I75C 4ZK8A 1IJ9A 3BQUB 3VFVA 4RGNE 4A6YL 1DQQB 3UJJL 1E30A 2VDOB 3CG8A 3SDCC 2F15A 4PGCA 5CLTA 5BQDA 3ULVF 3P9MA 1G7HB 1U58B 1Z5LA 1UWXK 2C9QA 1PNCA 4KJPD 4KQ4H 2EVGA 1MCBA 2RR3A 2CHWA 2H0PA 4IRJB 1MCWW 5CZVH 8CGTA 2V7NB 4E42A 2NX5E 3FB8A 3ZU8A 1X4XA 1D5BA 2V7HA 3TO4D 4AYGA 1WAAA 2XG4A 3T0ED 1KB5H 2QZQA 2WZAA 1K2DA 3GMNA 3HAEH 3QYCA 4PQXA 1MLBB 3GSRA 5IESH 1R0AL 4LOUC 2Y5EA 4H7VA 4N2IA 1J86A 3LPGA 4XMLH 1U8HB 3V6FA 2VDQB 2WVUA 1MFCL 1Z9LA 4QRRB 4JRYA 4OLEA 4KKCD 5DJ0B 2G5BA 2CM5A 4KV5F 1IARB 5ALBL 3V4VB 4AG4H 3UMNA 4OH2A 5IUSA 3IU3B 1T4WA 2AEPL 1SEQL 4IRSC 2MIZA 4RDQG 5AKRA 4BM7A 1QPXA 4KDWA 4PRHA 3BLKA 1VDGA 3ILQC 2MPAH 4XPHH 1KTBA 5D6DC 1HHGB 1K4DA 1KJ2H 1PLCA 1FE8H 3LRGA 4UCFA 2GHZA 5LCVA 4XR8C 1TTBA 3T0DA 4N2MA 4D0CB 3BDYH 1L7TH 3ENEA 5LG6A 1KLFB 5BQ7A 3O4LD 4WUUB 2JKJA 5TDNB 2R2EB 3BKYL 3DX6A 1P4BH 4FYSA 1R3LA 3L3KB 4NQCA 4Y19E 4DZ8B 1ORQA 1T21B 1FORL 2YEVB 5FWRA 1D5ZB 1OAKL 3LJ3A 3GRGA 2CCVA 1NWOA 1TVHB 1YPZF 5CCKL 3FCTB 4LDEB 1WZ1H 1GPOH 1YSOA 3F04A 1XF5A 2IH1A 1QYGL 5IHWA 3R1GH 2ZKHH 3EYVB 4PJ9C 4PSPA 3IDXH 1TMCB 2CHZA 3LAFA 3FTYA 3FSVA 3GPEA 2Y6SD 2C9PA 2FNWA 5FHAH 3GBMH 4KRPB 1QEXA 2OI9B 3LD8C 5DUPL 2EYRA 2QVIA 4XP9H 3QIWD 1I31A 5GISL 5GGTH 5BRPA 1NTDA 1EEZB 1CE1H 2A38A 5C09A 3C5JA 5DMYA 1G87A 4RZKA 3E7JA 4WW1A 3SE4C 4TQ8A 3QBTB 4Z3GA 5ABAA 3ZDYF 2FATH 1A1OB 1NBVH 5MP6H 3RVWC 1ND0B 1S7RB 2XWTA 2XWBA 3O6MH 4UDUB 3L1OH 4QRPE 2MCMA 1Y7VA 2DKUA 5CEZD 1BAGA 2XT1B 1BBDL 3IF1A 3F62A 2J5LC 2PWFA 5KSAB 1J1XL 2F53E 2VLJB 1DVUA 3ES6B 3N6YA 4NO0B 1S5HA 3LNHA 1NKGA 2DWDB 2A9CA 1RPKA 4OF8A 3BLPX 3IEAA 1AQDA 3CX2A 2DYSB 1J48A 4M5ZH 1F58H 3JTSB 2ZSVB 4HYTB 5LWYH 2HYMA 2FQDA 1X6NA 3KWWA 5ESQB 4P5TA 3JV4B 4F7PB 1M05B 1D5MB 1QBAA 1WAEA 1EQWA 1CO1A 3ZYJA 4AT6B 2E27L 4LVOC 4MVBD 6PCYA 2O6PA 1LP9F 4DP4X 1UA6L 2UVEA 3F7KA 1ES0A 3U1QA 4P2RB 3VXNB 4IK6A 5ICYB 5DQDH 4CJ0A 1QZNA 5GRXG 1JJUA 3ZT6A 2XIIA 3SGDH 3NA9H 2W65A 2Y1YA 4IEFA 3T4AB 1EERB 5L8JB 4ZDHB 1T2QH 3O2WH 5C70A 1ET8A 2QQKL 4GG6F 5HJDA 2FHBA 3GXTA 3QZNA 4NM4H 4NI3A 4DJMA 5F72S 1U3HD 1T0NA 2OMBA 2PPEA 4YHPB 3ULVD 1CXHA 3Q43A 1F6AB 2G2PA 4XN1A 3UFIA 5IHLB 1XH1A 2IAMC 3MMEA 2W0LA 3L95B 4MQ7B 5I6XB 2H26A 2D3JA 3VXRB 4S1RH 1EFXD 1BXXA 2NTFA 3SOBH 4UNUA 3AY4A 1JI1A 1FZOB 1NEZB 1HQ4B 1BV8A 4NSKB 4HLEA 5EO9B 2EXWD 2GBUA 1T03L 4EVNA 5BS0D 2N01B 1D7CA 1X5GA 2LW3A 7CGTA 3H3PH 5B7EA 5AUMA 4KXZH 4C4BA 5B39G 2OTPA 1OWWA 5D5MA 3WDJA 1IBFA 3UABA 3GT6A 2DDQH 2WGNB 1HNGA 1IM3D 3S88L 5C0IA 3HAEG 1YMME 2DM3A 1A7RL 2MHAA 2WZ5A 5E5LA 5MI0C 1DVFC 3P9LA 1KMGA 1NCGA 1KXVA 2GB2A 1HKFA 4R5VA 4K94L 1GC1H 2BZ7A 3HVNA 4JDTH 4NGHL 3EJYC 4F8LA 1QFUH 4M48L 4KI5F 5C2UB 1VZIA 1NPNA 2CDFA 4QF1A 4GO9A 1FYTE 1IGIH 4NQDA 5EUOF 3STZA 2E3VA 3WE6A 1VHPA 3QUYD 1M6UA 4AE1A 2AMUA 4H8QA 1UZGA 1LDPL 3GBNH 3QS2A 4GQZA 4LARH 2VMFA 3N40F 4FZEL 3TIDB 4NZUL 3BUQA 2VMDA 5B7FA 1MNUL 2FEJA 4KOBA 3M17A 4GAJL 4D0DB 4KOCA 3AG1B 2WTOA 1O7DC 4TPRH 1JMZA 2CO1A 3R8QA 4Z3JA 5JMOC 3LQZA 1FIGH 4L4VB 4DFIA 4R0LC 3VDCA 