1AHMA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 7
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahmA00
3MU3A 1AHMA 1AHKA 3RG1C 3MTXA 1XWVA 2E56A 2E59A 2F08A 2Z65C 3T6QC 5IJCC 2HKAA 1WRFA 3B2DC 3M7OA 3VQ2C 3ULAB 3WEAA 5KWYC 1NEPA 2Z64C 3WEBA 3FXIC 1A9VA 1KTJA 3VQ1C 4G8AC 5IJDC 5IJBC
chains in the Genus database with same CATH superfamily
4G7RB 5K69A 4O2FB 1BEYH 3IGFA 5C0GA 3SHSA 4KRPC 3T1FB 3HZKB 1CFMA 3MRBA 4RVBA 4HIJA 3RNQA 1MF2L 4LVNB 4XP5L 3SDDD 1YEGL 3ISYA 3X3FH 3OZLA 2CLVB 2QSCL 5SWSD 4C56A 3QIWC 2ADJA 1WK0A 3CV5A 4AGPA 1D5ZB 2VDPB 1UADC 3P77B 3L5XL 3P4NA 5DHVB 4HW6A 1AGFB 4V11A 4F1ZA 5E5UB 2WN2A 3FT3B 1DLHA 4UQDA 2H26B 4X4YB 4JPIA 4ABWA 1TQBC 1KC5L 1QNZL 5IJDC 4LEEA 3VFTA 3NUKA 4HIHA 1NCHA 3ZZQA 1WTLA 3ZQ9A 2ITFA 4YXHH 4LL9A 2EVIA 4F1SA 4LEOA 1ET5A 5HI4C 4FQXC 2M8XA 3CMOH 3IMUA 3CSTA 3R06A 2WTRB 5J12C 3QDJD 3FQ4A 35C8H 4G70B 2EKSB 2Z7UA 1DVSA 4L1SA 2I60L 5IQNA 5GS0D 2B1OA 4FQHA 3NCJL 5JHLA 4BZ1H 1MVUA 3LJ3A 3P0YH 4JANB 4TPRL 1QWHA 3REVA 3V4PH 4LLWB 5TDNB 3IXTA 1WAAF 3Q43A 5SWZB 2ZF9A 4TYUA 4P49A 1OARL 2CXKA 1IC1A 3LMJL 2I7SA 5IMLA 4BQBA 3T2NH 4UV7L 1N5AB 1PIFA 4PVMA 5I24A 4U6VL 3ARFA 3OB8A 2F74A 3B7YA 1NKGA 1F4XH 1RLWA 2DTMH 3MRMB 3QJSB 2BPBA 3RPIB 1L3WA 3O4LD 1AXIB 1KCLA 1Q1PA 1ZHLB 3KE0A 3QJHB 4JL2A 1RZKH 2G3MA 1EEUA 4HJGB 2ENSA 3OR6A 1I9IL 4HT1L 3VWJD 4DW2L 1U8KB 2X6VA 4IS6A 3NGBC 2JI1A 4FABL 4WEMB 4LLMB 4NQQA 4ZW8A 2DJSA 2VZUA 2LFEA 5EUKB 4M4RA 3WY2A 2VM9A 4NQXA 4MMZB 2C1OB 2YQ2A 4PJFF 1BP3B 1VFAA 4TUOA 5HJGA 1MRCL 2PXYA 5J5EA 4F2MA 3KZ8A 4IKNA 3HEIB 1WIUA 4NHUB 5DSCA 4GIPD 3BVNA 4LHUB 1NMCB 2WLJA 4UT9L 3OPUA 4FRWA 1JMZA 3NZHH 4I2XB 4D9RD 2RACA 5FO7B 5I6LA 2XPGB 3NFPB 4WHYG 4RRPM 4DFIA 4OUUB 3QDGB 2P7TA 1VEOA 2H0EA 5CGBA 3CFUA 4H13C 5EUOF 2MPAL 3GBMH 1HSBA 3U7WH 2VW6A 2ICEB 2BMKA 3H6JA 1GKOA 4ODVL 4OQTA 3EFOB 1NEZA 1ZY9A 4R2GC 3GBNL 5BMFH 3NIGF 2NDGA 4OT1H 5IOPA 3QEUA 2NY7L 3OKDA 1AI1H 2WQ8A 3EOTL 5BCAA 3FC8A 1IKOP 4OF3A 3P3RA 5KSBF 5I8CA 2BNRD 4RWHA 1MHCA 3S2CA 1VDGA 3ILQD 4J3OC 5HYJA 1EVTC 3QCTH 1DFBH 5D1XC 1NOAA 1UJ3C 4HS8H 4LQFL 4I88A 5F7HA 3GTVA 1DCLA 4DO6A 4BSVB 3NPSB 43CAA 4YDMA 5IF0A 3UACA 4OIAA 5HVFB 2HPOA 3DX7B 1SQMA 5HI3D 3S36X 2R1WB 5FO2A 1ZDSA 5DZ9A 1BZ9A 2WNKA 1JUFA 3TIDB 4YDJA 5IK3B 1FDLH 4NUJB 3M1OA 2SEBA 1KTDB 5GGQL 2YEZA 4G9FD 2YOAA 3MNDA 1I85A 3X1EA 2Q3ZA 1ZGLP 4P4RB 4Y4FD 4OLXL 1Z9LA 2IG2H 3EYFB 4S11A 4XCCH 2BHUA 2EUWA 2Y72A 3GK8L 3NESA 2VSDA 3SPJA 4D9LL 4GRWF 4P9ML 2J8HA 3QWRA 1CBVL 4J3OG 3PV7A 2NUTA 1ZCRA 2C9AA 5D9SB 4EUPB 4X9HA 1S7SA 2K78A 1KEGL 3N04A 4ZD3H 2OL3A 2R69H 4CA4A 4NUGL 2VDRB 5EC1B 2R23A 3GSQB 4QNPF 2OULB 2UX7A 3ARVA 5CWSA 1BXVA 1S7QB 2VZOA 3FQRB 3OAUH 4OZHB 3MHZA 4JUSA 3GZKA 1XF5B 2OW7A 1E7VA 1LNUB 1Z3RA 3DIFB 5B38B 1BYNA 5HDBE 4O5LH 1MJUH 3JWNG 3K46A 4NQVA 4B95C 4ZXBB 3HC3H 1XR8A 1HINH 2LOEA 1A7QL 3B7TA 5E03A 4LARL 4LRNL 2E4TA 2WWMC 3U9PL 1V7MH 3NMEA 2YO3A 1QFWI 1X4YA 1ADWA 4FTVA 4PJ5B 1CE1L 1NOFA 5BZWB 2WWOA 1KT2B 4YPJA 1NM4A 4ZX3A 4KKPA 5E6ZA 4P46B 1L9SA 3IDIB 1KIRB 3MA9L 2X4SB 3AG3B 3D7PA 2OYPA 3HVDA 4X7EC 3TH3T 3BO8B 3CBKB 3LS4L 3ME0A 4XBMA 1R3IH 1OAYH 1G9MC 2VC2B 2HFEB 4F7MB 3VCLA 4A67A 1IC0A 1U3YA 1USZA 4I13B 5EOCJ 3UC0H 1W91A 1XSJA 3H9HA 1R3KA 1S9XB 2F54B 1O9VA 1YJDH 3BZ4A 3FB5A 3L1GA 3AXLB 4IRJB 2DWYA 5IM7B 4KRNA 1TFHA 3GI8L 2ZXDA 1UOWA 3P69A 2VERN 1R6VA 5DJAB 3B83A 3T3PF 1PY0A 1XF4B 5K59E 4JKLA 1F4HA 4GYBA 1E4WH 2APBA 4DKEH 2WVVB 1C08A 2OL3L 3GSOB 4HUMB 2E47A 2QGBA 3KPSD 4PJHA 4V2BA 2G5RA 4V33A 5GRXG 5MI0C 2ZUYA 2HN7B 4OI9A 1ZT1A 1OE3A 3QIUC 4NC1C 3FO1A 3H53A 5CJOH 2W91A 3AGWA 3ZDYB 5I15H 1MCQA 2QLVB 3CU1A 2Y7MA 4G6ML 4HWNA 5IUCA 2XVBA 3D9AH 3QWNA 1PL3A 5CCKL 1Q9OB 1MPAL 3BAXA 4JKKA 5TFSH 5I6NA 1C5BL 1JGUL 5FYLD 3TV3L 1NGQH 3TF4A 3TVMB 3SCMD 3WNMA 3BPCA 2WZ0A 1JZ6A 1OGPA 1WZKA 2YAPA 2HKFH 3CCHA 1LWHA 5BO1L 2QL1A 1NMAL 4YSQA 1ZVYA 5BPPA 2P44B 3HR5B 5DMKA 2JE8A 2H4EA 2P80A 3UEZA 1OQOA 4AQ8C 4PVBA 3PV6B 1M6OA 3SYOA 2FWOA 2F08A 3BEWA 2VDPH 3C6LB 3CIAA 2X5PA 3GMRB 4HJIA 4K71B 4PJ7B 2Z8RA 3H42H 1HS6A 5D5MF 1P9MA 4JRXE 3VYNA 2QTVA 3FCGA 3K1DA 4NQCA 4ZW7A 4ORGB 5HHOE 1RZFL 4CW1B 1P4LA 3FTVA 5BRPA 1FO0A 2N4IA 3HRPA 4FYQA 2Q8AH 3VFRB 4LSVL 5EEVA 3KYKH 4FP8L 4Y19A 3S9DB 3UZVB 4U0RC 4WWKB 3IRZA 3B2UC 4UNIA 3OX8A 2X4RA 3D33A 4ZDHA 4CU6A 3LNIA 4N5ED 1Z6JT 4K94L 3TP4A 5IKCA 1O5DT 3FYIB 4Q9QH 1EHAA 2ZYRA 3OF6A 4GBXD 2DWSA 4QRSA 4EOWL 2IMNA 4U0QB 4L0YA 1AGCB 3V7MA 3B4NA 4MS6A 2AQ2A 2FQGA 1QHQA 2ERJC 3LDBC 3LXUX 3BVXA 3PAUA 4KC3B 2IALB 4IM8A 2K3HA 2WO3B 1NMBL 4JFYB 1YEHL 3VWKA 5LGJB 3RWGA 4X6DE 1U3ZA 5I1EL 3AREC 3Q2LA 3FCSA 3TT1L 2MEJB 5GRJH 5DGQA 4YHNB 2WBJC 3UYRH 4DQOH 5JW4Q 3ETTA 3K81A 1PD0A 2AMGA 1B0RB 1DUYB 2NNAA 3O11B 4LQ1A 3VD2A 2GBTA 2PW1A 2YJQA 4HYTB 4RGNE 3GNML 4ELMA 1UM4H 3QB7C 2HFGH 4L8CB 3WNLA 4HAKA 3QWQB 2QHLA 3WJLA 4XI5C 1FGNL 4WO4A 1IGCL 5CLYA 2ICWJ 4AT6A 4K9EL 4PUBH 5I17B 1WFOA 1EA9C 2G60L 2FO1A 4FFVC 4MX7A 2FE0A 4HKXB 5FKAB 4CRPA 1S9WB 1V05A 5I76A 1WS8A 5ACZB 5EF1A 3HMWH 1LO5B 3FCTA 4N9GA 4LVOC 4ALAC 4M3KB 