1AHMA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
129
structure length
129
Chain Sequence
b'DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
molecule tags Allergen
source organism Dermatophagoides farinae
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
total genus 7
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahmA00
3RG1C 3VQ2C 1KTJA 5KWYC 3WEBA 4G8AC 3B2DC 1WRFA 5IJDC 3FXIC 2Z65C 3ULAB 1NEPA 3MU3A 5IJCC 3WEAA 1A9VA 1AHMA 2Z64C 2F08A 3M7OA 2E56A 1AHKA 3VQ1C 3MTXA 3T6QC 2HKAA 5IJBC 1XWVA 2E59A
chains in the Genus database with same CATH superfamily
5EULV 1CDHA 3BHBB 5DJZA 4H0LC 1YG9A 1ROWA 2B5IB 3NGBC 2I5YH 4KOCA 3ISRA 2XKSA 4UTBL 5CZXC 4NKQB 4N0YL 2NY1D 3GKWL 4BRJA 1ROCA 2QQLH 4TVPL 1DBML 4R5XA 2HSIA 5FYJL 2YN5A 5JHDE 1FSKC 5HHMD 1AS7A 1MCRA 4L8DB 5BV7B 5GJTL 4OCYL 5HHVH 2Q6WA 3Q48A 2YO3A 3HVDA 5CEZH 2EO1A 3T1WA 3ARGA 5MERB 5FDWA 3GSOB 2DLGA 1PKOA 2NXYB 4K07A 4WUKL 1FYHB 5GQBA 1WDAA 4XO9A 3K3QA 3L5IA 2KPNA 4OCRL 2WVVB 5F3HB 1F3RB 3IMTA 1NBCA 2APFA 1K5NB 4JO2H 2ZUQC 4OIIL 2HKHH 4ZDHA 1YMMD 1HILB 1G6RH 1AAJA 2EH7H 2WYIA 1F45A 5EU5B 4I7ZC 2Y22A 2ZONA 1SBSL 5B39B 1JNJA 2B2XL 3Q43A 4FS0A 3VXOA 5HBBA 5SV4A 2P5PA 4JG0H 1KIPB 3B8YA 4NUGH 4AMKH 1L4IA 1PLBA 1W0YT 5E2VL 1TNNA 4PGJA 1JF1A 2GI0A 3SEPA 4DGYL 4GOSA 4QHKI 5F6IB 5ICYA 4A7QA 4AYEC 4ALAL 3KBHE 3GZOA 3VFUA 4JHWH 3TONA 2MEJB 1F0LA 1T0PB 4YVUA 1WQVT 1P4BL 2ZE0A 5LXVA 5FM5O 1EANA 2WXPA 1N2RB 2FK9A 4LL4A 4N2EA 1WTLA 1JPSH 5JIIA 3RFZA 1VFBB 4AYMC 2XXGA 3OD3A 2WXGA 4Z7OF 4WEEA 2J5LB 3RIAF 2C3VB 4JQVC 3TZVA 3MO1A 4PJ9A 5D1QA 1J5IA 4NS0A 3VH8B 2JKIS 2HP4A 2VOTA 3PS6A 3HE7B 2W94A 1U8CA 5FR3A 4LRNH 2ZCKL 3G9VA 1E4JA 5BUPA 5DT1H 3KEHA 5I1KL 4NRZB 3L2MA 2XX1A 1TG8A 4AIZA 1IAOA 1OALA 4A67A 1IGIH 2ATAA 3NEOA 4MJIE 3ZQ9A 4O2FB 1LGVA 2CD0A 3BZEA 2AF2A 1T20B 3MROA 4H88L 4ZMWA 1FJ1B 4XP1L 5FW6A 3C6LC 3M07A 3DMMD 1HOCA 2W88A 2AJ3A 1S7XA 2YD7A 4GSXA 4ZFQA 2WSDA 1ZTXH 5KYNA 3DX9B 2G5RA 1A3ZA 5CILH 1UC6A 2AABH 3PGDB 2UUDH 1AE6H 1IKNC 4JG1H 4MYPA 3EJQA 2AXJA 1RD6A 2LU3A 3NPZB 2RAMA 4FL4C 4PJGE 2Y06H 1N12A 3ZRCC 4WJG3 4MJ5B 2M1KA 1AJ7H 1MCSA 1NJ9B 2R2EB 4X4ZA 3FUNA 1BREA 1R6VA 2JKNA 3LKRB 3AQXA 2NY0B 1J1PL 2X0WA 1FP5A 1U8HA 3DPBB 1DBJL 4D9RD 4F7CB 1AR2A 2BDNH 4NNYB 2NQCA 5AW6B 1ZLUH 1BG9A 1KTKE 4X83A 2IADA 3KPOB 1CQKA 2CKBB 2QHLA 3FFDB 3KWWA 1SM3H 1A66A 4AKPA 1A6VH 5B7MA 1D9KC 3KD4A 3QQ4A 1ZSDA 4J3WA 5I5JA 5JHDD 3P1VA 3TV8A 4Z6AT 4NO2A 1QR1B 4YK4B 1CGXA 3GI8L 4PRIB 1JWUA 3T3ME 4I1RA 4UILL 1GYVA 3STBA 2DQHL 4U1HB 3HUJB 4M7KH 5D7JB 4BZ2L 4DGWC 2X1XR 2YUXA 4AJYV 1E6OH 2X9YA 4M8RA 4FFTA 4XNXL 5DO2C 3MLUL 3THMH 2BS9A 3D39D 2QFRA 4PG9B 3PL6D 2EICA 1PQZB 4Q6IA 4BWTA 4Y9CA 1OEZW 4GQ9L 3PNRB 1QSVA 1WBZB 3QDMB 4K3EH 1YC8A 3HC3H 4LEEA 1E43A 2WWOA 5B7FA 3NK3A 1R3KA 1TQCC 2YPKA 1QVOA 2DWDB 3QISA 1XGUA 3SKOB 4Y2DB 3LS4L 4P2QB 5LBSH 1Z9PA 2CBQA 4NYLB 1N0LA 2ZOUA 4BSVA 1EGJH 1S7UB 4FHJA 5LVEA 1SOSA 2BIHA 2F1AA 3I9AA 4DFHA 1FG9C 1E5CA 1FZMA 4J8RB 4X6CA 4NO3A 1OB1B 5C0BB 4JX0A 1G6RA 5CCKL 1TQCB 2QSQA 1P84J 3U0PA 4WSKA 3NRPA 2NLJA 1K72A 4G6AD 4TSAL 3RVXD 4PRIA 3RTQB 1DJIA 4LEXL 5CSZB 1WAAA 2FSEA 5DFVC 2XU9A 1HINL 3U9PH 5LGJB 4KHTH 4Y1AA 5M94B 3OL2A 1ZHKB 3EZ8A 2X70A 4DPAX 4YZFE 4AW7A 2HVKA 5EA0L 2EIMB 4NQCA 4X6DB 2WWKT 1LD9B 3C5SA 2IPUK 1Q38A 1ZLWK 2FJFB 2NR6D 4JFFA 4ZD3L 1GHFL 1TEFA 5C0FB 2YAMA 5EFIB 2KUTA 5LG1A 1CPUA 2BSTA 2F7IA 2WBKA 1UD2A 4YSEA 4WI6A 2GQHA 3FRUA 3N1GC 4ODXB 1F13A 1DSWA 2NT0A 2XWJA 1T5XA 2C7FA 3KYAA 2OMNA 1LWHA 1O5DT 1AGFB 3JSSA 1EO8H 4QUOA 3U6RB 4JBSA 5ADOL 2BMKA 4N8CH 4M3KB 3MA9L 2V0AA 4OI9A 5E7FA 3V0IA 3VXUD 2Y6TE 4FTDA 1A7PL 4RGND 2PP8A 1SMDA 1FZMB 4J8RA 1I7TB 3AS0A 2ZCHH 4LKCB 1CLZH 3L3OC 3GTTA 3MRCA 1CICA 1MN4A 2EABA 2PPFA 1PFOA 1Z1WA 5DR5L 3OLDA 1PG7L 4H25B 3H9SA 4B7IA 3D07A 2JIXB 4O51A 1MLBB 1QA9B 1T6WA 4ZTPH 4WQOA 1PKQE 4L0PB 4JFXA 3Q06A 2R39A 1DJSA 2V9QA 2N7AA 4HWZA 3RJOA 3QDGD 1CWVA 4XNXH 2J5WA 5GRUH 1LLAA 1TTAA 3G08B 4U6HB 2J8HA 1DBAL 2UV3A 2ARJA 1NUFA 4YSOA 2GTZA 5IW3A 4F80A 3WFEH 5I1JL 4LSUH 2B16A 4PCYA 2BNRB 2BW5A 4ODTH 1OD9A 4FKEA 2IAMB 3U4KA 1M1XB 3AU1B 4UBDC 1S9VB 3PGCB 1U8LA 1ZS8A 3SDCC 3MRLB 3OKKA 5IHUH 3MLZL 4M8QA 5C09E 4B53A 2X41A 5AKVA 3ES6B 5HHXH 1TQVA 4NPYB 3S5LA 4AQ1C 1LL1A 3PWPB 4JDTH 4HWNA 1G7QA 2GJZB 1NSNH 5HHPB 3LRMA 1M1SA 5IVXE 2DQMA 4FYSA 3V9EA 3BVXA 3VSTA 4XPAL 1G7MB 1RZJC 4PY7A 3RKDC 3BKYH 4LCWB 5F6HI 3PY9A 1Q94B 2Q76A 2VLME 1T5WB 2Y06L 4OLZL 3CZUB 2VXSL 3L5HA 5JDJA 5DQ9A 3FFCB 2JB5H 3V52H 4Q4EA 5GIRA 2XPYA 4XNAA 3ZTJH 5DJAA 3ARUA 2SODB 4PJIE 4P4RB 1ZT7B 3TJHC 2QGBA 2X1QA 3ROOA 4AKOA 2NY2D 3QUGA 2BNUB 4OM0H 4PAZA 2CDEA 5CFAA 1OSZB 1DQIA 3EGXB 4RRPA 2DMCA 1OVZA 3DVGB 1JGUH 2XETA 4I0PD 1OK0A 3B5HA 1QD0A 5GGTL 3QAQA 5TFSL 4KBPA 1YECL 4JFEA 1SF3A 1KV7A 2J20A 2CALA 4XBGB 3VXNA 5EO1A 3W56A 1E8YA 5EBWA 2HFEB 2ZCKH 2ZKXA 3CTTA 3DDFA 2ENJA 1SDDB 1G4MA 1VCBC 3OKDB 4GT7A 1GYAA 4L8DA 3MV7B 5T1JA 4IBLT 3WUWB 2KQMA 3OB0K 1D2PA 2IVFC 1G9ML 5EZOL 1SN5A 2WTRB 4Q4IA 1U91B 3HNTH 5DXWA 3ZHNA 4DAGH 4UINH 3VJ6B 2YD9A 3GMOA 5HDWA 2PO6A 1FRGL 