2CLZA 4JPKL 4XP5H 1NBYB 1OT4A 3RFZB 4PBWD 3UG3A 4GRWE 4FCAA 3WY2A 3HBZA 1BZOA 2IDFA 2L3BA 3FB7A 3ECUA 3QCVH 4D9RE 3VDBA 4PGZA 1MF2H 1AD9A 2JELH 3SGEH 2H32B 3PWPD 1PEZA 1QASA 1X5HA 2F8OA 2IFFH 3DWTA 1NBZA 4G9FA 4Q56A 2OZ4A 3CMOH 3VUAA 1YC7A 4LAQH 1AHWC 3WHE0 3AG2B 3BGAA 3FF7A 4MS8D 5CBAB 3P4NB 4UM8A 2BVUA 1BM3H 2ERJC 3DUUB 1SXZA 3VXTA 1JRHI 2HT2C 4Y7OC 1WEJL 4HD5A 3QZBA 1KB3A 3CZNA 4K8RC 1JOIA 3DVIA 1ZJBA 5F89B 3SEPA 1CL7L 2CQVA 4PJGE 4BFFA 5D2NB 2XDHA 3NK4A 3VE0A 4IMLA 4M62H 4WCYH 5AL8A 2Y2TA 2VN5A 1UENA 3C08L 4GMSH 4MMZB 4PTTB 4R4BB 5FUCE 1L9MA 5KBPA 2O61A 4H5SA 5DEZA 1II4E 2H2SC 1CF8L 2G2RA 3W9DA 2WNKA 3UGUA 4KX7A 1FNSL 2AZAA 5IHBA 3MLVL 4FS0A 1KCBA 3EFFA 3UAJA 3FT3A 1JF1B 4PJXB 5HHME 3K6SA 3CZKA 4PVNA 4OZIB 1E43A 1K4CB 2Y9RT 1ZGLA 3N1GC 4PY7B 3I84A 1CCZA 2O5YH 1FG2A 1S78C 1I8IA 4CSPA 1XH0A 5CJ5A 4NN6C 2H7WA 3UYPA 5JZ7D 4UZSA 4RIRB 3D34A 2CLRA 4QTHB 3MREB 2XZCH 2EVIA 2BP8A 1E0OB 3PWNB 5EU7C 4UTBL 3EOTH 1YEGH 3ULUC 1SJVA 2EDQA 3W38A 1HTYA 4FQQA 3NABL 3QJFB 5GJTH 2OTUA 2KC0A 3IFPB 3NZHH 1SHSA 4WI2A 4H88L 3V6ZB 1QBLL 4KK8C 4JPSA 2DEYX 1QEWA 4M7JL 5LGYA 3ZLQC 1TJHL 2E9JA 3H7BB 3OMAB 1QLEB 4E9VA 3QI9C 1RIVL 3MJGX 4ZUWB 3FBKA 1M6OB 3ZE0B 5L2KB 3DVNB 4PP1D 5CN2A 3HKFA 1L5GB 3S96A 2DMBA 5KTEL 1XGPA 2VYRE 2FGWL 3IK2A 5IB4A 4ELKA 5G4NA 4UINL 3D18A 3WI9A 1R6VA 2WXIA 4GQQA 1IC4L 3SYOA 1T1ZA 5JQ6L 1RK7A 1MFNA 3M1OA 1N4XL 3MO1A 3D2UD 1FFNB 5GS0H 4CW1B 5EH1A 4ZUVA 2R0KH 5DHMC 4KROC 3TN0B 5TE7L 3VI3F 1HK6A 2I07A 2Z9TA 5F71A 5E7FA 5SV4A 5MHSE 4LESA 3E3QE 2Z65C 3MJWA 5GRUH 3UC0L 3VD5A 1JYXA 3L3OB 2BSTA 4JO2L 1TPXB 5AZ2H 4F27A 1ZANL 1W0VB 4K7PL 1U8MA 2BIOA 2GYSA 3BUIA 4TUKL 2DM4A 2JJWA 1PEWA 2VTFA 3UTTD 5KSBA 4XNQA 5CU9A 5ESVB 2GW5A 5JLZA 3BVNB 2AERT 4EI5D 2HPOA 1CBVL 2W9DH 4MB5A 1IC7H 4M7LL 3FONB 1P4LB 4PV9A 5F1IB 3NJGA 4EXPX 1SOXA 4XAKD 1JFQL 4ZMLA 1WBXA 3W0WB 1RFDL 2A9ML 5CF3A 2H0EA 2ROXA 5AW7B 4ZOEA 1A7OH 3RTQD 1BOYA 2F74B 4RSVA 1IKNA 1A02N 4OZGF 2BMKA 4UQ2A 4MD4B 3CC5A 4HUMB 3SD2A 3NJHA 4NKDA 1OY3B 4UYPA 4PPTA 2WQAA 3B8YA 1EIBA 5I0WA 2QHLA 4HUWB 1XMEB 1KGWA 3GJFH 3ARGA 1LO4H 1C5CH 1TJMA 5F6IC 5CHNB 3M88A 4RH4A 4R3SB 3G5XA 4F7KA 3EBGA 2XKNB 2VLKB 1MFBH 1DBBH 3ZL1A 3A3YB 3NZ8B 1EVUA 2XSKA 3FT2A 2EIBA 2JKSA 3GXPA 3RKDD 3RWIB 1U8PB 5D1XB 3S3PA 4M4RB 1GOHA 3VVVA 4OBRA 1HL5A 4ZRGA 2VDMB 2Y5QA 4KXDA 4HUNB 1XTMA 2XFXA 4KQ4L 5CP3A 3SDDD 2BZCA 2RA1A 4DN4L 1W6WA 1JSYA 4YO0B 5GSRA 2UWEF 3QNZB 4R9HA 4JFZH 4YEFA 4NZJA 1WBZA 3HG5A 2VUKA 5D7HA 2O1AA 4OIIH 3FH5A 4U0RB 6FABH 5EFIA 1KB5L 1NCBH 2IDCA 2NY1C 1U2YA 2GC7C 5IESL 2UXVA 2O26U 2M83A 2X4SA 3U46B 5I66B 4XMLL 2A9NH 3KHOA 3UTOA 1CFQA 2XACC 4GRWH 4ZO7A 5SV3A 5M95B 1UXLA 1GA2A 5TQ0H 4YDLB 2ADJA 2GJ6B 5HHOA 1FC1A 3FUKA 1CG9A 1ACCA 2VNCA 4AG4L 2G75B 1U8LA 2QPEB 3BPNC 3QNXB 4QHUA 1JWSB 3KPSA 3ESPA 4MAYD 4TTDC 1AGCA 4G1EB 1A6VH 1JVOA 2WKOA 3EO1A 2MPAL 3MFFA 3BZFA 3KCPA 1UASA 4JHAH 4XPHL 4F7EB 1KJ2L 1FE8L 2FJGB 2MTPA 4GINA 2PWDA 3QDJE 5GRVL 4MDIB 4O02B 3BDYL 1L7TL 3KGRA 4RRPG 5JA8B 2VJ8A 