1YO4A 1DBKL 2R2BB 5E5LA 4DP7X 5HYIA 5EU6A 1FUNA 2WK2A 2BNUA 4PJXE 3M1CA 4UTAH 2ZP8A 5AG9A 3JTTB 1M42A 2Z7YA 2VLJB 4X0NA 3MTRA 1AQHA 2N01B 3DRQB 4B50A 4GG6F 1EJOH 3FU0A 5T5FL 4QRPA 3ARDA 3V4PA 3ULUC 3QC6X 3D4ZA 3HA0A 5EDXA 1HX0A 3EJZC 5K9OA 4RCAA 5CFAA 4GQ9H 3DUSB 2MIZA 2IFFH 1QLEB 4ECNA 1WTGT 1JHLL 1GZHC 2BS8A 1T3FA 4MD5B 2R2EA 2ICWB 2FATH 2X9WA 5AVRB 5C0JB 4URKA 3NBNA 1I4FA 3VI4B 3E8UL 1XTLA 2QBWA 3BPOB 3DETC 3US1A 1S7UA 1IARB 2XCMC 1AKJB 1T03H 4JFQA 5ANHA 1UACL 5CJQH 2JB6B 1OB1A 2VE6B 4NYLB 4MD4A 4OF7A 1JGIA 2RFXA 4TNWK 1KLGA 3CN1A 1AKPA 1Z7JA 3WKYA 4NQEE 1KN4H 5E2WL 2QADB 5GS2H 1A1OA 3ZTCC 4ZMLA 2OSLA 3QEQD 1WE5A 3G5ZA 3QG6B 5JOFA 3B9KD 1MHHA 1TYRA 3RILA 4O02L 3EOBA 5FB8B 5E4EC 3HNTH 5G4OA 1L7TH 2YQBA 1ZK9A 5I16B 3MFFB 2P8LA 4UOJA 1G7PA 2XACC 3ZHKA 5BV7B 2ZQKA 25C8H 3D0LA 3LQMA 2W0KA 1YMMA 3FT2A 4GW4B 5DD5H 2A0LC 4N8VA 4OY9A 2IQAB 4ERSH 1KCVH 3V4UL 3VXOB 2J5WA 1A6WL 2BSEA 2NY6D 3QFDB 3F3HA 3CMOL 3M8OL 1DDHA 1PYWA 1TPXC 1KF9B 2E76C 1BV8A 5DJZB 3OGCA 1N12A 4EKXA 1A22B 5JLZB 5D1QA 5AZ2H 5AW3B 4OGZA 1RD6A 4BZ1L 2YC1A 3P0YL 5GISH 4ZYKB 5ADPH 5BZDB 3ZKND 2EZ0C 4XN2A 3W39A 1EXGA 2Q6WA 3T65A 1FNFA 3AC0A 2AZUA 4U1JA 5BOJA 3SE8H 4C54A 5EOTB 1WVZA 4AX3A 1FH2A 2EIKB 3P9WB 4P2RB 3T2NL 1SRDA 3FB8B 4EQ3A 1QSEE 2C7FA 4X8GA 4MDIB 4YE4H 1NDMB 2H47C 3PWPD 1OPOA 1I9JL 3OHMB 3DLQR 3KG5A 2E8ZA 1HOCA 3V0VA 2R4RH 4XB8A 1TUPA 5L4MA 4PRNA 1IAKA 2VAAA 4MB1A 3RTQB 1DO6A 2Y06L 5E8DL 3OKNA 1R3HA 1RZKL 3OSKA 3ZKQD 3VXUA 2IXQA 3P0VL 1MAMH 4B3VA 4QOKE 1GZPB 2TAAA 3D1MC 4S1DC 2XQ0A 4XBPB 3AUWB 4PIBA 4H25A 1F90L 1QUNA 2VIRB 3DYOA 3HE6B 5D7SL 3H85A 3PDOB 5KEZA 5CJ8A 2HZHA 3IFOB 1AFVH 1QLFB 4FQXD 5HI4D 1RU9L 2ZOKB 4PS4H 2VO8A 3PWVA 3QCUH 5F71A 3D34A 3NZHL 2R69A 2EDJA 1IEHA 2H6PA 1AO7D 3BVWA 3VM5A 1M71B 4KMLB 5DWUH 3DV6A 3C12A 2W9DH 1WEJH 5TPWH 4BFFA 3BVDB 3GBML 3JT2A 1OM9A 4FA8A 2I9LA 3U4EB 4MAUH 3OJDA 2MCMA 4Y8DC 5JDJA 1PD6A 3SPHA 2DKUA 4UQAA 5KUMA 1BBJA 2CNYA 4JCWA 4TSAH 3TGXA 1AI1L 1FIGH 1JVLA 1B0GB 1S5HA 3GGWA 3GZPA 3BD4A 1AIZA 4JFEB 3RNKA 3MV9B 4WI7A 1AD9B 2H2SD 4NBYB 1NGYB 4FNRA 5B39B 3HS0C 2XNAA 4L0PB 2QDWA 3JYBA 2XWXA 4H26A 1U3HA 1V5JA 4Z3GA 4Z7VA 3F7YA 2VABB 1VFOA 2N1TE 4JFDA 4QD2E 3G5VA 3ARGD 1E8XA 1FDLL 3MBWA 2FX9L 3SPVA 2DB8A 3KNBB 5MHSD 4NQTA 1JIBA 2GJ6D 2YPKB 1AZUA 5ENWA 2EYTA 5ACMA 4OB5H 1DVYA 4PJDB 5CJ5A 1KGJA 4WHDA 4PG2C 5I0XA 3RKDD 1JZ2A 2IG2L 1UXWB 4ZFQA 4PW4A 4XCCL 4Z3HA 3LPFA 1ASPA 4Y16A 2UWEF 2HSIA 4P57B 2NNXA 2WXIA 3Q2VA 3D85D 2E7BA 2PN5A 3BP6A 2JK5A 1RZGA 3NDYE 1J0KA 2E9JA 4RISH 1J8HA 4E5XG 4E41D 3BRDA 4OFIA 1XCTB 5DEFA 2WIMA 3NH7L 3L1FA 1P1ZB 5FA3A 1M2VA 4QHUA 3IDGA 2F5BH 2FWSA 4N6QA 3VSTA 4Z95H 4J3OD 2C3XA 3OAUL 3IMWA 1DLHB 3K80A 3L5JA 4P23A 5IGXL 2X6BA 3QQ3A 5GS3A 1PD1A 3RWFA 2LW3A 4CSTA 1OCOB 2XDHA 4A7TA 5C6TL 3BW9A 3OKYA 3MBEC 3D0VB 4LEOB 4N90E 5DEZA 4LSQH 5JZ7D 2VW4A 3SJVD 4AOFA 2NY2D 3BCDA 2HRGA 3R06B 4Y9GA 4FI6A 2H1LM 4IGBB 1V7ML 3UG3A 2W65B 3FQYA 1E27B 2ZXBA 1ZE3C 3H9SA 5FHAL 2D9CA 2RALA 3BUTA 4FQHB 5T3XH 2WXMA 3LPPA 1BAWA 2DLIA 1OAJA 4OLYH 2KH2B 2QQNH 4WKZA 3EOAA 3FFDA 3B9DA 3QDME 5F0LB 4P4KB 3L3KA 4OD3L 4HAFA 1FL3B 2YD9A 3L4YA 1DJXA 5JPNC 1R3IL 1OAYL 1JI1A 2H0JA 4EDXA 3PWJB 5E6IB 4GMSH 3VYOA 3VRLE 3NQKA 1HILA 1HNYA 3KVQA 1QI4A 3B9VA 3UC0L 3U7YH 2AVGA 3VH8A 1YJDL 3VXSE 3RL1A 4UNUA 3JVGA 5I1JL 4Y5XA 2I5YH 3I84A 4KHXH 3RJDA 3FW6A 2VTFA 2OX5B 3L7FB 3T4AB 1RP8A 1DQLH 2E56A 3MCLL 5F0MB 2CK0H 4KJYA 2XKUA 1HHIA 1E4WL 4RGMB 1K72A 3CFTA 4GFTB 4PEEA 4ZUTB 4I1NB 1OGAD 4DKEL 3EJYD 5C0BE 2YAOA 4N8UA 4NQXB 2YQ3A 3SGEH 3S96A 3AQYA 2J73A 2B08A 2D4FA 4WIQA 4IEFA 5CJOL 5ANMA 3VGAB 3BVNB 4H5SA 1GRWA 1QBMH 1F00I 1UH4A 1QLEH 2XZZA 2C3WA 5IHBA 2V9TA 4OJAA 3UTQA 3D87B 3LQZA 1A6VH 4PD4J 3TBTB 3EXJA 1WFTA 4RMWA 5E9AA 2ITEA 1IM3A 3GWJA 3P2BA 4JDEB 5TFSL 3SBRA 4F9LA 3I9IA 5C97A 1CFBA 2WW8A 2XWJB 1NGQL 1J18A 1LP9F 1XHHA 5I66A 3V0WH 3BN9C 4K23H 1TQCB 3PHOA 1T89A 4BINA 1GGBL 1CICD 4D0DA 5C9JA 3TJHC 1EXUB 4OJEH 1FFRA 4UM9B 2Z8WC 4QKTA 2AJYL 4G6AD 3M1BB 4G42A 2VDPL 1LEKB 1UZ8B 4B41A 1UA3A 5J9PB 3H42L 4M7LT 3HKZA 2I9TB 5BV7H 4TLKA 3S2AA 3GPEA 2PCPB 1R0AL 1OEZW 4MSWB 5LG6A 5IF0B 1C8PA 3Q6FB 2XQYK 3OR7A 1U8OA 5E99L 1I1RA 2E75C 4B9JA 1HCFX 4U1HB 1WCBB 3LEXA 2JXMB 4YDNA 1E6JL 2Q8AL 3T08A 3KYAA 3UDWC 1UJTA 3G04B 1RERA 1XF3A 2Q0ZX 4P9HC 3QIUD 4FQIH 4FYRA 5C07A 2WBKA 1A1NA 1R5IB 2FHBA 2EO9A 3H1ZA 3HHSB 4E9RA 4Q9QL 3LPWA 4PJIA 1L4IA 1SLXA 3O8XC 3US0A 2LT9A 1FYTE 4LCUA 3UPCA 5L0QB 4KDWA 1MEXH 3I6LD 4KV5E 5EO1A 5IHHA 3FONA 2P49B 4KXDA 4EDWL 5DFVC 3LKRA 4JQVA 1TJMA 5E2VH 2R8SL 2ZUQB 4MXWL 3QA3B 1KV7A 4PREA 1SYSB 4MDJA 1QRNE 2J71A 1UWXH 1MFBH 1SQ2N 1B3JA 3VD0A 1NFIA 2E3VA 3V6FA 5M7QA 3RZCB 1ITBB 1MCPL 3NA4A 2R23B 3KS0J 1ZSHA 3O9WC 4N26A 5KOMC 1TYEB 2Q3AA 2IDQA 5CWSB 3LN4B 1UD5A 2XV0A 3FXIC 2V3FA 5DRZB 4Q7DA 5AKRA 4KO9A 5BJTB 3UBXG 2J5LC 4DQOL 3GLZA 4Y4KC 4R4FH 4JCMA 3QJFA 1SUJA 5IEHA 3P4MA 2P8MA 4ZPVA 1UM4L 3P30H 4U3HA 4DGUA 3TH4T 5ESVB 3VGFA 4Z3IA 3DI2B 3UZEC 1SEQH 3HRZB 4PJEF 1HYRC 1N70A 4F8TA 4EIGB 3OC8A 1UHVA 2YD1A 4D2NA 