1AHMA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DER F 2
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
total genus 7
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahmA00
2E56A 3RG1C 1AHMA 1XWVA 2Z65C 3ULAB 1NEPA 2E59A 5IJBC 5KWYC 5IJDC 3WEBA 3T6QC 3FXIC 3VQ1C 5IJCC 2F08A 4G8AC 1KTJA 2HKAA 3MU3A 2Z64C 1AHKA 1WRFA 3B2DC 3WEAA 1A9VA 3VQ2C 3MTXA 3M7OA
chains in the Genus database with same CATH superfamily
4K15A 2XWRA 5IB5A 15C8L 1NFAA 4FS0A 4JPWH 5KOMC 5IIEA 4U7SA 4WSKA 5D72H 1JPGB 1G0YR 4ZMTA 4ODWA 1YEJL 4J3OG 1KIUA 5HHMD 4KOBA 1G9NC 3KEHA 3QFDB 1ZVHA 2BDNL 2HVJA 1J8SA 1T4WA 1HNFA 1YA5A 1VPOL 2QQKL 4LSPL 1A1NA 1G4RA 4K5PA 3QNZA 4FQCH 3DETD 4RMVA 3KXFB 4ODSL 4Q2ZB 3BMWA 1RZKH 2XYCA 3RX7A 3WS3B 1OM3L 4FTVB 3SOTA 3HLAA 5SWZD 3RBSA 1FNGA 3GPEA 2BIIA 1J0IA 2UZYB 5CJOH 3PE9A 4UT7L 1A6TA 5GGVL 3BVXA 2NXZD 5FEBA 2ZXDA 3I6GB 3O41B 3NA9L 2EYRB 4F33B 4GUPA 4FQLH 3ULUL 4NKDB 4LBAA 2FQFA 4FXGC 1A8ZA 2BY1A 4RRPG 1MRCH 2R2EA 1AIFA 3GUTB 1WWBX 2ZNWA 3FUEA 3BQUD 5FUOH 3S3JA 2P5EB 3QFJB 3TCLB 3L4WA 5DMKB 1RI8A 4P4KA 4N6QA 1WFTA 3PNWB 5I1GL 2RJMA 2GEEA 4AEFA 5J9PB 4LSSH 5I74B 4CW1B 5IW3A 5LXGH 1MLBA 1AGBA 1G9ML 1HQRA 4HH8A 4M7LH 4UOW1 2YQBA 3RP1A 2GFBB 4PGZA 3V0FA 1G0DA 1R3KA 2YOCA 5HPMA 1UKQA 3DHJA 3K4DA 1BM3L 4ZMOA 1A4AA 2E4FA 3L2LA 1JDCA 5CIPA 2DI9A 4DEWA 5E2WH 1P1ZA 3QULB 1MFCL 2BOCB 5KW9H 4P5KA 5IESL 1O6TA 1Z5LB 1TNNA 5LCVH 1T20A 3M7FB 4JS7A 2CBPA 4MMZC 2ZONA 3I84A 3NRFA 3A67H 3EJYD 4XBMA 4U2ZA 6TAAA 3MBXL 4H26A 3FB7B 1FVEA 2OMWA 3NK3A 4BHUI 1RUAH 4JREB 4ELDA 3NJLA 2XG4A 1TDQA 2ADFH 2VR6A 1SEQL 3GMPB 4ZUTB 4GO6B 4JFVA 3FRUB 1G1YA 2DQHH 4MASA 4ODHL 5CN2A 2J8UB 3EG9B 4P46B 3FFDA 2A4EA 3HRZB 2ICWA 1J05B 5I1CL 4WUUE 3SCMA 2Q3AA 2ZSVB 1A64A 5T3ZH 4OIFA 1CDHA 1KACB 4HS6A 4N0FA 3BAJA 2MCPL 1BVNT 3ABGA 3BIBX 5IQ7H 3WTXA 3ATAA 2H0JA 1P7QD 4UU9B 5LAXA 3V6ZA 3EBIA 5DUPH 5D4JA 3IRPX 4F57L 4NQEA 9PCYA 3GMLB 3PWNA 1QO3B 3BP4A 4TQEH 3FB5B 2B3IA 3MV8A 4GBXB 3RI5F 4Z7OF 5KZCD 2VQTA 4NZDA 2HFGH 3T2NH 4FCAA 3TYFB 1VEOA 1WD9A 2VXSL 3LNHA 4HCGA 5B1KA 2IIJA 3SDAB 2CJUH 2XV3A 4TS6A 5E6ZA 4GRMA 3V6BR 4UM9B 4L23A 5D1ZC 4JKWA 3RB7A 4GRLA 3HKZA 3QIUA 4M1CD 2G5BB 2P1YA 3KYAA 4Y5VB 4UTBA 3D2UA 3KJ6L 2FJHB 1J8RA 3TNNB 1LE9A 3QG7H 5I66A 3T0DA 1RK0B 1PZ2A 2H26A 2MH4A 3S5LA 1U91A 5CCKH 3QCTL 3T1FB 2E74C 4PVNA 4S2SB 2JKJA 2YFOA 3NJVA 5C3TA 3H1ZA 2FATL 4FFZA 3PGCB 4UMSA 4QRPA 1RZJL 1TVBA 3GSNL 4YUEL 3WI9A 1OP5H 2FR4B 3ESVF 4DP7X 4LKCA 5EZPA 3B2MA 4Z78B 1NZRA 1C08A 1FO0L 3S3DB 1OARL 2YD4A 2UZIH 5C07E 1GGTA 1T22A 3TEXA 3UABA 1I75A 3T2QA 3UL4A 2EXWD 2WMPA 1EHXA 5JDSB 3GJEA 5DJAB 4NKOA 3LNIA 3KVPA 1W8EA 4RGMB 2MHAB 3APCA 3CLWA 5AAWA 4NT6A 3CN1A 2F7QA 4NGHL 1MFAL 1HXYB 1NEZB 3C08L 4KPHH 4X6CE 5K59F 1ERNA 5TQ2L 3SPVB 4G8GE 4G1EB 2QPSA 2F53E 3IFLL 4P2OD 5BS0A 4P49A 4JM4L 3B7TA 3W2DH 2AAAA 3T4AA 2ED7A 3ULUD 4FQXD 4UI2A 4B27A 2HKFH 3EDJA 3UZEA 3FT4A 2WY3B 2VR4A 1OSPH 4ZTOH 1E9QB 2AJ3A 3QDJE 1VKXA 1A4JB 3CJJA 4WI2A 1CFNB 4CKQA 1LJMA 4D9RD 5L88L 4ONFL 1SBSL 1OTTC 3D18A 2XPZA 1TPXB 3AXLA 4I0PA 3MX0A 4JKLA 4MXQC 1JHKH 3UBXI 3Q6FA 4PM1A 4RAUB 2FZ3B 1CYXA 4NQXA 3B3IB 2XFXB 2VJ0A 3FH7A 1N0XL 1DQVA 5DEZA 4QDGA 2D31B 43C9A 4B6ZA 1NIEA 1QTSA 4JFOA 5C0AB 1ZCRA 1X7TA 1JV2A 1URIA 12E8H 2RQEA 2YAPA 3PL6B 3VXMD 5IG7A 4J12A 1ORQB 1KYDA 1R9FA 3RWIA 1FORH 1I3RB 1LMKA 4Z7VA 1AOZA 1T1XB 4JGJA 5E6UB 3COOA 3BSGA 3MRLA 5I71B 2BINA 1SEBA 1NCBH 3OMIB 5DRXA 3K71A 3V4VA 3WGVB 3EYOA 1JGIA 5DD6A 4HIJB 1O9VA 4H5SB 3NCFB 1WBZA 1Q9OA 3GI9L 1INQA 4NJ9L 3FT3A 1JGVH 2IAMB 1CLCA 2ZWYA 4MQ7B 2Q7YB 1BQKA 4DTGL 4F91B 2ZP9A 4K8RH 2Z65C 3PJSA 1JGUL 3OVUB 5AVRB 5F71A 2WIIA 5GS1C 4KQ4H 1NWOA 1U58A 4HETA 2R9HC 2NLJA 4R90H 3V5KA 2R2BB 1NCWH 3C2SA 1QSZA 4NC1C 1J8HD 2Q0ZX 3HB3B 2YGVA 3PHQA 4FLQA 3FQYA 4IK7A 4CVZB 4DAGL 4K7FB 4XN2A 2PPAA 1MCWM 5B39B 1IUZA 4JFDA 1UACL 4WFEE 5ANMA 4MX7B 3AAZB 5EDXA 5EO0B 4XBEH 1HWWA 2EYTB 3HZVA 4PVLA 4UT6A 5TFSH 1Y07A 2VXQH 4MWFA 4OLYH 4WI7A 1EZSA 4OTXL 4I9WE 4RMBA 1MJ7H 5KVMC 1U8NA 1JAEA 1VACB 3NIFE 4DN4L 3CFJA 2B4CH 5CWSB 3OGCB 5JTWA 3HBQA 3RNKB 1M3IA 1MNNA 3TVMD 3TURA 1KFGA 3G5WA 3KYKL 4APQD 4XH2B 5D8JL 2Y69B 3RY6A 4U1HB 2C8NA 3ZE0B 4ZD3L 3RTQB 5KG9B 4KVNH 3SE3A 1F1DA 2AJZB 1NKRA 2NY3B 3FHEA 4QJ4B 4ICXA 5JIQA 1H0DA 1NGXA 3HNVH 4R8WH 4CC4C 5MEQA 3BHBB 4DUWA 2YPVH 2WLKA 2XN9D 4MD5B 1N5AB 3TO2A 1JWUB 2D0GA 3CK0L 1NGZA 1ZY9A 5EC1A 1U0QA 3PHSA 3FTVA 5J12B 5HI5D 3M45A 1GS6X 4PJGE 3MFGB 3LOWA 3VGAB 1S5IL 1UT9A 3R7QA 3HVDA 4NS0A 3T5WA 5J1AA 3TJEL 1YY8B 3C60D 2YXFA 4BSWB 3QXDA 5L2JA 4MS6A 4HIHB 4OLXL 3UGUA 4XNXH 4HWEH 1U36A 1EJ6A 4HIEA 1OQXA 3N1QC 3N04A 4JM2A 1CQKA 3D34A 2HLFD 1JGDB 3ZDYE 1V3LA 4LP4A 1J11A 5EU6B 1AZBA 2K1MA 4FHKA 1EHNA 4A7GA 1X5IA 1LE5A 1JI1A 3LB6C 4MYWB 1EDQA 2DKSA 4ISVA 1DJIA 4WAFA 1P9MA 2F7RA 5E4EC 3IFOA 5I73B 2DQTH 3O6LH 1NTDA 2CLRB 3LSOB 1OF0A 1ZK9A 1E6OH 2CA4A 3P0VH 4L9LC 3S35X 4L4TD 1IO4C 5EZIL 3DC0A 4Z7VF 3SDDB 4FULA 2EH8L 5JW4N 3UTPE 3D48R 5I6PA 5I1IH 1NBQA 2DYPB 3TO4C 3QQNA 4XHJC 1HINH 5KBNC 5LGJA 4NUGL 3CGTA 4HHAB 1G9NL 