1FO0H 5GXBB 4GXUN 2WC7A 1XF4A 2KLTA 2NY2B 1P4BL 4OVVA 2EDDA 2NW3B 3TCLB 4WU7B 4LCYB 1YEHH 2JXMB 4Y5XA 1FL6A 3C60A 1VA9A 2PXYA 4JL1A 4JREB 3NEOA 1WZ1L 5CILH 1GPOL 3HMXA 5C1MB 5DMKB 5IOKA 1CVRA 5C3IA 5IB3A 4OJCA 3R1GL 3FU6A 3FUJA 2ZKHL 1DUYB 4RFEB 5C0GB 1C8PA 4N2FA 3IDXL 1BFOA 4JFSA 2MQGA 3V4PH 1XSJA 1WF5A 1TZIA 1UXSB 2DI9A 5FHAL 3GBML 4P5TC 3T0EB 2HN7B 3GTVA 4XP9L 4WW2A 1YEIH 2Z31A 2QMJA 5GGTL 4OCYH 4KUCF 1X5ZA 2J44A 4LHQB 4ZFOA 4R4FH 1B3JA 2D7TH 4ZMOA 2VXTH 3L7FA 1H6EA 2IBBA 2IMMA 1MCDA 2FATL 4GRLC 2FJFA 1DFXA 1NBVL 2YUWA 3Q3GB 5MP6L 1I8MB 2AJZA 3ASWA 1CICA 3FH7A 4F33B 4JFOA 2B5IC 4A7QA 3ZO9A 3O6ML 1N0LB 3L1OL 3TURA 4HPYH 2UXFA 4HC1A 3SB3A 2D9QB 2SEBB 5B1CA 1A4AA 5CLZA 4X6FB 4WY7H 4ZSOA 1GYAA 1PDKB 4UQ9A 1TTUA 3IN0A 4FNSA 5B3SB 3KWVA 5EU6D 3RILA 1JIBA 2VLRD 3QFDB 1RURH 4XT1C 5D55A 3VFPA 2NYKA 1QABA 3V95A 3L4TA 4MXWH 5FC9A 5TE6H 1F97A 1ZLVK 4BK8A 4M5ZL 4JNXA 1F58L 2NY4D 3QPQD 5LWYL 4KGLA 3AY4C 4D0BA 1HQRA 5J6SA 4OUUA 5HSFA 2CJTA 3GFUA 5F8RC 4OM0H 4KKAC 4M9OA 1E28A 4QTIL 4TRPH 1BIIA 3AREA 4KXCA 5HYJE 5I9QC 1A47A 2X4NB 1SBBA 2ZXDA 4IDJH 4M00A 3WEAA 4B5EA 2Z7UA 4RAHA 3GBLA 1JGUH 1UATA 5L4MA 5T3ZD 4GAFB 4HFUH 1KXVC 5SWZA 3ULAB 5DFVD 2OMXB 4TOYL 4JUTA 4ZOBA 5DQDL 4FTVE 3N1MC 5E8PB 1LDSA 3P1VA 1AVAA 4LCCB 3ZOAA 5B38G 5JOFA 1PKQA 1USZA 3NA9L 3RNQA 5EF1A 1T2QL 3IKCA 2G4EA 3O2WL 3QULA 1XBRA 5TGBA 1OE3A 2O6CA 4GKZB 4XP6H 4NM4L 3FB5A 3JYCA 2XN9D 2ZX8A 3AABA 5DVMA 3GC3A 1Q1JH 4BA0A 4UOZA 2CNZA 3I6GA 4S1RL 4TNWF 4E41E 5KOMC 2GT9B 5HI4D 1JPEA 3SOBL 1XGTB 3P2TA 2OJEB 1WUNT 3QXUA 3UTZA 2DM7A 1U93A 3KW7A 4HS3A 1C1EH 4ZMYA 3GM0A 3SQBB 2HLAB 2HVBA 3H3PL 3VXSB 3BAWA 4V2CB 1JNJA 3VRLE 4OLYH 5TDPA 3O6LH 4N2GA 1CD1B 3K72A 1JHKH 2DDQL 3RI5F 4JLRA 2P5WA 2X70A 4HULB 2FECI 4QT5A 3I6KB 2ODHA 4KGJA 2PW2B 5EN2B 4U1KA 3L48A 4AYDC 1GC1L 1DSWA 3D09A 1JNLH 4YXKH 1QFUL 1YNLH 3WIHA 3RY4A 4WNSA 3PWVB 4JBSA 2D7PA 2P5EA 3D52A 4PWKA 3KLAA 4YVUA 2A99A 1IGIL 3MRLB 5JQIB 2DJMA 5E5MB 3EOAB 3CUPA 5E2TH 4PJ5A 2J7LA 2H2PC 3L4YA 1XR8B 3E0GA 3GBNL 3V6OA 3QYMA 2FZ3A 4NQTA 4BCZA 4ESKA 5KVMC 1YVLA 3IPFA 3LZLA 1MZZA 5KBDA 3T08A 4CU7A 1KYOK 4LB8A 4HOZA 5AFAA 4GAYB 3QEGH 4LCWE 5E1AA 4XZUA 4I7ZC 1H8LA 3G3LA 4JZOB 3ARFD 2ZAHA 1A3ZA 1FIGL 3O8XC 2EDJA 1T0MA 4LZKA 4XP5L 4L9DA 3HNVH 2BH0A 4Q6IA 3GSOB 3I2CH 4PP2A 5CINH 3BE1H 1DEEB 1EAPB 1S3RA 1Y6NR 3QCVL 3K6NA 4IIQA 3PQYA 3TONA 3UAJC 1CFSB 4F57H 2JELL 5AYUH 1QRNA 2YEZB 2AQ3A 3NGBB 4MRBA 2IQAA 2B59B 3V5HA 4AL8C 3HS0B 2IFFL 3CQQA 4G8IB 4LO9A 2F9BT 4PI0A 2VABA 3CMOL 3H9SD 1AR2A 2J6EA 4LAQL 3GSNH 4G43A 3VH8B 2JKNA 3CSPA 2WCPA 1BM3L 5FOJA 3HPLB 1M2VB 1IM3B 4MNQD 3KJ6H 3EYFB 1KYAA 4U3SB 3L3DB 3MGOB 1SFHA 1V7MH 5EZJA 2OSLA 2V9QA 2VRQA 5EV7A 2WO4A 3ECBB 4J2QA 4X7CC 3P0VH 4JFQA 4RA0C 4IS6B 2Y72A 1QSFA 3FZUD 4JANA 2DQJH 2IGFH 3JXAA 4M62L 2K6YA 3H85A 2DWXA 4NO5B 5AZUA 5B1JA 4YAQA 3AWEA 4LLYB 4CNIB 5C0NC 1X9UA 4GEJA 1PQZA 4LLMA 4NC0B 3DUSB 2JKXA 3FQXA 3LKQA 2HUHA 1UQSB 4QGYA 1M7XA 4U6XA 3IXTA 4KJQC 1U8QA 3DV6B 5CKGA 1BJ1J 