1T04B 3DHJA 2EE3A 4Z5RB 3Q5YA 1OD9A 4JZNB 2L7UA 4WWNA 5F3BB 1G4RA 1G87A 3ATFA 3D06A 1EDYA 2GJZB 2VLME 3HMWL 4LSUL 1BJ8A 2ATAA 1JPGA 1RK1B 1JZIA 2I69A 4YHLL 1HQRA 3CZUB 4YZWA 3E2HC 3PL6A 5E1IA 3TA3D 3QUYC 1E4KC 4JFZH 2ZWKA 4KXAA 3W0WA 4UTAL 3NIDF 2B9BA 4GT7A 3A4DA 2NMSA 4PP1C 5CP3H 1MAKA 1TEFA 1XBDA 3MA7B 2IH9A 4N68A 1U93A 4N28A 3VFMB 2IJ0C 4W9JC 4PR5B 4YGAB 3ARPA 3NJHA 4X7SH 3H9HB 2DQCH 1OTTC 3FB5B 3M7FB 5CSZB 1UB5A 3MLRH 4XWOD 1KYDA 2IFFL 4HSCX 4ZZFA 5M94B 2GJJA 2YBRA 3ZL4L 3SKJH 5E9DA 1GMEA 3N2JA 1CFTB 4WJG3 4AG4H 4WTZG 2KMWA 1A25A 4HFUL 1JPSH 1Q94A 4P2OC 1T03L 4MJ5B 5CJQL 3C5ZB 3SPCA 1C08B 1X9LA 2G2NA 4PJHB 3NRFA 5J13C 4MMXB 1B2YA 3BQUD 4PS3A 3O0RH 1Z5YD 4KWUA 1SDYA 3DXAE 3WNIA 3LRSA 3MLSL 4XNDA 4KU1A 5IBTL 4ZMPA 5AALA 3VFWB 5E6SB 3IWVA 2Z0UA 3QXDB 2WNWA 3CSYA 4XVOA 2Z4TA 1HXMB 1R5WA 3MV8E 4N86A 3HG4A 3ULVF 3HNTL 2J1ZA 2CO2A 1L7TL 3FFCB 4ABVA 1DANT 3UO1H 1E9PA 2VQUA 4PBWD 3IKCB 2XJLA 1NBZB 1LO0H 1CFQA 2WYHA 3FN9A 4Y7OC 3VO0A 4FYSA 2FJHB 25C8L 5J06A 5EC2B 4GG6E 1JCVA 3BPCB 4K7PY 3HB3D 1D7DA 5I8KL 4RIRA 4YHML 5DD5L 4N0UE 2A9DA 4Z7OF 2DQDL 2UXVA 5DMKB 1EWHA 1WA0X 3QR2A 3GXNA 1M6OB 2G75A 4F7PA 1RZPA 2AABH 2WLIB 2ZWZA 4JPWH 5ES4B 3IGUA 5AZ2L 4HV8A 1EFXA 4Y5YB 3HFMH 4U3SA 5GISL 5ADPL 4N2FA 2QLYA 4K8RD 4JM2C 4P48A 4A2GA 4FZEH 3KAAA 1KBWA 3SKUD 3JUYA 4Y19B 3QDJA 2QQLL 2HJKB 4QRUA 4AGNA 4F7CA 5CBEB 3GKZA 5L7XH 4J27A 3PFQA 7PCYA 2BSRB 3H56A 1J9TA 3MUJA 4MNHA 1QR4A 4KI5C 5FFOA 2R56H 2ADYA 5I18H 1HI6A 2EDOA 5DCCA 3OJ2C 1OCWL 2O61B 3RWHA 3QISA 1RZ7H 4XOEA 3R1GL 5C0DA 3TWCH 4YBQD 4BEIA 3BWUF 1T6VN 4FNPA 4YH6A 1UENA 2A99A 4N3UA 1MAML 4NO0D 3AVEA 4PTTB 3BISA 3RGVB 3CHPA 4XH2A 5JORA 1ILSA 3NK4A 2VC2L 1FZJA 1AZBA 2A0LD 1CLCA 2EDRA 1L6ZA 3FRPA 3O4LA 1AFVL 1E6OH 3RX5A 1JV5A 1FAIH 3CBJB 3CDGA 4PS4L 4W9DC 4I18C 4F27A 3MRPB 1I9EA 4ZNCD 2J88H 4HUWA 2FR4A 4EIZC 1DN2A 3VWJA 2W07B 5FYKE 2AI0L 4FXLA 2NNAB 1JHTA 1VAHA 5CNHA 3GIVB 2V8LA 4QF1B 2QMKA 1JGDB 3MODH 5DWUL 1SDDA 2RQ8A 1WEJL 2W9DL 3QQ4A 4K9JA 3X12A 3JTSB 3AQDA 2DTSA 4PLKD 2UY6B 1ND0A 5T1MB 1D5RA 3RG1C 4B5ZA 4NM4H 4ETYA 1WC7A 3TO4B 3EYOB 4KO7A 2EACA 5FW7A 1J5IA 1CVSC 4TSAL 3WHXA 1FIGL 4QRQA 1S9YB 2QPSA 2XTJE 4UQ3B 3S3CB 1CF8H 3CE1A 4HLZG 2G5BB 4AL8C 1T5KA 4CC4A 3QG7H 5D7IA 4KGJA 2N1KA 2WNGA 4ZX4A 1XAKA 3HE7D 3B37A 4P06A 1KGIA 2VWEE 2BNRA 4OLVH 3UCRA 1A8ZA 2WIIB 2R0LH 3LEVH 1CN4A 3KPRB 3ROLA 3UJJL 3SIKA 4I89A 3B2DC 1JXJA 5FV2A 4JFFB 5IVXB 2ZCZA 4Z6AT 4WLCA 5I73C 1U91A 4WUUB 1YEEH 1KACB 3QNXB 5FGCB 3O2VH 2QGCA 3KPMA 4L8DA 3ZKMD 3DO4A 3VX0A 3MRJB 5I9QC 1HZKA 4A38A 3F6JA 3JWDH 3RFZA 1JK9B 1E7UA 4JFTA 1UXSB 4WSGA 3TZVA 1MVYA 1DBBH 1RIUL 2BO0A 4OGAD 4RDQF 1VFBA 3PU7A 4RISL 1XZ0B 4HUUB 5CXPA 4ZNEA 1MVFA 3QNYB 1DJZA 4LASH 3WDJA 1D5XB 5FAAA 3EOBB 3CHRA 4POYA 3ULAB 1T21A 3Q8EA 5MEPB 3DO7B 1OF2A 2V2WA 2NXZC 5FYJL 4Z95L 4OAWA 3T0EB 5FLVA 3EGDA 3HI5H 3QAZB 4PJCB 4UINL 2DLTA 3OXSA 3QYNA 4R7DA 1YMMB 5IUSA 2EDBA 4HX1B 3PYCA 4NKDA 2C3HA 4X6CE 5JHDB 3B3IA 2ITCB 1X9RA 2RAMA 3G6AA 1XWVA 3MJGX 4LSQL 5DJ0A 4MA7H 3TIEA 4OF6A 5A3ID 2GIXA 1IGTB 5KSAD 1VZIA 3GBEA 4BWWA 4APQD 4M5ZH 4UQCA 4PCKA 5DK0B 3MJ7A 3VW3H 2YSSA 5D1QB 2ATPA 4AV0A 4EI5C 2ILLA 2UZXB 1BPVA 4U7MA 1PSKH 1XSOA 4KK5C 2Z4QB 5T3XL 2E7LA 4MNGA 2ENYA 3MX0B 2NSQA 2QQNL 3RGBA 4XRCB 2FZ3B 2NOYA 2C4FT 1OSZB 2PCXA 3NP4A 4ONFH 2IQ9H 3T65B 3EHBC 1V3JA 5HVGB 1KWKA 3TFKD 1V7NH 1YEJH 1N0XH 5LBVA 3KHOA 4PRPE 3K0WA 3IDYB 2BDNH 2FSEA 1K4CB 4KROB 3ZE1E 2XKNA 4G43B 1HEZB 1T1XB 4ZOBA 5DZNA 4FJZA 1VGEH 2FWUA 1OB0A 4W6XB 1UFUA 1KYUA 2C9VA 1QO3B 4FQLH 3V0VB 1VESA 5IB5A 2I5YL 1T0PB 2VAAB 2XN1A 3OKNB 4M7JH 3KPTA 4KXZI 3KLAB 5HDRA 4WI0B 4D8PA 4PG9A 1DQLL 4YO0B 4M5YL 5L2KE 1V8HA 4DOHB 2WN3A 3E6HA 4IKLA 2DL9A 2CK0L 2VRKA 3PQYB 3LKQA 4M8RA 1KIUB 1QUNB 4OZGE 3SPIA 1EHXA 1FJ1A 3FF7A 1AR1B 2CIKB 4DO4A 1EGJH 5HHPA 1DQML 1KXQA 4LCWB 5DD1L 1HH6B 2IV9A 1QBML 5F2FA 1QLEL 4ODTL 1MW2A 3CZLA 3VFNB 5D6DA 4NZJA 1H9DA 5EWIH 2OXHB 3BGMA 3UBHA 3ARXA 3GMNB 3KWWB 3FTXA 4P5RA 2NY5C 3MLUL 4PJGA 1BZQK 4R4NC 3WL9A 7TAAA 2H3KA 2X3BA 5DK2A 2A5UA 1Q0YH 2PKDA 4I0PB 4K23L 3DGCR 4MAZA 1MFNA 1IGJA 4IBVA 1HE7A 5F8QC 3SY0A 4PWJA 2BSSA 4RFEB 3RNKB 4Z9KB 4XGZB 4R0LA 5DMGC 4M8QA 2PP7A 5DK3A 1G84A 1R3LB 3SCMA 2XNAB 3QORC 4X7TA 5BV7L 1IKNC 2XX1A 4NM8H 5IV2B 1Q9KA 5E8OA 2NUPA 3NCMA 4RH4A 4Y2DC 1AYRA 3LNFA 2OMTA 1N6QH 5H4YA 2VXQA 1P4BH 1PIGA 5F9DC 3ULSB 1NFDE 2Q2EB 3MBWB 4ZUSB 1LO3L 3IDJA 3VU2A 1FG9C 4DGYH 2HVKA 4ELMF 5F6IB 2F1AA 2LABA 5C0AB 5LCVA 2TRYA 3Q6GH 4QKXB 1PG7W 2OK0H 3TCLA 1ZAGA 5EIQA 5E2VL 4XNUH 1WBZB 2B5IB 4U6XB 4H40A 1BFSA 1QEXA 3DROA 3F05A 4JG1H 5IVOA 4UT6H 3VQMA 1MFBL 3ISWA 4EN3B 2FD6H 4PVNA 5HD8D 4XNBA 4CSSA 1F3JB 3PHAA 2GFBA 4LF3A 2VLKA 5I6KA 3QIBC 2BVQB 3IDGB 3RWDB 5CEZE 4GQPH 1CDHA 2B1HH 3MLZH 3L3JA 4QLWA 3TFBA 4XN9A 1G6RH 4L4VE 1Y6MR 1T6BX 1B4TA 3O3AA 4R4FL 3APNA 3HZVB 3ELAT 3BW9B 3BLBA 1FAKT 3P30L 4XN7A 2DBJA 7PAZA 4JVWA 1SEQL 4DZ8A 1HAUA 2LU3A 3SYCA 5LJYH 1WUNT 3K8LA 4TULH 2P5ED 3IJHA 1TLMA 4JG5A 4PRAA 2VXSH 5DC4B 4AITA 5KYXB 2IH3B 3RIKA 3TTYA 3EO1A 