1KLFB 3V0DA 2EIJB 3UCQA 3UZVA 3ZTDC 5B38B 1YECH 3EH3B 1K5NA 3BAWA 2V8MA 3JTSB 3K6OA 1ID2A 1A9BB 4XVTH 1BIIB 3NPSC 4WENB 5LG6A 4Y2NA 2KH2B 3EOTL 2YHGA 1KZYA 3KPSE 4H25B 1GGBL 5AW8B 3RU8L 3VG0H 1P6WA 4AYFA 5J6SA 1MWAA 1KCRL 1M7XA 3QJHB 4PG9A 1OAXH 1JCKA 3EAKA 5K9OA 2F54E 4OLEA 4V11A 1MIEH 4HZLA 1EA9C 3LH2L 3Q01A 2I5YL 4KK9D 4PJAB 4X9IA 4AUYA 4BHUA 5MHSD 4GUOA 4PV1C 5DD0H 5F7KC 3FTSA 4WUUA 3IS1X 3CDGB 4NUMA 5EO1B 4WY7H 4EN3A 4NKMA 2OMZA 2CG9X 4BDVA 2W91A 3U4BL 3TIEB 5JPNC 1Z9LA 3WJJC 2UWEE 4PB0L 4Q8BA 2XWBB 1XR8B 4I1PA 1HC1A 1M6UA 2J44A 4JHBA 5IB4B 1PLGH 2IDQA 1Z6JT 3VXOA 5IMLB 1U95B 4KV5F 3U7WL 5K93A 5IKCB 1IGIH 2EC8A 3VGBA 2ZG1A 5E8OB 3MUGA 3T6WA 4OT1H 1OAZH 4BFOA 1HI6A 4KKBC 3VXQA 3BFWA 5BXFB 1VFBA 2NQCA 5GS2H 2A7BA 3FB8A 1ZDQA 3Q1SH 4KI5D 2SEBB 4LEXH 4TF4A 4LSRH 4YHKL 4QRRE 2H1XA 3ET9F 1FGNH 2I7OA 3FMGL 1MCPH 1X44A 1LO3L 3Q8AA 4LPYA 4N8CH 4JUTA 1KV7A 4B5EA 3MLWL 3FN9A 1AMXA 5JORA 4ILDA 1SDDB 3HC0B 4I7ZC 3W0WD 5BNXD 5FYJE 4WI6A 3RFZA 1J5CA 1KN4L 1MJUH 2NY1C 4X5XA 4DJMA 3CFQA 3K2IA 3IBOA 1ZXKA 3GF8A 5DS8B 4DKAA 1QUNB 3K8LA 1S9WA 1I82A 2LT9A 4GKSA 3DGGB 1PF3A 2FH8A 3VSTA 4XWGH 4KJQC 3LHPL 5EBGA 2OCFD 3QUGA 1Q94A 5L7XH 4HJUA 3EYFA 4NO2A 3QI9C 5JHLA 4YEEA 4Y4KA 2X89A 5DK0A 5C07A 1J1XL 1QTPA 3L9BA 4MNQE 1O7DE 3C5ZC 3VU2A 1ZTXE 2FLRT 1NFDE 2XVBA 2YKLH 1OP3H 3VUAA 4Z76A 1HEZB 4W9JC 3P0GB 4JM2F 1UA6H 2WQRA 4X6CA 2FT8A 1I8UA 4G8GA 4KRNA 5D6DA 4A7GF 4K7PH 5IFHH 2F53A 1A3RL 4KDVA 3VGGA 3MLZL 5E03A 2C9RA 2XTJB 4XOEA 1WP6A 1ZSDB 4OI9A 5CEXA 4YHZH 4O2CB 3VB8A 3TYGH 3EUUA 2J2ZA 3OR6B 4DO5A 5EEWA 2I25N 2J6EH 3QDJA 3BAEL 1PEWA 3GBMH 3Q3GA 4AH2B 5ENWA 3MREB 4U1MA 3D33A 1RUML 3TEWA 1XGZA 1T5WA 2FB4L 1C5CH 1GSMA 1VB9A 2YWYA 4L3AA 5DRZB 5D93B 1QKZH 2HKFL 4B9KC 3MJWA 1YRKA 4M5SA 1DP0A 2LR4A 4HD5A 3VYPA 1CU4H 1UM6H 1MCEA 32C2A 3POHA 5FYKH 4BSJA 1PFOA 1BXXA 1F41A 3VFOB 3TBBA 2EDTA 4XVUD 3LEXA 4IBQA 4ZK8A 1L0XA 5JIHA 3KLAB 1Q9LA 3GHEH 4X4XB 3DMMA 3UBXA 2JKLA 4L2LA 4JGMA 2ATKA 4MRCA 1EZVY 3CZKA 3BYTA 4A7SA 1DEDA 3WN5A 3VXSD 1I3GH 1E9OA 4Z7NB 1G7MB 3GEFA 1XH2A 4AG4L 4OIBA 4X98B 3ORJA 4NBYB 1ZANH 1F6LL 1KTDB 2JK5B 4G8EA 3O4LE 3GIVA 4NI3A 3O45A 1A14L 4UIMA 2CUMA 1E4XL 4MNHB 3P3SA 3L5XH 1N64H 5E6SB 5C08B 4DQOH 1T0NA 1OGAD 1H8SA 4AQZA 1F4HA 1JPTH 4KKNA 1U8QA 1F3JB 1UEYA 2FJFB 3QGVA 3BH9A 4RAHA 1QRND 4U6XB 3WLWC 5KVGH 1MCCA 4GXFA 2WVVB 3OMZA 1KJ2B 1HOCB 4UYQA 43CAA 2P8MB 4ZRGA 3Q8CA 1DEEA 1U8CB 3T1WA 4KX8A 4JMXA 5I23A 3QJXA 2XPGB 5T3XE 4F2MB 2YK1L 1RVFH 5ERWA 5L0QB 3Q43A 2EILB 2DQGH 2VSDA 4JZNB 3FRPB 3DSNB 3I9GH 1H3PH 2VE6B 2HFTA 4QRQA 1XF1A 4R83A 5IVXB 2K8MA 4HIQA 2X3BA 3FAXA 3HEIB 2WNGA 4FQQA 5GJSL 2Y6TE 3EGSB 3EO9L 5HJDA 1KG0A 1A22B 3O81A 4QRTA 4J23A 4NB7A 1FL6B 1Q72L 3W9EA 3GJFB 3LRSB 1ZVNA 2CAKA 5CF3A 4N8VA 1XCQB 2YR3A 2ZOKA 4Z77A 2MKLC 4HMDA 2YAOA 2VGLM 3FCTA 5E2UH 5FWRA 3IAPA 1UVQB 2Z91A 5E8EA 3BVUA 1WYJA 1R5IA 4P4KC 1RLBA 5F1NA 5CD3B 5I82A 5KSVA 3QUYB 3ABMB 1L9RA 3UFIA 2XWJB 4JFEB 4LU5L 4R4FH 3CHOA 4G9DB 3VD7A 3APNA 3PJNA 4X6CF 1V3KA 1WFJA 3O11A 1DQJB 1B6DA 4P57B 5HDLA 1KGCD 5ADOH 4P59H 4X8GA 1F02I 3QWOA 3AJ7A 1MF2H 1PD0A 2YD8A 2VKXA 2BP0B 4ZFOA 3A4AA 4PJGA 3ESNA 1XGYL 2LTQB 5GRUL 4YSQA 4YBLC 4YS4A 3IK2A 3H9SD 4WWNA 4Z9KB 4RBPH 3X13A 1Z3GH 3GBNH 2Y6SC 1CF1A 4FFYL 3F12B 4Y7MA 5DZNA 3W5MA 3BW9A 4KJWC 5KSBE 2WSPA 4RGOL 2Y06L 2A1WH 3MV7A 2GITA 4KTDH 3T8XA 4OW6A 4UANA 3KLSA 5DQ9B 4LL9A 2R7EA 3U0TA 1T0PB 3FDWA 4OFPA 1CVSC 3RWDB 3TWYA 2QGDA 1RUKL 1HVXA 1MCLA 3APDA 4PGDA 1W0WA 4XGZB 3MR9A 4P2CG 4ZOAA 1F6AB 1GZQA 4JFFE 1FFOB 3GSQB 4LCIL 4OZFB 5D1ZD 3WNPA 4OM1H 3FOLB 1WFNA 3SCMC 1WT5A 4HS8L 1IFGA 1USZA 2C1PA 4WU7A 1XSOA 4L05A 5EIIG 3EYSH 5I1HH 4GSQA 4K07A 5D2LB 4U1NB 2EKJA 5GS0C 3BKML 1BZ7B 1UOKA 2BC4B 4HKZB 1OSZA 3DO4A 3WIFA 5JO5A 1JGLL 3PQYB 2ARJB 3RA7H 3RHWK 5KBKA 4G43B 2E9WA 3VH8G 1TZHA 3WDIA 4F58L 1PD6A 1O5PA 4OF3A 2ICEB 2ZQKA 3KDPB 4JRYE 2KL6A 3VJ6A 1YDPA 3KPSA 1YEDB 4JB9L 1UD8A 3G7TA 2JJTA 3VFTB 3V8OA 4GRLC 3QIUC 2KQMA 2RIKA 2H3KA 4K2UL 3U4EB 2F54A 2WZPA 5FUCE 3C5SB 1XF2B 4JFSA 4X6BA 4YE4L 1UXLA 3OD3A 4LDEB 4RETB 3RX5A 4W9DC 1SLWA 4YDIL 2Z92B 3KPMB 4LSTL 4HBCH 2Q6WB 1OT4A 3W1ZA 1KBWA 1B0RB 1X9LA 2UWEA 4OZHE 4M8QB 3BP5A 1FLTX 2H0EA 3LS5L 1YMHA 1JNNL 1N7MH 4MMXC 2NDFA 1KB5B 1QBLL 2HKHH 2GJ6E 3NIFF 3O4OC 4LIQE 4F9LC 1MUJA 3Q2LA 5ANHA 1MAJA 4JKNA 1IEAB 1AG0A 1U8MA 3TXAA 1PCXA 4F15C 5A1AA 5IF0A 4PY8J 1OTTD 5KUMA 2C9AA 4NRYA 4QRRA 4HOMA 2PF6A 2YXWA 1ZLUK 5AAWC 4MXQD 2VN7A 1H3VA 3WAKA 4FE9A 4KRMB 4DVRL 3Q2CA 3SY0A 5A40E 1JTTA 6FABL 1OP9A 2DYRB 3W5NA 1ID5I 1Q9KA 2JXMB 3C09B 4M7KL 1QNZH 5BO0D 4MXVE 4QXTB 3T4AC 1FG9C 3TT1L 4WTZG 3MRNA 2WNWA 4TUUA 3UZEC 5DI8B 1RMFH 3ZJAA 2V17H 4BA0A 1U2CA 3P9MA 4DKEL 4TNVF 4EQ3A 5F3HB 3DSFL 4PJGF 1DQQB 1T6WA 1PNDA 5JHDD 2CHWA 2QHRH 1KLUB 2EC9U 4NERA 5FXCH 3WSQL 1A5FL 1MHCA 4FQJL 2LFGA 3ARGA 4PJHA 4I0PC 3FUKA 2OYMA 4UV7L 4MNQA 5IVNA 3QZWG 4R7NB 3S96B 1QLFB 4OF8A 4HG4J 3BUPA 3HZKA 1NFDA 2GSIA 3JV6A 4OJFL 5FHBL 3OPUA 4FYTA 4U6YB 3V0VB 3O6FA 5L7XL 1QAWA 1BFVH 5DFTA 3Q5OA 2HH0L 3ZDYF 3I6KB 1FN4B 