1AHMA

Der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
129
structure length
129
Chain Sequence
DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Der f 2, the major mite allergen for atopic diseases.
pubmed doi rcsb
source organism Dermatophagoides farinae
molecule tags Allergen
molecule keywords DER F 2
total genus 7
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1997-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ahmA00
3M7OA 2Z65C 1AHMA 2F08A 3RG1C 3WEBA 3MTXA 5IJBC 1NEPA 5KWYC 3T6QC 3VQ1C 2E56A 1WRFA 3ULAB 3VQ2C 5IJCC 1AHKA 5IJDC 2E59A 2HKAA 3WEAA 2Z64C 1KTJA 1A9VA 4G8AC 3MU3A 1XWVA 3B2DC 3FXIC
chains in the Genus database with same CATH superfamily
4ZS7L 5MENA 4OZHA 2WBJC 3ABGA 1A4CA 1JIBA 3N9GL 4FXGC 1N6QL 3FUIA 1CFNA 3F7VB 4JFZL 3NSFA 4OUUB 3VA2C 2DI9A 3OX8A 4YGAB 5K9QI 1RK1A 1U8LB 4Z9KB 4KQ4L 4JHWH 4KX9A 1NFIA 4TVUA 4YVUA 1IZJA 2V8LA 2PR4H 3MV8E 3S5YA 3O3EB 4YBHA 3K2IA 3QP3A 3UTZB 2A38A 3N06B 2GY7B 1E6OL 4HIHA 3TBSA 4ELME 1GKEA 3QRGH 1J1PL 3WOVA 2OLDA 2X4RB 4NQDE 5C09E 1R3IL 4K5PA 4XVTL 5MHSE 2UX6A 4OCRL 4RNRB 1U58A 4DP9X 4CC4A 2VQTA 4HEMA 4RGNC 2H0PA 2OMXB 5FFGA 5JR1L 1TR7A 2GT9B 4H40A 2FVNA 5JYMA 2VN7A 4N8CH 4MHHG 4BSVB 2FSEB 4JRXA 3RGHA 1ZWIB 3UAAA 1D9KC 2Q87A 1T5WB 4ENZA 8PAZA 5EZPA 2VITB 2XWEA 5KG9A 5EU4B 5EEYA 4B6ZA 4DTGH 2ATAA 4NO2A 3MKKA 5F7NC 4EI5A 3EXLA 1G9NH 1RJLB 5DUPH 4OZIE 4JPSA 3QYNA 3MJ7B 4NBYB 4LL9A 5EO9A 1DJSA 4OUUA 3O8XA 2CUIA 3BWUC 5E00A 2EYRA 4V2BA 4LDLB 5HI4D 1AHMA 5F1IB 4FJYA 2H0FA 4WW2C 3TJEH 3V6OA 3ATEA 4JPWH 2VMJA 4KRNA 5EB9A 4PREA 2NLJA 2VDKB 3OHXC 3P30L 1J8KA 1DVQA 5DHYB 4NM8H 1BZDA 3T6WA 3SBPA 3BVDB 5J12B 3PGDB 2YGPA 1CE6B 3UZVA 5I1EL 4DK6A 4AQ1B 3MA7A 4JANB 4FZEH 3H85A 1IGJA 1MHEA 3JWOH 4Z1PA 3MRRA 3F05A 2BNQD 3O6FD 3LEXA 3S36L 4BSWB 1U8PB 4HFUL 4MJ6A 2DIBA 4ZNCD 2EUXA 3L7FB 3K72B 3I75A 1GHFL 4JB9H 5KUMA 2IOIA 2OL3A 1E5UI 1YEEH 2OI9C 3T65A 1NANH 3T8XB 2F15A 1K8DA 1XF4A 4LSPL 4RLDA 2J20A 3QDJA 4NUMA 5AOJA 4J4PC 4MDIA 4X99A 4XPAH 3US1A 4C4KO 1OGAE 5DHYA 3O2WH 5KSBE 4KK6C 1YDPA 1UM6L 4MQXD 3VVWA 1MDAA 4BKTC 4HAKA 2A4EA 2XX1A 4MNQA 4ZSOE 3EDJA 1WFNA 3GRWH 4LLWA 3VWJA 3KPTA 2ERJB 5IVXB 4A7QA 2IPTH 3MJ8B 4ZMLA 2X87A 1ZOXA 1A4JB 3KLAA 1ZGLA 1A7QL 5FLVA 3WG7B 2IFFL 1NIBA 4RMWA 4C8XA 1MSPA 5JUEH 2ID5A 3PGDA 3DOSA 1S9XA 3VFRB 1JGVH 1RHHA 3MV11 3X13B 2P24B 3EUDA 3FOLB 4Y4KB 3SHSA 1MCFA 1T0OA 1UADC 4HAGA 2H5UA 5AEAA 1CN4A 4FTVB 1BQHA 4L4TE 4A7UA 5DHXB 3D07A 4W9GC 4XZ4A 1NPJA 4GXVH 1BBJB 4MRBA 3T8XA 1F6AB 2GAZA 4AYDC 1PCSA 4I7ZC 4GAJH 3DVNB 3JTSA 2DKUA 1RP8A 4FQCH 5BV7C 3SD2A 3IWVA 5D7JA 3AAZB 4RMSA 1CI5A 3AXLA 5E6IB 3ZPDA 2N01B 5CIPB 5FA4A 5DDHA 4OZHE 4PW3A 2EEBA 2FBJL 2AJSL 4HHGA 4G8EA 1XCQA 3EGSA 4CA4A 1UZ8A 4JJHA 1IL1B 1MFDH 4QO1B 1SMDA 