3O6KH 3HB3B 3AS1A 1E27B 1MJJB 1W91A 4XB8A 1TJGH 3IDNB 5KAQF 3CZFB 4Y1AA 1EUTA 1WZMA 4N24A 4PR5B 1BMWA 2DD8H 2FJSA 1GVIA 2OMWA 4AVJA 1DQJA 1KLGA 2WB1A 1E4JA 3LB6C 4NC2B 4IHOA 3OBAA 4HKZB 1YPZB 5CZXD 5C0AB 4JM4H 3TBTA 2Y07H 5F7FA 1UKSA 4ABVA 3LSOA 1OALA 2DPKA 3O41A 2ICEC 3FBQA 4WHTA 2Y7NA 1FFPB 4UIKH 4AK1A 5JHAA 3CZEA 4HG4J 2XZCL 3GM8A 3EOTL 3IMTA 3PWPB 5AVUB 1YEGL 2Z7WA 5D7LA 4NQED 3K8KA 1D2OA 2A0LD 2FO4A 5I5MA 3SODB 2JVUA 3BMVA 3NZHL 2QLVB 1CLOH 2PYFB 1SXBA 4EUPA 4UOJA 3UTSD 1JHTA 3BAEH 3UTQB 1FFTB 4LPWA 4ANWA 3KYNB 1JGDB 3ZDYB 4RMUA 5AYQA 1NFKA 1YLBB 2BCMA 1KPUA 2BOLA 4OTXH 2RFXA 2VWEE 4OFYA 5EUKA 1N2RA 2NQCA 4Z0XB 5K39A 2YMXH 1FHGA 3QQ3B 4ERSH 3GZOA 2Y2YA 4ZFGH 4CDHA 1T6VN 1DZBA 2LLGA 2WB7A 5DWUH 4EI6A 3ZMRA 1IKNC 1OQXA 4FQJH 3OGCB 1V05A 5F7DA 4H26A 2VXVH 5GS0L 3RJQB 1HFUA 2JK5A 3IXAB 1ZJAA 1BJ8A 2ESVE 3MI6A 4U7KA 1IJNA 4RWHA 4ZAKD 5CMAB 2KPNA 3ARGC 1TQCC 3R0NA 3LH2H 1Q94B 2CUAA 4JFFA 1LYQA 1K8DB 1NCOA 2WOBA 5AVTB 4F1ZA 3IMSA 1UA3A 2ARJA 5AZ2L 3CMGA 4M6OH 5HJGA 2J3SA 4BFJA 1TCRB 2JI2A 2XVLA 4Y5VC 4PD4J 3U1PA 4DEWA 1LWJA 2WLIA 1VEPA 2XNAB 5BPPA 5SWSD 2YZ1A 3P4MB 1LP9B 5C07A 1JGLL 1WWBX 2NXYC 2DQMA 3AACA 1F18A 3CSTA 4F7CA 4H8WH 2W9DL 1IC7L 2VMEA 1EWHA 1DQDH 4CGUB 1O7DE 3T0WA 2ADGB 4DQAA 4JKLA 5AW2B 3K8MA 4Y19D 2PPFA 4FJYA 1W0WA 4KJWC 2APBA 3FYIB 2Z93B 4MZ2A 4GG6B 1A7OL 3O11A 2OSXA 2YXWA 1MY5A 4G8GE 4GRWF 3O3AA 4JQIA 3QHZL 1U36A 1SXCA 1X7SA 2YN5A 3P11H 5E08H 1BVKB 4TULH 3WE1A 2ICWB 3V0JA 1AIFA 1HHHA 3D12B 3OKEB 4JL2A 1LO4L 1C5CL 5CU5A 3Q6GH 5B7MA 1A9VA 4XX1G 3V9CA 3GRWA 2CGYA 2Q86A 3BD3A 5JORA 1MFBL 1DBBL 4OGQC 4Y9BA 5IOPB 2Y0SA 3ROOB 3D2UB 4JO3H 1I1CA 3MYJB 2CO6B 4L3EA 5CJBA 1WWAX 4ADJA 3ZKND 2YD8A 4L0YA 3KVPA 4JM2A 2WYIA 5IBLC 4FQXA 2GSGB 4EEEA 1UVQA 3MACH 3NN8A 5ISZE 4PJGF 1Q9KB 2E6PA 4QHKI 4R2GD 4BFBD 5F96H 1SJEA 4RBPH 5KN5B 4FHJA 4FNUA 4JFZL 4QO1B 4JVUA 2I5YH 4OIIL 4PJ7A 5IW6A 6FABL 4OFDA 3KXFD 2BP0A 3OXRA 1NCBL 4Y5XC 2AQQA 3C60C 5EUOB 4Y16D 2PXYC 4S1QH 5SX4H 3UTTB 2F53D 1BAFH 1G4MA 4K5NA 5BV7B 2XX1A 4LEXH 2A9NL 3BVWA 4EI5B 3C9NB 3QWQB 1BWWA 3ZHDA 2X2UA 1JUFB 4U7MA 2MNUA 4QHLB 3BUPA 5TQ0L 1RD6A 4FXLA 3T2QA 1QQDB 2IC2A 1LO5B 5DEFB 3EDKA 3N1PC 1UD5A 3L13A 2ID5A 4J8RA 5E2UH 3T4YA 1XL4A 4AYFA 3OJVC 5T5FH 4L8SA 3CC1A 3VYOA 3NJFA 2LHAA 3T1FB 4DFHA 1A6VL 2WTPA 4RRPM 3CN3A 2WO3B 1QO3B 4JHAL 2BHZA 3N5AA 3S2AA 5A6IA 5EU7E 2A7BA 4NKMA 3ULUE 5E2VH 4WNJA 1KZYA 5D72H 1YQ2A 2J88H 2WLKA 3APDA 2R29A 1FO0L 5F9JB 1CICC 2X4OB 5FLVA 1FWXA 1TVBA 5JXEA 3MJ7B 5E8DH 4H40A 3N44F 4X8JB 2JB6A 2ADFH 3D3VD 1YEHL 2X53A 3ARWA 3JT2A 1KXTB 4HEMA 5CILL 2DIBA 3M1BB 4L23A 2R1XB 3HC4H 3TBYB 4YSPA 3WNNA 1UXMA 1ICTA 4MAUH 1LM8V 4Z1PA 1FQ9C 3MTXA 5J57B 3WTWA 1LE5A 5D93C 3KBPA 3TGXA 1I7UA 1ASQA 1CN4A 4HMCA 4IGBD 2W38A 4JFUA 3CXFA 2ICCA 2VISB 1YEIL 3LS4H 4EN3D 5IKCB 3KL0A 4KXBA 4OCYL 3AREC 5DJ2A 3DO4A 2PCYA 5EEYA 5T5NG 3BEVB 1OARH 4R4FL 4X6BB 2D7TL 4HWZB 1F42A 1G6RA 2VXTL 5F7LB 2YD1A 3RX8A 5IMKB 5BVJB 1WCQA 1SYVA 1W8OA 4AMXA 2ZOUA 2XN1A 