2VH5L 5FLUA 3KYMB 4BYHA 4CSTA 3ESPA 2XZCH 3GSRA 3RDTB 3RWJA 3TA3B 3CSYA 4Z0XB 2P8LB 3C8KA 2R9HD 4OD3L 3N50A 2ZP0T 3OKDA 2ALAA 3KCWA 4XVJL 4KQ3L 4PRAB 3ZQ9A 2CKBA 1MREH 3N43B 3TONA 3DI2B 1AYRA 2P24B 3EJPA 3NFSL 1A6AB 1GAFL 1PZAA 1PLBA 4NBZB 4BUHA 4AT6A 1RZIB 4KVCH 2OR9H 3U9PL 4PJBB 4ZUUB 1B2WL 2OMTB 1QWNA 2FDBP 4PJ5B 3C75A 3VFUA 3F6JA 2FHCA 2EDFA 4EXPX 3BX7C 3OJMB 3N55A 2DJSA 3WDHA 1K2DB 3LVTA 4BV1A 4YFDB 3LDBB 3MZTA 2EEXA 3U2SB 2YD9A 4ABWA 5ICZA 4XPHH 1FFRA 4A2LA 4X7SL 3S37L 2DWYA 3FSAA 3NMEA 5DHDA 4E41D 4L37A 5D2NE 4L3EE 5JOPE 1XZWA 3GLAA 1IQWH 4FP8L 4JKPH 2DEWX 1XB8A 4MMYB 2W0PA 3O9WB 2ZZUT 3WTWA 4O9HL 4LLMB 3TWCL 4S0SD 1NSNL 2Z0BA 3D0VB 3I02B 4UTCA 3Q7JA 5A3ID 4PV8A 4PJIE 2XWZA 3MNWA 4AQEB 3OBAA 1VLXA 3GBEA 2DEYX 1E7UA 1FJ1B 1IT9L 4U1KA 3D12B 2UWEF 3IMWA 4BK5A 4JHWL 1QP1A 4LASH 2X4SA 1OPOA 3THML 2VC2L 4UV4L 3UAFA 3TBSB 3CQPA 1T1YB 3FPXA 4ANKA 2JI1A 1XGTB 2IOOA 4DCQB 1JHLH 2N7AA 5EU4A 4JJHA 4JJ5A 5KYWA 1ZANL 3HLKA 1CDIA 1CFBA 2WXOA 1NL0L 1I8KB 5GGQH 1S3KH 1TOXA 4KKAC 5GRZA 3RY6C 2LABA 3JUYA 3QVAA 3H3BC 3L3IA 4EI5A 5ESVA 4XPAH 3SE3C 3FQNA 4G3YH 2E7LA 1M05B 4BFGA 1DYZA 1GKEA 2WTPA 2OSWA 1TSRA 4WI3A 4MS8D 4P2RE 1P69B 4PLJC 3L3JA 1IQDA 2XCMC 3U0PB 1XGQA 4FKHA 2AEOA 1Q0YL 5EU7E 3L3GA 3MOAL 1CVRA 4OJDH 2VL4A 3LB6D 4NZUL 3KLKA 5FYLL 3X17A 4M43H 1OT1A 1BZ9B 4H1LH 2ZOTA 1LD9B 4LNVA 1FUNA 3HHRB 5FW8A 2BLFA 3V0WL 2Z93B 2FX7H 3IF1B 4PJHF 4LOVA 4OD2A 2OK0H 4PS4H 2X9YA 3DTXB 5F1IA 4JEGB 4PVMA 5TF1H 4CSZA 4NFBA 2YBRA 3T2PA 1JHTB 4HWBH 5C0NC 1M7DB 3PWPE 4JHVA 4XHJD 4NZRH 5DFAA 1NFDF 1TO5A 2I9LB 4JM2C 4WI8A 3F65A 1WBXA 4Z3JA 4YDLB 1K8IB 5DLML 5AW1B 2FX9L 2DTML 4Z95H 4CN1A 3HZYA 4U1JB 1KTBA 5HHOD 5C8JA 4DP4X 4HC1H 4FG2A 4FOMA 2NNAB 5HHPA 1N68A 4Y8DC 1HESA 5DRNB 5FGCE 4KRPB 3NJNA 4PMFA 5ITBL 1NINA 1IBBA 1YMMD 1FGVL 1P7BA 3BEWA 3BSZH 4ORGB 2JCCB 1SGKA 1R3HB 4H88L 4LLYA 1PZ5B 5LGYA 4IHOB 2OTWA 4PV9B 3GS7A 1OAUL 4IOIB 4WUKH 3EBHA 1AZUA 5KSBA 3OWEA 5DR5H 5IW1A 4NDMB 4Q14A 2EE9A 3VI3A 2QQQA 5FIEA 1PZUB 2R0WH 4UILL 1HIML 3VWJB 1I8IB 1M2OA 1DBAL 3A47A 2ZOOA 1I3UA 5CJQL 5KVEH 2DAVA 1D5IH 1Z32X 2UYLB 1KBVA 1WZAA 2A1WL 1JPSL 4U1LA 4QWWC 4IEFB 3BE1H 4PJ9A 5FWQA 2BOLA 3TT3L 4JFFA 4KKBD 4LCWE 2HVKB 3IGKA 2JF1A 4QGTA 4EN3C 2P80D 4XP5H 1TU2B 3LKPB 3M1BB 4AQAB 5B7FA 1QA9B 4PHZA 4ZXBC 3PWVB 4MJID 5D9SB 2VNCA 3LD8C 4LVOC 4G6FB 3F7YB 1BF8A 3IWVA 2NY1D 5KSUB 3L4VA 3K6SA 3EYSL 1WZMA 4CVXB 2VDOL 2Y7MA 1FG2B 3ZZSA 4BE6A 1A7RH 5F9WC 1I7RB 1I7TA 1EHAA 1UQSA 4KJQD 3B8SA 2VDKB 4JRYA 4L1HA 5E1AB 1TVDA 3D4GA 1RULL 4LKXB 4XP9H 1QATA 1J12A 1E50A 1Z9SA 1UB5A 3QZLA 3UTTB 3C5JB 4MDIA 1MRDL 3QI9D 1QBMH 4K55A 2NCEA 1NMBH 3UX9B 1D2PA 2YA2A 1X5GA 2GTZA 1R17A 2UUDK 1LVEA 2XTSA 5JW4M 4DPCX 2IQ9H 3HPLB 3RFZC 4M3JA 5I8EB 2WXMA 4YSEA 4WKXA 4HEPG 5CBEA 4QI3A 4FZEH 4KOCA 4EAEA 1BZEA 3L4YA 4XX1E 4B0MB 4N87A 3LXAA 4OZHA 2D2OA 4HCRH 1XTLA 3MJGX 2DWEB 3MUJA 4HUXB 4H20L 4OFYA 4N85A 4Q6KA 3WNMA 4OCMC 3RIAF 1WCQA 3ZDWA 3VGHA 2GJ6A 2F8VA 4L4JA 3HR6A 2WKOA 3ZO0A 4Y4KC 4HPHA 5D7SL 1AS7A 4JN2B 1F86A 3OZ9H 1V7MH 3JT2A 3CC5A 4MJ2A 3POCA 5EU5A 2VLRD 2HVBA 4CMHB 4PREA 4ZQTA 1F1AA 3X1GA 3VFNA 4AQ8A 2NW3A 3D69B 3E3QE 3RPIB 4K9EC 5D6DC 5GS0L 5FYLD 3L13A 2G3ZA 3P40A 4WCYL 3B34A 2D03H 2YPKB 3A4EA 5JW4Q 3QORB 2BSBA 3L3OB 2WYTA 2R15A 2IH3B 1QQDA 4Q97A 1D7CA 4WV1A 3IT8D 3ELQA 3LZRA 4QAMB 4XWOC 2Y36L 1NBCA 3FO9B 3KNBA 1EV2E 4BZ2A 2QADC 4WI5A 5H37G 1F6FB 1BEXA 2VXVL 3FQ1A 1TQVA 2TRYA 4UTBL 3B7YA 4DETA 4L8SC 2J5LC 1CICA 3SDCB 5KSBF 2CSPA 3GIZH 2A9NH 4FQ1L 3ETTA 3VI3F 3MMEB 3DVGA 4JO3L 2EE2A 2QJDA 3CFKA 3OKMA 4GIOA 4RGNB 1NLDL 5CO1A 3U30B 3L9RB 2QVIA 3DMMC 2H3NA 4FFZL 4XMXA 3NZ8B 5DJYA 4RDBA 1E6JL 1RUPL 4GAYA 1R3IL 4N1HB 5I1KL 5A2LH 2XG5B 1HYRC 3GMNB 3WN5C 3QAQA 3WLWD 1KCVH 5AW0B 4NC2B 3GSVB 3REWB 4DVBA 5TDPA 3N41B 1EGJA 3QDGE 5CJ5A 3Q06A 1A25A 2UZPA 3GSWB 1GHFL 3NJGA 2V2TA 1DVZA 1GIGL 3O0RL 4AGMA 3WNJA 4E2OA 2BSTB 3OLEA 1NGYB 4UZUA 4ZOBA 2B1HL 5EWIL 3S88H 3E6FB 2X41A 4LAQL 1CFSA 3ZQXA 3PG2A 1NC4A 2WBJA 1AR1C 4HK0A 1N18A 3KVDD 4PN6A 4WTXA 5JW3H 1ZWIA 4HULB 2G9HB 1AD9B 1KTCA 2C1OB 1W15A 3GMOB 4PP2A 1BGXL 1X5LA 2AVGA 2IALA 3GI8L 3QEQB 4RQQA 4JAMB 1NOLA 2ZCLH 3P2BA 1DQLL 5D2NA 4L3EA 4YFLI 3SZKC 1FVCB 5E99L 4C56B 3TEYA 5AD0B 4QRUB 3QHZH 3U7YL 4PCYA 4J3XA 3CIAA 1CXLA 2FSEB 1D5BA 4P4KD 5C6PB 5EOCJ 3GXTA 1P53A 2Y72A 2ZICA 5JPMB 5LGKA 2X4UA 4LHJB 5IFAH 3WBDA 4WRLA 4HIIA 1VSCA 4BFFA 4JFXB 3MLSH 3ES6B 3Q2WA 4L8DB 2HJKB 5IV2B 2XLLA 1IAKB 4OZHF 2X87A 3A24A 1L9QA 1O9ZA 5DHYB 1T7VA 2B2XH 3KLDA 4P5RA 4M7ZC 1IKFH 5EORH 5G5DB 2ENJA 3HG4A 4JO5A 4N28A 4KZEL 3N1GC 3K0WA 2WZAA 1YYML 1N0LB 3HE7A 1H5BA 1XZ0A 1ES0A 3N6YA 1KXHA 3D4CA 1J5DA 2WKOF 4Q7DA 4X99A 5I8OL 1ZTMA 4WEBL 4N2FA 1UWFA 5IUCA 2B5IC 1LNUA 3F7RA 3K2UL 3MROB 4JL2A 1XFPA 5FA4A 2IVFC 2DQFA 2Y6SD 3VSQA 1JHLL 2AJSL 2EDOA 4KJWD 3Q0HA 2IDUA 4DZBA 4QYOB 4JANA 5LWYL 1LL1A 2BOBA 5I75B 1JVOA 2FQGA 5ID0A 5K9KA 1RSYA 3B7RL 4NCDA 4P2RA 3T2LA 3VD3A 5JR1L 1P4LB 1S2EA 1JPEA 1BV8A 4CVUA 5I1AA 2FT6A 4LSQL 4F7MA 1WLHA 2AAVA 3MU3A 1DFXA 3L7FA 4FC3E 5PAZA 