1FZMA 3N0AA 4QNPF 2EH7L 2NYKA 3PHOA 1LHZA 5ESAA 1ORQB 2WLZA 1IIIA 3SGDI 3LVEA 3BT0A 3DJSA 3KGUA 3PWPE 3DGDA 3RE0A 3S35L 1YY9D 4ZS6C 1S5IL 1A6WH 3TTYA 1X5FA 3CFTA 4DFIA 4B97A 4NRYB 1HXMB 3B2UD 3MGTA 1AO7D 1RIHH 2HKFL 1F18A 6PCYA 1YN7B 4U7MA 2IG2H 4ZTPH 4XNAA 3WLBA 1F4AA 5SWZD 1I1FB 1SJVA 4KRLB 5EOTB 1E50A 1VFOA 2B1HH 4XE5B 5ERWB 5DVNA 1ANUA 4FXKB 2OMZA 4EUPG 5D96B 5C0JB 5GS2H 4JO1L 2EDBA 1FFPB 4KFZC 4QXGH 4YSDA 4ZPTA 4G42B 4K71C 3PNWB 4YPGB 3V8CA 4PJXB 2B1OA 2HT3D 1AIFA 1RUPL 1T0MB 1WBZA 4PR5B 5EBLB 3V0VA 4NCC1 4E9RA 5IJKA 3WKPA 3R4RA 2Z1PA 1XFPA 2FGWL 3HR5B 4F5CA 3OAYK 4FFZA 4LLWB 4NUQA 4EF3A 1SEQH 2HT3C 4AUUA 5CEZH 3KJ4B 1OT4A 1OANA 4WY7L 2ALWA 4MS8D 4YBQD 2KZBA 1KCBA 4GIAA 2OMBA 1JGVL 1TZ8A 4IRSB 3EJPA 4GXUM 1BGXH 4LGPB 4X6EB 1NIDA 3T2NL 5D1XD 4KZDL 4P2OB 4K2UH 1D5MB 3SE8H 4PAZA 1J9CT 4K9EC 2NXYD 2AEOA 2MOVA 1AQKL 1NCWL 2ZOLA 3ME0A 1MY7A 4LVHC 4X83A 4MASA 2Q0ZX 3LN9A 3LZQA 1D6VL 4HLZH 2JNZA 3KPRA 1CFQB 3WJJC 3ZDWA 2JKLA 2FO4A 1NGZB 1YMME 4X5XA 4PSPA 5E08H 3N43B 3CZJA 4DGYL 1CD1A 1XGYL 1XBDA 2C9XA 2EE2A 3GSWB 3F6LA 3PREA 5C6TH 2CJ3A 2H9GB 3L3IA 4GRMA 2ZP9A 4I9WE 4IK7A 2NY4B 4IKKA 4XWGL 2RFXB 2IAMA 2RIKA 2V7NB 1OSZB 2MNUA 2NRDA 4O58H 2CZNA 1I7RB 1IM3A 2J12B 2MTAA 1XCQB 1K5NB 5I66B 1ZJAA 5CZXC 3QIBC 1OAZL 1TQSA 2QQNH 3C6SA 3ZZSA 3AXIA 3KJ4C 3IFPA 3T0EE 3PHOB 2D0GA 2VXUH 3ARDC 2YQGA 1QSFD 1R46A 1JYVA 1RK7A 1E6JL 4NQSA 1SXBA 2YPKB 4OJDH 2VMFA 2LFEA 1LO3L 2OXHA 4IRJD 4MNGB 4FNTA 4ZNEE 5HY9B 5A6IA 4H4NA 2Y7OA 2RFXA 2V7NA 3ESUF 3GJFK 3IFNL 1PLGH 2EVHA 3NCYP 2BP0B 3AG4B 5EOCL 1XZ0B 4LB8A 1A9BA 4P3DB 3RIAF 1VACA 5DLLA 4HUXB 3NVQA 5I0VA 2DZEA 2J71A 2CO7B 1INQB 5C0RL 3CDGB 4L3EB 4F8QA 3CQQA 3HMXH 3VI4A 1A9EB 1MNUH 2WNGA 1SYSB 1T0NB 1M6OB 4Y9BA 1CLZL 4MAYC 2LABA 5CM1A 3PE9A 1KJ3H 1P7QB 4JUSA 1L9QA 1UCBH 3ULSB 1N7MH 4IGBC 3N43F 3MZTA 3TT1H 1U2CA 1FJ1A 1UH4A 4A7SA 4XO3A 1I85A 3EGDB 2VLLA 3QDJD 2ZZUT 2AQQA 2ICEA 1OGSA 1E9PB 1MVYA 2WW8A 1MLBB 1J5OL 5FUZL 4H5SA 1E5CA 5DC9B 2GI7A 4EDWH 4ILDA 3REVB 3OC5A 3RIFK 4QRSB 4JCLA 1EAQA 5EH1A 5LJYH 2R56H 3CCHB 3VFMB 5KTEH 4LCWA 2E8YA 3AREA 1RZGB 3GBML 1X6LA 35C8H 5BVPH 3D5OF 1SNRA 5GRXG 4EIUA 1RZQA 2I32A 1EAOA 3DKHA 3L95B 1QLRA 4APXA 2C3WA 3RWDB 4DKEL 1QX1A 35C8L 3LPGA 3MBWB 3VFTA 4F8TA 3P30H 2E3VA 2C1PB 3HNVH 2X4UA 1FIEA 2N7AA 2NR6D 1FNAA 2BW4A 5JLZA 3MRHA 1MH5A 3BH8A 4WJKB 2W1NA 2DQGL 1E4HA 5DD1L 4PJGE 4ALAC 3BQUB 3ARXA 4XNDA 4HDIA 2G4EA 4N0YH 4H25B 1MFCL 2V7HA 1Q0XL 1MF2L 2FL5B 3MXWL 5CP3A 1KELL 2NY7L 4YXKH 2H2SD 3WFHB 3UYPB 2FX7L 25C8H 4YSOA 4UOJA 4RMQA 5A2BA 1UD3A 4FHKA 3GSVB 1OY3B 3W11C 1UH3A 2R1WB 1WRFA 4I3GA 1FRGL 5L2KE 2Y7QA 1V27A 3B6SB 3FF8A 3M45A 3W0WD 1KBKA 1ED3B 3C6LB 5B3JE 5D7LB 4APXB 3MGOB 4N2DA 1FC2D 5KANG 5I1AA 4G9FB 3QFDB 1BVNP 2CXKA 2EH8H 1BV8A 