4FNUA 4AC2A 3F7LA 5C08D 5GRJH 3JWNG 4MBRA 5BO1L 2Q9OA 1PSKH 2RB8A 4F92B 1NIEA 1Q9LA 3TT1H 5I1EH 4ONHA 4CGUB 4IMKA 2ATKA 3TBSA 4WY7H 5FUCE 5CMAB 1JAEA 2HJFA 2ZUVA 3AWGA 3V10A 3SO3C 3OAYK 2FBJH 4EIGB 4JKNA 3AT9A 2VDLH 5BW7C 3F6LA 2QTEA 2P4AB 1DQDL 4Q9RH 4BH7B 1AD9A 2V9TA 4NCDA 4G8IB 5IB5B 3VWKD 1E90A 2IH3A 4AMKL 5LHDA 5IK3B 3WAJA 2ADGB 4PB0H 1A5FL 4FQCH 3MHZA 3KPSD 2OMYA 4XN8A 2OR9H 3QIUC 1Z6JT 4PRAA 3VVWA 4S1QH 4PJCB 3WLWD 5SX4I 4AT6B 5I6LA 1IJ9A 3JUYA 3LPOA 1L9QA 5ICUA 2FD6H 3OKNB 4L1HA 4LGPB 3G6DH 2BOCA 4G43B 3CFJA 3LIZA 3U1SH 4JZJA 2KMWA 4X4ME 4AK2A 3V0WH 2YQ3A 1AKJB 1KBKA 2A1WL 5IB2B 3CBKB 2A77L 2PCFB 3O6KH 5L8KB 4JZNA 3ZMEA 4FTVB 4OGQC 5DRXA 3TIDA 2IAAC 2WIIA 4ONHB 2DQTL 4ZSOA 5DS8B 1U8CB 4Z3GA 1HDMA 3DVFA 2EKSB 3AG1B 4OM0L 5ETUA 3QRFM 1NFDB 1VFMA 2L4OA 1OHZA 1HWHB 2ZKWA 4W93A 4YL9A 4C8XA 5C07E 5IJVB 2GTQA 3BUPA 3I9PA 2E7DA 3K6IA 5PCYA 3FU0A 4FQHB 4NUQA 4Z7NE 1QYGL 1GY2A 5E8EB 3HB3D 3ARGD 5ANME 5MP6H 1QTPA 1VZGA 2UZPA 1BZQK 1CD8A 2YZ8A 3IKCB 5EB9A 2FUQA 5CU9A 4H5SB 1T4KA 1XEUA 1OHQA 2NY2B 1NAMH 3MRFB 4TKWA 1DVFB 4JREC 3PGDA 5GGVY 1J10A 5HP5A 2VERA 4PLKD 5I5MA 3ELQA 5C7ZA 4N9GA 2CLRB 3NH7H 1VFOA 2EVGA 1P69B 1UWGL 1RURH 2IBZY 3FB8B 2YS4A 1AQDB 3QYMA 2HLFC 3HEIB 1DJZA 4H1LG 5G55A 4Y5YA 1I8KB 1F8TL 4XN5A 1HI6A 2HRPL 5IHLB 4OI7A 3CH1A 1W0WB 4NN7B 3K6OA 3GEFA 4YHOL 4EOWL 3W11D 4TMPA 3D85A 4KKCC 4RDQG 4Q97A 1GKEA 1XH1A 4JM4H 3WOVA 4DESA 4Y4HC 2L7JA 3LZLA 1RMFL 3V9FA 1UEYA 3FB7B 3CZNA 1JGEA 4OZHF 5IVXB 3LQMA 4X6DF 1U3YA 4PJ7B 4L18A 2CDGA 4YIQB 1T1YA 2DJSA 5K59F 5DGQA 4WW2B 3UMNA 2G9HB 1JZHA 4ZFGL 4HFWA 5DD6B 2I9TB 3RNKB 1S8DB 1I1AC 3JWDH 2F19H 2F5AH 4G42A 3ISYA 3KLSA 3CHQA 4I18C 1YZZA 4CMHB 4NX0A 4XNYL 1RFDL 1PTZA 2OJ1A 8CGTA 5F7HA 3C6LD 5LGHH 2NZ9D 4UU9A 5TE4H 1T4KB 3MRFA 4LAQL 3WEMA 4AIEA 3LKQA 3RY6A 2V9UA 2EXSA 3CFCL 4HJJL 5I6MA 4P07A 4NN6C 3OXSA 2A6JA 3MCLL 2VDPB 4GIAA 4WRLA 1J18A 1LP9B 1O0VA 9PCYA 4MX7A 3LRLA 5BVPL 4N2MA 4JFQB 3WL9B 4X7SL 3WD5L 1U6AH 2BINA 4HCRH 3BP6B 1T1ZA 1EZSA 4LVEA 1SLXA 5BJTB 1JVKA 2EXYC 3TYGH 4E9YA 3D4YA 2ZNXA 3LNDA 3QHZH 4ZT1A 5FKPA 3SPJA 3ESOA 1CDUA 4Y2DA 3ABZA 3CX5J 1T0OA 1JGEB 3CFNA 3T71A 3PP4L 5LNGA 1GZPA 4P2RA 3V5HA 1BA9A 4NBXB 3RGVA 2G75B 4ZPTA 1R0AL 1NMCB 2G9HA 2KT6A 5AW0B 5JIKA 3MTXA 1KCSL 4FFZA 3KH4A 3BDYL 4BFEA 1JZGA 1BEYL 1OD7A 2NW2A 4KVCL 1F6FB 1YC7A 2JH2A 2VIRA 2E5EA 3P4NA 4NERA 5DC2A 3TPUB 1GJIA 3TM6A 4ENEC 1MFUA 2VSCA 3P9WB 1KTBA 1TKWA 1CLOH 2P8PA 4H26B 1FLRH 4A2DA 3LRGA 1OK8A 4K3HA 4R8WL 3L7FB 3DGGB 3ARWA 3G6DL 2A7BA 4PWIA 1H3XA 1C12B 4LT7A 4X6DE 3UO1L 4AUJA 4OF5A 1K4DA 4E41B 4JB9L 4KJQD 4JHZA 4ANVA 3QYCA 1G7PB 3QYNA 1GYCA 2R9HC 1I3GH 2VUKA 3G3LA 3QDJD 5KBPA 4I2XB 1P0SE 5AAMA 5C07A 4MMXC 2ADIB 1Y7VA 2ZXEB 4FLQA 4K3EL 1FNEB 5F9DC 2Q8BH 1LEGA 2Y36L 2I7OA 1A7QH 1MNUH 4LMQE 4U1JA 2Z34A 2ZUQB 3CGTA 3WNNA 1FI8C 2GBVA 3A3YB 1RJZA 1H0DA 1NBVH 2QPEB 3BP7B 2PW2B 2VRKA 2XIIA 2EE6A 5DQJA 35C8L 3B9KA 1WZKA 2CNZA 2UWEA 3CN2A 3GUTA 1BSIA 2FQDA 3DX2A 4M1CD 3SYQA 1W72A 2NXYC 1OM3H 1BCIA 3DX6A 3FTVA 3KDPB 4G6AC 4LASH 1C5CL 1B4TA 4A6YL 1EV2E 4PP2B 3IDYB 4JAMA 4FFYA 5AL8A 4K7PL 3K6SB 4F8QA 1IQWH 3HG5A 4MMZC 3IPFA 4KPHL 2BY1A 1OTSC 2OR8A 4KROC 4TL5A 3S5YA 3V6OA 1MIEH 5C9JA 3IDNB 3EOBA 4K9EH 4Y5XA 1CGUA 1KBGH 4UM8B 2FGWL 4J28A 2BDNL 5CWSB 3Q8AA 2BVOA 4W9IC 2RMNA 1YNKH 2E4TA 2X44D 4P23B 4DGIH 4KK9D 1S7QA 4X8JA 2IPUG 3RX7A 4TUKH 4Y5XC 4W68A 4YHLL 1B0GA 5GS1C 3TN0B 2Q7YA 3NCYP 4IRJC 4YE4L 4I1PA 4X8GA 2XZQL 3V6OC 2UX7A 4WEUD 1IGYB 4FABH 5DTFB 4PJIB 3AABA 5EOCJ 3TJPA 3VWKC 2AK4D 1CTMA 2PP7A 3NCXA 4G8FB 4F7MA 1YNTB 5ID0A 3TBVB 2CO7A 4KOBA 3N43F 3BMVA 2BERA 3T08A 5FWRA 3VSQA 5EF1A 3K8KA 1RJLA 4PY7B 3SE8L 1T1XA 3QPKA 4YO0A 3BPNB 3V52L 1INQA 4Z7UB 4QRSA 3SQRA 2VXSH 2NW3A 4CDGC 4BXSV 3W5MA 4X6EA 1NGWB 1OIOA 2WC7A 4JRWA 4JW3A 3JWNE 3ZIYA 5IESL 1EO5A 3BW9A 4PJHA 3IBOA 4KO6A 2C3VA 2ED8A 5KSUA 5C9JB 3WEBA 4XX1E 3L9BA 1FN4A 2ITEA 3VWJB 2VN5A 2XVKA 4MXVE 3T2PA 2QL1A 5ILTH 4RQQB 4JDTL 4MMXA 2AJUH 2KLSA 4EN3D 1XGTB 3AUVA 3KLAB 3UAAA 1ZHNA 1NC4A 1T7YA 3HC4H 3P11H 1JN6A 3O2DL 3QJVB 3FT4B 4XCNB 1KTRL 1XX9C 3DTDA 3VXNB 4ZUVA 5D96C 2Y5TA 2F1BA 3EYFB 3VD7A 3Q8EA 4YDKH 1FL6B 1TZIA 2NY0C 4DN4L 4LSQH 4PW9A 4R3SB 4NRXA 3PHAA 3ROLA 2ORBL 4DPCX 2ITDA 4ZXBC 3S0PA 1HOCB 4BE6A 3QI9C 4WGWB 4S1RL 4ZO6A 4PWFA 4CW1A 1AQMA 3KVDD 3Q3GA 2P80A 2WJ7A 3BUDA 5KN5B 2XWCA 2X7LB 4K5MA 1TF4A 2G2NA 3APDA 4LPCA 3CLWA 4GINA 1BXXA 3DX4A 4QRSB 5IBTL 1BPVA 2LT9A 4Z8FL 3FUDA 4L3AA 4PJ8A 4WFHD 2YLHA 3T8XA 4QHMB 3VFVB 4FFZH 3ZKMC 3ECVA 1AVAA 3D0LB 1MKFA 5FK9B 1U8HB 3DPBA 3FB5A 3QEGH 3CXFA 1HXMA 3HCVA 4MZ2A 2VKWA 5H37G 3FCGA 2VB5A 4NKDB 4ZO9A 2HKHL 4WK4B 2IAND 4YDJA 5JNYB 2WTPA 4XBPB 5FOBA 1PG7X 3P9MB 4OTXH 1PPIA 3CFBB 2EXTA 1QRNB 4UTCA 4MCYA 1N6QL 2WXIA 1IZKA 1IKFL 2C9PA 4JO5A 4UIKH 1IAIH 5IW6B 4X4YA 1KJ3H 2Y7SA 4V2BA 1TOXA 4WDIA 3V4UH 4P3CH 4XNQA 2MKWA 1HAUA 3PJSB 5CGTA 5DZNA 5HHOD 3RVWD 2HVJA 3MRRB 3WNLA 3AGWA 1U8PA 3RKDD 4QLWA 1B4RA 1F4AA 4WV1A 4PG9A 1DEEB 2P5WD 1MHEA 1XB3A 2AAVA 3P4MA 1MFDH 2Z31C 4NO0A 1MRFL 1TJGL 1KJ3L 2VUYA 1VEOA 3AM8A 