3CFDA 3QO1A 1K3ZA 5CJ8A 2DB8A 1HAUA 3MJ9A 3MJ8B 2VLJB 2HFEA 4QRFA 4UINL 2CR0A 3U6XA 3CPUA 2QGBA 1BIHA 1M56B 5FW6A 8CGTA 3HS9A 3SCMD 3NSJA 3LN5B 2BIQA 4DGIL 2PTUA 5EFIB 3IAGC 3NIDB 3IE9A 5GS0D 5E70A 4NP4H 3PWPA 5DT1H 5H35B 2IWEA 4F8QA 1QPKA 3M88A 4ZMLA 4EEEA 2MTAA 1BQ5A 3FT9A 4NQED 4X7EC 1ZLSH 3N85H 2YOAA 4R3SA 3VXTA 5EF2A 3FT2B 3MV8D 4UOJA 3KXFE 4MDRA 1Z9PA 1ICTA 2Q87A 2AABH 2CHZA 4Y7OC 5T1KA 1AXSA 5HHQA 3DBXB 3RZCB 4UT6L 4APXB 1IFHL 4HXAL 2H32B 1G7HB 1A21A 1UWXK 3CCHB 1WT5C 2JKRM 1GYVA 4GRLD 3QIUD 2O93L 2EO7A 4BZ1H 1TQWA 3SJVA 1SXNA 3D2UD 3WXVL 5J11B 3UMTA 5I18H 3VFRB 2BJMH 3QHFH 4F7TB 5KJRH 3F6LA 5AG9A 4B9ZA 3WFDH 4U0RC 4F80A 2XN0A 4NO3B 2CE6A 4JRXE 2DIAA 5CEYB 4N0UE 4P5SA 4J2XA 1IE5A 4PRNB 4QRPD 5B1AB 1XL4A 1TJHL 1TZGL 3MYJA 4RFOL 1TTCA 1VFAA 2Q76B 1FE8L 2OPCA 4X7FC 3G5XB 1QPPA 3MBEB 1L5GB 1MEXH 1QLEB 2QL1A 1VAHA 5BOPA 2HLAA 2JJTC 5AENA 4JFQA 1NEUA 3BLKA 3A6CH 4NRZA 4UM8A 3D25A 4XP6L 1PX4A 4M62L 5I26A 3MRKB 5TE7H 3CLFL 3LKQB 4MBOA 4FG0A 4PJ8A 4PQXA 3PDOA 2G4EA 1LO5A 3OPZH 3LMJL 4YPGA 3ROLB 2VMFA 4LCWA 5EHFA 2MSPA 2O5YH 4AL8L 4Z5RA 1K8DA 2OS7A 4LPWA 1DHKA 3PWUA 3O8XC 4LSVH 4PW9A 1F90L 3APMA 3KM2A 4I85A 2P3YA 3QUZA 3IE4A 3SO5A 1MFNA 4QT5A 3P4OB 3X2QB 4PJIF 4ODXA 2Z9TA 1IGFL 3S5LG 5BS0D 3CG8A 4TOYL 4QKTA 1JUFA 4YVNA 3MRIA 1NMCC 3Q2VA 4G7VH 2A6KB 4W93A 3K81A 1DBKH 5HJ3B 3HKFA 2WQVA 5I1DA 9CGTA 1RFDL 4G42B 1H8OA 4XPGH 4MZIA 1BLNA 3GHBL 3ARTA 3OTTA 1S5HB 5AZUA 5LDUA 5E8NB 1TNMA 2D8KA 3DURB 4I0PD 3B8YA 4FX5A 2VLME 4HGWB 2YPLB 2EDLA 4U1SA 1A7RL 4TULL 4WHYG 4HCFA 4B96A 3VM5A 1T2XA 3AVEA 3FYIB 3ZR6A 3MLVL 1SY6A 3QZNA 3F83A 4A6YB 4TVPE 1WA1X 2BVTA 1LO4H 2PYEE 3OHXA 3AM8A 5AVYB 1LXMA 2L7EA 5CSZA 3WFZA 3EFDH 4DKFH 2FGWH 2DLHA 1U8HA 1E27B 2VDRB 3ARGC 4R96B 1N5YL 4RMWA 3B2DC 3GZQA 1MWAL 1U93B 1ILUA 5FK9B 2CLVB 3RIFF 1JV5A 1CT8A 2OW7A 2J56A 4O02B 1UFGA 2V5YA 4M6OL 2JTDA 3LNEA 3WTTA 3E8UL 3O3BB 5KN5A 3LKOA 3D05A 3NP3A 3U36B 3O6FC 1CE6A 5B21A 2NUPB 5CSBA 2GC4C 3MTRA 4NNYB 5GJTL 2OTUA 1EUUA 2NX5B 2ROYA 1HWHB 4YHML 1IC7L 1QSFB 1Z0NA 1CDJA 3B9KB 4J5VA 3BKCH 5DVMA 1UATA 2WLNA 4XN9A 1SFHA 3SGKA 4OM0L 3RL1A 4ZFZA 4GRWB 2J88H 5INCB 2IG2H 3MRJA 4G6JH 3EHBC 4EXKA 3DUUA 4NUJB 1QHPA 2XA8H 3EO1A 5I0XA 3K4AA 1KCUH 1R3JA 3U1SL 5LLIC 4KMTH 4YL4A 4UT9H 4JFDD 1UZ8B 1CFTB 1ZHLA 4YDJB 5A7EA 1OALA 3IETA 1FNHA 1KFAH 2BVYA 4PB9L 2O5NA 5GHWH 1N59A 3BAXA 4GG8A 3CFBB 1X4XA 3LIZA 4J8RA 2A38A 2J8OA 5KEZA 3I9AA 4PCSA 5DUBB 3GXUB 2PCXA 1PQZA 1AQ8A 2BK8A 4Y4HA 2J7LA 3HAEH 4M6NH 1TF4A 3B2VH 1I31A 2HJLB 4Y1TA 1NAKL 3WFEL 4KKAD 3QDGA 1DJWA 5ETUB 2GUYA 5I19L 2ZT9C 4K3EH 5JHLL 3D3VB 2PO6A 3BD5A 2WLYA 4I5BA 1NANI 5F6IC 4BK5C 4EI6B 4YR6A 4PLJD 3EJRA 1DJXA 3TCXA 1DQKA 5HYJA 3KMDA 2BWDA 2BNUB 3ULSA 3RL2B 2AJVH 1ZE3H 2FEEI 2XWDA 5A2BA 5CGTA 2VL5B 3BJLA 2I07B 2NSMA 4UDUA 1PSKL 4TTGA 4K9EL 5J8OA 2CO6B 3EOBB 3X12A 4WWID 5CFAA 1FSKC 1QOKA 3G5YA 4JFPA 3WLBB 4AMKL 4QHNB 4EI5C 5CZXC 3GKWL 4N2NA 1FLRH 1HSBA 1XGUA 2E7LC 1EXUA 3BZ4B 3NH7H 2HG5B 4KAQH 4MLIA 1G6RB 1MCIA 1ND0B 1YEHH 4MLSA 2LHAA 5C0ND 2OSYA 4WVRA 5C09A 5DS1A 2VMDA 4JM2D 3OWRA 3FUHA 4PGBA 4D8PB 5AW2B 3RVTC 5E1QA 5H4YA 2BSCA 1DVXA 4W9FC 1KPRB 3P11H 5E9DE 5MEOA 2YQ3A 1D6VL 3TU6A 3BSHA 1SXAA 3GRBA 3UAJA 3K5SA 4BQ8A 4PPTA 4F7PB 5TGBB 4OCRL 1JZ6A 5IHUH 3E1F1 1S7RA 1I4FA 2EIBA 4KH2A 8PAZA 1CD1B 1KEGL 1H6TA 4QHUA 4OLUL 4E5XA 4AQ1A 3ZL1A 4OJAA 2WAQA 2WXHA 3TFKC 4M1DH 3MLTB 1A2YA 1RJZB 5FV1L 1JWMB 4NN7B 3Q5YA 3DX7B 1K85A 3B6SA 4PCTA 5E5RB 3QNXB 1I8MB 3ZUNC 2AK4B 4LVNB 2ZCKH 1AC0A 5EOCH 5FCSH 2JB5L 2ISDA 1RZPA 3H4FA 1EHLH 2HRPH 2ZSWA 5TDOA 1OF2A 1RURH 2MNUA 2DQCL 4TN9A 5C0RH 2X0VA 1FRGH 4NAQA 2XIBA 1JS4A 2E6QA 3RVUC 1EZUA 2F1AA 4KX9A 4BFBD 1MJJA 1VADB 3OX8B 5T3XH 4W6WB 3GSOB 4QWWD 3FZUC 1INDL 1BSIA 1M2VA 3LEYL 2DL2A 3X11A 3LNFA 2Y24A 2G3NA 2YMXH 1NC2A 4WUUD 3L5HA 4AMWA 4LRIA 4X4YA 4GT7A 4EN3D 4OKVB 5LHDA 2CUIA 5IW6A 3L3HB 3ZMEA 1DQDL 2WUCL 3RI5K 4NENB 1JPGA 1NCCH 5AZ2L 1GPOH 1S7WB 3N0PB 1N67A 4XE0A 2VO5A 3X3FL 3QFDA 4WJ5B 3HA0A 1AVAA 5AOIA 2F58H 2OZNA 1IILE 1KJ2H 5I76B 2PABA 4I48B 4ACTA 3KXFA 1G7IB 3IJSA 4PJEE 5FDYA 1G7PB 4PJ9C 3ZQWA 5C0CE 1A9VA 5EEUA 1PYWB 4MXWH 1I3VA 1OCWH 5MI0C 3GGWB 2OMYB 3D5OF 1ZLSL 3TH4T 3TJPA 2RACA 5ITFB 3DARA 4EMZA 4QGYA 3UPRB 4AGLA 4D9LL 3DBSA 3MRPB 2KUTA 3I6GA 1MQKH 1RHFA 3P4NB 5IUSA 3MXVH 4IRJB 5CGYC 4F33A 5MEPB 1AR2A 3KG5A 4JRXA 5C71A 4O2EA 4YGVA 4N0UA 4R97C 3DX0A 5BPPA 4U4IA 5HPOA 1YEGL 4E68A 5GGSY 3A4FA 2FJGA 2NUTB 1EBPA 2IFFH 3GJFH 5ISZB 5GGSA 4A7UA 4ZMYA 4D94A 3TCLA 1KC5L 3IPFA 2C5DC 3BZEA 2IPKA 5DHXB 1X5MA 3PNWA 4FF9A 4KROB 1CR9H 1Q1JH 4AEIH 3RWFB 4KY2A 4CW1A 3UROR 2AJXL 1C7SA 3FSWA 4ZFOL 4Y4KD 2X89D 1LP9B 2CDFA 4M7LT 4R7DA 5C07D 4BKTC 1YNTB 3QT2A 3TBYB 4WGKA 4FXTA 4AE0A 3BP6B 4K3HA 4OZGE 3VDAA 2ADYA 4N2IA 2GQHA 3BPNB 4U1GB 1EERB 1MEXL 2YC1A 4KNQA 3UTSB 5SWQB 1KELH 3LQZB 1VGEH 5SWZB 3IDYC 2X44D 5EG6C 3K7UA 1YEEL 3KBFA 4YFLF 4G8GD 3ARXA 3KLQA 2F53D 4XCYB 4X9HA 3QULA 2BOCA 5AW7B 2NXZB 4LGSB 2DI8A 3EGXB 1FZMB 2K4WA 1YNKL 35C8H 4XO8A 2ZPKL 5DEFB 3QDJD 1XL6A 1WO2A 2GABA 