1N8ZB 4HIIA 4FF9A 2UY7A 4IRJB 1NFKA 4LCVA 1V3MA 1PF3A 4TUOB 3WN5A 2PUQT 3ECBB 2LE9A 1KGWA 3QFGA 4QRBA 3V55A 2X0UA 3CFIC 4Z78B 4AYMC 5I75C 1AZUA 1KXVA 1HT6A 2WLLB 5FF6A 4QLRA 1HZHH 1N0XH 3V79C 1W6WA 4H20H 4Q6IC 5LGJB 1XF3A 1FZKB 3O9WA 4HKXB 4NEHB 3CLWA 3SPVB 4YFLI 1CXLA 5F71A 3VYNA 3EJRA 5CJOH 3HS8A 3LN4A 1JHLL 2D3VA 4KK9D 5DCCA 4D3CL 2NYYC 5MEND 4QYOA 3VFUB 1LO2L 1SXAA 5C0EA 4DUXA 3V0WL 2X1PA 3GKZA 5DJAB 3IJEB 1H3GA 2K70A 1DN2A 3ECBA 3QT2A 4NLHA 4ZOEA 4AYFA 2WNKA 1C5CH 2HXAA 3ENEA 2AEIT 4XO8A 1TJHH 5D4IA 1NFDA 1UXWA 4LP8A 3C5JA 1H5BC 5L88L 5INDB 1DYZA 4NBZB 5HYSG 1NMCB 1F3DH 1QFWM 1Y07A 3V0HA 2V3FA 2O4EA 4NN5C 2F08A 4KKPA 5CZRA 2R23A 2NZ1A 1XIWB 5DD0L 3SKJL 3B9EA 4UTBA 4RWHA 3KBEA 2BNRD 4HCFA 4PUBH 2W80C 2NUTA 2OKMA 4HJGB 3SO3B 1KB5L 1W72B 1IC0A 1M53A 3CUPA 2VDML 4J1UA 3DO7B 3TNMB 4P5SA 4HIEB 2HWZH 4XN9A 1J9RA 2R1XA 2Z8RA 4N4YB 3OR6A 1J05B 4OFKA 2EUZA 1E5YA 2JKIS 2OTWB 4HJ0C 1U8JB 4QYOB 3F58L 3MV7A 1G9ML 1Z5HA 5DLML 2PW2B 1D6EA 1QP1A 1F45A 2CCLA 2HA1A 3QUXA 2UXTA 3WMQA 1M71A 3QBTB 2ZNXA 1FFTB 1Z9MA 1SOSA 1FN4B 2H6UA 3ZXAC 2FH8A 3DXAB 3ULUF 4XXDA 4XRCA 2WO2B 3BDYL 3X3FL 3CU1A 3IE4A 1EERB 2WCGA 3RWIB 3CN2A 2WGNB 3DBSA 1QTPA 1FPTL 4AGLA 1QA9B 1TETH 1NH6A 4XP1L 2AQNA 4DVBB 1YA5A 4QY8A 5AL8A 4XNMA 4XPAL 2QADD 3Q8FA 4DESA 1TQTA 2A9MH 4KHTL 2WQRA 2F61A 4J23A 2GPZA 1LK3L 3KYAA 2YKLL 4X4MA 4GUQA 5CLXA 1A7PH 4P4RA 2FLMA 3TCLB 1CJYA 1P9MA 3MNZA 4FXKC 5E9NA 3OC8A 2YD0A 4GNKB 4NS0A 5CKAA 1FYTE 3DJ9A 3RZCB 2VZVA 2D03H 1BOYA 4JKPL 3KCPB 4YQXH 5I2IA 4TXVB 1FV1B 1GJWA 4JCMA 2IDQA 4ODHL 4XNXH 3AB0C 3HRZC 3WNMA 4YHKH 3LIZH 4M5SA 2AJ3B 4GW5B 5DTFB 2NY3C 1AC0A 4P49A 2JKRM 4YXHL 3VM5A 3NZSA 3BEWB 4RMUA 1OAXL 5JUEL 2GJJA 1GW0A 1PZUB 2D31A 1N3NB 2HG5A 4NQVB 1N59B 1I3GL 3M46A 4EN3D 4FFTA 2W07B 3T0WA 3QAQA 2BWQA 4NZUH 3VB8A 2ADIA 1XB3A 3MCYA 4J7RA 1K8DB 1XF4B 2IGFH 2NY2D 1M7DA 2VDRB 3GO1L 3VMPA 1CTOA 3JWNE 4X7CC 3MLYL 4ODWB 1L7IH 3C9NB 5LBSL 1I1YB 1NJ9A 4OF0A 1F42A 3S3CB 3VRIA 2AJZA 3FSAA 4MNQB 4JPKH 5F1NB 5C0IA 4PTTB 4NQCB 4PVMA 1QFUL 2ATKB 3GD1C 5CJ5A 4QTHB 2XTLA 1V7NL 4GSRA 4N0UE 3V4VL 5IB1B 1DN0B 1PQZB 2BS71 3E7JA 1WO2A 1IX2A 2P5EB 3Q1SL 4PMFA 3NQKA 2R59A 2HSIA 4B9FA 3QFJB 1J1XL 4PJDB 3ZR5A 3R18A 2R4RH 2A1WH 4P5MB 3RNKA 2A74A 4FQ1L 4TUKH 5FB8B 5DHEA 4F27A 1A64A 1T21A 2AK1H 4W4OC 3T77B 3U4AA 4F2MB 3WBDA 1KTRL 1NAMB 3SDAC 1U2HA 1CFSA 1RZFL 1I85C 1IAKB 2BWDA 2BHUA 4BSVA 4EIBA 1H3TA 4YSEA 2A77H 3KPRD 4WHCA 1I9RL 3UX9B 1FDLL 4KQ3H 4RCAA 5GGVY 2W9EH 2CA3A 1ZLUK 3KPQA 4BA8A 2DJ4A 2VITA 2ED7A 1ZV5A 3AG3B 5FAAA 1CICD 5FHAL 4NQEA 1ZV9A 3U0TB 1QAWA 2DW5A 2WVUA 5CBEB 2PPFA 4N9GB 1J18A 1YNKL 4KTGA 2W88A 4BIKA 1RULH 1WAAE 1Z0NA 2ZD0A 4FS0A 4P5MA 2MCG1 2M83A 3W57A 1FAIL 2ZOKB 3F7QA 3QPXH 3TGXA 3V6OC 4J39A 4HG4K 2AJYH 4QGTA 2G9KA 