4A7QA 1CZ8H 3PABA 3SE3C 4YSOA 1NLBH 3EOAB 5JO5B 3L3DB 5B3NA 1CTOA 4LHQB 4AVJA 2NW3A 5DFVD 4F7TA 3HIZA 3FTWA 3IDUA 1BYOA 3PWLB 2O6CA 3SKOA 2K9FB 4NUQA 3L3IB 1IAIM 4LPWA 1HL9A 4BFIA 1UCTA 4MMZC 4G1MA 2V0AA 4JRXD 2CNZA 3C09B 3BUQA 4OFKA 4X7SL 5T1DH 2DQCL 3B2VL 3D0AA 1UQSB 3MLRL 3M17A 1WAPA 5ITFB 2FJGB 1FF5A 5A2FA 3SKJL 1N9PA 1MXGA 5TE6H 1NGZB 1KULA 3O3DB 4WU7A 4CDGC 3F7VA 2EJ1A 4AG4L 1KNOA 2X9XA 1K5NA 1SBSL 3O3EB 1JPSL 1OAQH 3KVDD 3R19A 1II4E 4BUHA 1A4JB 1ACCA 2D3JA 5E9NA 4ZBJA 2VRAA 2NYKA 3VXNA 1K8IB 1M6UA 2YRLA 3O0RL 4XOCA 1FPTH 2Y4SA 3O2WH 3VTMA 3CFBB 3MFGB 6FABL 2VDNH 5FGRA 5D7LE 5TQ0H 3JV0A 4FL4C 4YFLF 1B9KA 5C0RH 4NJAH 4AZ8B 2X7LB 3VFOA 1GY1A 4H7VA 4JM0A 5C09B 1ZK5A 3UTQB 4J8RA 3U2SB 3L17A 2ZXWB 1U3JA 5H37H 2J55A 4AK1A 1UTDA 1WS7A 2ZOLB 1MCKA 5KWYC 3BSZA 1LO0L 1EHLH 2VOTA 2W80C 3A4FA 4WSJA 3B9KA 1N19A 5C9JB 4HXBH 5DXWA 4HIQA 5LXVA 4BFEA 4QHPA 1F11A 4WWPA 1R24A 1TJXA 2APFA 1MCSA 2Y9RT 4RGND 2EXYD 5I75C 2Z91B 4P0DA 2WPGA 1OTTD 1A02N 1FNGB 4XO9A 2AABL 2AJ3B 1QTPA 2FJFB 2I24N 4F57H 1JK8B 1TEGA 4HC1A 4N2HA 4YNYB 5IHZB 4I85A 3HPLB 3C2AL 1DBJH 3GBLA 4XMLH 4NZDA 4Q2ZA 2VLRE 4O58L 1RK0A 4W6YB 5D2LA 1NPUA 3HFML 4NO5A 4NOFA 2V2TB 5IQ9A 2DWTA 1FI8C 2C34A 4XXWC 3T6WA 4FZEL 4M6AA 4OJFL 3WNPA 5F3HB 1YEWA 3QCVH 4ZPTA 4GSRA 2W9LA 1Z9PA 3DYPA 4WI9A 3GJFK 1J05B 4X8JA 2V5RA 1J48A 4EI0A 1KN2L 3NAAH 2XXCB 2FUQA 1QEWA 2R56L 3BXNA 5I18L 4I7ZC 3T04D 2IAMC 2YZ1A 4OZIE 4O2EB 4P3DA 5DO8A 1A7OH 4ENED 5INCB 3T6ZA 3TWCL 3IFLH 1T5WA 4K15A 1FG2B 1GAFL 3GINA 1CD1B 2LAGB 4KNSA 1VKXB 3L13A 1TF4A 1MNUH 4GKZB 5BRZE 5CBAB 1J5DA 4ZOEA 2IWGA 3KGUA 4DHLA 1NFIB 5GZOA 1DR9A 1SNRA 4F5CA 4G6KH 4GMTL 3UX9B 4IOFC 5JR1H 5DZJA 3CVBA 1XF2A 4HK0A 4G7YL 5AB1A 2GPZA 2QR0B 3GI9H 2CDEA 1B6UA 2WUBH 2ZOOA 3U46B 2NTFA 1WA1X 2J88L 2G2PA 3LX9A 3QI9B 4JLRB 4K5OA 3L6FA 4NQED 4JRYA 2YD8A 4Q89A 3W37A 4R8WH 5D7JC 2HLAA 3QJFB 4L1BA 4P46C 4Z7VF 3OJVC 3P3SA 1MCEA 2VXTH 1FIEA 1TLKA 4HPYH 2FEDC 2K8MA 3QUZC 4HWEH 5LGYA 1L5GA 3TF7C 5D4JA 3SDAA 1N0LA 1XTMA 4WNQA 4C4BA 2ZAHA 4NQDB 4NM4L 1X6LA 4CNIB 2LR4A 1LE5B 1MCJA 4NN5C 2VXUL 4BE5A 1AO7A 4GNKB 1AMXA 4MJIE 3PPEA 2IF7A 5ICXA 2GITB 1QLRA 1MIML 1WT5C 1JPGB 1P4IH 3APDA 3BAIA 3QG7L 3LVEA 1BYPA 4KI5D 2J44A 2XLLA 4KQ4L 1L0XA 2G3NA 5DHEA 4HIPA 5CZKA 5EB9A 5AYTA 3WY3A 1SZNA 2I07A 2R27A 4HJ0C 1CGYA 2PTTA 2BINA 3FOLB 3IU4L 1O0VA 5A6LA 2EH8L 4F7EB 5EBLA 4QJ5B 4MAYD 4OQ1A 2R0LL 5FW8A 3LEVL 3WEXA 1BD2B 2XPZA 1XMEB 4JFPB 2Z93A 4R7NA 5I1AB 1DVFB 4NO2B 2RMNA 5E9DB 4LP5A 4AXWB 2XWEA 3DVGA 1YEEL 1EDHA 2CMRL 4L4TB 4R96B 3O2VL 3P1VA 1OAXH 1QG3A 1Q94B 3GMLA 3JWDL 1ACYH 1PG7H 3H8NA 3AGVA 4YZFF 1DBBL 5EULV 2NCMA 2HFFA 1XL6A 2GJ6A 3F5WB 1NOLA 1P5UC 5DC9B 4HDIB 4QOKD 2YJLA 3QVAA 1SMAA 3NJGA 2XVKA 1WZMA 3TNNB 5A2BA 1NSNH 3PS6A 4HKBB 4TVPD 4G1EA 1CFQB 3CDZA 1I3RA 1B2WL 2J1XA 2LE9A 4K3GA 3D85A 4K4KA 5CILL 5AW8B 4QXVA 1JZ3A 1EERB 2BVEA 3WUWB 5IFJA 2WQRA 3SDDB 4E41A 1K5WA 1O9WA 4RIRB 1T0NB 4UU9B 3X14B 1UKSA 5SWSB 4DN3H 4U7KA 5L4JA 1JCKA 4MA7L 4LB8A 1DP0A 4S0HA 4MCYA 3DMMD 3SN6N 4NIKB 1ZA6A 2WXQA 4M5ZL 5IHUH 1KB5H 3MRDA 5ALBL 4JE4B 2JIXD 5I6MA 1G7MA 3DOSB 1PSKL 2H2PD 1NWPA 3MKKA 2DIEA 5GHWH 3LKNA 5CZRA 2J56A 4ONFL 2JCCB 1I1YA 3MV01 5DHYA 1DBAH 1V7NL 1YEJL 3A24A 3QDJB 4KHTH 4F7CB 4IIQB 3T0BA 2JJSA 3RU8H 4JY6B 3FQUB 4IDJL 1VGEL 2HUEA 2E9BA 4N5UA 4BH8A 4F33A 3BDXA 4ISVA 1KYFA 4FQLL 2XXFA 1LLAA 3CC5A 4Q56A 5FUCC 1CTNA 1IAII 1I1FA 4I1RA 1TVHA 3KM1A 4O2CB 5GGTA 4M7JL 3N06B 2OXGB 1I8IB 3RWIB 3KEDA 1A9EA 1S7WB 5J6HB 5MEQA 2OKMA 3QNZA 3CDYA 3SDYL 1BQUA 5HYSB 4AYGA 1DJGA 3G5YB 2ZWNA 4WW1A 1EGJL 3CLEL 1U2CA 3FQ2A 2X6AA 3MGTB 5I74C 3GSNA 3OMNB 3VRJA 2L7EA 4HUWB 5AAWC 1AACA 3NZ8B 4XOBA 2V9QA 2NZ9C 2KKQA 1YPZB 2XBTA 2G9HA 2HT2D 2XX0A 4NNPH 3S4SA 5J3HD 2D7MA 3KGRA 4KK5D 4RBPH 3CJJA 2IGFH 1OGAA 4LLYB 1CT8A 1TTUA 4PJBA 3KCWA 1KGYE 1FL6B 3BVUA 1BZOA 2OTUA 5JYMA 1P5VB 2QEJA 3F2LA 4K3EL 1G6RA 2WKGA 1BVLB 3WENA 2ZOUA 3VG0H 2V3EA 3QPQC 3DIVA 1WF5A 2WXFA 4PJIF 2XY2A 2QELA 4LCYB 4L1LA 3FTGB 2BVTA 1QVOA 3S37H 2ZYHA 3Q44A 4FA7B 3T4YA 4N90D 5C08D 2Q86A 4F8NA 1RXLA 1RVFH 1Y6NR 1H5BB 3V6ZA 1MLCB 3EGSB 4HZ1A 1HN1A 1CICA 3IWUA 4NM8L 4Y4HC 5HGHB 5I6PA 3KWVA 3ZZLA 3EG9A 1LO2H 4F58H 4ZTPH 5FF6B 1RURH 1N6QL 3MACH 3LIZH 1P4BL 5GXBB 2NY1C 32C2A 4KUZH 3QDMD 4N6RB 5GSVA 3ASOB 3B5HA 2XICA 2GSIA 4DGYL 4F24A 4KXBA 2R7EA 4LSSH 5J4MA 4MGXA 4L8DB 3MNWB 4HUKB 2D7TH 3ARBC 4Y0GA 3K7UA 3Q6GL 4OW6A 5E24E 3OQRA 4BZ2H 4LESA 4YPGA 1CB4A 2D9QB 4RQQB 3VXSD 5LBSA 4OCRH 1F86A 3IU3B 3WE6A 5A2KH 4X8XA 4F9PC 3DHPA 4JG1L 4LMQE 3VXTA 1CLZH 2VDKH 4G59C 4UT6L 1R9FA 1X5HA 1XGPB 4G9FB 3ECBA 1GR7A 4G7VH 1S7RB 5E2JA 4CKQA 2O93L 3RX8A 3EFFA 3IXAB 4Y4FB 4Y88A 2XUWA 2J8OA 2VZTA 4BKTC 3SOTA 1OF2B 4MNQA 2C7UA 1AGDB 1DE4A 1MFUA 1UM6H 4CKVX 5C0BD 2ZXCA 3MRHA 1EUUA 3OXSB 4NBXB 3F7RA 3MLZL 2B1HL 4UDUB 2Y7QB 1MXDA 3OKEA 4BK5C 3HG1B 4ZAKC 5IB1B 3K2MC 3UBFA 4XOAA 3DTDA 1MNNA 2G3XA 4XNMA 3WFHB 3KH4A 2B39A 2P28B 4N8PA 5HJBA 2VITA 3SBWA 5BVPH 2H32B 5EO9A 1XGQA 1SLWA 1X5KA 3BFOA 3CN3A 4X80H 1LWJA 5CP7A 4XXDA 1WCQA 