4XWOD 1KCSL 1QUPA 3L9EA 3GMPA 1KBGL 2QADD 4ZUTA 1IVLA 3G6DL 4YDKL 3FRUA 1OAQH 1KJVA 3QUMB 2J8UA 2JNZA 5ALCH 4P46A 3IJ9A 4OGYL 4AQ8C 4XNMB 3UGEA 2F15A 4S1SH 4O58H 2F8OA 2VABB 4XPGL 2F5AH 2VR7A 4OLVL 3BIAX 4HXBL 1XH3B 5E8DH 3BPCB 3BCFA 3FO2A 4OZFH 1CXEA 4I2XE 2H5UA 3DMMD 4GP4B 5EBMB 5ICUA 2Z8SA 5IMKA 1MAKA 3DOSB 4WV1C 1MWOA 4MA1C 3MRGB 4XVOA 1CG9A 1ZT4B 2A5UA 4B9YA 3IDXH 1FPTH 4Q0XL 1U33A 1QO3A 1XQ4A 3GMMA 3P69A 3FB5A 1RIUL 1XX9C 4GFTB 4EUPG 3WKQA 4HMCA 4E9QA 1OCOB 3TYFA 1CICC 4M02A 2ZD0A 5CP3H 2ZYSA 1A7QH 4I18B 4HKBB 3L5WA 4BKLA 3QQXA 2BP8B 4UM9A 1S7TB 4JPVH 3TS8A 3NBNA 4ETQB 2G5BA 1EAOA 4LDOB 4Y5VA 3GB7A 3R06B 3OKEB 5BZZA 4EDXB 1NFIA 3PAYA 4MVBC 2P7TB 1S7QB 3PP4H 1AR1D 2AV7B 2JQAA 3ILEA 3TNNA 4N1EA 4LCVA 5HYQA 3QJFB 2XY1A 4R4BB 1FNEB 2NDGA 2CGZA 1IGMH 3T1FA 3CLEL 1E8XA 4QY8B 4IKNA 3EYUL 3ESOA 3PGCA 1P7KB 3UBXG 4ZYKA 1YJDC 4UB0H 2DM4A 2ZJSL 5IOPB 1VFMA 3MUHL 4KXCA 3S35H 1NICA 3CXFA 4U6VL 3ZKMC 2FR4A 1DVFA 3ZTNL 2XX1A 3D4ZA 1INEL 2VDNH 1ZHBB 4HYTB 5B7EA 1A4CA 4WFED 3BZDA 1OW0A 1P7QB 1RZGB 1R24A 4KNTA 4AOFA 4ETYA 1EJ8A 1A47A 4MA8H 3ARDA 2WBJC 1KB5H 4YDNA 1DLFH 1FVDA 5AALA 4E9WA 3EJTA 4ONGH 5BZWB 4JE0A 5BRPA 1CFVL 2XZZA 5CLTA 1G9HA 5FYJL 3CMOL 4MZRA 4I9WD 3IVKA 2ORBL 4PLKC 3TF4A 4WLCA 1BQUA 3ML9A 2A73B 3QQDB 5DLLA 1NEZA 4QD2E 4AUUA 3Q9QA 4OFVA 5D2NC 2WXLA 1XF5B 4P9MH 3SN6N 3SPVA 2HRLA 1ZV9A 5IGXH 1TZAA 2OMUA 2R4RL 3RNQB 1ACYL 3C6LC 1SLXA 4M7JH 4HCIA 1A7PH 4G59C 1GS8A 3BO8B 3BP7A 4E42A 4XXCA 3WFBH 5KTEL 2Y5TA 1ZTXL 4OB5L 5DD1H 2E8YA 5CD5C 3H55A 4QPEA 4BXVA 2X5PA 3BT2L 1H3TA 3Q05A 4XAWH 2P28B 3HE7C 4G82A 1H5BC 5CGBA 3B3IA 4P3WA 4FNTA 2B15A 2XVLA 4ERSH 5IEHA 4WNQB 2D31A 1TJGH 3LY6A 1L9SA 2CA3A 2OCJA 4EZJA 2J57A 2CKBL 2R1WB 3VX0A 3DX2A 1CIDA 1UH3A 4N8VG 4XP1H 4GINA 1ORQA 2YWZA 1KWKA 2J8UF 3MV7D 1R0AH 1T1XA 2HYMA 4P2OB 4Z7NE 1UT1A 5EU7C 3MJ7B 4KHTH 5CJXA 5E9DA 1X5HA 4HIJA 3OAZK 1MFBH 2XPYA 4N68A 4WSGA 3MA7B 3N44F 2IAMA 4OSUL 2FO1A 4G7YH 1QSEB 5GIRA 4ZNEE 3LEVH 4G9FB 4IU2A 4DZ8A 1JG9A 5F96H 5DO8A 4FQIL 4ODVH 1BAFH 3UTPD 3C9NA 4YFEA 3BXNB 3OC5A 5FOJA 4BH8B 1GH7A 3VFMB 4PJDB 4OGXL 4UAHA 3SQOL 1EIBA 1ADQH 1IEBB 1MFVA 2WCPA 2XVKA 5DTFB 4ZT1A 4HUVB 2W8CA 4JO8A 4PY7B 2ZXQA 2WZ5A 3KYNB 4AVHA 1WSST 5TH2A 1TMCB 4QF1B 2OX5A 5DGQA 1R34A 1KYAA 3TPKA 1AXTH 2FHFA 4FQ2L 4TLUA 1QFWM 3LQAL 4KTEH 2WLIB 1D7BA 1KDJA 4X9BA 3ECBA 1QVOB 5C0DB 3EOYG 2DIEA 3ULUE 4NSKB 3VXMB 2HX8A 4JKMA 1G5GA 4KUCF 3KPSD 1USQA 4N20A 4MX7A 2LLNA 3AAZA 1HFUA 4ZQKB 2VRKA 3DX6A 4YHIA 1TSHA 2F54D 2WZPD 4X9GA 4GW5B 1BREA 4NQCE 4L8CB 4TPRL 5I16A 5IVOA 1SMAA 4LEEA 4YIQB 3FONB 1CWVA 3OGCA 4YPJA 1WA0X 4Z7AA 1NBZA 3T0EE 3QEHA 5IB1A 1FFPB 2CO4A 4QHKJ 5T3XL 3WKPA 4KFMA 4NRXB 4PLNC 5GSRB 1CF8H 2FWSA 3WFHB 4XH2A 2JFCA 3ETSA 4U1HA 5FFLA 5KG9A 4XTRC 3ULAB 2AJZA 5DJ0B 4JFEE 4XPTL 3DUSA 4LF3A 2GUOA 3H3PH 4PJEA 2OA9A 1J8HB 3II1A 4PJ8C 4XX5A 2YAMA 1DO6A 4AV0A 1IGYB 2F18A 1JWUA 3O3UN 4UMGA 4J3UA 5D7KE 4XCFH 5KJ4A 4H4NA 4LLQB 2BHUA 3RQ3A 2QSCH 3DVIA 4P3CL 2XIIA 1CYGA 4QRRD 4FKKA 3QUZC 5CCHE 3IB4A 5HYSA 2WXQA 4M03A 3BUIA 4WWKA 4WK2B 4ADGA 2GJZB 5FYJD 4A63A 4YHLL 3QXVA 5AYUL 3SY6A 2ZYHA 4R5XA 4FLSA 2X0UA 3ESUF 2WKGA 1TZIA 1QFUL 1BQHG 1KGWA 4G6KL 4PRDB 2IPTH 3UJIH 4L3CA 1W2KT 1IKOP 5E08L 3BAIA 3RWCB 1ED3B 1W8NA 1UWYA 3RUGB 2R0KH 4YHPB 1JGDA 3HMWH 4JJOA 1DSYA 4APQB 3ARGD 2QSTA 3PAUA 3HC3H 2X9XA 2OI9C 1DVQA 4MNQD 2CGYA 1MCOL 4Y4FB 5AVZB 4OZGA 1IMHC 3HNTH 2CLRA 1J9CT 3GSNB 1VESA 5CM1A 3O6FD 5AWNL 3SDDA 3FQTB 4IRSA 3OHXC 4MB4A 3AM8C 4XXWA 4NX0A 1FO0B 2WW8A 4QCIA 4YQXL 4FFTA 4FXLA 4RWYH 4BCYA 2Q3XA 4KMQA 1E5BA 5LN4A 5E2TH 1BJ1J 3ZT6A 1GC1C 5H94B 3EHBD 3P30L 3SYQA 1J1OL 1V7NL 3QIWA 4ZSOB 1JBJA 2YD0A 5JUEH 3JTSA 2Y1VA 3CFCH 1BIIA 1MHPH 3LPFA 4K3GA 2IMMA 1UD4A 4PWIA 4XCNB 4Z7UB 4YSOA 3U7AA 2KYIA 3UO1L 5B8CB 1KULA 3C60B 2G3XA 5EN2A 2IDTA 3V5HA 1D7DA 2B0SH 3H7BB 1A3LH 2J55A 3QJHA 3STLA 2EIMB 4QHLB 2C3XA 1CL7H 3HI6L 3E3QC 1IL1B 3VFPB 4S11A 3PLYA 1T7XA 3KLHC 1I53A 4QJ3B 5I1LB 3SGKC 1F11B 1OO2A 4EI0A 4BZYA 4QXVA 4BE5A 4I2XA 4ORZC 1P5VA 3SOBH 1XD0A 3PNRB 3WEXA 2X1QA 3CBJB 2IXQB 4XB3A 3TIEA 3FQXA 4DN4H 4L4TB 3FN0H 1PKQE 5AVTB 1TJIH 4LCCB 4NWTL 1JD9A 5E7BA 4B9JA 2BWQA 2WYIA 5IMLA 1U95A 3C6EA 3EYQC 1VIWA 1CBVH 5DZLA 2E27L 2MFNA 3HBPA 4XMKL 1ZLWK 3RX8A 3QEGL 1Z1WA 4ZO8A 2Q8AH 5ICYB 1W72B 4Z7WE 1MRFL 2PYFA 3TV8A 2VDKH 2V7NB 3BVWA 2CM5A 4IBLT 3BZFB 3MFFB 3ZGHA 2GEQA 5IB3B 5I6MA 3OAYH 4C4KT 1HHHB 4Y4HC 5D96B 4DGVH 1TETL 3WUWB 1OAKH 4P48A 2D7TH 4PD4J 1EXHA 1SDDA 3HC0A 2XWCA 2V9QA 2IOMA 4PJEF 4GAGL 4RNRB 2CGRL 3OKNB 3ZDXB 4AJVA 1U6AH 3PY9A 2YAFA 1Q9WB 3EFOB 4AYBA 5K69A 4JRWA 4XC1H 1U2YA 1T66C 4G71B 5DS8A 1OTSC 1BVNP 4YX2H 1QUNA 2Y2YA 4LIQL 3FUMA 4EI5D 3DGGA 5CZXD 1QNIA 3O3DB 4D0DB 2YD1A 2PO6C 5LQBL 5HVFB 3G5ZB 5IHZB 1GSKA 2UZXB 3FU5A 1IGML 1WZ1H 1XF3A 1QW9A 5EZOH 4FXKA 1DVUA 3Q8EA 2GY5A 2K7PA 4MA3B 2GAZB 3RVTD 3UTZB 1T5XA 3HIZA 3FBKA 2AV1B 1F42A 4AYDC 1T21B 5FYJU 3LZLA 2E0PA 4W4OA 1URZA 3VE0B 4HQQL 1IC0A 1HEZA 1DJZA 3PV6B 2OL3A 4DOHB 3LKSB 1PGRB 2V9TA 1NCUA 1VFUA 2IMNA 4LPCA 2UY6A 3FJTA 