3HN8A 4GMSL 4LCCA 3RWJA 4HK3N 2ZCLL 4C47A 1NAKH 1LILA 5ACMA 1JTOA 2DWEB 1U93A 4UDTA 3VRLF 3T2LA 4LVOB 1ZEAL 4N2LA 1MIML 4LVEA 3NCWA 2DEWX 4Z77B 2Y0SA 3BZFA 4MSWA 1JYWA 3L2NA 2COQA 5CEZL 1D7BA 2GUOB 5HVHB 3KLKA 3GRBA 3V6ZB 3JTTB 2IVFC 2O61A 1F8TH 1JSYA 3JWDC 1GZQA 3ZDYB 2W92A 1OK8A 1EMTH 1ASPA 2XICA 2G9HB 5L6YL 1SLUA 3FUMA 2D31B 2HG5B 4YDKL 5BRPA 3HG3A 2ESVD 4L8SA 4R7LA 2ZT9C 4LXFA 1SJHB 3CIQA 2LQRA 3MRNB 4GAGL 3QARA 3C75A 4OZFG 4O00A 1DSFH 1Q4NX 4QLWA 2ZOKA 3A3YB 2BXYA 3CDZA 5F21B 5C0GA 5IBTL 4J8RA 5C07D 3GMQA 5FM8A 4DIXA 5DF0A 5FCSH 1TCRA 3FTUA 4JHWL 5T1KA 2QPEB 4XPGL 3LKPB 2EYRB 5TE6L 1GGBH 2HFFB 1AGEB 5FCUL 3SN6N 1U3HD 3WGVB 1TDQA 2G2RB 4IOFC 2BOCB 5CMAB 4OU3A 5IK3B 2SEBB 3NJFA 5KJRH 2YMXL 5F7FA 1K2DA 5H94B 4IMKA 3O4OB 2QPFA 5IVXF 5B4MC 2JIXA 3HG1D 5EC1A 3KYNA 2BJML 3MGAA 2VUYA 1HEZA 1ZANL 2GFBA 5FB8A 2VM4A 3X14B 2X1OA 3D39D 4A2DA 1MFEL 3SE9H 1O6TA 2PPDA 1QR4A 2IADB 1JAEA 5DFWH 1RUAH 4N28A 2Z7UA 1HSAA 5E70A 4ONOA 3L4CA 3QQ3A 4GKSB 1EIBA 3NGBC 4F9LA 2OMTB 5JA9A 5CIPA 4O02H 5FA4B 3Q2CA 3AU1A 2K4AA 2K8QA 2PR9A 2Q3AA 3P9MA 3U0TA 3MRLB 4PG9A 1E3XA 4EOWH 3L4ZA 1FH5H 3ES6A 5HJBA 2XKUA 3UIZA 5I5JA 1E2ZA 5BS0E 5AYUH 3L7EB 4M61B 2PXYB 3T6XA 1OAJA 1OW0A 2EIEA 2YBRB 2I26N 1KGXA 4JDZA 4X9YA 1N4XH 1VZHA 1CPUA 1AFVL 3U1SH 4C4UA 5B38A 3LKSA 3X1FA 2Y4SA 4BEIA 3HE7A 3MLPA 4G6KL 4LASH 3FO0H 1XGPB 4M1CD 1MCHA 5IOPA 3MLUH 4Q7DA 4PV8A 2OP4H 2QPDB 5CCKL 2Z91B 3S5LA 5E2WH 2UZYA 1MWOA 1NGXA 2EDHA 3D0AA 2P80A 2CJUH 3PJSB 1I3VA 4F8OA 2XY1A 4RRPM 4YHNA 5DD6B 5IHZB 2OJZL 2X7LA 3FFCA 4LSSL 5FCUH 4NFCA 2AJSH 4P99A 3QZNA 4YGVA 2B1AH 1MFNA 1QNIA 1WAAA 1N9PA 4DGWC 3D12B 4LLQA 1T0MA 1NINA 4L0PB 2CLZA 3U6RB 4M00A 4IU2A 1BREA 3TIEB 5D71H 5F9JB 2Z3FA 2XQYA 1EEYB 5EUKA 2YPLD 4X8JB 3PV7A 3APDA 4ZO7A 1ZS2A 4KRPD 2BHZA 4BFJA 4BFRA 1E3FA 3RUGA 3LTVA 3JVFC 3B8YA 3P3TA 4J12A 3VFGH 3OKNA 3FFCB 2IFGA 4P9MH 5BZDB 3BYYA 2ZWNA 2EH8L 1R5WA 2WMPA 4X80H 2O5ZH 4PGBA 2QVMA 3MOBH 5KVEE 5I82A 1X5MA 4E36A 3AQDA 5GJTL 3BQVA 3EBIA 3QJHA 4X6FA 4HJJL 4E41A 4GG6F 3DXAD 1PKQA 4YHPB 1WAAF 5AYUL 3VFNB 5ITBL 1DUYB 1NLDH 1UWEH 2Y3NA 3TYGL 1YYLH 2DLIA 5EUKB 3RKDC 3C8KB 5IMOA 4RFEB 4PD4K 3NCYS 5CWSB 5DUMH 1EJOL 3RGVC 3GINA 2YA1A 5D1QD 1NLBL 4UT6A 2YAEA 5HHOE 1SM3L 2EEFA 2YS4A 3N85L 3H2QA 4YVNA 3GHBH 1YNKH 3Q2VA 3KPLA 3WS3B 4JG9A 4ZX4A 4MAYB 3BESR 4UQ3B 2E46A 1IKNA 1RVFH 3LQAC 3AQYA 3MRHB 3NP3A 1BQSA 2NT1A 4IRJC 3Q9QA 5IMOB 3MR9B 3G5YA 4U31A 1HH6B 1JRHL 2DS4A 2H3XC 4F2ME 4IK6A 4NAQA 1FORH 3OLEA 4G7YH 1RPQA 3LKNB 5ALBH 4JM2C 4P3WA 3GK8L 4NM8L 5AVXB 2V7HB 4NZRL 4YHPA 3PP4L 5K9OA 2N3JA 3R8QA 1VADA 1QSEB 5I6PA 2X4TA 3V0WH 4JZOB 2QQKH 4Y1AD 3BPNC 4JPIB 3MXVH 1WFIA 5EEUA 3S98A 1TNMA 2EC8A 5TQ0L 4ZUVB 2NY4D 3N5AA 1FI8C 1WA2X 3ARBC 4P4KA 2JFCA 4QCIA 3UJJH 2BIMA 