5ECGA 3FTYA 4WU5B 2VXSL 1YAIA 2C4XA 3K0YA 3TO2A 2YSSB 3FAXA 5CU5A 2O6FA 3RY5A 3GSRA 1BOGB 3HKFA 2OMBA 1G7HB 1NLBL 1RUKH 4ZQKA 1UM5H 3VE0A 4B96A 5I0VA 1S4IA 2IH1A 2OMNA 2YPLA 1L3NA 4N0CD 3PHQB 4JQIH 2FNBA 1KXHA 5I0DA 3HE6C 1NUFA 1N59A 4XBEH 1CG9A 2VDMB 1CVRA 1I75A 2E7HA 3ABZA 1PAZA 1JVKA 1BFVL 1FFPB 1T66D 4C4KT 1A14H 3BH9B 3KLDA 4RZCB 1NCTA 2DM2A 5KBPA 1SM3H 3TA3A 1JSYA 2NYZA 5CGYD 4PFEA 3SBQA 4J6RH 4PGCA 1NANI 2A1WL 3QJVB 4ONHA 3BYYA 4QHMA 3QUKA 1HHGB 1HXYA 1RJLB 5BZXA 3SD5A 2SODB 1OAQL 1FFOB 3L4TA 2ARJB 2QMJA 3VUAA 2NY0D 4DKAA 1FYTD 1I7RB 4KJQC 1YG9A 4PWGA 1TMCB 2A74B 4LAQL 4M8VA 4MCZA 4TSCH 4BCYA 3S98A 2IAAC 1EXHA 5F44A 3A4EA 4ZFFA 5TQ0L 3T0XA 2R2CA 5FK9B 4W9LC 1L0QA 3MYJA 1LQSR 4NJAL 1IMHC 5CD5D 3L7EA 1J9CT 1DQJA 3GMPB 4Z1PA 3GMQB 5ESAB 5EU4B 1KXVA 1EH9A 3E3QE 5D96B 3KPSB 3UTZA 5C0IA 5EZJA 4PJGB 3WL9B 1HWGB 2G4GA 4TUKH 2GJRA 3QFJD 3VNYA 4PN6A 4A63A 4BFRA 2FDBP 3MV7E 3PJLA 3QUMH 2XU9A 1QW8A 3ATDA 5IG7A 4OSUH 4HXBL 2DOCA 15C8L 1M1SA 4LGPB 4MB4A 4KK9C 1W0WB 5HHNB 3S35L 1KWGA 4TNVK 2WYZA 3CFJB 1SLVA 3ASWA 3WHE0 4M7KH 1H0DB 2YD4A 3MRGB 3TJEH 1YVLA 4F57L 1P69B 5IMMA 3MUY1 1NC2A 1PGRB 3N9GH 3I50L 4KVCH 1LD9B 5IJKC 2DBLL 3MRKA 1X5GA 4NHCH 3OG6B 3CN4A 1NINA 3ZOAA 4YAQB 3DJRA 5IY5B 2OLDA 2VLMD 5BVJA 2WLHA 2K3TA 2BWDA 3MXVH 3ZDXB 1KPVB 1NLDL 4KMQA 4OLUH 4QCIB 4J12A 3U4AA 3PE9A 5GGUB 4K55A 3TBCA 3QZPA 1NCAH 4N0RA 2YQGA 4UIMB 2DN7A 3IETA 4LGSB 2X4TA 2APXA 4D3CH 3L2LA 2M2DA 3IF1B 5EBWA 3MNMA 4AQ1A 1J1PL 3ALXA 3IFLL 4NKOB 3NCBB 4LPXA 3GUTA 4NPYA 3D39E 1GTNA 5GGVH 3FSOA 4S1SH 2PPCA 1DVZA 3BZ5A 2LU4A 3BGAA 2P1YA 3G6JE 3L4XA 3MKGA 2WQAA 1XGRA 3WKNA 4GBXB 2MHAB 5JR1L 1IO4C 5HJ3A 4DERA 5D7IF 4XO5A 4Z7NE 2VN7A 4ELKA 2HYMA 4UQ2A 4TKWA 5C8JB 2WLLA 4QRRE 2IPKA 5ERWB 2ZOWA 3L3JB 2AV7A 3DXAD 4NO0A 4R8WL 3MCYA 1J12A 3IJEB 3ULVC 4M1GH 4ZSOA 2OMZA 4L3EB 2VXTL 2DLHA 4HPYL 5E94A 5HYQA 3MV8D 3NN8A 4HWEL 4LVEA 3HTLX 3MUHL 5AVVB 1GTFA 5JIIA 4DZ8B 2JQZA 5C7ZA 3CZGA 4HA1A 1NCCH 1C1EH 1IEAA 1MJJA 1DUZB 1MUJA 2PYEB 3ARFC 3AS0A 3IJHB 4A7UA 2HKHL 4AW4A 2W9EH 4R3SA 5DWPA 2Q10A 1AC6A 1PLGL 1WD8A 3NT0A 4LCCA 4E36A 4RA0C 2NR6D 2FJUB 3DPBA 3WU1A 1RL1A 2X05A 3TBYB 1P4IL 2WMPB 1ZGLB 2BFGA 4QHNA 2IAMD 3GRBA 4YDVA 5T1JA 3HJEA 1U8JB 4NCDA 1ZD6A 1WZLA 1XQ4A 5I8EA 5IW6B 3UAJD 3GJFA 1KDIA 1KCSH 5CAYB 2L4OA 5DTFA 1MG3C 5E56A 2PXYC 5B8CB 1TJHH 1LK2A 1OPGH 2PO6D 4AUJA 4XTRC 3LHPH 4NWUL 1RIVL 2NX5A 3Q3GB 1J8RA 4LOFA 3HE7A 2Y5TA 1AGEB 4Y5VB 4DT2A 4HUCA 4WU7B 3O6KH 4YK4C 2NY4C 3JZYA 1P7KB 4FG4A 3CG8A 1ZVSA 1OAXL 2NSMA 3RBSA 4G82A 4P2AA 4JFDE 4YHPA 4EI6B 1ACYL 1PG7L 1MLBB 4DGVH 4L2LA 5CR1A 3WI9A 3DBXA 1ONQB 1TQCC 1HHKA 4LSRH 2ZSWA 2F0CA 1B3IA 4JDVA 4PBXA 3MRLB 3RLSA 3UC2A 3VM7A 3FO0H 5C70A 1WBXB 1IZJA 1F41A 5FKPA 1XEUA 3SDXB 3CGTA 5JIPA 3SKNB 3MRIB 4M48L 3B34A 2VISA 5GRUH 1N8ZA 1A1MB 1IFRA 3GSVB 4MB3A 5C0CE 4DGIL 1M7DB 1P2CA 3PUCA 4JE0A 4OFYD 3CMGA 3QEQB 1BWWA 4WHCA 2R29H 4L3AA 4X42A 2VKWA 3S6CA 1RUML 5ABZA 5FYKD 5KSUA 4PJ8A 3TLRA 3LKPB 1BMZA 4H8WL 2X10A 3APMA 7CGTA 3VD5A 4JM4H 4A7GA 4EF3A 2DQUH 4X5PA 4J3TA 4A6YB 3EBAA 4IHOB 5IHUL 4LP4A 1KB5L 3TCXA 4AKQA 1I85C 2VXVH 1TZGH 5FC9A 4FG6C 2BIOA 3QO0B 4Q2ZB 5I1KH 1IGMH 3G08A 3QAQA 4P2QA 5GHWL 2XFXA 3NZSA 2ZXAA 4KJPC 2NY6B 3FQNB 5KSAA 3H9SE 4APQA 4KHTL 4B53A 4RAVA 1H3PH 3RZCC 3WIHA 1UUNA 2DQJH 4JJ5B 3VI3E 1IGIH 4NWTH 1UD3A 4LVHB 3DURA 1NGPH 3MRNB 5HPOA 1YYLH 3WS6A 4PJGF 3ZE2F 4YSTA 4HG4K 2WQXA 5IJVB 1Y6KR 1T5WB 4FNTA 3U83A 4PIRF 1U8MB 3QC5X 4JN2B 5E1AA 5B7MA 2UVFA 5M95B 4A2MA 3U6XA 1JXDA 2ZCHH 3NQIA 4G11A 2WSDA 5ADOH 3MJ6A 1RJYA 3PWPB 5JW3H 4BZ2A 1TTCA 1P7QB 3AM8A 5E00A 5HGBA 3SDCD 3QIWB 1XGYH 1XF2B 1T2JA 4N2KA 4POZD 4Z7WB 4ICWA 1FP5A 1S7XB 2OPCA 3HC0B 1XH1A 1GY2A 3FU3A 3V5KA 2WLNA 3GXMA 3OMZA 4WSKA 4DJMA 1TQBB 1YAZA 2CGYA 5EF2A 3QWOB 4NNPL 1U8PA 3UG4A 3V2AR 4GXVL 5SWZE 2ZAGA 1EJ6A 3SQBB 4NLHA 4FQXB 1LXMA 1L5GB 1N0LB 1YMHB 4ETQA 4ZUVA 4AQEA 4BHUA 3DUHA 5J12B 1SVCP 1JGLH 3FT4A 2PYFB 2NY3C 2YK1L 3DC0A 3HUJB 4AYFA 4KK8C 3ZXAC 2AXFB 4S0SD 4ZFOB 5EEWA 1UD4A 1OANA 4FQQA 5K1NA 4J1UA 5B3JE 1AH1A 5TDOB 3K6SB 1UYWH 2PW2B 5KS9B 1RVFL 4OVVA 5LLIC 3C6SB 3NFSL 4FOMA 3B7SA 4HIEA 2IC2A 3I75A 5DRXB 1LO2L 1NIFA 3RVVC 1RURL 3U7AA 1IBDA 1OCRB 3MACL 3IS0X 3LIZL 3KPPA 2Z93B 1ZWIB 4JQIA 4N87A 4KUZL 2ZZUT 1WWAX 4I2XE 4A2FA 1W72H 1BLNB 1BX2B 2VL5A 3I6GA 2Y7NA 3FNKA 4PRPD 3RQ3A 5FEBA 4TS6A 1F13A 3VU1A 1G7JB 4ZODA 4LSSL 1KZYA 2ZKXA 3QZNA 4LNRA 4BSWA 1NGWA 1I82A 4HWZA 4YHKL 3UG5A 2O6DA 2JCWA 2XWRA 4DP0X 4LOUC 3WO4C 1M7UA 4AGMA 1LEIB 4OCRL 3ARGB 4NO3A 1BQRA 1KBGH 1CLZL 2VDKL 2GJ6B 4RESB 3L95B 4GAAA 4JG0H 2X2HA 1XFPA 2F8VA 2IWFA 3C9NB 3HI1A 5EU7E 4GH7B 3RWEA 1RZJH 3UOAB 5G5DA 5L2KD 4EXPX 4FE9A 2CCLA 2DQIL 4BQ6A 4HOMA 4PS8A 1G1KA 1RZIB 2QKIA 2VQ4A 5KG9A 4M7ZB 1S8DA 4R9HA 2E6JA 4OU3A 4H1LG 4G1EB 1VACB 4JN1H 1P9MC 3O3UN 3RYMA 3QUXD 4FHKA 5TQ2L 3PXHA 5DD3L 2DD8H 2X09A 3HN3A 1SHWA 2KQMA 2YUXA 4IOSD 3HG0A 4J23A 4Y4HD 3LRKA 4Z18A 3N1PC 3ES6B 4B3EA 3QUMA 4P2CG 4TTDC 2P48B 5SX4I 1U58B 4JY5L 1XIWD 1LE9A 2BVOA 2DY2A 2NY1D 2X1XR 3AMLA 