4YL4A 1I1FB 4O51B 2VERN 3TBSB 5J1AB 4HPYL 3MRIB 4MAYB 3GK8L 5F2FA 5I24A 4JDEB 1F8TH 1YEKH 4LVNC 1DQMH 1FYTD 4WY7L 3WKYA 4JZNB 1IKFH 4UYQA 4TQPA 3K2UH 2R7EA 5BO1H 1NANI 1NGXB 1P6FA 2V5YA 4YR6A 1RURL 3Q1SH 4OI7A 4D8PB 1S5IH 1TZOA 5TE6L 3EGDB 5L0QB 1VFMA 3Q7JA 4JY6B 4W9CC 4L29B 1Y07A 3MRJA 2A74A 4PJCA 4ZYKA 4TSBH 3S3CB 4F2MA 3DPBB 1H3WM 1QUNA 3KPMA 4Y8DC 4TRPL 4JPQA 2BIMA 1OAUH 2MOQA 5EO1A 4WKZB 3PAVA 2L8AA 4XPBH 1EDQA 3DMMD 1ZA3A 4IDJL 2EKJA 2ATPA 1SEBA 1JGUL 3G04B 4HFUL 3NRFA 4PRHE 5J9PA 2ITEA 2KUTA 4WWNA 2A6KA 5E6IA 4LLVA 3ZHKA 1T80A 5C0DA 4FJ6A 3RIKA 3UZQB 5IHZB 1P53A 4OFPA 4IU2B 3DI2B 1NEUA 1IGFH 4XP6L 3ILPB 3OHMB 3GDCA 1X5KA 1ZA6A 5CJOH 3V6OC 1BOGA 3QO0B 2E4FA 1XF2B 1SOKA 3KJ4C 3VI3B 5DA0B 1ZTXE 1QWUA 3LRSA 1Q1JL 1PGRB 4G5ZH 5E4EC 2EACA 4K71C 1HSBB 4GUPB 4XVSH 4LLUA 4OLZH 5CO1A 1C1EL 2QKSA 2HTLD 3IE9A 3LEYH 4HALA 3P54A 4B41A 5KVFH 4QXGH 2AW2A 4OLYL 3O6LL 1P84K 4GKNB 3B43A 3CE1A 3S4SB 4QLRA 2FEDC 3J2PA 1JHKL 4Q6IC 1DP0A 4ATWA 3NPSB 4W70A 1TJIH 4IIQC 3VFRB 1A9EB 5JO5B 4U1LB 2GY7B 5HHMD 4N8VB 3O81A 2ZG3A 4IOFC 2QV2A 1JNLL 4YXKL 1YNLL 1ZVNA 4HP5A 3RVVC 1KB5B 2AXWA 3CH8A 5IFJA 1EDYA 1K8IA 4DKFH 3O0LA 2YGQA 4K8RH 1JAEA 2J56A 5E2TL 5IMLA 2BM3A 4OZGB 4U2YA 2PTTB 4XNZC 3GS0A 3VFMA 5AOKA 2WINB 3HS9A 4LDCA 3STLA 1MWAA 4FXGA 4N2EA 4PLJC 1YAZA 4L9LA 4HHWA 1NM4A 1G7LA 5H35A 3QEGL 3QXDB 4P3DA 4HUCA 3KLHC 3CFBA 2FYYB 4WEBH 4W9FC 1IAKB 3HOGA 3MLYH 1E2VA 4HHGA 4O9HH 3ZGIA 2GSMB 2AJXH 4PRBB 2EINB 5IQOA 2VE6A 3D33A 5J13B 1S9VB 3HNVL 5FF6A 2X1OA 4UDTB 2WZPD 3FB6B 1JVLA 1QBBA 3I2CL 5CINL 4DWHA 3BE1L 4AQ1C 3QIBA 1QKZH 4UOQA 2VRAA 4WDIA 2VSDA 4F57L 5AYUL 1OTTD 2UWEB 1ZHNB 1HILB 3PRZA 2VDRB 3SHSA 1RZIA 1NCDH 1R5WB 1WFNA 3F7VB 3D4CA 3QUML 3GSNL 1KDIA 2PYEA 4HXBH 2XXCB 5C0JA 3IETB 2QMKA 5GZOA 1VFUA 3CHQA 3KJ6L 4NIYE 2L7QA 4K4KA 3L8QA 3G5WA 1CI3M 2BVPA 1V7ML 4KNQA 5D4JA 1UEYA 5A2CA 1IQDB 3N1QC 4JRXA 1S7TB 4P5KA 2FUTA 3P0VL 3U48A 5I8KH 1A65A 1S2EA 4Y4FA 3H9YA 4XMKH 4DEUA 2GITA 1ECZA 1BA9A 4G82A 4Y88A 1LEIA 2DQJL 1PNDA 2IGFL 1DJWA 2MNWA 5KG9A 3UBXB 3QG6B 3QG7H 3QJHA 5KBKA 3BWUC 3FO1A 3SDAA 1M4KA 5CP7B 2VZVA 4HUUA 1J0KA 1NDMB 4YHNB 1TQUA 2ICES 4P3CH 1INEH 3FTVA 3EO9H 3MA9H 3O6KL 5SX5K 3DX4A 4ATTA 1S9KC 4QYAA 3CD4A 4NN5B 3VRJA 1PIGA 3P77B 4KX9A 4HWNA 2DQFA 5T5NF 1MH5A 1N3NA 5B3JE 2WM0A 2EH8H 3TA3B 2PTVA 4GAGH 3TBVA 4AZ8A 3FDWA 3ARFB 4ODWA 3PXLA 3EG9A 2Y07L 4TLUA 2H9GB 1VACA 5T1KD 2FWOA 3MNMA 4ZW8A 4JFEB 2F54A 3FO0H 5TFSH 4PRNA 1OTSD 4X5XB 4UIKL 3BWAA 2QQNH 5CSGA 2VJXA 3EHBD 3FK3A 4NQDE 3WOVA 4EN2A 1PD0A 2MPVA 4R4ND 4AGOA 2GCYB 3DA0A 7FABH 1N18A 1OGTB 1CFTB 4MSWB 1O9ZA 1QA9B 4IRZA 4LP8A 4PJAE 4TMPA 1SMDA 4HKJB 3WNLA 3D07A 1CLOL 5B22A 3X12A 3DBSA 4MNQB 1BVLB 4HIIA 3BAEL 4N0YH 3QZWB 4W6WB 4M7ZB 3UC2A 5F3HB 3LQMA 5DHYA 2FL5A 3KPNB 3UGEA 3D85A 4OTXL 1Z3GH 1XZ0A 2YMXL 4N9GA 4ERSL 4ZFGL 4LVHC 3DGGA 3MRDA 1QVOA 4RNRA 3WUZA 4AEIH 1OOAA 5IG7A 4L4JA 3MRFA 2QL1A 5DWUL 4ONHA 4X80H 3VRLF 2G5UA 1MW3A 1PAMA 4FQJL 1RERA 1CGVA 2VXVL 5TPWH 3AFLA 