5GS0H 4WGWB 4JR9H 4GW4A 4L05A 2NXZD 2XQYK 4P2CG 1VZIA 3ZBMA 3RZCC 4HK3J 3ULAB 4H8UA 3AS0A 4GUPA 4MXQD 4W9IC 4PJFA 4ECNA 5BRZB 3LEYH 3NCJL 4NHCH 4PRNA 2X2HA 3LPOA 3E6HB 1VERA 1QBLL 3LN5B 3NJMA 2Z4QB 4PJIF 3ECUA 1P7KA 1JUFB 5E8EA 3N44B 2JB6A 4X4YA 1UYWL 2A73B 4W9DC 1W2KT 2BC4B 1ZTXH 1YN6B 4PJGF 4DOHE 3CN3A 4QXTA 3TO4C 4F7PB 5EF3A 4Y5VC 1I3GH 5H4ZA 1MNUL 4NKQB 5EA0H 3HE6A 2KZWA 3KAAA 2YUZA 4JFPB 2CHDA 3PS6A 3E2HB 4ZOCA 1ZTXL 4QTIH 4PGCA 1E4XH 4D9QD 2WMPB 4ALAL 1DVZA 1FVEA 4JFSA 5D70H 4YXHH 4MNGE 4JPIA 2ZCLH 5I8OH 1L0PA 1PW3A 1EAPB 5DWUL 3ZHDA 2W0KA 1AANA 1NGYB 3UJTL 1E4WH 5DGRA 4Y9CA 4LEXH 2GB2A 1FE8H 4WTQA 3VE0B 4PJFF 4K5LA 5D7KE 4FHJA 3ALWA 2Y6SC 4HMCA 2JB6B 4X4YB 3ZO0A 4YSUA 2H1PH 1DVFC 3NEXA 2WIIB 2A83B 1JVOA 3NJIA 3TVMC 2QFPA 3JZ7A 1EEZB 1CGWA 1INEL 1OTTD 5BVJA 4HUXA 5J3HD 1W91A 1BZ7A 1A3LL 5DJXB 3FTZA 4FNUA 1VJSA 1A7NL 3PFUA 3QYMA 4Z3IA 3QG7L 4JNXA 3RUGE 4WWNA 3GSQB 2NY1C 3AXHA 2EDOA 2DQCL 1YJDC 3ESPA 1G4MA 3FONA 5F3FA 4X9FA 5KSAB 3P4OA 2DM7A 2ZJSH 3DV6B 4OZGA 5I0DA 4HBQA 1NCGA 4EE2A 2LOEA 1MCJA 5IB3A 4UYPA 3WFBH 3MRGA 1P0SE 4XI5D 5BOZG 3GBNH 2FQFA 4M56A 4Y1SA 1CDCA 3DPBA 1R24B 3OXSA 1R3KB 3PXHA 5KVGE 3ZJAA 4C57C 1IFHH 4ONFL 2GJ6A 1BVNT 1D9KA 1D5BB 2EICA 3EO9H 4LMQE 4M9PA 4WUUA 4ZZFA 3NIGE 5DK2A 4KGJA 5FYKU 3UTTE 2YGQA 3QJSB 3EYFA 5ALBL 3HBPA 1EVUA 4QRPE 1U3JA 3H7LA 1EAJA 3VI3B 4NM4L 3CDFA 2Y1AA 2OTWA 3ZKMC 5DJXA 3UGUA 3LD8B 4NIYE 4AGPA 1U8MA 3NSDA 4UQ9A 4OZGF 4XTRD 1MOEA 3RAJL 3QQDA 3IXTB 1BMZA 3W2DH 4UTAL 3D9AL 1J5HA 5AOZA 4DKTA 2FRGP 3DETC 4NCC2 1MZYA 1ZHBB 1EV2E 3FONB 4TV3A 4DF9A 3L17A 3HA0A 4Y5VB 1KPVB 5FK9A 5ISZE 4IMKC 1WZ1L 3C5ZC 1LO4H 2QSCH 3NUKA 4TKWA 1A7OL 3HI1B 4ZK8A 2MPAL 1IBGH 4XN1A 1S78D 2F74B 2CHZA 4HDIB 5DUML 2NXZB 2A6DB 2PO6B 4AXWA 5GZOA 4MD5B 3QQ9D 2O30A 5IW1A 5DQJB 1Q72L 5HTSA 2P5WB 2ZKHL 1FZOB 3LB6D 5FYLE 3EYOA 2JKXA 1JI1A 5HHOD 3RFZB 2A3TA 2G0LA 1JTPA 4JGJA 1F5WA 2AJUH 2IDSA 1YEJL 4X5WA 4AENB 3C5ZA 5EU5A 1CBVH 3GHPA 1KCVH 2WBXA 3VGAB 5J13C 1F11B 3V5DB 4MA3A 4YR6A 4FQHA 3UG4A 1WGVA 5E5MB 2E0PA 3WFDH 2XI9A 4NNYA 4PLJC 4OLXH 4OCWH 2XZAL 1N26A 2A6DA 3OAYH 4IMLA 3QFDA 1FNHA 32C2B 4OM0L 1UA7A 3GXDA 4PI2A 2F8VA 2EIMB 3I9PA 2BZCA 2EKJA 4OCWL 1WWWX 3T3MB 4FG2A 1KC5H 2WTRB 3SQBA 2XY2A 3P77B 3ZT7A 2O6DA 5KBPA 1JFHA 3UTOA 1XEDA 4OZGB 1BAWA 3BZEA 1EPFA 4LHJB 1DCEA 1IC4H 4KMTH 4LSSH 2OCJA 4UQ2B 4EDXB 1XL4A 4NHUB 2Z92B 4E68A 3QIWD 4PLKD 3V0IA 3LV3B 1NWPA 4V2CB 4DZBB 2ZXEB 1B3IA 1EUTA 3KCWA 4Z7UB 5HJ3B 1ZWIA 4LAQH 2HX9A 2APFA 2WXOA 4HKBA 4DVBA 3QDHA 4PRBB 4U33A 3TWCL 5DRNA 3BRFA 1LLAA 3QUKB 1H8SA 3DRTA 4IIQB 1DN0A 1GZHC 1PQZA 3IDYC 3RWFA 1J11A 4ZMAT 5E4OA 3ESNA 1CICA 4KROB 3O2VL 3MLXL 4KDTA 4ZTOH 5JIKA 2KZKA 1SOXA 3PNRB 2PYED 3UL4A 5I17A 3RNKB 5CINH 2VDLH 1GAFL 2J4WL 3ERXA 4BKLB 