1MY5A 3ZSTA 1UJ3B 3BAJA 4N0YH 1DEEB 4MVBD 4N8CL 3R7QA 3MOAH 1L9PA 2CALA 5TD4A 1S7TA 4IJ3B 4LFHG 3C75A 5KVEH 3HZYA 3UBXA 2QKSA 3ARBD 3SJVB 1UM5L 1JPTH 1XO8A 3N41B 3BVVA 1KJ3H 3VNZA 4IU3A 3ABLB 5AW2B 1G7IB 4NI6A 1YNLH 4E9TA 5D71L 4KKZA 1OCCB 3GS0A 3T5WA 1XCQB 3DSNA 3JXAA 4LOEA 2F68X 1PZ5B 4P5KA 4K0OA 4OZHE 3LN5A 4PRDB 5LN4A 4CSPA 2X42A 3MJ9H 4OI7A 4PRHB 3MROB 1TZIB 3M46A 1TVHB 4J6RL 1OGTA 1AANA 3JV4B 1SOXA 4WEBL 3KD4A 1X7SA 2DIJA 2KC0A 3F04A 1T22B 1AZCA 4K73A 1VCAA 1FV1B 3CVHH 1WZ1H 2DZEA 4JRXA 1W16A 3K5RA 3KYMB 4DTGH 3VXRA 3RWCB 1FZOA 1KLUB 5AEAA 1SJHA 5HHOA 2JKSA 5DJXB 1SHXA 4OZFB 4WO4C 1PZSA 3U36A 2XHNA 2J7LA 4HWBA 5I1LA 1ZT7A 4RAUB 3MLXH 5I1CH 1QTSA 4PJ5E 5E8EB 2OI9B 1YZZA 3PDGA 5KN5A 5I5JA 5D2LF 2G9HB 3ARUA 1SLUA 2AERT 2EUXA 1FRGH 5AFAA 4QT5A 1WBYA 3IAPA 1CT8B 2ADGB 4DK3A 1RJCA 1GPOH 3FN0H 2OTUB 1OHQA 3LAFA 4C8XA 5IMKB 4TUKL 1NCNA 3EYVA 4WRLA 4BD4A 4WTZA 3MBXH 4DEPB 3QO1B 2K4WA 3QUML 2FEEI 5DEJA 5DFAA 3UFIA 2CE6A 4G8FB 2B77A 4X8CA 3ARDC 3F85A 2X2JA 2EUZA 1OOAA 3ZZ1A 5IVZA 2IADA 4L4VD 3D18A 3PWNA 4WAFA 4XPHH 2F54E 5AW5B 1KIQA 1YYMH 4Y2OB 2GQHA 4X6DA 1EEQA 2ZAIA 2ICWI 4G3YH 2XSKA 4G7QB 3V5HB 5EZIH 1UUSA 4M7KL 1HZHH 1G9NH 1JWSA 3I6KA 5E7FA 4S0TD 2EIEA 1GSMA 3A5VA 3U0TB 2K45A 2YWYA 3N9GL 2DYPD 4G2AA 3DK0A 2HG5B 4KVCL 4YEFA 1VHPA 5IBUG 4BM7A 1YSOA 3Q8CA 3N43F 5JIDA 4M1CC 1U92A 3SGDI 2GUOA 3NJNA 2FB4H 1P84J 3MXVL 2YSTA 3N1FC 4JPSA 4NENB 32C2B 3ZDYE 1QKZH 3BP7B 4LU5L 4HQQL 4OLUL 3G5WA 4WDIB 4YE0A 5IHWA 5LGKA 3V4VB 4A6YH 5F89A 1FVDB 2CSPA 4GRLD 5F9AC 2D2OA 1YEDB 2PCYA 3T0EC 5KVDH 3N55A 5MI0B 5KZCD 1HQ4B 3HPJA 1ZDQA 1VB9A 2FYVA 4NP9A 1J1OH 3QIUB 3VXTB 1LK3H 4PJXA 3EO9L 4XP1H 5GGVL 5I1HL 1U8LB 4JDZB 4S1SL 1ZT4A 2BM3A 2X44D 1TQVA 5HY9A 4D0CB 3ESVF 5DS2A 5EZOH 3ZMEA 1D5IL 1U8NB 3K2KA 4MQXC 3B9AA 4ZUUB 4P5TD 1MRFH 2AK4B 4QPEA 4UWQB 4ZFGL 2IMMA 5CLTA 4PJ7E 3STBA 3Q13A 1KY7A 5D1QC 1UEYA 2Y69B 2FLRT 3UPAA 3BMVA 4KJWC 4Q58C 3FF8A 5C7XH 3RGHA 2FT8A 5D7LD 3DVNA 3BRGC 5IEKB 1ZSDB 4W9EC 1E50A 1NBYA 2P52A 5A16A 3BPNC 4H8VA 4WW2A 4Z7UB 1RLBA 2EYRB 2FRGP 2VITB 1ZANH 4V1DE 2EXWC 3IDYC 5HGGS 3DX3A 3S5ZA 4BELD 4M62H 5CP7B 3VFPA 1L9QA 2RD0A 1CD0A 2E59A 5C2BH 4BK4A 1J0IA 2X4QA 3JT0A 5FDYA 4OV5B 1OCZB 2W9EL 3LSOA 5FYJE 3ZDZF 5ICYB 2UUDK 1VFUA 2WANA 4JQXA 1OTSC 2EDXA 4N8VG 2WCGA 5DZPA 4CAGA 1CGUA 1RP9A 2CDGA 4OGYH 1D7CA 4KTYA 4U0RB 4X4MA 2BK8A 2CRMA 3EF7A 4NS0A 5EPMB 5AB0A 3CVIH 1N59B 2KDGA 1CG9B 4X83A 5A1AA 1AR1C 1RI8A 2VLRD 4HZAA 1A6AA 1JF1B 1TJHL 4DESA 1QFWL 1OPGL 2DICA 4GI6A 1J5CA 3LHPL 3C8HA 4G8IB 5DJ6A 4GI8A 4QEGA 3TA3B 5T3XE 1TTAA 1AY1L 2ERJB 5DO2D 4PWKA 4ONHB 3A6CH 2GTZA 1BZ7A 5DR5H 5LNGA 5CUSH 5EEZA 2VRQA 2ED9A 3RL2B 3FU7A 2DL2A 4MAYA 4CDHA 4Z8FH 2EUVA 4UBDC 4DGVL 1VRSA 4OLZL 4IBYA 1K3IA 4PPTA 4HOZA 5K9QG 5DUBA 1BQHA 2KHAA 4AYBA 3FO0L 3F01A 4XPBH 2E74C 2WCSA 1QSEA 4ZO6A 2VMJA 4HJSA 4TLSA 3UMTA 4MD0B 5BRZD 2PWGA 2YUWA 1YC7A 4QXTB 3N91A 3J8F7 5ID0A 3BQUB 4PGZA 4Y1AA 2BP8A 1OP5K 4ZNEE 5DVOA 4B9KC 1U4FA 4NQSA 2X1PA 1U3HC 3TEZA 3AWEA 3DTXA 2R29L 3EH1A 3HJ0A 3DK2A 1TKWA 2PWHA 2GVYA 1JZHA 3O3BA 4QOKA 3WFBH 3Q0HA 4A2DA 5KVGL 4XVTH 3KDMB 4XVUC 4ZMWA 4LVOB 1S3KH 2ROYA 5EFIB 2N0MA 4KKBC 2WOYA 1HDMB 4JM4L 2DQUL 5EOQL 3VI4E 3VRIA 4G83A 2F5AH 5F6IC 2VXVL 3HB3B 1TZGL 4G80A 4DVRL 4XO4A 3MLYH 1JHKH 5EZLA 2XIDA 1KYOK 1IGML 2O5XH 5I1KL 4GW5A 1OE2A 1WFNA 2ZUUA 5K93A 4Y16C 5F9OL 4AIZB 5AVQB 2B5IC 4RFNC 2XA8H 1D5BA 3ESMA 4MJID 5AB2A 2W0FA 4QAMB 4R5TA 3DMMA 3MR9A 4L9LA 3II1A 4KNQA 1CK0L 2JIXA 2VB5A 1IGIL 4WENB 4NWTL 2Z6FA 4QY8A 5FUOL 2OV0A 2DWDB 2XZCH 4GG8A 1JGVL 1NGPL 3FPYA 4PJBF 1YYLL 3IETB 2X4TB 3C2SA 1IC4L 4P23C 4FFZH 2AKRA 4GUOA 3BD3A 4EAEA 1FVCA 3IK2A 4KVNH 1ZVHA 3HBGA 5IT2H 3N85L 4UI2A 2DH3A 5EHFA 5JW3L 4HK3J 3CPUA 1V3LA 1IAOA 5E4EB 2VDML 4O51A 2E27H 4OZ4A 4XMXA 4YHYC 1QX1A 1FCCA 5F7EL 3MREB 2OSXA 2WLLB 1H3XA 5DJYB 2R59A 5AW1B 3H55A 4AENB 1T5XA 3NABH 5ECJE 2OMZB 3Q2WA 4BIKA 4OCXL 3PNWB 1MIEH 3QT2A 2EEDA 1MREL 3NN8B 5B21A 3PUUA 5CCJA 4OCMC 5AW9B 5FDWA 4P2RE 4KJPD 3GB7B 5F7NC 5J7CC 4OZFH 4Z0XB 1GC1H 1INQB 3QWRD 3F83A 1TPXB 1MJJB 2ADFL 3A67L 3P9MA 1JGLL 4QRTB 5AYUH 4Z76A 2GTWB 1ZHBA 2XXMB 5DQ9A 3STLA 3IDXH 4W9CC 2OZ4H 4LCCB 2J8UA 3JVGC 2JJWA 4Y5XC 3R0MA 3TYGH 4Q0XH 4XPAL 1TG8A 5CU9A 3HAEB 2X89D 4NNYB 1MDTA 2BH0A 2IPTL 1KBKA 1NAMA 1EMTH 4M00A 4QHNB 1UYWL 1OWWA 1JZJA 4TSBL 4UIKH 4Y1SA 5C86A 4YDVB 1A6ZB 1S5IH 5I8OH 4TLUA 2ZONA 1MCNA 2DWEA 5JUEL 3R8QA 3MC0A 3V0AC 4OCSH 3D3VB 5DTFB 1A21A 1MFCH 2RBLA 2VW7A 4HXAH 5AAMA 4D8OA 1UWGH 2OMUB 3VB9A 1DN0A 2C9PA 2CBPA 4IKIA 1PCSA 1F3DJ 4PCSA 2WQUA 1HXKA 3CZFA 4JHBA 1D5MB 1Z1WA 1W72L 1AQDB 1O7DC 4NKIH 1M1XA 3WN5A 5HPMB 2JKLA 2WXOA 4DEWA 1AD0B 1EDQA 1ZVSB 2GEQA 1MWAB 3N44F 4F9LC 1UASA 3I74A 3MJ9A 2A6IB 1G9MH 2EDKA 1SDAB 1J0YA 3AY4A 2QDVA 5EBGA 1FNSH 5HHQB 2A4EA 3VH8G 3AWGA 3QDMA 4AC2A 5KSVA 1T89C 2CKBH 3QUGA 4JDVB 3D25B 4X6BB 3CVHA 8FABB 2W94A 4J4PD 4JG0L 5GIRA 2K7PA 2Y36H 4JFEE 5TF1L 1OP5H 3MV9E 3ZZSA 4NPJA 1ZTMA 2AEQH 3REWB 4DP1X 5GS1B 3SB3A 1D6VH 1X3DA 1BAFH 2RR3A 3WEOA 1N3NA 