1C5DB 3NEEA 1HH6A 3ULUE 4I3RH 1K6QL 2G9KA 3KPNB 3L8QA 4XO4A 2YFOA 2AJSL 2YC1B 4UAHA 4X5XB 2P45B 3F6JA 1JZIA 1MCPL 3MBEB 5LAXB 4AIXA 4X4XB 1M7IB 5I9QB 4NO5B 2Z31B 4PJXE 2IIJA 1EXUB 4LPUA 5E5MA 1S9YA 1MFNA 3CFCH 2D31B 2XPZA 1OB1A 2G2PA 3AY4C 2JI2A 5E2WL 4OZGB 1J9CT 3GGWA 4NENB 4GG8B 4OZHB 5F9WB 1MXDA 4GKNB 4JFSA 4TUUA 1RUMH 5D7HA 2HUHA 3LNFA 2HXAA 2DQUH 3F2LA 4BELD 1X5AA 2FSEB 1A3LH 3OG4B 5AB0A 4MNQA 5AZEL 3S36H 4AGLA 3MX0A 3MLUH 5AAWA 2WYZA 3T6WA 4B9JA 3LPPA 2XN1A 4OUOA 1YJDH 1Y0LA 3IN2A 4WWOA 3M1OA 3ULVD 2GVYA 5AFAA 4GO9A 5T5FA 1ZJAA 3TJEL 2R0ZL 1FZJA 1UVQA 4PRHD 5ALCL 3D25B 2MKLC 3F5WA 5J9PB 4Z95L 1R9FA 5DHVA 4ZX5A 1YPZE 2Y07H 5MENB 3ZQWA 4JJHA 4AV0A 1OE1A 2ICWI 3TN0C 4XGZA 5GS1B 3PV6B 3Q2VA 3W0WB 2RALA 4KWUA 1T89A 1KGXA 1NGYB 3V6ZB 4PREA 2SEBA 2K9UA 3P4LA 5F3HA 3MOBH 2K3TA 4L3FA 1TJHH 4UOW1 1EHKB 2YXFA 4F27A 4WI0B 3VXTB 1RERA 3GRGA 3QUXB 4HV8B 1BQ5A 3TLRA 1G7JA 2B1HH 3ARFA 3DIFB 3S8GB 2JNZA 1YRKA 4KDWA 3VDBA 1JUFB 2CDFB 3J27A 2H0FA 4X5RA 3IGFA 3FCBA 3T0AA 3MMEB 1K8IB 1D5RA 3G5ZB 5AVSB 2WBXA 4JM2C 2IALA 1EEUA 1EHNA 4MNQB 2EC8A 2HT3C 3MX0B 4PTTA 3ULSA 1M71B 3CSYA 5F1NB 5EPMA 3NPSB 1MRDL 2Y1ZA 1WFUA 4XI5C 3MBXL 2CAKA 1LMIA 1C08B 1QABA 3FHAA 3DECA 2OMXB 4NZDA 1QFWI 3QUKB 4JPSA 1NDMB 5D7LB 2NZ1A 2IAMA 3LVEA 5EHFA 1O5PA 4FXLA 3DSFH 1EWHA 4Y2NA 2JKLA 4HSQA 2OZ4H 1FFRA 1A4JA 3LPFA 4FQJH 3D4GA 4LLUA 1L5GB 3OMIB 2HRLA 4DGIL 5ICZA 2QQQA 3REVB 2VMJA 4MMZB 1P9MA 2GCYA 1H9VA 3MO1B 4PJ9B 3MGOA 4PRBA 1R3IL 1REIA 3CIAA 3QUMA 4UQCA 4APXB 5F3BB 1TPXB 5IG7A 2AV7A 1KCUH 4XX1G 3SCMC 1UKTA 2VLRE 4EDWH 4OLEA 2LU5A 5DMYA 1V8HA 3HB3C 5K69A 3CBJB 4PJIF 5BV7C 4AQAB 5KSAC 3V5DB 2XBTA 4MLSA 4BWWA 2IMNA 2WXNA 2DLHA 2DI7A 5ACLA 4CVZA 4JDZB 1TXKA 1G7HA 3D85D 3ILPA 1SN2A 1SOXA 3QEHA 3PP3K 2X4UB 1RU9H 3PV7A 4XC1L 4GAGH 5C1MB 4IS6B 2FBRA 2LGNA 2FGZA 2KL6A 4AQZA 5I8CA 3ZO9A 4XMPH 5B8CA 3VXOB 4P4KA 4MCMA 4YBLB 2FO8A 2HTKC 5CR8A 4MRBA 1B0RA 4TRPH 3SDDB 3TO4C 3IEAA 4F2MB 4URTB 4GAFB 4ZFFA 1TJIH 2AXGA 2GBTA 1NIDA 3LEVL 3IKKA 3HFFA 3BP7A 3MNVA 3QPQD 4PJ5E 4R6UA 1OQOA 3K6FA 5ICZB 1BJ1H 5E7BA 5KVDH 3VG9B 3HZ3A 3VFUB 2EVHA 1QMUA 4ZUSB 2FJSA 4AXWA 3K5SA 4PTUB 3FH8A 4OIIH 2GITA 2YD5A 5FS5A 5HHMB 2ZZUT 1AMXA 3NCFB 2K6ZA 3O41B 4XP9L 5G4NA 4YR6A 4J3OH 1LO0H 3ZGIA 3H42H 2ETWA 3W39A 4GUCA 4PJFE 4MB3A 3W11C 4FQ1H 1KB9K 4M3JA 2D8KA 5TFSH 4XP6H 2CJUH 2VN3A 1QBLL 3VG9C 2J1XA 3OG6B 4PRHE 1J11A 1A7NH 4H1LA 4NM8H 3UBFA 4OCYH 4LLDA 5HHVL 4K5LA 2BVPA 2RBLA 4KMTH 2PXYA 2X4UA 4NQED 4FXGC 3CHSA 3S5ZA 5J6HA 4FLSA 4Y7OC 1GAFL 2P9RA 3UZVA 3QNZA 3QVAA 2ZG3A 3BFQG 3RUGA 4UTBH 1DLFL 4X0KB 1AIZA 1VENA 1CF8H 4PJGB 1PD0A 1MCJA 1X7TA 3IJYA 1AD9B 1WBXB 1NPJA 1WGOA 2H1PH 3GNML 5K59E 3BDBA 4LSSL 1QTYT 4E36A 2HX7A 4JR9H 4PJDA 1S7XB 3GS7A 4LCCC 4AUYA 2QGDA 1SGKA 3NEXA 3ZKXC 2C9SA 5FPIA 3MNWB 3NTCL 2ESVA 1QNZH 3SGEH 1BZ9B 2DLIA 4ZFOL 4MYWB 1INQB 1WA0X 5H37A 4B9GA 1SY6A 3DTXA 5B1KA 3RWGB 4LCCA 2Q7NA 1KGCD 2OL3H 3IFOB 4YN3A 1HHKA 5KW9H 2AK4E 3BT0A 2GSGA 3D9AH 5DQDL 3BD4A 3V0JA 2RCSL 2Y07L 2OTUB 1RPUA 1JTPA 1O9WA 2BP8B 4P5KB 3BQUC 2LTQB 3B2UD 3VA6A 3JWDL 3VFWA 3O9WB 5KOVC 2C7UB 3S37X 3OKMB 2CKBA 4B9IA 4WI2A 5TK4A 5GS0H 1ZLEA 4G9FD 3QFJB 5SWSB 3W81A 4XCNA 3BUQA 3G6JA 3NA4A 2WXQA 4P5TB 4K23H 2WJ5A 2GK0B 2QKIB 3TYFA 1FYTA 3KM2A 1ZXKA 3HS9A 3RDTC 1JRHH 2FX8H 3D09A 3LQAL 3RUGE 2HJKA 3D5OF 1HXYB 2YRZA 3ASOB 3ZZSA 4DOHB 4XOAA 5BS0E 2Z0BA 1D3CA 2ZG1A 4JN1L 3HZKA 2CLRA 1EJ8A 1M2OA 1HZHL 1RUKL 1XF1A 3NH7L 4XPFH 5L4FA 5A3ID 1P7QA 2BMKB 1I8KA 1CT8A 2E9IA 3NDYE 3H9HB 1COBA 1U8QA 3DIDA 3GYRA 4G9DA 3E8UH 1W8NA 1HHKB 4PJ9D 5D1QD 2Q86B 5E2TH 5D7KD 1R4XA 5HVFB 2H1PL 1RUPH 3ML9A 1UD8A 3MR9A 3GSWA 3UTTE 1W2KT 1OSPL 2X6CA 3RUGF 4K3GA 3P77B 4WTXA 5BW7A 4ZX6A 4N2DA 3L7EB 5CLWA 2ZX5A 1TQBB 4NQXA 2AK4A 4MA8L 2VW4A 2YAHA 2C5DC 3TV3H 4Q9BA 1I4FB 3WIFA 3ZL1A 4Q6IC 3KGUA 4LQ1A 2J88H 3W38A 4R7VA 4JFDA 3EDJA 1DQLL 2H1XA 3QR1A 2ZOLA 3ZOAA 4TF4A 5LNDA 4IOIB 1QBLH 3S6CA 1W8OA 4FMVA 4JRYB 1OAZL 4XOEA 2H3NA 4PVBA 5CCKH 1CFMA 4TNGA 1YEFL 4MMYA 3KW7A 2BM3A 1XCQA 2XQBL 2X6MA 1UB5B 3OAUH 5C0ND 4C47A 4DO6A 2YFNA 3V4PL 5CCJA 3DYPA 5LDSA 1CBVL 5DF0A 1E7VA 4CRPA 2FUTA 3SCMA 5PAZA 4EE2A 4HK0A 2BRRH 3SDXF 5GJSH 3EOTL 4WFEE 3STZB 2XHNA 3CSBA 2BZ7A 4RCAA 2Q86A 3AUWB 1HH6B 3S3JA 3HBQA 3N40P 5I9QC 3FUHA 3L3IB 5CGYC 3ZKMD 4F7TA 1BIHA 5FECB 1RHFA 4HIXL 3TCLB 1A6UL 1DQJA 4LOFA 2ZX9A 5E23A 4GSUA 2AQPA 5TDPB 5FFOA 4TRPL 5E94B 1T5WA 1O7VA 4BA0A 4P2RB 3F7VB 3L3JB 4B96A 2VDLL 3VGAB 4OGAD 1XWVA 2J2ZA 2NY6C 3SQOL 3KPLA 2NYYC 1D5IL 3JV0A 2CHNA 2X4NA 3CD4A 4BZ2H 3JVFC 1SUHA 4NENA 5I1EL 3FOMB 5JLZB 4XVSH 2OBGA 5DRZB 2ZUTA 4XWOD 3C12A 2MCAA 2Q3XA 3JWNC 2H3NB 2ROYA 3IGAB 5I8OL 4YHIB 4QEGA 3S4SG 3ME0B 3RX9A 3S7GA 4DAGL 1NGQH 1N3NB 4YH6A 3RGHA 3PL6A 3VXQB 4Y16D 3N1FC 1MH5A 4M7JH 7PCYA 3UC2A 1IGJB 5L88L 1DE4B 5DJDB 1E4WH 3OKDA 5DEGA 2YSSB 2B9AA 2VDRL 4LLYA 1EDHA 1FO0H 3GI9L 5ITFB 3BIKB 4TYUA 3ESPA 2VL4A 2WBJC 4IGBC 4PGDB 1J5HA 5JOPE 2BSEA 2WV3A 1RZ7H 1WFNA 4Y4KC 4P2YA 5IIEA 1IVLA 1NGYA 1U3HC 3V6ZA 4QXVA 3I84A 2C1PA 4KY1L 4XCCH 3VNYA 4XNUL 1OGTB 1PJWA 3T4YB 