4A66A 2J55A 4NZTH 4QY8B 1UGNA 4OD2B 2D4FA 2PWGA 4PJEB 2OR9H 4YOKA 5FHBL 3SYCA 3TWYA 4FC3E 3I2CL 3P77A 4TULH 1U92B 4JK0D 1L5GA 3CFNA 3Q6FA 2MNJB 1UYWH 1QRNE 2DEXX 4X7EC 1UB5B 4Q9QH 1JDCA 1TTAA 4JAMA 3CFEB 3HZKB 3QEQB 1CDHA 1KZYA 3LNEA 4QRAA 1YEDB 2E7LC 1MFEH 3QXVA 3LQZB 4PY7A 4WU5A 3IU4H 2OMVA 3UTTA 1QRND 2IBZX 2OMXA 3P4NA 3RX8A 1S9KC 1IFGA 5EZJB 4DJMA 1JF6A 5LCVL 2N7SA 4ZUUA 4P06A 4HPOL 3CV5A 2YMXH 4JFVA 4S1QL 1A1MA 4JE4B 5GISL 2DWEA 1YDPB 2QKIA 1FVCB 4ZZKA 1WH0A 5I5RA 3WI9A 5F96H 3BEWA 1M7DB 4WRLA 1MCOH 1EK3A 3Q7JA 3R0MA 3WNNA 5AYTA 1XH1A 3WN6A 3JWNH 2CO6B 5IB5A 1T03L 3TC9A 4LHUB 4M5ZH 5CEZD 2FD6L 4PJAB 3TT3L 1IUZA 4Y16B 5T1KD 5B3SB 2ALAA 2WWOA 1IEBA 4WFHD 5HHQA 2XCMC 5D7IE 3QEHA 3BSHA 1IEAA 2Y69B 4PLJD 1NC4B 2VDPH 5KN5B 5IGXL 1HHJB 4RMBA 2WYTA 2OAAA 1FRGH 1YEWA 4Q97A 4M6OL 1NCCH 4LE8A 4X7SH 4XCFL 3CVHA 2VN4A 2O6FA 5DJYB 1NWOA 3GMLB 4KNSA 4WK4B 2DM3A 3KVPA 3EZJB 3HUJE 3OKEB 1SJXA 2EADA 4I3SL 5F7AA 2VXVL 3BUIA 2R1YA 3DMMB 1FO0A 1UENA 4NT6B 5B22A 1LO3H 2X89D 4OZIB 6FABL 1CE6A 3UZVB 4PRHA 1L6PA 4U6VL 4EN3B 2BWIA 2X1XR 3BIAX 1JPGB 3EFDL 5DRXB 1LJMA 1I9RH 1FIGL 5LGYA 4EZJA 5IFAH 3PV6A 1Y1DA 1I9IL 3NIDF 4GMSH 1FZMB 1AZRA 3S2CA 5DURD 5C8JB 5TDPA 4P9ML 3QNXA 2XTJC 5TH2B 5IK3A 4RX4A 3MRFA 4Z7OB 2IADA 1HHJA 3BPNB 2BS8A 4PJBF 5GRVK 3N40F 3CHSA 3MRKA 3K4ZA 1PS3A 2ADYA 2AI0H 1FDLH 4KQ3L 4J3BA 3FNKA 4U3XA 1G1CA 1KBGH 1WDAA 3S36H 2Q6WA 1X9UA 4ZFFB 3D85D 1CLYL 1NBZA 2Y23A 3JVGC 4FFYH 1CGVA 1URLA 5D1QC 2R4SH 5JA8B 1EWHA 5TF1H 3L2LA 2VSCA 4UNUA 5JOPE 4UCFA 5D96C 2F8XC 1GGIL 3HNSH 1M9WA 3DTUB 3KD4A 4Y2OA 2BNQB 3VH8G 1BVKA 5AVZB 4C56E 1EO5A 4GMTH 4YMPA 3NFNA 4WFHE 3A6CL 1A6ZA 3IDIB 3IRPX 4K71B 4H8WC 4GI6A 4UOZA 2R2HA 4AT6A 4PJDA 1KCRL 1O7SA 1TIUA 5FO7B 3SE3A 4AYGA 2WANA 4CSSA 1GZQB 1J10A 3RFRA 2B15A 2BVTA 3P0YL 1S7VA 2XVGA 3ARGC 5GRJH 4CMMB 3LHPH 4U1IB 5KS9F 1MRFL 1KLUA 3QEGH 3WY4A 1SJHA 1TJGH 1QRNA 1KXTB 4B9KC 3GMOB 4PSRA 2AK4D 1ZVHA 5E9DB 3HMXA 4KRPC 1QO3B 1WZKA 4POZC 4HUKB 5JZ7D 5JIIA 4QGYA 2EDLA 3SSGA 4L3EE 3P2TA 2CIIA 2X2IA 1PG7W 4XMXA 1A7RH 3ARGA 1G5AA 3DOIA 4GW1B 4IEFB 1UKQA 4KMQA 1OD9A 4X0NA 4AL8C 3EH5B 2APVA 5I6KA 2DB8A 1HXMA 1SJEB 1U8CA 2JKTM 1ZLVH 2EXYC 4POZD 1ZK5A 1LXMA 5LG1A 4M03A 3V0DA 1E8XA 3KPSA 4HLJA 3IETA 4MVBD 3MRIB 2JCWA 4NWUL 2UZXB 3BVNA 4ZX3A 1S3KL 4LL1A 4Z77A 3M88A 5T1LB 3KPNB 3QVAA 1HESA 1UASA 1QSEE 4AUJA 5ES4B 3SGJC 4NFBA 5DMJB 3MRBB 3T3ME 4IBWA 3FTWA 3K6IA 1AG6A 5BO1H 5J11C 1FCGA 3QB7C 5C09A 3TA3B 3UG3A 1ZT7A 1IT9L 3BWZA 2XQBH 1ZLSL 4YSQA 5EEXA 1FG9C 4RGND 5DVMA 1GS8A 5CWSA 5HHNB 1K9TA 4DGUA 3SOBL 1KCWA 1CYWA 1NGQL 4BK5A 3UO1L 4ZMYA 5EF0A 3WNKA 4Y2DA 1JPEA 3DX6A 3HS0B 1VEOA 4LSVH 1EHLH 2IOMA 4JDZB 3L3OB 3MFFA 3EGSB 3STLA 1AXSB 4YZFF 5MEOA 4MCYB 4G6KH 1K4DA 4LASL 1FG2A 5B1JC 2VXSL 1MREH 