4OY9A 3QG6B 3KBPA 5KYXA 2PR9A 3WL9B 3NUKA 3TFKD 1LWHA 2AERT 2PW2B 4OZGF 2VXTL 4EDWH 4POZC 3K1DA 4LFHG 5DVNA 5E8PB 3W0WB 3QDAA 5C92A 1D5XB 1SN0A 3DYMA 4TRPH 1DL7H 2XV0A 1WAEA 5C9JB 5I24A 4FNLH 5KBDA 4MAUL 3MREA 2EVHA 1Y1UA 2X7LB 3N40P 1QR4A 2YXVA 4XPFL 3UAJC 2AS5M 3BGFC 2NXYB 2R27A 4JFHE 5DRZA 5BV7H 1T2JA 3RVUD 3OL2A 2WXIA 2Z31A 4LQFH 3GTNA 4E9VA 1IGTA 3P54A 4QRSB 3DV4B 3QUKA 4KI5E 3UYRL 1HU8A 3CVHA 3FZUD 1LYQA 3UJTH 1F4XH 2WQAA 2FTAA 3KLAA 2I60L 1XXFC 4X4XA 1ETZA 2FJUB 1EGJL 2ZKYA 4ZS6C 1YJDL 4LBEA 3HCVA 5JQHC 3CZUB 3OKOB 1WUZA 3AUWB 1CDCA 3BKYH 5T5FH 5T5NF 4C57C 4PJXB 3MI6A 3VFWB 4EZMA 2CIIB 4HU2A 2W9DL 1T03H 4M1GL 3GM8A 3E7JA 2H3XC 4JG1H 2VRAA 4WO4C 3DHUA 5B22A 4D0CB 3DROB 2FLBT 3E2HB 1KTDA 2JK5A 2CH8A 2NY4C 1NDMB 4PJ9D 2ICES 5GZOA 4ZNEA 4JFFD 5GRWA 1P84K 3AROA 3ECQA 1SUHA 3VFVA 4W9GC 2BSRB 2QMJA 3BDYL 4HFUH 3A6OA 4FG4A 4LRIC 4UDTB 4YSSA 1IBGH 4J3SA 3KAAA 1XGRA 2ARWA 1RAMA 5E94A 3IDMB 1ET7A 1SBBA 4PSPA 5AOZA 5F7YC 3ABLB 2YFNA 4LPUA 1HOCA 5KVDE 3RGBA 1RJYB 2ROXA 1JFQL 2EDHA 4HUKB 3STZB 2NRDA 2JIXA 3FO0H 3GS4A 3D9AL 2PCPA 3MCKB 5DMIL 2A9BA 2ED8A 3VFGL 4JRYD 3F6IA 4JZNA 5DVKA 1MCHA 1Z9OA 3FRPA 3DSNA 5SX4I 3AFLA 4DPBX 4F8PA 3WE6B 3VXSB 2C4XA 5IVXA 3DK0A 5MERA 3MLXH 2X2JA 5JHMA 4DKDC 1YNLH 2EZ0C 2QKIA 1NUFA 4NQCA 5CLXA 1BCIA 4NO5A 4ZMAT 1L9MA 3FPYA 4N8PA 3LRSA 3V0IA 2GI0A 3T0EA 4KJYB 4YDMA 2PPDA 2OJZL 1RZ8B 1RP9A 5CZRA 5B3NA 1UVQA 3FFOA 4JG0H 4MAYA 4U0QB 4ZUSB 4IDJL 2W60A 4OFYD 1N6QL 5CD3A 2AQ3A 2F19L 5L4MA 2ZWLT 1JVKA 4P2QB 4JFEA 4KXAA 2XQBL 2GJ6D 2P5WE 5I74C 4FCHA 1F4WH 3ZGIA 4AYSA 1PZ3A 1CLOL 1SHSA 3MJ9L 4EIZC 1DQJA 4FXGB 1OGPA 4P5TA 3GO1H 1ACCA 2GCYA 3I9IA 5LNEA 3BN3B 2B1AL 1N8ZA 1XF4A 2W65B 1NGPH 3FQWB 2LE9A 4KKLC 4N0YH 3P0YH 3I9PA 1DBBL 3I2CH 5F70A 3DPBB 5E4IA 1FCGA 5DEGA 1SJXA 2G5UA 3F12A 3FTZA 4XOCA 4Z23A 3HR5A 1O9WA 3AU1B 3GSXA 4S1DC 5E00B 3SD2A 4F24A 1EAPB 5HDQH 2CDEA 2P8PB 1ET8A 3UJJL 5EIVA 1R5VA 4M4RB 4IQHA 2Q86B 3LVEA 3FU3A 4DF9A 4J6RL 1DLHB 1NUNB 3JUZA 1BJ8A 4YXHL 3T3PE 3RWDA 4CDGC 1SUJA 2XNAB 3OMAB 2YSSB 2Z34A 1IX2A 4P46C 5DD5H 5DVOA 1CICD 3HZMA 3ZE1E 2KMWA 4MMZB 1Z9NA 4K7PX 1AE6L 3HRZC 1MAMH 1MVUB 2G2RB 1A6VL 3SE9L 4R5VA 1TVHA 5TPWL 3U1PA 1UH2A 4Z7NF 1EZLA 2BRQA 5G4MA 5D2LA 4U1NA 1T0MA 1BZ7A 5PCYA 2BY3A 4MD0A 5DJZB 3F7LA 5ILTL 3ZT7A 2X6AA 4NQVB 3U46B 4YWGL 4BFKA 5HGHB 4G43A 1F18A 4L18A 4NIKB 1NKOA 2CJSA 2FUQA 4HPOH 3P4LA 3ZKMD 3VW3H 5BVJA 1XB6A 2YRZA 3VH8B 3VFTA 3UTTE 1K6QH 1UH4A 3A3YB 2NMSA 2C34A 2NCMA 1QI5A 4IKIA 3CZFB 4PUBH 4Y5XA 4Y5VC 5BJTB 1QLEH 1OANA 3ULVH 1J7VR 3MBWB 5TK4A 1NC4D 2UVFA 3DA0A 2AF2A 2WBJD 3C5SA 5EC2B 4UNVA 4HJ0C 3OLDA 4MJ6A 3H2WA 4NZTL 3MSPA 1KGCE 1VENA 1MHPL 1HYSC 3FCSB 1OPGH 5E0QA 1FZOB 3KPMA 4WJKB 1E5YA 4EBQH 2Q6WA 2CJ3A 1CXFA 3IU4H 4PHXA 4RMQA 1BJ1H 5D1ZB 2A6DB 1B0RA 3MRMB 3NAAL 4L3ED 1PKQA 2QT6A 3MC0A 5IVXF 5JOPD 2QQLL 5IOKA 4IRZH 1DVFC 3QDME 5D7IE 1ASPA 3QW9A 5C0EB 4YZFE 2IBZX 5GGTH 1SN2A 1OW0C 4HD9A 5CLYA 2OJEA 3ARDC 5E1IA 4GW4B 1IJ9A 1ZGLM 5IJDC 2YMOA 1YEFH 4QOKB 4YK4C 4Z7WA 3QH3A 1ITBB 5AOMA 5K33A 1OCZB 2EDYA 3EF7A 5CD5D 2RQ8A 3P77B 4L2YA 1SY6L 1TUPA 2LAAA 3JVGA 1TQBB 2K9UA 3PP3H 1SOSA 3SBQA 4D9QE 3HE7D 3DRTA 5F7DB 5E7FA 5AW9B 3F58H 5DVPA 1WBYA 1F13A 3QYMA 1NGQL 5IB2B 4EKXA 1KN2L 4IDLA 4QXTA 4I77L 1VGKA 1GC1L 4AYGA 2P43B 2PXYA 1XD1A 3MXWH 1TITA 3OJ2C 1DSWA 1HHIA 4J27A 3D39E 1AGCA 1OAKL 3GRWH 2OP4L 5F3HA 4XXCC 4YXLH 2X6VA 1KLUA 2W1NA 5HGGS 4P2RD 4QO1A 1ZVSB 1HE8A 4P8QA 1TPXC 3F84A 4HU8A 2EDRA 4K3DH 4U7MA 1RK7A 4DW2H 4R4NC 3KPRE 4CILA 1ZT7B 1EVTC 3S3CB 2VDRH 1GGUA 2B16A 4MCZA 1FL5B 1QLFA 4LRNH 3NQKA 3TH2T 3GLDA 1WCBA 3BGAA 2E7CA 3HG2A 3V0VA 2Y1ZA 1XWVA 3HMXH 5AL0A 3BQVA 4GQQA 2VDML 3DJRA 5EZOL 3UAAA 4BQBA 3I3EA 2VITB 2H9GB 3IPBA 3AMKA 3IS0X 4Y16A 3I6KA 1FN4A 4IJ3B 1FA4A 5EBLB 4IOSA 5CEZH 1YC7A 5J4MA 3VMPA 3PWPD 1U8IB 4OZIE 2HT2C 4FABL 1E65A 2L7QA 3K46A 4PRAA 1XH0A 1DCEA 2ZOLB 4GRWH 3VRIB 5TDNB 2GTWA 3MRRB 5K9JL 3ZLQC 5CJXC 5LVEA 2QELA 2HX9A 4LQ1A 3DLQR 4N1CA 4CMMB 4W9HC 4GG6B 5D2LF 5FGRA 4DESA 1BQLL 4EVNB 1NCAL 5T1KD 3LIZL 2IAMC 1MSPA 1RZIA 1WQVT 4OUOA 5HXMA 4N26A 1YVLA 1GTNA 2HWZL 3NCJH 5FCUL 4PJ5A 1AZNA 3MA9H 5CP7A 4NNXA 1J88A 2YARA 1M71B 2A77L 3EDFA 3BLBA 3SJVD 5I8KL 3EZ8A 5E5MA 2PN5A 1L3WA 3EJQA 5D6CB 4CN4A 2ZUYA 4KZ0A 3CXHK 1KBBA 4ELKB 2J4WH 1E8ZA 2AQ2A 4Q74A 5T1LA 3VXNB 5EUOE 3UACA 5IEKB 4YXKH 1FZKB 3G6AB 4M00A 2WP3T 4DFIA 2ITEA 4OCYL 4X5PA 5BV7L 1QWUA 3IDIB 1QLRA 2C9UA 4BFIA 4C56E 1XCXA 1AANA 5F89A 3HI5H 5H2BB 1E40A 1IC5L 3BUBA 4MMYA 5JW5B 3IDJA 1BXUA 2AJYL 1KLGB 5GS1B 4XMLL 3W38A 3WIIH 3NSDA 4RMTA 3I02A 3D0VA 5E6IB 4XTRD 5DVLA 1XV8A 4P9HH 1O75A 2VXUL 4XOBA 5JHDE 1XCWA 3JV0A 4H0HB 4U1IA 4PJ8D 1P6AB 4LCWD 2HXAA 3EF4A 1KIQB 4JPKL 2ZAGA 1MLCA 4G8IB 2W94A 3QUZD 1AD0B 3KJ4C 4KO5A 2ZCHH 3N2JA 4XNYL 3V4UH 1I8KA 2E8ZA 2FBRA 4Z7WF 1U3HA 2XDHA 3H2QA 4ZJ9A 1S4IA 2Q8BL 3L1OH 1WIOA 4AZUA 2KZWA 2YUZA 1M05A 7FABH 3UC0L 1G1KA 4OCXL 5EEYA 1EO7A 1JNLH 4OZ4B 1L7IL 3BDBA 4UNTA 2CRIA 2DQIL 2IOIA 5CCGE 5F9DC 3VX1A 2LU7A 2C4FU 4I0KA 4DK3A 1XR9B 3VRJB 4NHUA 3CHPA 