5KBNC 3T8MA 2ZKHH 1OZUA 2XWTA 3LHAA 4ICXA 3QNYB 4G5ZL 4RETB 5DWPA 3ULVE 1FFPA 3HFMH 3S4SB 4WI0A 3VXTA 3F00A 3MBXH 3OX8B 3RFZC 1ADQA 3ARFB 3Q0HA 4OLUL 4M5SA 4YC2B 3ZHFA 1A0QH 4GRWB 1LO4L 3QH3A 5LLIC 3A67L 3C5ZB 1H15A 4YNYA 2HB0A 3DSNA 5AOLA 4G8IA 3TIEB 2GJJA 1JIBA 2XXMB 2AMUA 2BZDA 4PS8A 2OI9C 1S7VA 5ELIA 3ESVF 3ORJA 4P2QD 5AZ2H 5F9JB 5EC1A 4HJGB 1JNHA 2WLYA 3BH8B 1N64L 3IK2A 2ZOOA 3MYZA 5D1XD 2B59B 4LOEA 3U4EB 5T8IA 1TYJA 5TE6L 3EXLA 5LBVA 5T5FL 1F3DJ 3GS4A 4XAWL 3MPCA 5KS9F 3HMXA 1D7FA 3MJ6A 2JJTC 3OKYA 2AKRA 3WLBA 1X5KA 5F1SA 1KCWA 3ZE2F 4HUMB 3AT8A 1I7ZA 2PCFA 4LCIL 1S7RA 4LPWA 2BVQA 5D5MF 2W07A 1NPUA 2YRLA 1S3RA 2P3YA 4PLJD 1XH2A 3BPNC 3V6FA 3N41B 3MLXH 2NTSP 5F9OH 4DGVH 2ZAHA 3PYCA 4FA8A 3FQ2A 4MKTA 4YO0B 3UJIH 3UTQB 4MS8D 5A7EA 1OSEA 4ZTOH 5JO5A 2GY5A 3G5WA 1NOFA 5FYKD 2DMHA 4KJWD 3MRKA 2ZWZA 3MRIB 5A6LA 4A7SA 2AEOA 2YWZA 4GBXB 1EVTC 1VSCA 3VFNB 4IS6A 4GAYA 1CXEA 4ZMVA 2DLTA 1SBSH 1VESA 1MCWM 3HC2A 3UBGA 3IDIB 3CFDA 2QZ5A 3HZVB 2VXVH 1YEHH 5I8KL 4WI5A 1JPEA 4AH2B 1WWBX 1UT1A 2EDWA 2GIYA 2A4EA 3BCDA 4PJHF 3L3HB 2QR0B 1UGKA 3O6FA 3I74A 3OR7A 2J12B 5AL0A 4ZOCA 3VCLA 2Y5TB 2B14A 1F1DA 4JFYB 2P47B 3T77B 4YXKL 4E9WA 2HFTA 1E27B 2IPTH 5CSBA 5C07D 1NCGA 1CG9A 2ZX6A 3KCPA 1U3HA 1ZLVH 3KDMB 1JCVA 1VEMA 1VLXA 2CO2A 3QHFH 3BAJA 4L3EE 4YR6B 1UADC 4M02A 3FQXA 2V5RA 1JZFA 3HUJF 3PGFL 4KRPC 5AD0A 1TZAA 5E1AA 1S9KC 5T1LA 3TL5A 4OM1L 3DJTA 2E9JA 4PJ8B 4JZNB 2ZAGA 4JY5H 2O5YH 2F53B 3LNIA 4Z3HA 1EXGA 2DYSB 2A9NH 5FK9A 5DJ2A 3T3MF 4AEEA 1IBYA 2IFFL 4XMUA 1CU4L 1SFHA 1XF3A 3GQFA 2ZOTA 1U95B 2DIAA 4X0KA 4DPBX 3C2SA 4HC1A 3P3UA 4WI9A 3GHBL 4WI8A 1IBGL 2JQAA 5IBLD 4JPVL 4DSYA 2NOYA 1C9SA 4YHKH 1TQUA 2A9CA 1MQ8A 3FUIA 5AOMA 2GUOA 1T1ZB 1V10A 4IBQA 1A25A 1LE5A 4FFVD 5DHDA 3RJQB 3SOBH 3H85A 2AQRA 3APFA 2VLKE 1RZFH 1KIRB 3FCSA 5I75B 4LLVA 4AVIA 4Y8DC 4NQTA 4XN4A 4KNTA 4HFUL 1D6VL 2G75A 4ZPTB 3ZYZA 3WTUA 4WV1B 3PUUA 3TGXA 3UAFA 1OT2A 2QQKH 3BSZL 2X4QA 1AGCA 2CG9X 3Q9QA 3GMPB 4OFPA 1LE9B 1U42A 5FV1L 1A1MA 1GZQB 2CGRL 4HVBA 3DYOA 4FYQA 5F7BA 1X7QB 4XPHL 3EFOB 1ZLSH 5DHXB 4ELKA 1SJVA 4B9YA 3FUMA 4EIZC 3VXSA 2CDGB 3AQZA 3J07A 3BWUF 4EUPB 4TLTA 4NWUL 1FVEA 2X4TB 5FV2A 4XAKD 4PJBA 2PCPA 4NHCL 3GMNB 1RURL 1Y1DA 3Q44A 4G42B 5I1CH 2IJ0C 2XQ0A 3QI9B 2P49B 2R1WA 2RR3A 5F1IA 1QG3A 1AYRA 1G7PA 3B9EA 5K1VA 3TASA 3P73B 4QYAA 3RDJA 3PDDA 1E5AA 4LK4A 1YYLH 1PDKB 1JZ2A 4A68A 2OULB 3QWOA 1LXMA 2ITFA 4GBXD 2CRYA 5KSAD 4XNZB 1HHGB 4Z7VE 3IRZA 1BWWA 1AO7D 4W9LC 2NY4C 4D3CH 4MB1A 5DGRA 3A21A 4DCQA 2X9WA 3HPJB 3WFHB 3JTBA 4WHYG 3DX3A 5IWLA 2YPVL 5L2KA 2DMBA 4NRYA 2XYCA 1PLGH 3NIDE 1FZJB 3VU1A 5GS0D 2VLRA 4GKZB 3S88L 4CSSA 3KXFB 2YGPA 2P80D 1DANU 2X6AA 3QCVH 3BQUD 2G3MA 2OK0H 4U1MA 1ZV5A 1X5FA 5GS1A 4MDJB 3RY6C 3U1SL 1XCWA 3QORA 5JQIB 1Q0XL 1UT9A 1XCTB 1TSHA 1OCRB 1OAQL 4LIQH 2CIKA 4LRNL 4C4KO 3MREA 4X4MA 5L6YH 5DD0L 1FDLL 1L9TA 2WQSA 4ATTA 2ZOLB 3GBLA 5I6XC 1RUAH 1D6EA 3MYJA 5BVJB 4N3UA 3BEVA 4K94H 2ZP0T 3QIWC 3LZFL 2UVEA 4PSRA 4RGOL 4UT7H 5DLMH 4ONFL 1WBYA 2WMPA 4PJIA 1FORL 5A3IC 4XPGL 5E1QA 1BJ8A 3JUZA 4XMPL 4A38A 3I50L 1MJUH 3EO1B 4FCHA 4NRYB 3BC9A 3FL7A 4RBPK 4ALAH 3CQQA 4L48A 4HKXA 5E99L 4D0BA 1X5JA 1CUOA 5EG6C 1AXTL 1KB9J 1WAAF 3KXFA 4HJ0D 1MI5A 3WO4C 4MBOA 3DO3A 2W60B 5TDPA 4AL8C 1XB8A 1NDTA 1N5AA 3JWNH 5EN2A 2HG5B 1PZSA 4DUWA 4LCWE 1FYTD 1MY7A 2D7TH 2VLKA 3ZDXF 1KLGA 2V2WA 4F8PA 3OJ2C 2XBDA 2DTSA 1M6OB 1FFTB 4BINA 3VWJA 3QEUB 4UOW0 5GJSL 4R2GC 3NMEA 4L0ZA 1E2ZA 3A23A 5DVPA 4BFKA 3DURA 4KX7A 1FL3A 1IIIA 2XV6B 4RGNE 4ZNEA 3G5YB 3KLAA 1KV3A 4YDIL 4RDQF 3TC9A 3U2JA 4X42A 2NUPA 1ZSDB 4GG6B 1JTTA 4YWGL 3MLXL 3M7FB 3PL6C 3EKCA 2G5BB 3N41F 3B83A 1J86A 3QP3A 2J5LC 2WOBA 3F04A 3EO1A 4S0HA 4TV3A 4Y4HB 5IJBC 3TT3L 4HGWA 4F1ZA 3BYTA 3PHOA 4KGLA 4MSWB 4OZIE 4YDKL 4XAKE 2WXMA 3EDEA 3PABA 4FNQA 4MAYA 6PAZA 2YUWA 2IG2H 3OJMB 4Q56A 4P8QA 4YJZL 3Q7JA 5E6IC 2VRQA 3T8XB 3CSFA 5JTWA 4RVBA 1XHHA 3RHWF 4UB0H 5ISZA 3UYPA 4RIRA 2ZIDA 1TU2A 4CU6A 3FULA 1QKZL 4M4RA 4U33A 3FC8A 4JFFD 5CP3A 5IQOA 1AO7B 2IO5A 1TQSA 2K6YA 2WLMA 3QH3B 4FKKA 4NHCH 5GRVL 4G1EA 4JRXB 4F15C 4NC1C 5IFHH 1RK1A 3OKOB 5J11C 3MLZH 4Z3IA 4L8SA 4ADGA 3B34A 3L1OH 4Y2OB 3PHQA 5TE4L 1FUNA 4JDVA 1T6BX 2AXHA 1EXHA 2J71A 4FNPA 4M6MH 4NO3B 3A6CL 4IBUA 3CVCA 4JO1L 1AHWA 2ZSVA 4GQPH 3NJMA 4NZUH 5FF6B 2VLMD 1A4KA 4YS4A 4BUGA 1TTGA 1T20A 1MZZA 4YFLI 2AQ1A 1V3JA 4FMKA 1QO3A 1UOKA 2OTWB 3VVVA 2WCSA 1G0YR 1YEGH 3MV9B 4HPHA 5F1KC 5T3XH 5IMLB 3ZKNC 1NC4B 1IGTA 4AJ0A 3PHOB 2F7OA 3LTVA 1XIWD 1BF2A 2XN2A 5C0AE 5JW4N 2BIOA 1FO0B 2VLJB 5DMIL 5I1IL 2CLZA 4IHBA 4K4KA 2GJ6D 1E8ZA 3GB7A 4JGMA 4NIKB 5T1MB 5F89A 3V4LA 4JRXE 3N55A 3UJJL 2RA1A 3I02B 4HS8L 4LBEB 3ZVVA 2EVFA 1K3ZA 1SRDA 2IDFA 3KPMB 4RIRB 5MEND 2APXA 4WWKC 3U0TB 2DTML 4YHYC 2AZUA 3QIUD 5J1AA 5A2JH 3LSOA 4FDWA 4AITA 4F24A 2DKSA 3QCUH 4HGMA 1M7IA 2PR4L 4ELME 3RWGA 3LKOA 4BZ1L 4NO5A 3WMPA 1NCWH 3Q1SH 4KJYB 2ZT9C 1I7TA 1BVKA 1RVFL 3GSVA 3HE6A 1JE6A 2DJ4A 4ZI8A 4ALAC 4C56D 5IEKA 3D0LA 5C97A 2EH8H 4RFEB 4O58H 1BQUA 2W81C 4WWKA 4HXBH 1PIGA 1J0ZA 4Q9CA 4JRFA 1EJOH 1D7BA 5I1LA 