2OSWA 3WAKA 1UWFA 4WFED 1CFQA 4ADGA 3MRIA 1DVUA 4J3UA 3WU1A 4WO4C 5IJBC 3CSBA 3BZ4B 1NMCC 1WZ1H 4WLCA 5GIRA 4UAHA 4LQFH 3LMJH 4UF7C 4GXFA 5DFAA 2WINB 1HHIA 5HDQL 4P9HH 3S96B 1M1XA 2WXHA 2FHBA 4PCKA 3H4FA 4TUUA 3OQRA 4OFYD 1J9TA 1BZOA 3V0EA 4CJ1A 4BWWA 4YDJB 3AACA 4XWOD 3I50L 4XNUH 1DEDA 4FMVA 1R47A 2CR6A 4TYUA 3CQFA 2Q8AH 4LEEA 3L1OL 4KHXH 3QA3B 3LNDA 3DUUA 2B4CH 4F7MA 2ESVB 3FQNB 5JPNB 1ETA1 3VYPA 3U30C 1BJ1H 1NPUA 3QDJE 4ELKB 2EEAA 2XBDA 4JRWA 5CEXB 4MA8L 2WLKA 1AXSA 2LLLA 5FDYA 5IQNA 1MI5D 1KEGH 1BG1A 5KSBA 1TU2A 1FC1A 1U91A 4H1LG 3N41F 5DO2C 4X42A 4P5RA 4MJHA 4H20L 1QBAA 4KWUA 5DC2A 1XH2A 2B08A 4X6EA 1LNUA 1ZHKB 1RZ8A 2EH7H 2HZHA 3EJUA 1ZA6A 3CDGA 2XZAH 3AT0A 1MEXL 1J5DA 2XYCA 3TJEL 5IBUG 3LOWA 5I74C 4Z18A 5A7EA 4LF3B 3KPLB 2KLTA 3AC0A 5TE4L 3WS3A 3H9HA 2J1XA 1P53A 1EEQA 3GEWB 2GC7C 3MUUA 4ZD3L 5IJKC 4P5KA 4YHNB 5IHZA 2OYLA 4IW4C 2R0WH 1WIUA 4R2GD 5IEHA 4L3EA 5KSBF 1CGTA 4CW1A 1JPST 4GAJL 3VA6A 2VC2B 3MACL 5FGCE 1KCLA 3DO3A 1DL7L 2F53B 3NSJA 1RK0B 5D5MB 2NQDA 3QC5X 4Y4HB 4N2HA 3WFZA 4MXVF 2FBRA 5DMKA 3E1F1 1ZV2A 3L3OC 3NJGA 4CUCA 2F54A 3IKCB 3BSZA 3RPBA 3VFSA 3MNDA 1TQBC 1TTBA 3VX1A 1K5NA 2HPOA 1YEKH 5F7KC 5I9QC 3QDMD 4WO4B 4D9QE 5AD0A 4PJ5A 4LKCB 2BHYA 2HJFB 5AVRB 1ZHKA 1FFQA 4FTVE 3FW6A 4G9FA 4AGOA 1BQ5A 3E38A 2DBLH 1OAXH 2DQGH 4NQDB 5E03A 3PRZA 2DQHH 5CGBA 3SDAD 3VTMA 4TNFA 4F2FA 1CFVH 2YA2A 5HHXL 4QHPA 4XVTH 3GHEL 5C97A 1G7IA 2DQIH 4RGOL 5E24E 4YLCA 1Q9OA 1RZ7H 4Q89A 5CGYC 3RA7L 4E41B 4YHKL 2E7DA 2XIIA 4GQRA 4RIRB 4F93B 4YXKL 5CJXA 4IBVA 4G8GE 4PS7A 4N2GA 3SY6A 2OK0L 4I77H 1DLFL 1PVHA 5IW3A 3F65A 3RFZC 2UZIL 1KDJA 3MCG1 4O02A 1N6QH 3VU1A 5IHLB 2YJLA 1FP5A 1MVUB 3TVMD 3W39B 1LK3H 2HTKC 2RD0A 1FVEB 2ZXGA 4PB0L 5CD3A 3BH8B 3VQLA 4L18A 2WYZA 4PVLA 3PWNB 3BPOC 5DD3H 2VXQA 1MJ8L 4HCRL 4LOEA 1QSED 4PGEB 4BH7A 4PJ8B 5E2VH 2R4RL 1SJMA 4FQQB 4CMHC 2WXRA 4F5CE 1K3ZA 4XCNB 5JIDA 2X3BA 4GKNA 1HHGB 4Z7NB 1ZXQA 1NCHA 2KBGA 4FFZH 1ZAGA 2XTJD 2IANB 3WUWB 4APQA 5IR1A 1KYAA 1E9PA 2IPUK 3UPAA 2ZXQA 2EIDA 1AMXA 2IBGA 1SHWA 4AQAB 2YD3A 3L81A 3MLTA 1MG3C 2VR9A 4AI7A 3LH2L 4B27A 1G7JB 3REVA 4ICXA 1VF5C 1QWUA 4WKZB 5F9WB 3BN9C 4PTUB 5K39B 4J3OC 1H0DA 2RA1A 4MJIA 1B4JL 1AR1D 1N8ZA 2H45A 4HIIB 1A2YA 4I3RL 5D1ZB 4IRJA 1A25A 1YMMA 2J5WA 5BRZA 1D6EB 4HISA 3QNYA 3GSQA 1QSFA 1QI5A 3D3VA 4P23D 3L3DA 2YUWA 3VXTB 3CIAA 3FT4B 1JG9A 1KG0A 3IKCA 4I8DA 4K3EL 5F9OH 5IG7B 1FZJA 2QTEA 2QADC 4K9JA 3H54A 3KYOB 3SKNA 3SE4A 1OF2B 1S7WA 5C3LD 4WO4A 3PAVA 3D3VD 1GYVA 3KYMB 4W9HC 3ZDZF 2WQVA 1T03H 4PD4J 3L4UA 4G5ZH 4WK0B 4HF5H 4QHLB 4NCDA 1IAIL 3SKUD 3GZQA 4WU7B 4NHUA 4U49A 3IGUA 1NGYA 4QRUA 2W65B 3BDYH 3ZKMD 1G9MC 2YA0A 1HAWA 2NYZA 4R96A 1PYWA 1NBVH 4BK4A 5JHDE 5FYJE 3WHXB 3T8VA 3PCYA 5IF0A 4Y19D 3BHBA 2P46B 3SDYL 3CMOH 1UJ3A 