4MJ6A 1P2CB 4JN1L 3MNVA 3UIYA 1E5AA 4NFBA 4Q14A 4XP9H 1UWEL 1NDGA 3SKMA 1PY4A 1MN4A 3DI3B 3GMOB 4JFXA 1PDKB 3S34L 4I77H 3OBAA 3NK3A 2P26A 1KPRA 5CHNB 4E5XB 5C0BA 1SMDA 5TTRA 3FQXA 4WFHE 4DVBA 5C0FA 5IREA 2BC4B 5J6GA 1JWMB 2XZQL 3I9PA 4PJDE 3HS0B 2GSMB 1HNGA 4N0YL 2AJUL 3MOAL 1KCKA 4IK7A 5HI5D 3BAYA 1T6WA 3BZEB 3HR6A 4YSRA 4JQVC 5KVEL 5MENB 4PTUA 4BXVA 4U31A 5KTEH 3VXMB 4LKCA 1SGKA 1T20A 5KSAB 1KJ3L 3GTNA 1MQ8A 1HIMH 4LFHD 3UPRB 4DGWC 2GYSA 5AB9A 1AHWA 3HLAB 5DEGB 5G55A 1ZHKB 5I23A 4LSPH 5DJ2B 1F0LA 2P80D 2Q1EA 2MNJB 1RFDH 4U6YA 1FGVL 4AEIH 3GXUB 3ESOA 1TXKA 2WXHA 1CGXA 3VFSA 2H8PA 2AK1H 2FBRA 4TOYH 4H8HA 1MH5B 3FB7A 4ZUWA 2D31B 2MQGA 1WZ1L 4RWYH 2UV3A 4DTGL 2HT4D 3EZ8A 2X1QA 5HGBB 1J1XL 4XNXH 3G3LA 3Q1EA 2WAQA 3JV6B 2EQDA 1HWHB 1NFAA 1CGSH 5DJDA 1JPFA 4TTDD 3LXCA 3MLXL 2VJ0A 2YGPA 4MMYB 4U6TA 4L0ZA 4JHWH 4QXGL 2BP0B 5L4FA 2CGRH 4J3BA 2ZSVB 5FYJU 3FZUC 1IBYA 3FTSA 1UURA 2Q76B 2WV3A 1AZZC 1EAPB 2BXYA 2E86A 5E7BA 5ICUA 4YJZL 2MTPA 2NW2A 3PL6C 4QRFA 1XCWA 1GPOL 2YA1A 2ED8A 1FYTA 3FN0L 3MBEB 3ESUF 4NLAA 2Z8SA 5GGSA 1Q9LA 5C92A 1M7XA 4ETQB 2JI2A 3MBXL 4GRMA 1OSPH 1IFHH 1BF5A 3VWKD 1QRNA 1KJ2B 3AAZB 3C5JB 4GY4A 4JCLA 4XPHL 5ABAA 3WS3B 3UGEA 4AYFB 4OCYL 1YYML 4ORZC 4AWJC 1NUDA 3O4OC 1NCWH 4G3YL 3OB0H 1IC7L 3CIQA 3F84A 3A47A 5DI8B 1OM3H 2Z65C 5H35A 3TN0A 3CLFH 1G9NL 1M53A 3ZW3A 3KDPB 3WTSA 4JKMA 5D72L 3UP1A 4X0KA 4NSKB 1ORQA 4HPOL 5C6WH 2HT3C 1J9RA 3BAEH 3I75B 4YHOL 2AF2A 2M83A 3ORJA 5IWLC 1EEZB 3CZEA 4AMKH 4ZMZA 2YAQA 2VDLH 4YSPA 2BY2A 2A6JA 4JPVH 2AEPH 5ETUB 1QKZL 4ALAH 3KVPA 2WVUA 3EBIA 4TUJA 4A6YL 3ML9A 1B90A 3MJ8A 1BIHA 3MGAA 3VSVA 4TF4A 5KVDL 4FLRA 4AM0Q 1DQKA 1T80A 4JZJA 1GIGL 3NIFB 4XT1C 1M7IA 2R9HC 3D2UA 5PAZA 3B5GA 1NGXA 3UTZB 3UYPB 3ULUH 1J1OL 4NO3B 2VDOB 4LRIA 1XT5A 2QSQA 4XP1L 4M61A 3IJSA 1PCXA 2JH2A 4RGOH 3K2UH 1URZA 2CRYA 4YGVA 3ARDD 4HS3B 4OD1H 3RWEB 1OZTG 4MA3B 4WI6A 5EZOL 3I2CH 4LOVA 1H8OA 2AQ3A 4N1EA 5IHLB 1CE6A 1CFNA 1MRFL 2QKIB 2JKTM 3WLBA 3IJ7A 1NCUA 4OKVA 5C7XL 4HZLA 1CD8A 2Y6TE 2V7NA 3FB6A 3L08A 1ZHNB 3PRZA 1VPOH 1FL5B 3P9LB 1YECH 2K8QA 5EMYA 1IJNA 3FRUB 3KHQA 3RKPA 1EO8L 3MCG1 1PJ9A 3EJCA 5IB4A 3ECQA 4IIQC 4M62L 3VFUA 4E2OA 1E90A 4JW3A 4YC2C 5GS0C 3AS1A 5C2BL 4LMQI 2VM4A 2BVOB 2P43B 3IJYB 2O72A 4FMVA 4PV8A 1N68A 3VXQB 4CMHC 3QSKB 3QZOA 5CEZH 2ENQA 3E7JA 3O81A 3EBGA 3QE5A 5DS1A 3LQAC 3MV8A 4HK3N 3DX8A 1VA9A 3KPNB 5L8LB 4KH2A 1PEWA 4PV9B 2P5EB 1QUPA 4XP5H 1YEGH 2Z1PA 4GXUN 4NRYB 3FCBA 2JJTA 4N0FA 1I7ZB 2QGDA 1UOKA 2Z31D 4GG6A 2BZCA 1F6AA 3CVIL 3I02B 1JNLH 4JY4B 2DYRB 2NR6A 3CDFA 3SGJA 3L5XH 4N0UA 4PRIB 2OMVB 2Q8BH 4AK2A 3U9UA 2BSED 1OP3H 4APXA 3U4BL 2E5EA 1QBBA 3OWEA 4IMLB 4KKQA 4ZFOL 5D1ZA 2F61A 3CFKA 4WNSA 1JGEB 3O41A 1UKQA 3VWJC 3HAEH 5I1IL 1YYCA 1KC5H 5D1XA 3DVIA 3RVUD 3A6CL 4E9VA 2KLTA 4L1TA 1IBBA 1O6SA 4K3DH 5DR5L 3UAJA 1N2RA 4GW1A 3V9FA 4JRXB 1BAGA 3SZKC 4FFZA 4GLRI 2PO6A 3O9WB 4A7GF 4OBSA 1WG3A 3RTLA 3OKLA 5EN2B 5LDSA 1XH3A 1A6PA 1QTYT 1SXBA 2FL5B 4Z0BH 2J5LB 4XPBL 3NCJH 3D39D 5F96L 3IDMA 4KKCD 2EE2A 2L0DA 1O7SA 4X6FA 4Y4KB 1L6XA 5T1KD 4TPRH 4CC4C 5KYYB 1IQDA 3GHBL 1KJVB 2V8MA 3IMSA 1OARH 3MUGA 4EKJA 3FSAA 5TH2B 1JXKA 5EG6C 3FRPG 4V2CB 1AZNA 5J8OA 2ROXA 4GKNB 4U6VH 5GSRA 4Z7IA 4QRRD 3ZK0A 1XR9B 2MCPH 4Q9RH 3ILQC 4QAWA 5B7FA 2L3BA 4UB0L 1CXEA 3LNHA 1A2YB 2TSAA 1MZZA 4W81A 4E9YA 3E2HB 3H3KA 2QVTA 3QUYB 4HT1H 5C6PB 1ZA3B 2F5AL 3IVKA 3MLYL 3OKKB 1JHKL 1SJEB 2O5XL 5HI3C 2Q20A 3RFZC 4OGXH 1X7QB 3B6SB 1U8QA 3IMVA 4UDTA 2XA8L 4LCVA 3AT8A 3CBRA 5AUMA 2DQGH 4UBDD 2IANA 4JKWA 3RHWF 3BT0A 2YD0A 3ZBMA 1CXKA 3KXFB 2YARA 1J7VR 1PTZA 4U6HA 4Y4FC 1EJ8A 1OZUA 3TBBA 2OTWA 2IVFC 3FFCE 1BIIB 3EDEA 4P2OB 5FGSA 2MPAH 3IBEA 3QHTC 4U1MA 1SY6A 3AACA 5EO0A 5J13B 2BS9A 3T3MB 2Y7OA 3AG4B 3L9RB 4KVNL 1JWUA 2GJPA 3GM8A 3GBNH 2GI0A 4AEFA 3DOIA 3DYMA 1CFSB 4PJXB 2WWKO 4XZUB 4GUPA 1ZT4B 3EOTH 1BW8A 1U3HD 1KTBA 5C71A 4X6EA 5F7BA 4MQTB 3QH3A 3ETBJ 1D9KA 1U33A 3K4ZA 4G7SB 4JFDD 2CKBA 4LLVA 4XVUD 3H3BC 3MRRA 1T1WA 3MOQA 4KKBD 4LQFH 4YFLI 3LKOA 1ETZB 4HMCA 2E7LC 1VLXA 3HC4L 5HDBF 1BZ8A 2VYRE 2CWRA 3DVNB 5AW4B 2BSTB 3P73A 3ROOB 1I8AA 4HIXH 5A16B 3PG2A 5I1DA 1MFVA 1MIEL 2HJFA 5E08H 2IOMA 2WXNA 2DQEH 4AH2A 3NJXA 1HHJB 3FUJA 5DRWA 4QHLA 4X50A 2DLGA 4BCXA 5C0CD 1XGUB 4W9HC 5AYUL 4ZO9A 4DETA 4UNVA 4NQEB 1HT6A 2DI7A 1JNNH 1GZQB 4KNUA 3WEBA 2OZ4L 2OR9L 4L4JA 1JFHA 3TYGL 4Q0XL 4KKLD 2F1EA 3AXIA 3FUDA 1K8DA 1EMTL 4JM2B 5ESQB 4D9LH 2DM7A 1XCXA 4WV1A 4HCRL 5JOPE 2X6UA 5I8OL 2YXVA 4GAJL 1N64H 1KEGH 3NA9H 4Z3JA 4OCSL 1KCBA 3RY6A 2MCG1 1E8WA 2GAZB 4X6CA 1MFCL 3LD8B 1EBAA 1ZE3H 3WJMA 4HXAL 4BGLA 4F20A 3N42B 1UWGL 3DGGA 2FT6A 2PR4H 2ZKHH 1JRHH 1NQBA 2AHIA 2V2XA 3QULA 3MO1B 4M8UA 3QHFH 3H9SD 4NKIL 1JNHB 1BZ7B 1F4AA 2NXYC 3OLEA 5K59F 2BY1A 2YEQA 3FQWB 1DDTA 2LTQC 1ZS8A 5H94B 2UY7B 1G9ML 4WGWB 5DUPH 2CO7B 4LARH 5JHAA 4LRNH 4FMKA 3U9PH 2WQSA 2CKBL 4I18B 3II2A 3I3DA 4LXFA 4PRPA 1HCYA 4HIIA 3TNMA 3L3OA 1G1OA 3WMPA 3V4VL 5FOBB 1U36A 5A40E 5I30L 1C8QA 1D6VL 6CGTA 4HETA 3IS1X 2MPVA 4XBGA 1AGBB 3SCMC 4HUVB 2KUTA 3LS4H 4KUCD 