5AKSA 2XQ0A 1EJOL 5DUMH 1FAIL 2W07B 4ZZFA 4WWKC 3VGAC 3UYPB 2X88A 3KWWA 2WQSA 3L16A 3AQYA 4EKJA 3O2DA 3RIAK 3FN3A 3IF1A 4U6TA 5BO1L 5HTSA 2WOYA 2EDKA 4N2HA 3VO0A 1YNLL 3T65B 2ZWSA 1ZEAL 5D1XE 1M7DA 4U3SB 2FX8H 5K1VA 1QFWI 2I9LA 3CBRA 3ZZQA 4E41E 3BAKA 1U8JA 1K8IA 2VM9A 1BBJA 2P5WA 3D1MC 1JTPA 3KR3L 1YQVL 2CWRA 2GJRA 3GK8H 1A7NL 4U1JA 1RJCA 4OFKA 5DC2A 2GSGB 2IGFL 4F37F 1AKJA 2NNAA 3JV4A 4X7TB 5F9OH 2WANA 1BEYL 3DNKA 2NTFB 3BKJL 5T8IA 3B7UX 3SDDC 1RHHA 3HJEA 3V6FB 3ZO9A 4ONHB 3F7KA 1CI5A 4IRSC 3HW7A 3MGTB 2VM3A 3V5DA 3IFNL 4XXWC 5FDWA 5HJBA 1R3HA 1PZ5A 5I0WA 4L5FH 2AEQH 3E6HB 3KPQB 1IAOB 3KLHD 1HS6A 3IWUA 2X1OA 1BX2B 1ORSB 1OTUC 5DUJA 5DRWB 1L6ZA 4X5QA 3OC8A 3QIWC 3B9VA 2DLIA 1UD5A 3LN9A 4JCLA 4L9LB 4ODUB 5FO9A 3KZ8A 1BD2E 1EFXA 4TQ8A 3N06B 5FUZL 2VW6A 1U8LB 1KCLA 2O4EA 1I1FA 3HUJB 4X5RA 5GPRA 4RIRA 5FM5M 2C9VA 2JELL 3IXAB 3EYQD 2X9WA 3UTOA 2I69A 2UYLA 2ADIB 2D7NA 1KGXA 1F8TL 1AZCA 1B90A 1GA2A 3V0AC 3BIKA 4J3OH 2G3MA 1EEZB 4TUKL 1GMIA 4UUJB 1AQMA 2WZ6A 3NABL 4NCC2 4NN5B 2XI9A 1KBPA 2HVKA 3OLIA 3X3GH 5C0BB 5HHOB 4MJ4A 4JR9L 3V6OE 3LKPA 1JZ5A 5HGAA 4YHNB 1QA9A 4PJCE 1MFEL 5DJ6A 3QSKB 1I1RA 3QB7C 1CN4A 4Y4HD 5D9SA 1BJMA 2BRRL 5F7LB 1AJ7H 2D7OA 5L9DH 3U0WH 3QR2A 4Q9BA 2E46A 1AGEA 1MAML 5IMOB 1BDYA 3DIFB 2ZXWB 3MO1B 3NTCH 4JNXA 2V8LA 3HG5A 3JXAA 1T66D 1KSRA 4FG6C 1OTSD 3QDGD 5FLVA 3QK0A 3C2AH 4CVXA 4WKZB 3RZWA 2OSLB 3VDBA 2PO6D 4OD1H 5TE6L 5LBSH 2EKSA 4H7VA 3UTTA 1DUZA 2QQNH 2Y3NA 3JWDC 5HYJD 4AEEA 1J0YA 4BQ9A 4ENEC 4DGYH 2ESVB 2R39A 4ZMXA 4AXWB 4JGNA 4GPVA 2YPLE 5IHHA 1FFNB 2F1EA 4HWZB 3RKPA 3DX8B 5J56B 2PCFA 4HV8A 3MRFB 4DEPC 5EEZA 4ZUWA 1PTZA 5F6HJ 3QPXH 3RGVB 2CXGA 3RVWC 4N3TA 1NH6A 5GGRY 3NACL 4BFNA 4ZUVB 5GGRA 2YLKA 4HUXA 3QDMA 2X4OB 2AQTA 2X6MA 2VQ1A 4MJIB 5F7BA 2Q10A 2FGZA 4E9RA 3WTVA 5EDSA 4AV4A 2K6YA 4FXKC 4POZD 4NM8L 4EE2A 5C09D 2A83B 3MLRL 2Y22A 2J1ZA 1CE1H 1JK8B 4HT1H 1HCFX 3OXRA 1WEJH 2ZE0A 4JN2A 4MJHA 3M46A 4IHBA 4S1RL 5C6TH 4ZI8A 1SXSA 3WEBA 2BS8A 2H1PH 4ZMWA 1AGFA 3UAJD 4OQTH 4W4OC 4LSUH 4GKNA 2Y7SA 1PKOA 1LEGB 4TVPL 3D4YA 4YNYB 2AK1H 1MCWW 2BMKA 2VUYA 5EZLB 1U8OA 3FTXA 2AGJH 4EIBA 4J1UB 3QI9B 1MNUH 3MCLH 2YPKA 2JJSA 2XTJC 5EOTB 4BBWA 3L3OA 1C5DB 1IGJB 1HXKA 4ODTL 3LH8A 3WKML 1XDTT 5DC4B 2VC2B 3D39A 2P4AB 5BOZG 1RZFL 1E9PA 1HH6B 3NN8B 1EO8H 4YHYC 4IBTA 3SGEH 5B1CA 4ZS7H 3S5ZA 4Z3FA 4GMTL 2WHVA 3KPRA 2GBUA 3BWUF 5D93C 5KS9B 5KSAB 3DTUB 2Z31C 3CHQA 2FL5B 1ZPUA 2K8QA 3SPJA 2R29H 4WO4D 4CU6A 5JXEA 1ACXA 1QBAA 1Q38A 2GW5A 2WWKT 1RH8A 2NY4D 3LKRB 3S0PA 1G7QB 3Q44A 3L5IA 3IRCA 1DJGA 1IGCH 1QEWB 1ZS8A 1NC2D 1C7TA 4ZOCA 4JPIA 3T3PF 4E5XG 3OZKA 4WO0A 3NFNB 3II2A 2WTRB 4NWUH 4FJZA 1C1EL 2XG5A 4OZIA 4MNGB 3ZE1F 1OD7A 1N70A 4FDWA 1ZSHA 3GSVA 1LDPL 4JY4A 2V2XA 2PUQT 2JCWA 1GY2A 1ZV2A 2E75C 2DBJA 3FYEB 4HJSA 4DN3L 2ADJB 2H6PA 2G2NA 3D3VE 2EDBA 3BPLC 3KXFD 4UQ3A 1TTUA 2N7BA 4AK2A 2Y2WA 1NGYA 1SVBA 3CH1B 3SE6A 1S8DA 1R3LB 3ME0A 1Y18B 3E6FA 5A2AA 3MODL 1FP5A 5GZOC 3EFFB 4OCNC 2DQDL 1Y7VA 3ETBJ 3SE8H 3JV5A 1HL9A 3PPSA 3F7VA 1FNSL 1I7UA 1I9JH 1FHNA 3J7HA 4LOUC 1I9RL 2GK2A 2XUWA 3AC0A 2EZ0D 1OE2A 3GMOA 2UY7A 1TQUA 5DURD 5EUOA 4KXZI 2C3VA 2ZKXA 3QZPA 4JRXD 4RISL 4KDWA 1UTDA 1JN6B 4IMLA 4C56A 3SIKA 1NBYB 1BMWA 3JWOC 2H8PB 1KMGA 1G94A 4QRUA 1OE3A 5LGHH 4V1DE 3L95B 1MOEA 1EMTL 2FSEA 2XHNA 4PR5B 1HCVA 5I1JH 5IIEB 1IAII 3PGFL 3D52A 1HHJB 2DQJH 4ODWB 3LPPA 4TLSA 5IV2A 1UJ3A 2KT6A 3CH8A 2HVJB 1T2QL 2GBTA 5DWPA 1A1NB 5DHYA 3QNZB 3ISWA 4N9GA 4XMPL 5ESQA 3ENEA 3DPDA 4YBQD 4ZFGL 15C8H 1P4IL 5DHVA 1F2XK 4YZFF 1N0LA 2F7PA 2WWOA 1A4KA 2FEEL 2VOTA 4JFYB 3T0EC 4KKLD 1BVOA 3HLAB 4H0LC 1YEJH 1FNGB 2FK9A 3WNLA 2YQGA 2BDNH 4MAYC 2QQKH 1VPOH 4ZMVA 3MNZB 4LSPH 4X6DE 3W3BA 2WCGA 3EJUA 1A6TB 3CSPA 5C2BL 4ODSH 3T8VA 3BUDA 4BUGA 1HTYA 2VN4A 1B4TA 1HXMA 2K70A 2NTSP 1OM3H 4S1DD 3CC1A 4GUPB 2GK0A 1KB3A 1YPZB 2LAGB 4ZAKB 4BUQA 4EOWL 2K9FB 4UQ2A 2E3VA 1P4LA 2VZOA 2E9IA 3CFUA 1E5AA 1C16B 4OIAA 4P5TC 2F8XC 2VJXA 1LK3L 4UT7H 5GGVH 3DJZA 1WRFA 2PW1A 3S98A 3QHTC 4H8WL 1KCKA 3R1GL 2VLMD 4QNPE 7FABL 3NA9H 4P46D 3UG4A 1PY0A 1SF3A 3MJ8A 1RLWA 3CPLB 5J0BA 1KEML 2VLJA 2Y2TA 3ULUH 4TSBH 3PDDA 1KGUA 1MY7A 1F56A 2XZAL 1MLBB 4NC0B 1HQRB 5A2CA 3H2PA 4PJ7E 3AU0A 4NOFA 4TVPD 3QA3B 1R3KB 4FYQA 1TQCC 4OR1A 5HPMB 4OAWB 5D1XA 5KVFE 3RIFK 5I1GH 2AEWA 2R69A 4ZX5A 4KNUA 3WXWL 2ODHA 1PY9A 4YBLB 4XC3L 5CIPB 1G9MH 1UJTA 2GYSA 5JXAL 1JYWA 3KYOB 2OXHA 4MKTA 1P1ZB 3VQ2C 4P07A 4TUOB 3LAFA 1AS6A 1PLAA 4IKLA 1T20B 4IGBA 2VMJA 1BM3H 1KNOA 1UXSB 4UM9D 4IIQB 2H32A 4OZIF 1MCKA 5DJCB 3AW5A 2WJ5A 1P0SE 4G7QB 3BPOB 2OMWB 4PMEA 4Y2LA 2C7UA 3N41F 5ABDE 3WHE1 3CHRA 4M9PA 5C2UB 2XG4B 2XX0A 1MFCH 4OV5B 5IESH 4F7TA 4HJ0D 3X1BA 1CGYA 1EEQA 2FJSA 1HYSD 2F9BT 4KUCD 3ML8A 4LLUB 1G7JB 1GXEA 3MBXH 1EEYA 5KYYA 2YD2A 4OVVA 1WD8A 2R56L 2RGSA 2VR3A 4XBPA 1BD2A 5SX5K 1SEQH 2YJLA 1DVFD 3G5XA 2FSDA 4HS6B 4N0FB 1MW2A 4ODHH 5D4IA 5DHMC 5DJXA 5EUOF 3BWZA 3ABZA 3ARDD 3LKQA 3PWNB 3GT6A 1TFPA 2PLTA 5IQMA 5T1DH 2L3BA 2XKSA 5I1CH 4HK3J 1BBDL 4W9KC 4PRBB 2G30A 3OZLA 2DLFL 3L4ZA 4LE8A 3AB0C 2NNXA 4HJJL 