5JHMA 4X4KA 2PW1B 3CLEL 4HWZB 3NCCB 1FO0A 1GSKA 4CADB 3NYKA 5G5DB 4MCYB 3K2MC 4KK6D 1JZ6A 1MW1A 4C83B 3SGKC 4ZUTB 3PAUA 3V6OE 3GIVA 3G9AB 1RIVH 3F7YA 4P5MB 2IPTL 3QGVA 1ULVA 2VR5A 4LIQE 4P4KD 5FGRA 1O7DC 1X5IA 3WTTA 1HQRB 3MRBB 3EOTH 2FNBA 4NJAL 5JPMC 3WS6C 3UH8A 4WK0B 4GMTL 4KXAA 1A8JH 4GP4B 3T0VA 5JW3H 3QDJE 3UO1H 3A5VA 5EZLA 3T09A 2ICEA 3ILQC 4AQ8C 5BZWA 9CGTA 2XQYA 1A14H 4FZEH 1YEHL 5I8KH 5GISH 1L0QA 2JTDA 1G94A 1W6WA 5T3ZD 3GTVA 1KULA 4KJWC 5K5YA 2O6EA 4IJ3B 5LO7A 3SPVB 4EVNB 4PRPB 1Q1JH 3OGCB 4E5XB 4E9SA 2PUQT 1NC2D 5F7LB 1BGXH 3QXDA 3U79A 4GQ9H 1XF3B 2BNRD 1CGVA 4Y4HD 1EAOA 5F7DB 3SBWC 2YUVA 4MA7H 4IBYA 1PF3A 2EYSB 4U3SA 1G0XA 4ANWA 1HFUA 2XNAA 5FB8A 1Y07A 2BFVH 2VDMH 4Y1AB 3UFIA 5I75C 3RB7A 5BQDA 1I8MB 4TSBH 4F7KA 4PJDE 2K1MA 2H32A 1AHMA 4ZUTA 3GEWB 1E8WA 1DJWA 4EJ1C 2YD0A 3G04A 3NABH 1A6AB 3OLIA 3MOAL 4OCWH 3I9GL 4HCRL 4UDUA 5SWZD 4KFZC 1KC5L 3CAFA 1USQA 2LVEA 5C3LD 2G60L 2YMTA 2IQAB 4KXDA 4R7NA 1Q1PA 2H8PA 4BUHA 3ULUL 3K46A 5F3BA 3HHSA 1A2YA 1NAKL 3OM3B 4GRWH 5HYSB 4CA4A 1MVUA 2J6EL 2Y1YA 1A4CA 2MHAB 3VFTB 1U3ZA 2XACC 4TQIA 1QPPA 4M6AA 1LEKA 4ZMPA 4IIQB 3TCLA 2EP6A 1DN2A 4HIIB 1HNGA 3KYMB 5EO9B 2JIXA 2Y7OA 4FFYH 1FVEB 5DK2B 3PHSA 2AEPH 2EYTA 5FA4A 1P1ZA 3KYOB 1BVNP 1A0QL 1KDIA 4QXWA 5LN4A 1GW0A 3ZTEA 1HHJA 3HMWL 2WZAA 2UY6B 3OJDA 4RFNC 4U4BA 4V33A 2AABL 1F2QA 3TBSB 1KIQB 4B95C 1PDKA 2AXWA 4BZ1A 2HJFB 1VFUA 3IGKA 4DP7X 2RCSH 4IOFC 5DRZA 2V17H 4L8BA 5IQMA 2ZKHL 2EYRB 4OZFB 1UD6A 1DVXA 3V4VH 5ADPH 1TZ8A 3RAJL 3FOLA 4L37A 2EEAA 4OLZH 1JPGB 1GOHA 4F2MA 2GK2A 1GGIH 3X12B 4IK7A 2BW4A 2BZCA 3CSYB 5F1NA 3RPIB 4M8QB 4BQ6A 4RMWA 2I07B 4FOMA 3C2AL 4KVPA 2ERJC 4L3CB 3ES6A 5L2KB 4LL9A 5JW5B 1JNNL 3EDDA 1ZV2A 3FT3B 4QKXB 5INCB 1FO0L 1JV5B 1XSOA 3FQ4A 3QS2A 1LWJA 3D08A 4NFCA 5C8JB 3ZDZB 4GYBA 4PJAA 2VR3A 2O5NA 2X38A 2WXOA 5IFAL 1ZPUA 3UZEC 4PS3A 4AZ8B 3WNPA 1JOIA 2P52A 3KBPA 1JWMB 2H2SC 2FB4L 4I9WD 1GYUA 3I9GH 4G8GB 4PN6A 3T4YA 2GCYB 2HUEA 2BCKB 1AKJA 5GIRB 1K5NA 4OB5L 2O72A 5ALCH 4ZAKC 1TVDA 4M48H 4H1LB 4IDLA 1KPVA 4UNIA 1BYPA 1O6SA 1Q9OB 1YEIH 2E6JA 1EEYA 1U8NB 3V5KA 5KS9A 4J6RL 3X3FH 2F58L 2WNKA 1A9EB 2HCZX 4IMLB 4OSUL 4HS6A 1Z0NA 2WANA 3WY4A 5B1BB 1MAJA 5K9QG 4ZZKA 4ELMF 1S78D 1PY9A 4E42B 2YGVA 1E6JL 1WWCA 3VQMA 2FD6L 3BVTA 1X5ZA 2YGOA 3N9GH 1RZKC 3QWRA 5FA3A 4EBQL 5BCAA 4MA3B 3QI9D 1A21A 4JG5A 5E8EA 3BWZA 4E9VA 4NO0D 4CN6A 3BZ4B 1JNHB 2FT6A 1A7PH 3BPOC 2XG5A 5HDBF 1J8HE 3RJDA 2ZG2A 4O2EB 3WIHL 4UANA 1FPTL 5H35B 5DYOB 2BRRL 4MJIA 1IIKA 1NFIB 1IKNA 1LILA 1JHLL 3WYRA 3HG0A 3VJ6A 1KJMA 3RE0A 5AOIA 2CNYA 1MEXL 3IFOA 1FL5B 4D0DA 5IOPB 4FFVC 4W9GC 1ZVYA 1CD0A 2ED6A 4Q9QH 4L2YA 2OV0A 3PWVB 2C4XA 3CJJA 4B9CA 5HGDB 4DP9X 4NI3A 3TH2T 4WWNA 4OJFH 1FZOA 3WJLC 1Q8MA 1FL3B 1JZEA 4KO7A 4X2UA 2EDNA 3CLEH 3A47A 4HD9A 4H1LH 2ZSWB 4R2GB 1ID2A 1IVTA 4XVTH 4UF7C 3CWGA 2Y24A 3J7HA 1DQQA 3L2NA 4K94L 1JZ4A 1UM6L 3CHXA 2ADGA 3KJ4C 1FJ1A 2VKXA 4RMBA 4Q7DA 5E2TL 2R7EA 4HAKA 4PY8J 3CFIC 3VDCA 3ARPA 4A2EA 4Z76A 5FKAA 3DHMA 3WD5H 3S3PA 4LGRB 5GS0C 1I8LA 3KYNA 5J56B 4FQJL 5E5LA 3HI5L 5L0QC 3BVNB 2VSKB 4B0MM 3BH9A 1VHPA 1ACCA 2YA1A 1VADA 3SJVB 2Y7QA 3N44F 2MRYA 4G9DB 4FFZL 2FNWA 4QHLA 2JB6A 2O61B 2JV6A 2QTVA 3UTTB 4GKSA 3X1FA 1TZHA 4WJKB 3COOA 3LKRA 4PFEA 4ODWA 3X3GH 5E8NB 3MR9B 1BX2B 2A0LD 4QR7A 3VXSE 4U0RC 1F3JA 1FAIH 4R2GD 1A7BA 1FCCA 4TQEL 4ZSOB 3ZTJG 4IKIA 4JUSA 4J27A 5DMIH 4P5SA 1Z9NA 4D3CL 4ZFGH 5F8QC 3RY4A 4MAZA 5F7EL 5C71A 1N67A 4X6FA 4A2LA 5GGRB 1PX3A 5FUZH 3QQ4B 1NEZA 2H6OA 3LN4B 4N2BA 4N2KA 4IKNA 1ZEAH 3AADB 4KROB 4E9TA 1DYZA 3TESA 4K8RC 1B4JH 5DUBA 1P6FA 3UABA 1KNOA 1NZRA 2OJZL 3RL1A 4CKVX 1J5OH 5D1QE 2HRPH 1P7BA 2R0WH 2XPGA 2XZAH 2A6IA 5E6RB 3RVXC 2LV4A 3G6JB 4LF3A 3TTYA 5GS2H 4NN5C 1UD4A 4YDLB 4BQCA 1QKZH 4P46D 5JYMA 5ACMA 1OTTD 4LVOC 4EIUA 1WAAE 2A38A 1QAWA 3LPGA 1G4RA 3QZPA 4OF7A 3INUH 2BSRA 1WD9A 1TZHB 1JZ3A 2NY5H 1A4AA 2YPKB 1DBAH 3PQYE 3WFZA 5HYJA 3K6NA 4NI6A 5FLUA 3CC1A 2WLKA 1HWGB 2GKIA 5DSCB 3P69A 4CNIB 3F85A 4UNVA 1F1AA 2VZOA 4QPEA 1BG1A 3Q05A 1UXSB 1NGPH 5F0LB 1R3LA 2YD6A 4HCIA 2AEIT 3FT9A 4F7PA 1I9JL 3MLWL 5HGHA 4HS3B 3LKSA 3QZWG 2D2OA 1OTUD 1THCA 2X4NB 4FQLL 4H20H 4IU2A 5HI3D 3INOA 1HX0A 4H8QA 2NLJB 4G7YH 2D7QA 4D2NA 4XPTH 1H3PL 2YK1H 4ZG1A 3WU1A 2YPLD 2JQZA 4UNUA 1KJ2A 4OGZA 5LGJA 5ENWA 4PGEA 2VC2B 3CVHL 1OW0A 3LIUA 3EJYC 2PCPB 1R5WA 4WNQA 2AI0H 3JYCA 2COQA 4HUXA 2WUCL 1BQSA 5T3XE 1JWSA 3IXAB 4KQ3H 5EU4A 5IQ7H 5HGAA 4PH8A 1T7WA 1J5DA 2XXCB 1UM6H 4QCIA 2Y23A 4QHUB 3TZVC 1MRFH 2H2PC 4DP1X 4LHUA 5BZXA 3QQ3B 4NDMB 3SDYH 1MW2A 3ARDD 3ETTA 4EXPX 4FTVD 1IEHA 2XXFA 5EA0H 4G8AC 4BH8A 4ETYA 4OFDA 3TA3C 1S46A 3NSCA 5C6WH 2C1PB 1HCYA 3A6OA 4FQXC 1YQVH 3E2HC 2F1EA 5AW4B 3PLYA 1Q4NX 3ULUD 2F9BT 2LU4A 1OL0A 4LLQB 4LEXH 4L29B 5F8RC 4WU7A 3L3IA 3OX8A 4L8CB 1TEGA 3MRHB 1ERNA 3HN5A 4EI6B 3Q1SL 3MBWA 1E4XL 4JFHD 3C60C 3QXAB 4ZW6A 3VQ2C 2NW3B 1JGVL 1KJ2B 2PYEB 5AVZB 3TN0D 3HW7A 1NCHA 3VRLF 4ODVL 4K55A 2X4OA 5K33A 1USZA 4JFTA 1KCUL 5H2BA 5DA0B 1FDLH 3UG3A 4JO2L 1QHQA 3GD1C 3QQ9D 3WNMA 2Y6SD 4FULA 4NQVA 5F1OB 3H4HA 4I2XA 1U0QA 3CK0H 2Q87A 