1BSIA 5FCUH 1CPUA 4G9FE 4ONGH 2ILLA 3US9A 4ZS6D 2NY0C 3KBHE 3O3EA 3RAJH 3ABZA 4AQOA 3MJ9H 3BYTA 2A83A 5T8IA 3JVGA 3BP5A 4AKOA 1EZLA 1FVCA 1PS3A 2BNUB 3LH2L 1CIDA 1WFOA 2BC4B 4GXUM 2HJFA 1YNTA 3M6DA 2OXHB 1T7VA 2X4PA 1RXLA 2XVKA 4ZOCA 4MMXA 4M6OL 3VWJD 1VLXA 1U91B 1WTGT 5LN8A 2AEIT 4AJWA 4Y7MA 4PAZA 4JM2C 2CMRH 4FQXC 3W11D 1ZTXH 1BMZA 4H8WL 2WYTA 4Y0GA 1F3DJ 3IGFA 1JV5B 1NOLA 2OA9A 1DQDL 4RGNB 1H9VA 2X6MA 5DHVB 2D03H 3R8BB 4OY9A 1O6SA 4QR7A 3UAEA 5EU3B 2AEQH 1BECA 1R4XA 2CUIA 5DMGC 3QUXA 5KSUA 4OF6A 1JWUA 3T2LA 1ZVHA 3O9WA 5IJBC 4E68A 1FAKT 4MQXD 2GUOB 4PG9A 1HDMB 3LX9A 3VFTA 1KZQA 4KK5C 2KERA 1JFHA 1KXQA 3P11L 5E08L 5FO9A 1KCKA 2K8MA 2NX5B 5FA4A 3QXTA 2A4CA 3Q6GL 3RGVD 2VZTA 3UMTA 5EC1A 2KH2B 4L8SC 2BDNH 3HZ3A 3T8MA 4BRJA 1FL5B 2X4TB 1WD9A 2H3NB 3RNKA 1HSAB 4JO3L 4L4TA 3FSWA 1TYEB 1YEFH 4KRLB 5CD3A 3DVGA 4PJ6A 2BIHA 3ECQA 1J18A 5C0BD 3ALWA 4OD2A 1TFPA 4QCIA 2OJZH 3MACL 5JXEC 2CIKA 2ZP0T 5F96L 3R0MA 1QI5A 3RIAF 3C5ZC 3RPKA 4QEGA 2I5YL 1LE9B 1CS6A 3LIZL 4S1QL 4MASA 1BAFL 3OG4B 4GBXD 5EMYA 2BVEA 2CBOA 4LEXL 1WC7B 3EBAA 3L5WA 1F1AA 5HHPB 5JUEH 4WJ5B 4DHLA 1E4XH 1ETZB 3MGTB 2ODIA 5ETUA 2R2BB 1VFAA 4Y19B 3MRNA 4KUZH 5E2UL 4LSRH 2BVOA 3LKSB 3REVA 5KANI 5T5FL 4V1DA 1UJTA 3GMPA 1X5YA 4DZBB 3UP6A 1EHXA 4U1SB 3KPRE 5KYYB 5E2VL 1PY4A 1RMFH 2GTWB 4UF7C 3PV7A 3QQXA 2AJYL 3MKGA 5D72L 5FKAA 2J88L 4JFPA 3CDCA 3Q06A 2FR4A 2WXHA 3SDCD 4FTVD 2H0FA 2Z35B 4D7PA 2IDTA 3B5GA 5E8DL 1IAII 2O5NA 4R83A 3UIZA 1ZEAH 2WLLB 1MCJA 1RVFH 4F93B 1DVYA 1JPTH 3P3YA 1CI5A 4WNQA 3I85A 1E7VA 3US1A 2DI7A 3K0WA 4G1MA 4BQ8A 1FSKB 3QDGD 1H3GA 3HC4L 3DOSA 3JYBA 4YN3A 3QZMA 1A7BA 1PF3A 3ECWA 1F3JB 4MAUL 2Y7MA 3O4LA 2V2WB 5ECGA 2BNQD 5EO0A 4F80A 4P2QE 4R2GB 4MJIE 3Q13A 4QRPB 4Z3EA 3O6FA 1UT2A 4PVLA 3M8OH 5I82A 3WUWG 2A74C 1DBAH 3X1GA 4A7UA 2JI3A 4N1HB 5FYKE 5K1VA 3LS4L 4Y16B 3RJDA 3JTBA 2F53B 2N1KA 2YBRA 4MXQD 2GIMA 4ZXBD 2R2HB 1SY6A 4QXVA 1GYWA 5GIRB 2Y4SA 5I16B 1CTNA 2XWDA 1OARL 4TQEH 2YPLD 1YC8A 2KKQA 5FECA 1ZHBA 4L8DB 2XZAH 3J8F7 3QK0A 1D9KA 1OP5K 3OC8A 5E6IC 3K6FA 5E23A 3QISA 3MRBA 3MV7D 43C9A 1IC0A 1F8TL 1U8NB 1YEKL 1DQML 2WPGA 2X4RB 5A2AA 1IKFL 3EOBB 3IDGA 5BO1L 3K2UL 1HYSC 5DHXB 1DYZA 5G4OA 2ZOLA 3WS6A 5MEOB 4P5MA 2PCXA 3Q1SL 4H0HB 4PS8A 3AVEA 5E8EA 1S5IL 5EULV 4NERA 3GSUA 4NN7B 1UB5B 1BAWA 2EQDA 3PWJB 4HA1A 2XQ0A 3V0WH 5A6MA 4LCWD 2ADIB 2CIIA 3F7PC 1UWXH 1KIUA 2ZT9C 2QGDA 4QHNB 3VU2A 4TSBL 3AITA 2B7DT 3MNZA 3AS2A 2BX5A 2MFNA 5D2LA 1NIFA 5DRZB 1YYLH 4M5TA 4AOFA 1OAUL 3KYOB 2UXGA 4ZMQA 5BJTB 4G6AC 4QRQB 3EGXB 5K5YA 3WGVB 2VW4A 4XPBL 4IOSA 3F7LA 1RZ8B 4HJIA 3RGHA 3KPSE 4UT6A 1RHHB 2YLKA 2WXGA 4YNYA 1G9NH 5AW0B 4AIEA 1IUZA 4ADGA 5FW7A 3L2MA 3GIZH 3SKNB 4IGBB 1MCCA 3SPVB 2WXMA 2IADB 3VFUA 1UM4H 4F9LC 2PCPB 5LG1A 4GXVH 4DVRH 1HXMB 2V3EA 2I60H 3CH1B 2DYPB 3MNVB 3RVWD 4LDLB 2C1PB 1R33A 1IGFL 3ZQXA 3QQ9C 3UEZA 3WFHA 5B38B 2XOTA 2X0UA 4LT7A 4D9LH 1YMMB 5CJOL 1WLHA 2UUDK 4WWKA 4FXGC 3T65A 3WHXA 4W9EC 4AQEA 4PJ8A 2O6DA 3COOA 3EJZC 4L9LC 4AV5A 5IM7B 