4LEBA 3V6OA 7TAAA 2AQSA 1PBYA 4PJCA 3UTSE 3RWEB 4KWUA 1UADC 4F57H 1QBBA 3QIUB 3C12A 4ES9A 2HX7A 2Q3ZA 3CFNA 3D2UB 1JD7A 2R4SL 1GJUA 5HSFA 1LE9B 1F5WA 5I66B 5EF1A 5BVPL 5LBVA 5JLZB 5D7LB 3TO4A 2BXYA 3S5LB 2VXSH 4AY0A 3ATBA 2FBJL 2Z4QB 4G42A 1I7ZA 3VD9A 3F7PC 4NQEE 3ATDA 4HIPA 2PWDA 4LSDA 4G5ZL 4QRPB 2FRGP 3KJ6H 3QRBA 1L3NA 3VWKA 5EBWB 1ZS2A 3BUYA 1H6FA 4RX4A 3JVGC 4R4ND 4RFEA 2YPLA 1BLIA 1OM9A 3QCTH 1GKOA 1JZ8A 1NQBA 4Y9EA 4Q9CA 4ZPVA 3HPJA 2FATH 4HBQA 1Q0XL 4JX0A 4F7EA 3BDXA 2FHBA 1RZJH 4A6YA 3GSNH 4YUEH 3ZUCA 4FL4B 3GRWA 1NEZG 1ZLUH 2Y23A 1X5XA 4NKOB 2LOEA 4JDVB 2V2WA 4TNFA 3VD0A 1FO0H 2ZOUA 1EZVX 2HT2D 1N4XL 3QEUA 3GSUA 1E27A 2FH6A 1OARH 5AKVA 4HJIA 4MD4A 3GRGA 2BZCA 3GYRA 4PW3A 4O02A 3T4AB 3K0YA 5E9DD 3V9FA 4GB9A 3KL5A 3O3BA 4H13C 5TF0A 2EDMA 3FT4B 2XKNA 2IAMD 3OMNB 4NGHH 3S8GB 1MFAH 3A0OA 2OZ4L 1VKXB 4PBXA 2WGXA 3C08H 4YVUA 3ZL4L 4BQ6A 1CPUA 5TQ2H 1KWGA 1RL1A 3QQ3A 1NPUA 2DQMA 4Y16C 3DVNA 3IFLH 1AHWB 1VCAA 3D18B 1VZIA 2QEJA 1YYLL 3B9KA 4JM4H 1BPVA 3RDTC 4I0PB 3MX0B 1UKTA 3IRZA 2G4GA 1CFMA 4NQXB 1AMYA 1S7XA 3RPKA 4Z3IA 4NUJA 4K23L 4Q52A 4O51A 4QRBA 4DGUA 3LHAA 4ONFH 3VMOA 1SBSH 5BS0E 5DEJA 5L88H 1RPKA 1JV2B 2JJWA 5AKTA 2CBQA 2E6JA 4NKIH 1HZHL 5IG7B 2X1PA 1CFTA 2R1XA 3QS3A 4ZPTA 4YDJA 3WNNA 4L3FA 2QLVB 2EEBA 4GEIA 3ZIMA 1N0XH 2Z4TA 4Z7VB 4YC2C 5IHBA 2AKRB 3EOAB 3MRLB 2NT0A 1FBIL 1XO8A 1SEBB 2AXJA 4RH4A 4ZS7L 1YAIA 3EYOB 1DBJL 5F7EL 1NAML 1WBZB 3OJVC 1Q9OB 3C5ZA 5GRVL 1C5BL 3MOBL 1A66A 3VD5A 1KIRA 1G9EA 2WIIB 3K8KA 2EDWA 1U58B 5T33L 3G08B 2NLJB 2AZAA 4P2AA 3SD5A 4DERA 3RWGA 3GI9H 3WTUA 5AOLA 2XIDA 3D3VA 4NJ9H 4PJCF 3F04A 4FTDA 3FSZA 5AW4B 4G6AC 3GNML 1DQML 4DTGH 4ZMNA 2ODIA 1ESOA 4DIXA 4EI6A 1REIA 3WEMA 4HSCX 3TV3L 1JGUH 2BNUA 3JZYA 5IM7A 2OL3L 4H1LB 2EDEA 1WE5A 2WVTA 4DFHA 2YZ8A 1X9RA 2CO6A 3AG1B 3F85A 5ANMB 2LLGA 4CADB 4Q9QL 4WWKD 3NSCA 1U3HC 1YC8A 3ZKNC 4KXDA 4DAGH 1GS7A 2Y9RT 1JK9A 3M1CA 4K5LA 2ZUWA 4MWFB 3WIHA 2HG5A 4V1DA 1U8NB 1UACH 1G6RA 3HNSL 2JVUA 3E9TA 4PTUA 5DDHA 2PMZA 2OTPA 3QP3A 2A6IB 3MJ6A 2WN3A 1J0ZA 4KKPA 3UZQA 1H9VA 4F7CB 4B3EA 1TIUA 3I75B 4OTXH 4JFDE 5DYFA 3ALPA 3CVHL 5TGBA 1U41A 5I6OA 1H0DB 1NGXB 2WXKA 1P4BL 4M61B 4RZCB 1DVYA 5MEQB 4Z7IA 4KRLB 2YAHA 3SDDD 2UXFA 3KYKH 3ZK0A 4OBSA 4EIUA 5HYSG 4IRSD 4L1TA 2W5PA 1NGZB 4Y89A 5D8JH 5FR3A 4NM4L 4UYPA 3PIQB 1RJZA 4X6DA 4PGEA 2PTTB 1X5JA 2KBGA 2BVQA 3MV01 5E8PA 4ZD3H 1EHKB 2DWDA 3FULA 1I8MA 4ESKA 1UWEL 2QR0A 1T0OA 3TOPA 2BO0A 4ZW7A 1OTUD 3QIWD 2MQ3A 5D71L 2LV4A 4I3RL 5SWSE 5FO8A 3CK0H 4UQCA 5J1AB 2BH0A 3G04A 4N2AA 1QI4A 5KBMA 3AT8A 4HS3A 3J8F7 4AM0Q 5L2JB 4KRPC 5IHLB 4DUXA 2W81C 4PP1C 1VADA 3OX8A 4LNRA 4Y5YB 4HIEB 1S5IH 2DQUL 5F21B 2JKNA 4JM2B 3GSOA 2BNQE 4QTIL 3NGBC 2F74A 2XY2A 1ZGLP 3JT0A 3CHXA 3TJEH 1RU9L 4KTGA 3BWUC 4ISVB 4J39A 4OGQC 4PJ7A 4QXGL 4JQIL 4OKVA 1DJHA 2ZKHL 5MENE 4JW3A 4OLXH 4CRPA 3JWOL 2NT1A 1UYWL 4PI0A 1GZPB 4NENA 2J8HA 1V54B 1NDGB 4YAQA 4FFWC 1GGCL 1E4WH 3EH5B 4TSBL 3VWJC 1MHEB 4ZODA 1JZ2A 5AB0A 4V2CB 2DQEL 4L9DA 2E7HA 5D70L 4I48A 4FG6D 5LGJB 4QJ5B 1FF5A 1G7IA 2HFFB 5DZOA 2KLTA 2QMKA 5EZIH 4OU3A 2WXFA 5A7BA 2EH8H 5L6YL 1K5NB 3ASOB 2XRAL 5A16A 3I50L 5IR1A 2B59A 3U2IA 2AXFA 4ENED 2OYPA 4QAWA 1AI1L 5T5NG 4NUGH 3MRPA 1G9NH 1HKLL 1MWAB 3KVQA 4PLOB 2FECI 1RY7B 1QR1B 2V37A 3D0LB 3Q9PA 3S97C 5K9OB 3DRQA 1DTUA 1HHGB 1KJ3L 3AS0A 2HPTA 3RVWD 1HJBC 3GFUA 1LHZA 4WUUB 5CINL 1LWJA 2IANE 1KCBA 1AGDA 3EOTH 3MRBA 4FN0A 4NKMB 3RU8H 4EN3B 1DFBL 1GGBH 5CS7A 1BA9A 3PABB 3WUZA 2AQ1A 1KCRH 4HAFA 1TT6A 2H4EA 3RUGE 3LD8B 4LVOB 3RWFA 3E38A 5FAAA 2CR6A 3LH2H 1VHPA 2I5YH 3GWJA 1I85A 3VXOB 4PGJA 1YNTA 4ZMPA 2EP6A 3T6QC 1JNHA 5EZJA 1WISA 3D7PA 4N2MA 4Y1AE 4Y19E 2K7QA 1X6LA 3U4BH 3UTSA 3RFRA 4PRHB 4Z6AT 5SWQA 1BW8A 5F3BA 4R26L 2VQUA 5ID1A 1HI6B 1KXTA 4PB0H 5K5YA 4AYMC 2CO7A 1VFBB 3KWUA 5DWUL 3V0EA 3FB8B 4UTAA 4M5ZL 5L4IA 4XN8A 2AMUA 5T1DL 5J6HA 4X6FA 4NHCL 5F1OB 4XCYA 3GMRA 2XT1B 3U7WH 2UUDH 1ZHKB 2XICA 5JORB 2XTJD 4PGCA 2NZIA 3BISA 4AJ0A 3H8NA 3RFZB 3SEPA 1CZ8H 4YHKH 1O7VA 2Z7WA 4WEMB 1BZQK 1RIHH 1WUNT 1DDHA 3FMGH 4S1QL 3CFEA 3QXAA 3FFCE 3QWRA 3BJ91 4X6DF 1LO3H 1RIVL 1TO4A 3MLWH 3QUMA 5LNDA 5F88B 2Z31D 1ILSA 5I9QC 1KN4H 2CCWA 2VABA 2RR3A 3EYFB 3M7OA 4NO2B 3TP4A 4G6ML 4TVUA 2JJSC 2BERA 1DBML 1PJ9A 4FLHA 3L3OC 4HPYL 3IMRA 3DIDA 3JWNE 3LHPH 4K94C 2FO4A 3IGFA 4FMVA 5EBMA 4HISA 1JRHI 1YEKL 2DJUA 3MRGA 3KGUA 1CCZA 4QNPF 4Z76B 4GKZA 2OM5A 1NM4A 3C87A 1FI8C 1KV3A 4G8GB 2WLLB 2F53B 4JVPA 1J1XH 2AANA 2R29A 5ESAB 4TSAL 2IWKA 4PJ7F 3QZOA 4JFZL 3H9ZA 1NBVL 4YZWA 4X4ZA 3V4PL 5CEXB 3HG1E 4HZAA 2BP8A 5GQBA 4PS3A 7PAZA 2J2ZB 2EE0A 3PP3K 5JXEC 4MMXA 2EDDA 1AS8A 1B0GB 4F9LA 3QDJB 3ZPDA 5GZOD 4ETQA 4Q6IA 3U30C 2DH3A 1IARB 3R06A 3OKEA 1SMOA 4EDXA 4H8HA 2P7TA 1A3RH 4IOFC 4AIZB 2EUWA 1T5WB 2NOYA 3MLZH 2M26A 4XCEA 3QJFA 1A6ZA 4LOUD 4O00A 3OB0K 4WIQA 2BX5A 1FNEA 2AXGA 3K4ZA 2J5LB 1OZTG 4HH9B 1L0QA 1G1CA 1NCIA 1Y6KR 4S0HA 2PP7A 32C2B 3BAEH 3F05A 4YO0A 1ZT1A 4C54A 3LEXB 1CLYL 1SXBA 1RUMH 2JIXD 5IOPA 1D5ZA 3S2AA 2FB4H 2L7UA 1BG1A 1LEKA 2ZP8A 2FQDA 4I3SL 3UBXB 4LARL