4XNDA 1NOAA 5C0BD 2FE0A 1E67A 1N3NA 3BYYA 1W91A 2DV6A 2OK0L 3FFOA 5JOFA 4J3OC 4U7KA 1P7QD 1BDYA 4DVRL 5DURD 4PRNA 1JF1B 1RL1A 1L7TH 2RQEA 3EADA 1DTUA 5HYSA 4M7KL 1Z66A 1MVUB 1V3LA 4QRRB 1BVNT 2B4CH 2BP0A 3MLWH 5FYJU 1M7XA 2P48B 3BIKA 4F33A 5IMKB 4CC4A 4UDTB 4LPTA 3E3QE 1QSFE 5KN5A 4KK5C 2UY7B 1GA2A 4DIXA 3GDCA 3RWHB 2DL9A 1A6VL 1FNAA 3K6SA 4L4VA 4P23C 2UZYA 5HHOA 3ZYJA 4J4PA 2WIMA 2Z1PA 1GTFA 4WUUB 3ECWA 3WNKA 4XCFL 4FXKB 3DRTB 5TDOA 4N0UA 3C6EA 3EH1A 1U8MA 3PQYD 2AJXL 4MNGE 5ICXA 1AC6A 1A7OH 4PGBB 1QW9A 4XCYA 3QZLA 5SX4H 3LQZB 4MZ3A 2J55A 3GJFB 1DQMH 3QA3B 2BOLA 4NRZA 2FT7A 3SIKA 4P2OC 3A67H 3STLB 2ODIA 5F2FA 5FFGA 2CHDA 5E8OA 3H9SE 5GZNA 4ACPA 4OJDH 4E41E 1AE6L 4JG1L 4BK4A 1C7TA 1YPZF 1T1WA 4LU5H 1U8KB 4G8FA 2VITB 3WUWA 3GBEA 5C0JA 2B08A 5D5ME 1NBQA 1WFMA 4H88H 2J1YA 3P3YA 3ZRSA 1E9OB 4QD2E 4YHNA 2HVJB 5FWQA 1I7UA 3E9UA 5FAAA 1XSIA 4KZDH 3SGKA 3AS1A 3LD8B 2X42A 2XN9A 3SY0A 4YHZL 3JT0A 4ZTPL 4CC0A 2AVGA 2FHCA 4U1SB 2BCKA 3L1FA 2ZWKA 1YNKL 4MJ5A 4BQBA 1FNFA 4PRHB 4X80H 3BE1H 3GI9H 1YUKB 1S5IL 5C0CA 3KPNA 4UAOC 2R8SL 4PW3A 1U8NA 3V5KB 1THAA 5KANI 4ZX4A 2A3TA 1UT2A 2ITCA 4R84A 3SE3C 3ILQD 2FYVA 3WJMA 1NC2B 4V2CB 4ZODA 3B7TA 5JZ7C 1EO8L 4PJDF 3AJ7A 4CMMA 4J8QA 2W80C 1RK1B 1YJDC 4KZEH 1IQWL 1J1OH 3U2SB 1VDGA 4ZOBA 4QO1B 1S2EA 2XICA 4G72B 4XMWA 1DSYA 3U30C 4MXVF 4L3ED 2XBZA 3IETB 3ZL2A 3ELAT 2FJGA 2FWSA 4J3XA 4YSTA 2DWEA 5EO0A 2K9FB 4AKQA 3U48A 2LU7A 1XF2B 1P5UA 3DGCR 2KYIA 4N1HB 1I7UB 1DLHB 4B50A 4J6IA 3U82B 5AKSA 4FJZA 1JJUA 5IMOB 3VXUB 1I1AA 1MRCL 5I73B 5IB2A 4GKOA 5DHYA 1PZUB 4Z9KB 1F97A 1SZNA 4IRSD 1RI8A 1OTTC 1IAIL 1GZQA 1PZCA 4K5PA 4TVPE 1F6AA 3GSUB 4QHMA 1U4FA 3VFVA 1TDQA 2WIIB 4DW2L 3ZZLA 4FZEL 4HDIA 3AC0A 3X1BA 5T5NF 4JB9H 3O81A 4KC3B 2HWZL 1FE8H 3GLAA 1XL4A 4OF3A 2VLKD 2X4SB 4OT1L 4DW2H 1OV8A 4NQEE 3DXAE 3QUXA 4ODHH 4LE8A 1YMME 2PWEA 3SZ6A 3AB0C 5C0BA 3ZKXB 2UZXB 2WLIA 3KLHC 4G8GD 1QI3A 2DJMA 3WTXA 3EJCA 3N9GL 1LMKA 3HG1E 3WMQA 1DVFA 1QPXA 1WO2A 4A6YB 5AENA 2IWFA 1W72L 1C5BH 4GH7B 3TV3L 3DUSB 2P5WE 3FB8A 2GFBB 4N1CA 2D0FA 1ZVSB 3PP4H 3FU7B 4F3FB 3M17A 3VRIB 5CJXA 2OR7A 2WQRA 3HNSH 4M7LT 2O61A 3DI3B 3IU4L 1OT1A 4M48L 3ZE1B 1WC7A 2IXQA 2FJFA 1NKRA 4M00A 1NH6A 5D6CA 1EHXA 4PJ6A 5C0FA 1NFDE 4AENB 4KUZL 2N0MA 4M9PA 4AV4A 1NMBL 1F3JB 4HWUA 5D7LA 1XTMA 5TQ0H 4HSAC 1ZDQA 3EJTA 4IRJB 3NACL 3KWUA 1H9DA 1UWEH 3QUMH 4HKJA 3WJJA 1OOWA 1G7IB 4GS7C 2QKIC 4L5FL 4BHUA 1RJYB 4XVJL 4HHWA 1KCVH 5E6SB 3Q2LA 1JGDA 1K3IA 2WQVA 2ZQKA 4LHUG 4O2CA 5D7LE 3MACL 4WV1C 4H4NA 4W6XB 5I6NA 4ABUA 1WZLA 3ZU8A 4NOBA 2CGRH 4K23L 3IFLL 1X5GA 3S48A 2JXMA 2R0LL 2CR3A 3EJZD 3K8MA 1Z9LA 4ODBD 3UJTL 4HUWB 2WAQA 4HFUH 1PCSA 4UYPA 3SKMB 4BFJA 2OZNA 5DI8B 3HE6C 5EBMA 3GLEA 1QLFA 3VQ1C 3QFDA 1JS4A 2Z7YA 3GO1H 4LSTH 2ZKMX 4U2ZA 2O26U 4BGDA 1GCFA 4NZUL 3HAEH 5CP3H 4TTDD 4HQQL 1U3HD 1X4XA 4YHOH 3WKYA 2R29H 5EC2B 2X2HA 2DD8L 4OCLC 1ES0A 2D03L 4JPVH 3FSAA 4WEMB 5IQ9A 1XEDA 1UWGH 2E6PA 1XFPA 2SEBB 1B90A 4OV5A 1BOGA 4RAUA 5DUPL 3T1FA 3MXVL 2FECI 3IJ8A 4OZIF 5C0IB 3UTTD 3QSKB 2V9RA 4K5OA 1MFMA 1QYGH 2R56L 5CJ8A 2YGNA 5MERA 4N85A 4HWBA 4QRPA 1QLEL 4IIQA 4CAGA 1TLMA 2BNQB 2JCWA 1L9PA 1ZAGA 2UZIH 1P5VB 3DGGA 3S3DB 1UH2A 1XR8B 3CMOL 4UM9D 4K7PH 2OQJA 5DK0B 1HZLA 3VI4E 1OW0C 4U1KA 5CJXC 4PTTB 3C5JB 3TBBA 3ULSB 4Z7QB 5EEUA 3WUZA 2G5BA 3O4OB 5KUKA 2WCGA 3LNGA 3A22A 3CMGA 1R3HB 1KYUA 4J7RA 3ZHKA 2Q2EB 3ASWA 1WG3A 1L7IH 2E7LA 2CJUL 5MEOA 1MPAH 4OZGE 3AITA 1VZIA 1XTLA 2H1LM 2OMXA 1SLVA 4BH8B 2DQFA 3MBED 4PJGA 2OX5B 1RZQA 5FO9A 1S6NA 1GTNA 1FH5L 2R83A 4EI5D 3U30B 3AB0B 2XVGA 1KT2A 1U8JA 3QIBB 3QQDA 2PW2A 2ZCHL 1CIUA 2CM6A 5FFLA 5HVWA 3FT3A 5INCA 4HKXB 5DVMA 2Q1EA 3GXTA 1OLLA 1OQXA 4N8CL 1BPLB 4NZ8A 4WI3A 4M4RB 1RKRA 2VE6A 3EHBD 3RLSA 3BN3B 1GY1A 1S7WA 3PAVA 5AB1A 4WIQA 3ZMNA 4P46A 2PWFA 4PSPA 4R0LB 3VFRB 3OKOA 3C5XA 3W9EA 4OCRH 4Y2OA 2PO6B 3C6LA 5DD5H 1YY9D 3V9CA 4OSUH 4IU3A 3GUFA 4GEJA 4QRRE 3RRQA 4Z7NF 1J8HA 2P46B 1R3HA 4E68A 4NQVB 1BEYH 1BJMA 2BIQA 5DRNB 2CR6A 4Z7UF 3ZE2B 3GKWH 4JFHE 2WQUA 2JKJA 1F86A 3QFJA 2Y7LA 5SWSA 1ZA3B 1QRNE 2LFEA 2JJVA 5A2BA 2VT0A 3IDXH 3W9DB 2X4PA 3BX7C 5HPMA 2AXGB 2VR4A 3QULB 3IXTA 5D7LD 4L5FE 3MNVB 2C34A 3TBVA 5A43C 5EZOH 5JPNC 3D18A 3H55A 3S35X 4C59B 4ZMTA 1SXSA 4P0DA 1TMQA 2EC9U 4OF6A 4DVBB 1MVYA 3BWUC 4ZUSA 3WKPA 4QT5B 5D1ZC 2W59A 1OAQH 4LCYA 1PZDA 4NQQA 5T1KB 4JANA 3EYVA 4KRPD 5EEYA 2J56A 4HIHB 2EUWA 4JG9A 5C6TH 3O2WH 2KLRA 4ANKA 4QKTA 1LVEA 2NR6A 2E7BA 4AZUA 1MHCB 4JZJB 4RMQA 4D0DB 5KYWA 4FXKA 5TDOB 4NZRL 1HCVA 2CUIA 5SWZB 4CJ1A 5IEKB 4P2RE 3DKHA 3PWVA 2UUDK 4U1NB 3QEQB 1F1GA 1I85C 1Y1UA 3IJEB 4KXCA 4RQQA 4LSRL 4JM2B 5J6HB 2XTJB 5KVDE 3B1TA 3MLPA 2WZ6A 3F12A 1AS6A 1JYVA 4NSKB 1WCBB 3CBRA 5CN1A 5EEZA 3QG7H 3FQNA 1T3FA 2R15A 3BKYL 2BOBB 1F4YL 1M9SA 2XZCL 3QULA 4NJ9H 1U8KA 1ORQB 1Z2KA 5D8JH 4M6ML 3ULUC 2J6EH 3HUJA 4M7LH 4PCTA 3ZMRA 2DQ6A 2X09A 3FQRA 4YK4C 1WIOA 2IH9A 3D2UA 4OQTH 2VLJA 1NCBH 4X6CF 3VQLA 1A4BA 4LRIC 1OO2A 5IHUL 3TVMB 3QORD 4IGBB 4TNWK 1N8OE 5DJYA 3MRQA 4P23D 3O6FC 3I3DA 3RVWC 1WFOA 2XKNB 1N70A 3FHQA 1JK9B 2R0ZH 1EERB 