1REIA 3JWDC 1FZJB 1XF1A 3WS3B 1ZGLP 3APMA 4G5ZL 1L4IA 3K5SA 4LF3B 5D71H 5EZLA 3RWGB 3RWDB 1NUDA 3AUVA 4XBMA 2ZWLT 4M6AA 4XHJC 3H7LA 1S7VB 4XVSL 2F18A 1FYTB 4OLZL 5L2JB 1MCPH 1EGJA 2OL3A 4R5TA 3SGKA 3D08A 1PAZA 5KVFL 2DQGH 4QXGL 5J56B 1L6XA 2CR3A 1OSZB 3GZQA 1EFXA 3QIBC 1TJIL 1XD0A 4P46B 4HX1B 4LSDA 3VWKA 1RZKH 3LIUA 5E1GA 2EXTA 1AR1D 1WVZA 4PGBA 3H4HA 4UUJB 4N2CA 4JR9H 4DKFL 4K8RL 3ULUF 4YHYC 5HGAB 2X38A 7PCYA 4GRWB 1EEYA 3RWCB 3SOTA 4PJFA 4N8CH 4N2BA 4XBGB 4CSZA 3R7QA 4A39A 4ZSOE 1Z3RA 4HZ1A 1F4YH 5JPMC 4M8QB 4Y4FC 1HXKA 1WFJA 3D69B 5DZNA 5I2IA 3VD4A 4XXDA 3I75A 2BSDA 3BP6B 4WEBL 1WA0X 3U7YH 3NT0A 5TF1H 4YHZH 5H2BA 4FG4A 3MCYA 1I7RB 2L7JA 4L1SA 3MLYL 4FE9A 4WO4B 3IDYB 1CFNA 1FNEB 2ZYRA 5DZLA 4O9HL 4MX7A 2YPKA 4N6RB 4JHVA 3TT1H 3WIFB 3IJHB 2AJXL 4KAQH 4LFHD 2B3IA 4YHOH 3HCVA 4AENB 4JE0A 5IW1A 3BGFB 2XV2A 2F8IA 3IFOB 1QKZL 4TL5A 5GQBA 4G8FA 2B39A 5J06A 4PJGB 4FMVA 3HE6C 5D7JC 2MH4A 5DSCB 1NDGB 4KKQA 4G7RB 4Z6AT 1Z9SA 3C6LA 4HXBL 1EX0A 3BWZA 1AGEB 1FNHA 3VW3H 4K7PY 1NGYB 3CSBA 3G9VA 2QKIB 4XC3H 4NP9A 5E9NA 1NMAH 2DICA 5HHMB 3DOIA 1E9QA 1KPRA 3SPIA 5I8KL 2NLJB 3SE6A 2NXZC 2WLZA 4X6EB 1HHIA 1S8DA 4XMKL 3PDDA 1ZMYA 5HJ3A 4Z77B 1QLRA 4PGEB 5JNYB 3MAWA 5HHNA 3VXUA 2R0WH 1ZSDB 1RY7B 4R26H 1J8HA 5EBMA 1QSEA 3QG7L 3RL1A 4BK4A 1V3JA 2EE2A 2IGTA 2IWGA 2OCCB 4TL4A 4P3CL 1B0WA 1INEL 2C3HA 3EO9L 1FNFA 1JPST 4M8RA 1RJZB 5DC2A 3OMIB 3DRTB 2HJKA 3PABA 2ZUSA 5HYQB 3K4DA 1QHQA 1NSNH 2EH8L 3N44B 4GAGL 5E8NB 5GS1A 3P73B 1OWRM 1HOCB 2BNRA 4Y4KD 4RAVB 2XG5B 3S37X 4ZD3H 2R59A 3F5WA 3FO0L 5TFSL 2FTAA 2JIXD 3QJZA 2QQNL 2BFGA 3H2QA 2P5EE 1A4CA 1LL1A 5KYWB 3JVGC 1CDJA 2CCLA 2YARA 4NRYB 7FABL 2HT2D 2NCMA 5DJYA 4J1UB 5E51A 4LCUA 3MV8E 5E0FA 5IEHA 3V6OE 3FOMB 1AACA 4UTAA 3WJMB 3SDXA 1U3ZA 1U3YA 2P26A 5PCYA 4C56D 5KYXB 3MLSH 1PG7W 3LDBB 4EE2A 5A40E 4N0YL 4AK2A 2YGPA 4FXTA 4P2OA 1U4FA 1Z3GL 4FQHA 4I0PB 2C7UA 4LRIC 2VDKH 4LMQI 4QRSA 4PY8J 1Q9OB 4GQPH 3QUXC 5DDHB 2XQYA 4FFWD 4AEIL 1F6LL 4ZNEE 3IKKA 4X80L 2A2QT 3RUGE 3VB9A 3PQYE 1PD1A 3QEQA 3DX9B 3WY4A 5TPWL 4ODHH 5FCUL 3WNJA 4ONGL 1BF5A 4WEUD 3RAJL 3MJ9L 5IMMB 3BLBA 1KGCD 2QADC 2NNRA 1UZ8B 1Y18B 2C8NA 1F3DH 1F11A 1S78D 2HFFA 3S3JA 1IGJA 1XEUA 1BVZA 5TTRA 1MN4A 1SLVA 5CZKA 4S10A 5DZPA 1KIQB 4X99A 4Y5YA 5EEXA 2OMUA 4A68A 3ULUD 5D1QC 1KBGH 3S3SA 5EBWB 2CMRL 4XNUH 1JI2A 5GRVK 2QZ5A 1HC1A 1ZTXL 4I1NB 1X5LA 3FUNA 4ZJ9A 3EHBB 2H45A 1WAPA 1PMYA 3PNWB 1A64A 5FM5M 1JGIA 3W9EA 4R7DB 2NYYD 1PVHA 4LU5H 3U82B 1VFBA 2AEQL 2LT9A 4JHUA 1NLBH 2AJ3B 5EIVA 2P24A 4Y1AE 4RQQB 4C8XA 5CBEB 4PH8A 2BW5A 3AAZA 5AKVA 3EH4B 4FNTA 3ARDB 2XETA 4Z3TA 1PIFA 2UX6A 3EO0A 3IDUA 1EH9A 4KITB 3Q9QA 3TO4C 4JJ5B 2HFEA 3KPLA 4OIBA 2A6JB 3VTMA 4NENA 1A21A 3PIQB 1U95B 2JV6A 3L3HB 4HHAA 4U1NB 3O2VH 2BDNL 4RSYA 3ZGHA 3DTUB 4J6IA 5DJZB 4M1DH 2XA8H 3QWRA 1CXLA 1YEFL 5LGJB 2OS7A 5FGBA 1A2YA 4A7VA 5LDSA 3QQDA 4OB5H 2FT6A 5ENWB 4WTZG 3FPYA 3JWNC 4KKCC 4FHBD 1SM3H 1XR9B 4L2LA 4ZFFB 2OJZL 1R5IA 2VQ1A 1XAKA 1JRHH 3KS0J 3NCJH 4YJZL 1CXEA 3MRMB 