3KPLB 5IR1A 4NZFA 4XP9L 3DX6A 2FYYB 3B9EA 4MJHA 3DTXB 2VDOH 3KM2A 4KK6D 3O3BB 4NCC1 4LLQA 3U0PA 4MS8D 4QGTA 4WFFD 5DT1H 4I77L 5JXED 1DL7H 4PB9H 2VR3A 4OZGA 4QUOA 5BOPA 4JFFE 5IVXE 3L5WA 2VLLA 3GI8H 5D4IA 1ZEAH 3KPQA 4BKLA 1KJMB 3GSUA 3QUXA 2A4ZA 3H2WA 5FGCE 1HEHC 1DANU 1SHSA 2GK0A 2BOBA 1IVLA 1OY3B 1G7LB 1YEKL 2DQTL 4FFYL 4I48A 4IOSA 5I82A 1EHLL 1WLHA 4EZKA 1F56A 3MTXA 4I87A 4YHIB 1ES0A 2LQRA 1JL8A 1T1ZB 2IIJA 1QAWA 4GAFB 3DMMB 5IBLD 1TCRA 3P4OA 1EX0A 1XIWA 2EYSA 3HHMA 1J5HA 4ZTEA 3CXHK 7FABH 2ICES 1HIML 2JIXB 5CGTA 3PLYA 5I73B 4UUJA 1AZRA 4J3XA 3PGCB 2YPVH 4G6MH 4GG8B 3X11B 2BVPA 1VADB 3TJPA 3BAKA 5I9QB 5BQ7B 4PJCE 2WM0A 1RFDL 5CZXD 5FFGA 3OG4B 3TV3H 2HVJA 1C5DB 2FO4B 1FVCB 1KB3A 2AK1L 4RMUA 1UATA 4TOYL 3MLVL 4IBTA 3W2DL 4EVNB 1FNEB 1NMAH 4JAMA 2ARWA 2KZBA 4IDLA 4G8EB 4P9HH 3GSWA 5IW1B 4X6DF 4CU8A 2BCKB 5D7HA 4XNXL 1A9BA 1JDAA 2ADIB 1MCOL 5IMOA 1RZQA 4HHAB 4OZ4B 4NDMB 1NJ9B 4QIRA 3WTTA 2NXZB 3GTTA 4W9FC 1CGSL 1T7XA 2R2HB 2XV6B 3BP5B 4BA8A 1NFDA 1ID2A 2E0PA 4JHWL 4YFDB 4HFWB 2ZUWA 1OALA 5JNYB 2BX5A 5LAXB 5KJRL 4ZMOA 4L8SA 3AQZA 3CLWA 1BFOB 1BECA 4FP8H 5EUOB 1KCRH 4HKZA 4ZMVA 4AMXA 1FFNA 4HG4J 1OSPL 3P9MB 1IFHL 3AXHA 3KL3A 4GKLA 3NIGB 4K94H 3EYQC 3FT0A 3WKPA 1MCRA 2CM6A 1T1YA 1IM9B 3C60A 1TOXA 5KSBB 4CGTA 3S37X 1PW3A 1NCWL 1XX9C 5GS2D 1UG9A 4H1LH 4TQEL 3MI6A 3EHBB 1F4YL 5EU3B 5F7WC 4HPHA 5LGHL 3CFQA 2BWIA 4IRZH 3PQYE 1NMBH 1YEHH 3FN3A 2ATKB 1MELA 4L4VA 4FG0A 1J9SA 3BAEL 2JQAA 2OJEB 3OXRB 3TT1H 3WEMA 8PAZA 3T8VA 4LCWE 1B0WA 1QR1A 5C08B 2K6WA 4N2OA 4JPVL 2AEPL 3Q05A 2C3VB 1N18A 4ALAL 3S3PA 2H3NB 4E68A 1M1XB 2DYPA 1UEMA 2GCYB 3CUPA 2FQFA 4H0LC 4CC1A 1QFWM 5L2JB 3CFMA 4WW2F 1QW9A 1HAWA 4X5RA 4NAQA 4Y2LA 4X4XB 2X53A 2X70B 4MWFA 5KJ4A 1SOSA 1CURA 1ID5I 4IOIB 2LU5A 3IGAA 1FGNH 2GB2A 3SE6A 3ULUL 2V3DA 3V8OA 1K4DA 5L6YH 4K9EH 3GYRA 3B9KC 4GRWB 5K1VA 1YQVL 2UYLB 2H9GB 2EINB 2ISDA 3K2UL 2V9RA 4LLUA 3WV0A 2EILB 3IRCA 5KBKA 4OD1L 2DMCA 1E0OB 3ETBF 4FGMA 4GRLA 4ZXBD 3I2CL 4LPUA 1DBKH 3GPSA 3MDJA 1TMQA 5EU5B 3HCVB 2WAHA 4KAQH 3VXSB 4DZBB 1A9VA 3V8CA 4FFWC 4W6WB 2HRLA 5JQHC 1TTGA 2XIBA 5I71C 1VGKB 3SKMB 5T5FH 4PJ5D 1VPOL 4KPHH 3N0AA 1YECL 1HKFA 4JFXB 2GIMA 1G0XA 2NY6C 4YR6A 1RV6X 3E6FB 4P5TA 1KPRB 2APVA 4W1TA 1Z5LA 1JHLH 5C0BB 3GUFA 4DKTA 1ZTXH 5C0FB 2B59B 1E9QA 3E8UH 5J6GB 3DUUA 3EO0B 2YOCA 4LGRB 5C0AE 1X7TA 3QORB 5D7LA 4HS6B 3ZKNC 1I8MA 1P1VA 1UACH 4ELDA 2HX9A 5CKAA 3TX4A 3QXAA 5KOVC 3C5SA 3Q7JA 4Y2DB 3AQXA 3FO2B 2F54D 5DUJA 4PTUB 3ZVVA 3B8YA 3HS8A 5E2WH 1A7BA 1HHHB 2R9HD 2JTYA 1LM8V 1WH0A 5GZOC 1CL7I 5DURD 4O02H 2OMYA 3ARRA 5H2BA 3TYFB 2VGLM 1JNLL 3ZGHA 2EADA 1WZAA 2Q8BL 1CLOH 1F2QA 1NEUA 1UVQA 1ZLDA 1GW0A 2A77H 3GMMA 3NFNB 4UT9A 2FQEA 2BW5A 3CAFA 2EDHA 3V5DA 3VFSB 3BHBA 2HLFC 5TF0A 3UIZA 3QRGL 2ZWLT 2C4FU 1ODAA 3FB7B 3NCYP 5FWRA 3T3PB 1EFXD 4NRZB 5JQIB 4K3DL 2Y1VA 1Y0LB 4NRXB 3MLTB 3DV4B 5GGRY 3KMDA 4K7PX 3V4UH 2VLRA 1A6WH 2NX5E 3EUDA 3K72B 5DD6A 2W60B 3M8OH 3BCFA 3OV6A 3SDAC 1DQQA 2GI7A 3ZIYA 3ZTJG 2ZX6A 4OF8A 4Z7AA 3QIBB 1NPJA 5HJDA 4JHZA 1DQVA 4Z0BL 1VERA 2VR8A 5EF3A 3VXPA 1T0MA 4IBZA 4H4NA 3QJXA 1IAIH 2XYCA 2JI3A 2D7NA 2ZUSA 3APCA 4NNXB 3X1FA 2OCCB 3N1GC 5EEXA 2NW2B 5F3FA 2AV1B 2NY0B 1DTUA 1PLBA 3STZB 4BA0A 1OVZA 3C6LD 4YDLB 1OKEA 2Y1YA 4YDZA 4OZIA 5LWYL 4GRMB 4FXGA 4N22A 3UZQB 1T4KB 1MCLA 3AROA 2MCPL 5FA4B 4Q9RL 5BRZA 1I9JH 4U05A 2JMRA 2GBUA 4XVSL 3OHXA 1QHOA 2H2SC 4CSZA 2ZNWA 4E9WA 2WZPA 2Y06H 5E8DH 1JE6A 5DMYA 3B5TA 3QFJB 4OLWL 4V1DD 4WWKD 1ZKAA 3P0VH 3UTTB 4N3TA 5D5MB 4U1SB 4OBRA 2ITDA 4KQ3H 4F3FA 1CI3M 1F90H 2JWYA 1LEGB 5D7SH 4FEMA 4OGXL 3RWJA 5BOZG 3NJVA 3BEVA 4AQAA 3TBSA 1RU9H 3ARGC 5J1AA 1RIHH 1UB6B 2XG4B 5I2IA 3K71A 2DQGL 2CKNA 2MQCA 1CCZA 1WGOA 3HNVL 1U8IB 1BQSA 2FT7A 2EDWA 1YNTA 2Y22A 4P2QE 5C09E 3RKDC 3RVTC 4IRSA 5GZND 4M7ZC 2YKKA 4XNQA 4MJIA 1U8HA 5AVTB 2ZE0A 4OCNC 3VFVA 3TT3H 3DX9A 5E5MA 2D3VA 3U6RA 4BK8A 2IDSA 5T3XD 4UQBA 4M61B 4K7FA 4FL4B 4MQSB 5L8KB 2J8UF 4I5BA 4UMSA 4M6ML 1M05B 2QT6A 1XB3A 1BREA 5F1NA 4OKVB 1RJZA 2B0SH 4A7VA 1OSYA 1R34A 1Z9SA 4IJ3C 4Q6IB 3BE1L 4Z77B 5JZ7C 2CHNA 1EZVY 4E0RB 2XC8A 4ONGH 1AXTL 2NY2C 4HIXL 4R4BB 1CGVA 3M86A 5E08L 3JWNC 4BFKA 2DQEL 5CD3B 2CDFA 2YEVB 3TZVD 5C0ND 1QA9B 1HH9A 2AXGB 5I75B 2J21A 4L3FA 2FX9H 2NLJA 1KBPA 2XETA 2BHYA 3BIKB 2YFOA 3DXAB 3WIFB 1JNNL 1WAEA 2X4PA 3MRFB 2YAHA 2KZWA 1Q9WA 5JW4N 5DZAA 1TFPA 2IH8A 3L8QA 4NX0A 2O5ZH 1FFQA 2VQ1A 4M3HA 4BH7B 1EPFA 2F8IA 1CDGA 3T77B 3PY9A 1E67A 1N64L 3NH7H 3MCKA 3NA9L 4GG6B 4BZYA 2R1YB 4ADIA 3VRLF 1AKJD 2C9XA 5JW5A 1TR7A 1TU2B 2DMGA 4JGNA 1JBJA 2NPLX 2X89A 2HKAA 2PR4L 3AY2A 4S2SA 2C3GA 1JRHL 2ZKHL 1GS8A 2IAMB 2OI9C 2QADD 3NEXA 4U1GC 5IGXH 1IT9L 2CQVA 4TMPA 4ACTA 3QHFL 1EEYA 5B1AB 4Z3FA 5C6TH 4L3CB 1O6SB 3EJYC 4G9DB 3SYPA 5DUPL 1TDQA 4RMQA 1RAMA 1SYVB 2PO6B 4NQDE 4DEPC 5J57B 1ZGLM 3KYOB 1OD7A 1EHNA 2NT0A 3UDWA 1FSKC 5FHAH 5KBMA 3NTCL 4W9KC 2I27N 5D7JB 1ED3B 2XWBA 6PCYA 1NANH 3FUKA 1HFUA 4F15C 4MFHA 1EO7A 2JKXA 3WHE1 4OD3H 2IWKA 2J6EL 3QUZB 3IFPB 3MNZA 3PGFH 4I9WE 1CICC 1DCEA 3RBGA 4R84A 3GLDA 5J1SC