3UG5A 2X05A 4YSCA 5BQ7B 3IJEA 1R75A 4FQXD 5E94A 5I6KA 4I48B 2ZF9A 1D5IH 4JM2A 4AEFA 1EEQA 4YBQC 1S7UA 3WFCH 4C58B 2J2ZB 4HOXA 2C4FT 4HXAH 5KANG 3QNXA 4MQ7A 4QO1A 32C2B 3RU8H 4M5ZL 1KACB 4XZUB 2AJVL 4Z7OB 5IHWA 4J3OD 3AREC 3RWFA 3QQNA 1E50A 1A7NL 1TVHA 1FYTB 2YMXH 5E2WH 5EF3A 3BZFB 4JKPH 1IGIL 1A6AA 5KAQF 1FIGH 1AZUA 3NN8A 3UDWC 3EO0B 1BBDL 1A14L 1IEBA 2FHBA 1JMXA 4CADA 2W91A 3MUHL 4HHGA 2IFFH 3GBML 4DTGH 2FWUA 1JPTH 2BNRE 4RMUA 2X3BA 5GRZA 5IBLC 3WL9A 4BRVA 3BP6A 3FU9A 3K6DA 2HZHA 3QFJE 5SWSE 3PWNA 3CN0A 3GSUA 1EZLA 4PWEA 2DM7A 3MXWL 3CN4A 2B1OA 2W9LA 4K3JH 1JPSL 1EMTL 1I3VA 3NCYS 3BLKA 3MCKB 3OQRA 4FG6C 2EYTB 4OJCA 3FFDA 1RIUL 2FBJL 2H6PA 2K8QA 5CD3A 1EXUA 2YUZA 3LB6C 1K2DA 2D31A 3RB5A 4G83A 4Z3EA 1LP9F 3SPVA 1NC4D 2VIRB 5HJGA 4DGYH 4TVPD 4E5XA 4GG8A 4OZHA 3RTLA 4NCC2 4HK3J 4L8BB 1KGUA 3OZ9L 5F44A 4QRTB 3P2DA 3NJIA 4WSGA 5C0GB 1TETH 2FWOB 2VH5H 4JFEE 1H15B 3D0AA 4NUMA 5C09A 1MWAH 2WO4A 5FYLE 3TBYB 1KEGL 1I8AA 1AYOA 4GNKB 2H26A 3OC8A 1DQVA 3DHPA 2BVEA 1C12A 1CS6A 2WGNB 2ZX7A 3US1A 2IV9A 4HAGA 3DV4A 1Y0LB 2W9DL 2GBUA 1UG9A 3HMXL 3VXRD 4U0RB 3AM8C 1A1NA 3MUY1 4C56B 3HLAA 5C8JA 5HGAB 1I53A 1WVZA 2PWHA 3APNA 3ZXAC 1ZGLB 4JFZH 3QCTL 5MENA 3IAGC 5D7IA 4YAQB 3QQ3A 4NDMA 4LNVA 4PD4K 1OP3K 3K81A 2DWDA 1TQTA 3W0WA 1CLVA 2AGJH 1ZE3C 3VFSA 3JBG7 4NPYA 1ZT4B 1C1EL 2F68X 3GSXA 2VAJA 5GJTH 2H6PB 3QT2A 1RJYA 3NFPB 3U7WH 3W2DL 5CD3B 5I1AA 1HKFA 2R2BA 1K2DB 1AH1A 3PWUB 2V33A 2UWEB 3TPKA 5IZ7A 5I1HH 2YMOA 1BXVA 1IBBA 3MV11 4FHBD 4TUJB 4HS6B 1PNDA 4Y4KB 2UZIL 4KXZI 5DK2A 3QXAA 3B9KC 3IGAA 5L7XL 4PR5A 4GRMB 4FP8H 1N59A 1TJXA 1N18A 1IQDA 3K4DA 2UY6A 4KMLB 2VZ1A 1A7OL 1A9BB 4MA3A 4P4RA 2B1HL 4Z5RB 4AQEB 2MIZA 3N1MC 4MLIA 3NTCH 4OZHE 3ZO0A 4XP4H 5I30H 2CIIA 1T04A 2X3AA 2F54B 5D5MA 1DVTA 1QSEA 3AS3A 5IR1A 2CM5A 1ZGLA 1XCXA 2G3XA 4P23A 5F9WC 3D39A 4HKZB 2VJXA 4LNRB 3KPSB 4QDGA 1KY7A 2VCOA 5HJ3A 2N56A 3KVQA 3QXTA 5EBLA 4UOJA 5AEAA 4TN9A 4GXUM 3T0WA 1CURA 1D9KB 4PRNB 1SDDA 2JF1A 1PGRB 2XWTB 5IJDC 2CZNA 5C92A 1DZ0A 1FFPB 2DW5A 3FSOA 3S4SA 4APQD 5HYJD 3HB3B 5AG9A 1YDPB 3BSZA 4LVOB 4XNMB 1XMEB 3MRCB 4V1DE 3EYSL 5IM7A 3KLHD 2A83A 4J1UA 1KMGA 4G7QB 3ZK0A 4EO5A 3P2BA 4QTHB 2F53D 5JMOC 3FQWB 1YNLH 5CLXA 3TA3A 4H0HB 2NSQA 5F3FA 4XC3L 5KSUB 4ODSH 1OE2A 3ZLQC 2BRQA 1A9EA 2YPLA 2W9DH 4FERA 4IMLA 4JQIA 1IBGH 5JPNB 2GTZB 2MQ3A 4UQ2A 1JCKA 3C87A 5ADOH 3Q8BA 4Y1AD 1SYVA 2MNWA 3GJFA 5AW9B 4QIRA 3BVNA 5I8OH 4YSAA 3AU1A 3PF2A 4FZ8L 1TETL 2VH5L 2CRMA 3IJ7A 2WNGA 3DX8B 4OIFA 5FA3B 3WIAA 4ZFFB 1A64A 5EBLB 4AC4A 4F9LA 3EYFA 2AXFB 5J3HC 3REWB 4MNQE 5GRXG 1E5UI 1B3JA 5C08E 5I2IA 1HHIB 1MHPL 4JN2B 4PMFA 5HHOE 1C5BL 1CC3A 2WXRA 5IM7B 1PBYA 5E8PA 3CSTA 4HJ1A 4LZKA 5HD8D 4BQ9A 1H6FA 1J9RA 1HINH 3U9PL 1BGXL 1TTRA 4FE9A 5DA4A 1AGCB 4AGNA 4FNLL 2K70A 4KAQH 2JK5A 1BFVL 4YXKH 5HGDA 4HT1H 4QJ5B 4HLZG 3W0WE 3MRMB 2PXYB 5GISL 1N6QH 4LCWD 2WUCH 3MDJA 4OT1H 5DRNA 2F54D 1KNOB 4M43H 4H8WC 4HX1A 5L6YL 3C8KB 1ZA6B 3EGXA 1JD7A 4JZOB 3B6SB 2BLFA 4WW1A 5LQBH 2ZPKL 5C0EB 1DVYA 1ZA3A 1EFXB 3TEUA 2ZJSL 1FGNH 3TXAA 5IJVA 2BP5M 2NY6B 3BN9D 4JKKA 4XBPA 1Q72L 1XT5A 4PI0A 1MWAA 3LMJH 4YDMA 1BFVH 3NP4A 4DP6X 2VDKL 2R2HB 2ZXWB 3EBHA 3T6QC 1M7DB 3PDGA 2FATL 2XJLA 5ALBH 3HR6A 4H20L 1QFWM 1S9WB 2YPVH 4G7RB 4RRPG 1FFQA 4FYTA 4X99B 3RZCC 4AYBA 2J25A 4QYOB 3DTXB 4RWHA 3HG1B 2IOIA 3BQUB 1J9QA 3HBPA 2KZ1B 4I0PB 1RZJL 1IAMA 4JO3H 5AD0B 4JPQA 2NY5L 4DPRA 1WFJA 3OC5A 2JLLA 2EINB 1HSBA 3FFCE 4X7SH 2E59A 2GT9B 3MV7E 4YUEL 3MJ7A 4AEIH 4JPIA 4WLCA 3O2DH 5JW4Q 5E1GA 3B6SA 2V3FA 3F12B 4QNPF 1U95A 4PJXF 5H94A 1JVLA 3LN4A 2AJUL 3V7MA 3VXME 2IH3B 2K7QA 5IEHB 3SQBA 4GIOA 1BQLH 4FQ2L 4XVUC 2VDQH 4A2MA 4RNRB 3R7RA 1D9KD 1ZWIB 2PPAA 5IBUG 2D2CC 5D93B 1LNUB 2F19L 2F5AL 3SYCA 3TJEH 1JHTA 2QGEA 3KLQA 3GXNA 5DFTA 3SD2A 4X99A 1SN0A 3BH4A 3NVQA 4GW4A 2K4AA 2YBGA 1W8EA 3IDJA 3IS0X 4FCAA 4A2FA 3L95A 4RMTA 5FCUL 4D7BA 4ES8A 2YPLE 3OKNA 5ESQA 5AZEH 3S36L 1NWPA 5EUOA 2K6WA 5FM5M 3SJVA 5C0NC 5DO2D 1X7SA 3LZNA 1M4KA 3O45A 3LS5L 4JY6A 2K78A 3FXIC 4OLXH 4X7TA 2GJ6E 2KERA 3SPHA 3GSWB 1E5YA 5HHNB 4GI9A 2DQGH 4PIRF 4WJ5A 4EI6A 3KWTA 5IFHL 4YHKL 5K9KB 1I7RA 5FHAH 2EO9A 4EUPA 1QNZL 5C08A 1WEJH 2O93L 1PY4A 4F5CE 5BZDA 3KPRB 2R4RL 3T9WA 4XP4L 3V95A 3TEWA 4BK5C 3UTSD 2VN4A 2A73A 1F02I 2FGWH 5IEHA 4TUOA 5DEJA 1TIUA 4P9HC 5B1JC 4JPWH 5CBEB 3GNMH 2XI9A 2P8PB 3GXPA 4A39A 3NQKA 3DOHA 2HFGL 2BWIA 3QUZC 2I9LA 1ASPA 1EPFA 3AG2B 3EDKA 4HUWA 2YWYA 3AXIA 2A9DA 4HK0B 1SXZA 1QFWL 2FHFA 3QORC 1QLFB 2QHRH 5EU4B 3UACA 5JR1H 2DRUA 1C1EH 3DROA 3H3BC 3IMUA 5TQ2L 2OA9A 1OXYA 1TTCA 5CJQL 3ZGHA 1JI1A 3VYOA 2J8OA 1O9VA 1P6WA 5E2VH 4G7VH 1HS6A 1LO0L 1ZHBA 3DHJA 2WLNA 3LH8A 1I9EA 1UWXK 2BXYA 3PG2A 1AY1H 4AJVA 1GMEA 3FKUS 3QORB 5FO7A 3ETBF 3GSNH 2CO6B 4AYID 2HLAA 5C0BE 5KAQG 1S8DA 2HN7B 2QDWA 1YN7B 2GJ6A 2VQ4A 3SD5A 5JHDA 2O6PA 4WO0A 3FOMA 2OMTA 5JLZA 4YZFF 1QP1A 3TNNB 4AVKA 15C8L 1MF2L 1MWOA 5DVNA 2F5BH 5D2LB 4QRPB 1AY1L 1ECYA 4QRFA 4RGNC 3QHTC 2AERT 4HUVA 1DANT 1IBHA 3I3EA 4JHAL 3FT2B 1XR8A 3STLA 4XI5D 1SMOA 2EKJA 1KIPA 4MCZA 3MODL 3NZ8B 4JUTA 4Y5XB 2GHWB 