5FGCE 3QUMB 4AQAB 3LNEA 3VWJB 5A2IH 1B2WH 4ENED 1AMYA 4OU3A 4UIMB 5EEVA 3QDJB 4XO5A 3ZUCA 5E95B 3U1SH 5IVXE 4JCMA 5JUEL 2OULB 4PRDA 2PP8A 1E4XL 1C16A 4KDTA 4OCMC 5B3JF 1TYRA 2WQRA 3O6FC 1I1YA 4UM9D 5D5MF 2AXHA 2L4OA 4NFDA 4KUZL 2V4LA 4LSRL 5DGQA 4X4YB 5HHQA 3IAGC 3FJTA 5GGUA 4PU2A 4NRZB 4S1SH 1PZ5B 3EJTA 4JRYD 2H4EA 1OP9A 4N1EA 1C7SA 1X7QA 3MRPA 4YX2H 3KM1A 5E8OB 1IEBB 3BPOC 5L4IA 1IL1A 3LVEA 4HWEH 1RMFL 2WWMD 4U3XA 4H1LB 3PF2A 1EXUB 1D9KC 4PRHD 5JDSA 1NAMB 2A6IB 2V3FA 4IBQA 4QRUB 1A66A 3QIWC 1YY8A 4PY8I 3MLZH 2OQJA 4FFZA 3LQAH 1CXKA 4PJAF 2NSMA 4P4KA 4P05A 3ARRA 2R27A 1RVFL 1JPTL 4CMMB 5ESAB 1GGYA 4ALAC 4U6YB 2XWXA 3TYFA 1QFWI 2CHDA 5JPNA 3WS6C 2YOCA 1VERA 1ZT7A 1RLWA 4K3JH 3ZL2A 3BI9X 5LNEA 3BSHA 4NQCD 1VKXB 1BQSA 4YFDB 3R19A 1JK8A 4HEPA 4F8PA 4QRBA 2UYLA 4BBWA 5FB8B 1G1KA 5EC2B 3GMLB 1V10A 4KFZC 5C9KA 1DBAL 1KIPB 4M3KB 3HG0A 3F3HA 4QRFA 3DBXA 1ZE3H 2V8LA 2I7SA 4GBXB 2HLFD 2ENQA 4PRAB 4FQ2H 4LLQA 2Q87A 3T8XA 5D7IA 1U8KA 2R8SH 2EXSA 1QOKA 3B9DA 3V4UH 5AD0A 2XZAL 5DHEA 5FO8B 3MV01 2HA1A 2DQCH 1ZS8A 3GLDA 3FC8A 4RMRA 5C09D 4XO8A 4ECNA 3TZVB 5JHBA 1OLZA 1C5DA 3CBJB 3B4NA 4WK2B 3V0VA 3W1ZA 3SKOB 4FA6A 2G2NA 5HYJB 1IT9H 1OGAA 1KGJA 5I75B 1OSEA 1DN0B 1FL3B 1ZWIA 2DJUA 3KAAA 4ONFL 3ISWA 4P23A 1U8CB 3QFJE 5T3XD 2FSDA 4PJ8C 5DI8B 2IWKA 3SDCB 1BLNA 4YLQT 2C4FT 2Z3FA 4FTVB 5DJ8B 4TNWK 3V0WL 1N9PA 1JP5A 3N3EA 1KT2A 2VUOA 3CU7A 3TX4A 1ZT4B 2W1NA 1XCWA 4G9DB 3AU0A 5B1AB 1U3HC 1YYLL 3D0VA 3X14B 5IR1A 3E8VA 2OXGA 2FLRT 5GGRB 3TPUB 4P5TD 2Z4QB 5DRXA 1WICA 3PJSA 1EPFA 1A4KA 3JTTA 1UADC 2EDKA 4E41B 3U6XA 1G9NL 3VWKC 1J1OH 2Q3AA 4POYA 3GIZL 4UAOB 2EXWC 2HG5A 4UNTA 2K4WA 3VFWA 5KBLA 4KY2A 2Q9OA 3WLWC 1DDTA 1UM4L 4UQAA 3GB7B 3MXWH 1M3IA 3X3FH 4LSSH 5FGSA 1HE7A 4GXVL 3UO1H 4BQ9A 3HLKA 4DVRL 2I60L 2YAMA 4J3OH 2VCOA 3A0OA 1KCLA 3POHA 2YPLB 1LK2B 1T04A 3T0XA 4HS6B 2NQDA 2XV6B 3FT4B 4U3CA 3IMUA 1WISA 3OKDA 4IRSB 4OKVA 5C0EA 3QNYA 2IDQA 2WLNA 1QWNA 5K69A 5D71L 2H3XC 2YLHA 5IQNA 1LD9B 3FU8A 4TUOB 1LLAA 3MV7B 2V3DA 3FUFA 5GZNA 1Q9LA 2XZZA 3MXVH 4AH2B 1MCPL 4AQ8A 1JD9A 1LHZA 4YE4H 5I1AB 2CM6A 1NMCC 4JFDA 2MCG1 3TTSA 2DQGL 4BH8B 4E5XB 1A6AA 4PV8B 3EW3B 1W72H 3S37H 3W39A 1GJUA 2X0WA 4U2ZA 5DUMH 1OT2A 3IFLH 4KO6A 1N64H 1QPPA 1H15A 2R1WB 3B9EA 4KKAD 4HGWA 1J9CT 1T7WA 1A6ZB 3FT0A 2OYPA 4LCWB 5EIIA 5HGDB 1RZKL 4KKZA 3MUY1 4PJ9B 1YZZA 5I8EA 1PD6A 3C6LC 5AL0A 1V3LA 3TWCH 2ZX5A 3PYCA 4JR9L 2FK9A 1R24B 5AKTA 1N59A 3HG3A 1RJYB 3HG1D 4PGDA 3WBDA 4BZ2H 2X12A 4M43H 3VX1A 4N8CL 3ZVVA 2VOTA 4BZ1H 3DKHA 4NQDD 4I85A 5EOTB 1F4YL 2LFEA 1L9TA 2EO7A 2HX8A 5A2JH 1HZKA 4MS8C 3TV3H 5JIDA 5A16B 4XCEA 5TF1L 4YHZL 1CGXA 3BZEA 5DQ9B 1Y1DA 3OF6A 3CLEH 1H3VA 4MS6A 3OHXA 3MCLH 3KWTA 1NGQH 2P49B 1GMIA 3ASOB 2VDLL 4LHUB 3TL5A 3TT1L 4HEPG 4KAQL 4X9GA 1HOEA 2OMTB 4YHOL 5F7UA 3CFCH 1MVUB 3EH1A 1PYWA 5FO2A 5C08E 4F2ME 1HIMH 2J5LB 3SBPA 3RWEA 4PWHA 5JHDA 1A4JB 3L4VA 4QY8A 2H8PB 1UWEH 4QRTA 4LLDA 3NDZE 4P57A 4L1DA 4AM0B 3FOLB 4EMZA 1G7JA 4TVPE 3G9AB 1DSFH 1FFOB 5DYOB