3NPSC 4JDEB 4EKJA 2Z3FA 4FC3E 4S1RH 3FSZA 3S2AA 1H3WM 4U7SA 5I6PA 5L4JA 1MQKL 2FL5B 2JKWA 2VGLM 1F4XH 5B8CB 1OGAB 2YJQA 4M1GL 4HALA 1FRGH 4LQFH 1A3RH 4FXTA 4P2CG 3CDZA 2W60A 4QOKB 4ERSL 4MASA 5JUEL 1TR7A 1GZPB 1OSPH 3ZDYF 4B9KC 3O9WC 4I1NB 4I87A 3VXRB 2X9ZA 2DH2A 2HG5A 1HTYA 4RFNB 1RUAL 4HUUA 4KQ3L 5IQ7L 1OKEA 1JDDA 1KB5H 4UBDD 5ABZA 3FRPG 2WTOA 3ABLB 3IJSB 3WEAA 4QRRA 1OWRM 4FA7B 5E24E 4JY4A 2IH1B 1AZCA 5C0RL 2EVJA 2PYEE 2Q6WB 1T5KA 2E6QA 4OBRA 3FPYA 3QXWA 2NRDA 3IPEA 5FW8A 2OZ4L 4YGVB 1Q9WB 3DSFL 3HZMA 4HUVB 1RY7B 2GJPA 4L4TD 3W9EB 1TJMA 1UYWL 1WA2X 3U2SA 3VXSD 4NOFA 3GSVB 3T0EB 1UZ8B 2YEQA 2MJWA 1SQ2N 3W37A 2W65B 3CUPB 4OLUH 5AKTA 3HUJE 3ABMB 3SDAB 4R4BB 3OKLB 4KI1A 4GS7B 3U4EA 5TH2A 1SPDA 4RGMC 5DEFA 4Y19B 3QA3A 1Z3GL 4MSWA 5DUJA 1T2XA 5CZKA 3US9A 2E9WA 3CDZB 3FYIB 5FCSH 5AW7B 3RZCA 1RZ7L 3VXUA 2X87A 1WHOA 4R7LA 3CDCA 3ARFD 1QEXA 2XC8A 5DHEA 4N28A 5ICYB 4WO4D 4HPYL 2OL3L 3LHPL 1HQRA 3PNWA 3ILEA 5LUMA 4Y2DD 3FRPA 3ULUH 2V5YA 3EG9B 3P3TA 2VL5A 1ZLUK 4HIHA 4IDJH 4BGLA 4IJ3C 3VB8A 1NIAA 4G80B 4P2AA 5JO5B 2WUBH 3KR3L 3QXUA 2GJRA 2X4SA 5D8JL 2VQ1A 1ZVHA 4JJ5B 5F21B 3VACA 4YX2L 2BVUA 1I31A 1Y6MR 2OSLB 3IU4H 3SGJC 1RZJH 1HXMB 3HCVB 1Z9MA 3U4BH 3HZVA 1PX8A 4OZ4A 4UMGA 4MQTB 4K3DL 5JNYA 4F15B 5BXFB 1TTUA 1KJ2L 4CVXB 1RP9A 1T3FB 3BLBA 3IETA 4H0IA 4Z3TA 2BOBA 2FJGB 4WNSA 3V0GA 1O75A 3ZJAA 5T1MA 2FATH 2W0PA 1UJ3A 3AG4B 2A1WH 3MJGX 3KPRD 3CVIL 4PLNC 4N8VB 4ZOAA 3LRSA 3E6HB 3FRPB 2EZ0D 4WTZG 5GZOD 4LPVA 5D9SB 4HZLB 3RIKA 4KFMA 2VSDA 2NUTA 1SQMA 2F7PA 2QVIA 4L4VD 3ZZ1A 1DSFH 2AJSH 1OAYH 1CFNB 2FZ3B 3MLYH 4U6YA 4EF3A 4KAQL 4JGNA 3CSPA 3AQYA 4K7FB 4BFBD 3LEVH 4Z0BH 3Q1EA 2DDQH 4CC1A 1TZOA 1DQLH 4KDTA 4O00A 2F74A 2I60L 4WWKB 3RVTD 1YEJL 3CH8A 2WCPA 3R19A 1JYWA 1N19A 2DBLL 3PWLB 4TNFA 3JVGA 3Q13A 1XGTA 5MHSD 3GXDA 1ZHNB 3KPTA 1MCOL 1MHPH 3UX9B 1H6EA 1SBBA 2ICWA 2A6KA 5DI8A 1KBVA 4TSAH 3ZDZF 2WLIB 2VISA 1EAQA 3CHOA 3KCWA 4QGTA 5IVXF 1UA6H 3QIBD 2I69A 1WV7T 5T1KD 4HA1A 1QZ1A 2EIZB 4JRYA 4EN3C 1JG9A 3T5WA 3HBGA 5L8LB 1J1OL 1BVZA 3WKMH 3O0RH 3DGDA 4APQC 1JPGA 2HPOA 1CN4A 3E6HA 2B39A 3GPSA 1UB5A 1NGZA 2XWBB 3HN8A 2D73A 2XN9D 2ZWLT 5GGSA 3E7JA 5E0FA 4F8TA 1PQZA 1WT5C 3IJHB 1NL0L 3DVNA 5AWNL 3X11B 3T1FB 1HWWA 1WC7B 2IXQB 1JK8A 3NJHA 3ZSSA 3BGMB 1KWKA 4YOKA 1DVUA 4R90H 1XL6A 4BDVB 3LQAH 4PWKA 1JRHI 1S7SB 3OKEB 3EFOA 1ZIAA 2PTVA 4OKVB 3VXUE 3B5TA 4G3YH 2WB1A 4H25A 5I74C 1MPAL 1JWMA 4UQ3B 1JXGA 4WGKA 4MJID 5TQ2H 1BIIA 2XY2A 3VD3A 4KJQC 4CBZA 1DDTA 2VMCA 2RFXA 4C4KT 3P3SA 2R9HD 1W0VB 1FGVH 1XD1A 3GHPA 3OJVC 3PDOB 3GI8H 2ESVD 4QHNA 3VFOB 1GXEA 1E4KA 1R19A 1NMAL 2XQYG 3D9AL 1EHLH 2D7MA 5DWUH 5C0GA 2BX5A 3M7OA 3MCYA 1SM3L 5AW5B 1BAGA 3P11L 4M8UA 1RP8A 4ZQKA 3O8XD 3FTXA 2YAOA 3BP5B 2NX5D 1ETA1 1YEEH 3SKMA 2JJSC 5EPMB 4RWYH 3N1PC 4B3EA 5KOMC 1INDH 4MDIB 4FLHA 1N64H 5D2LF 4IYKA 4C57C 5IP4A 3X1NA 1CB4A 5DJ0A 1NSNL 1XDTT 1LQBC 2QPDB 1J1PH 2QVMA 3RY5A 2FO4B 2V8MA 4O2EA 2GJZA 4QY8A 4IRZA 5D1XE 2WK2A 5H35A 2J4WH 4KKAD 2OXGB 4IRSB 2DQGL 3L5XL 2EXYD 2YC1A 4MVBC 3WS3B 1P6AB 3ATEA 1BD2D 8FABA 2WVVA 1W80A 2ZTBA 5LAXA 1BOGB 3KGRA 2LQRA 3OAZH 5JIHA 4PRBB 4OCMC 5HJDA 5FA4B 3JV4A 2FH8A 3VM5A 2EDTA 5EH1A 4ZBJA 4DEPC 2X1WL 5C6PB 3N3EA 4L1TA 4KMTL 3L5WB 2ZF8A 5SWQB 2HKFH 2XZQH 5IJKC 3QBTB 2IANA 4IRJD 5EZJA 4FG4A 1KLFB 4D0CA 4L4VE 5F72S 4YDIH 3NQIA 3VFMA 3ZE1E 3C60D 5ID1B 3AWFA 3U9UB 1B6UA 3D0VB 3OPZL 3NOIA 3FTUA 2E56A 4GI8A 1ILUA 4ELDA 3NZHL 3PUCA 4IGBD 5AWNH 4IW4C 4H13C 2V7NA 5KSBA 4G8EA 4HIEB 1ZK5A 1OGPA 1HCZA 2IC2A 4A2GA 2H3KA 3NCWA 1Y6KR 5ESVA 4Z0XA 5FO9B 4HKZA 5JDSB 4AEHH 3WS3A 1OPOA 4XMLL 8FABB 3EYOB 5TE7L 1MHCA 4GKLA 2PETA 1P4BH 1G0DA 4GKSB 1HCFX 1I9RL 4TSBL 4HIPA 5CP7B 3LDBB 1YEJH 2GI7A 3HTLX 2V5TA 4XMXA 1XSKA 2ATKB 5F7KC 3U7YH 3O3BB 3S98A 4UQDA 1T22A 5DLML 1J5CA 3WXWH 5IWLC 2VNCA 2DWTA 3V4UL 4K3JL 2C9XA 3TCTA 3U46B 3AAZA 2V3EA 3O3AB 5DJXA 4E42A 3LEYH 5DZLA 1R5VA 2B2XH 1IGMH 4MKMA 3R18A 3TA3B 1IT9H 4UV4H 1CIDA 2QADC 3CVHA 2Y5QA 4P46C 1BFSA 4JGJA 4YQXL 5IKCA 1ZHLB 2ARWA 2WD0A 4R9HA 1JXDA 1UUSA 2J8UE 3UZVB 3L9RB 3BT2L 3IGUA 1VGKB 1YSOA 1GS7A 5J7CC 4PRAB 1S4IA 5T3ZH 4Q6YA 3UO8B 2XQBH 4QOKA 1IC0A 2E47A 2VQTA 2WWMC 1FHNA 2KBGA 2VR8A 1WBXA 3RGVD 1S7TB 3MLSL 3VXRA 4NZJA 4ZK8A 1VPOL 3P0YH 1AR1D 2YK1L 2ADJA 4HUUB 5GGTH 5JHAA 1N8ZA 5CJOL 3OQ3B 4PJDB 1T03L 3MFFA 1GOGA 4W9KC 4B3VA 1SXCA 2DI8A 3FUEA 5IBTH 4D9QE 1AOHA 2M8XA 3V8OA 4JANB 4JK0D 1FZOB 1WZ1L 2E7CA 4JE4B 5DC0A 43C9B 4U6XB 4DP5X 1EJOL 4G1EB 4JRXA 4Z7WE 1E6OL 1WZMA 2WVUA 4A7TA 4HCRA 2L8AA 1X4ZA 4DEWA 5D7SH 5FGCE 2H3XC 1R3LB 3QUZD 3U46A 1NPNA 5HGHB 4OCSL 3V0EA 3L45A 5T1LB 1K85A 2OTUA 4LSQL 2CO4A 3SDAA 3O8XA 3OMZA 1H8OA 4NQDE 4WNJA 1UTDA 5DJ2B 3JQOB 4FNTA 4PGEB 5ENWB 3BP4B 2DTMH 4PRDB 5BRZB 1WS8A 5HHXL 1MFCL 1EAJA 5JZ7D 4KJPC 5E4EB 4ATWA 1NQBA 5BRQA 3ZDXB 1MI5D 3T0XA 1CFQA 2XJKA 4YDVA 4UZUA 1AGDB 2J44A 1MCQA 5F89B 3E38A 4POUB 4JLRA 3NSFA 4BFRA 1M7DA 3CIQA 1KGCE 1ZEAL 5AVYB 1G43A 2CPCA 2WB7A 1JDAA 3UTTA 4A1RA 3GFUA 3PNWB 1IFRA 3DDGA 4WHTB 5I1IH 3DOSA 2NX5B 4PMEA 5IW1B 1AXSB 3APMA 1YEWA 4XO8A 3FB7A 2I27N 4P2QA