1WTGT 3OWRA 4JJOA 1JHLH 4MBRA 5BQ7B 3FJTA 1EDQA 2YSSA 3U0PB 2F54E 5J1TC 2CGZA 3K1DA 5IQ7L 5ACZB 4M62H 2JV6A 3FUKA 1LK2B 1FFNB 3GLEA 2DLFL 3B5GA 4QKXB 5CSGA 5BQDA 2BRQA 4WO0A 4ABUA 3QJVB 2A4CA 4H8HA 3IK2A 1OARH 2X4RA 2RQ8A 1CT8A 2NY0B 3D51A 2I9LB 5CJXC 1JV5B 2YC1B 2VLRA 4AG4H 3PGCB 4XCNA 3P9LA 4OUOA 5ICXA 1ORSA 3T2QA 5EO1B 2XV6B 2EIKB 4LOUC 4DGIH 2MCAA 4JZNA 3CZSA 4HHWA 1S7SB 3DSNA 3NOIA 4WU5B 2CO4A 4MXVE 2QSQA 5AL0A 1UM4L 1LK2A 4DPAX 3MOAL 4IBZA 4UILH 2W94A 2FYVA 2ZSVA 3Q5OA 2OL3H 3RDTC 3MJ9H 3R06B 1MG2C 1C5BL 1ZA3A 2PCYA 3I6LD 5BQ7A 4G80B 5IB2B 3LXCA 3ZRSA 2VKXA 3O8XB 3RNQA 4LCWE 1UTDA 1H3PL 3VGDA 2EDXA 3OAUH 2WLMA 2FGWH 2BINA 3FH5A 1N5YL 4NFDA 1DQKA 3B7YA 5JIMA 2NY6C 9CGTA 3U4BL 3VSVA 1MDTA 3IMRA 4UBDD 5BNXD 3P4LA 2Y7SA 2XA8H 3X3GL 4FFYA 1EO8L 3MRPA 1MHCB 3NCBB 3RWFB 2JI2A 1TYRA 3VTTA 1H6UA 3N0PB 4M5TA 3W0WE 4YNYB 3V5KA 3VCLB 2X4NA 1IB5A 1SF3A 2HKFH 1NGQH 3A6BH 3TA3D 3HHRB 1L0QA 1AKJD 1RJYB 1Z5LA 3ZKND 1GS7A 4DP5X 4YFDB 1OZTG 2E86A 4X50A 1U92A 2EEDA 1J9QA 2VC2L 3C60C 3C5SA 4RNRA 3RNQB 3SBQA 1J5CA 3UO8B 1XO8A 2CMRH 3HNTH 1TZHA 5DYOB 2AGJL 4E9YA 2XSKA 4AK1A 3VWJC 1N3NA 2E6QA 2WNXA 2OX5A 2NTFA 4JRXB 5D2LE 4MA7H 4FXGB 5A16B 2YXVA 4ZO9A 3ZHNA 3FH8A 2QSCL 5D7IF 3TFKC 1R5IA 1A1NB 2YOAA 3AG2B 4XB3A 4F57H 2K45A 4M7LL 5IB1A 5AKRA 3WFCH 4PRAA 5G55A 5T33L 4P2AA 5E9DE 5CFHA 3L45A 3RTQD 1A6TA 2A74C 2AXHA 2YGNA 1KIUB 3D09A 4R7DB 5KYUB 1A7RL 4P2RE 1ACCA 1GZPA 3RAJH 1JV5A 4HGWA 4FABL 4Q6KA 4UQIM 1U3HC 5IBLC 1OHZA 2XJLA 2ADFL 1F6AA 2AJXL 3BAJA 3Q8CA 4A2GA 2LLGA 4ANVA 3IF1A 1S7SA 3DSNB 2FSDA 4OD1L 4M93B 4NWTH 3MRNA 3NSXA 3BAWA 3RGVD 4DZ8A 2L7JA 2XWCA 5I6MA 1CMOA 3ZDXF 1L9OA 4YLQT 2FR4B 1MHEB 1F4YL 1DBAL 4YC2B 3VXOA 4XVSL 3DGGB 2V3DA 2X12A 3F7LA 2P7TB 4KTDH 2A6JB 5ECGA 1HYSD 1BX2B 2IPTL 2DD8H 5KBMA 4P8QA 3UP1A 3BUDA 3K6FA 1J5OH 4HCGA 2E9GA 1WFTA 4MB4A 3MJ8A 4HETA 5I1EH 2F8OA 4APQD 3JWDL 1N59A 2QVTA 5I71C 3ASNB 3N1MC 5INCB 2FWUA 1YYML 4N9GA 3HHSB 3RVXD 1RZ7L 3IJSA 1GR7A 2Y2TA 4AK2A 4KX8A 5FYJL 1DQTA 4JPWL 5AVTB 3U1QA 3MLWH 2XG5B 4Y1AB 1T4KB 3AJ7A 2KQNA 3BGFC 3LZLA 4JB9L 4XCEB 3C5XA 1MQKL 1JS4A 3DA0A 1KNOA 4GB9A 5J6GB 1BD2A 1NBYA 3L13A 2HJLB 3GZKA 1I1FA 5EOTA 4GJTB 1OP3K 3GM8A 4FZEL 2NXYB 3DDGA 5C70A 5KAQG 3QZBA 3D0VA 4QHNA 2XV2A 3MV7E 4G82A 4KK9C 2CJTA 1F3DJ 4DVRH 2X42A 3MRFB 3V4PL 3X12A 3IWUA 4LDEB 5DWUH 2N1KA 3GMMB 4HXBL 1XX9C 1DL7H 1BYNA 1EFXB 3QUMH 1UCBL 1XTLA 3KYKH 5AB1A 4DKFH 2P47B 4EQ3A 4MQSB 4FQPA 2WOBA 5LQBH 1SJEA 1U8CB 3MRBA 2P8PA 4FZ8L 5EA0L 1AAJA 1IL1A 3OB8A 2ZAGA 1JF1B 4I9WD 2FT7A 4LLMA 3ZDXB 2WZPD 1ZT1A 3UMNA 4P46C 1WCBA 4LP4A 4DHLA 3T5WA 2BOCA 5CMAA 1E42A 6TAAA 4RGMC 1HINL 3D05A 1C5DA 2R69L 4LSRH 1HAUA 1DVSA 1OD7A 5BXFB 3VH8B 1Q1JL 1D2OA 1MCBA 2PN5A 4AH2A 3BEVB 2B77A 1T83C 3LIZA 3CC5B 5DEGB 4X4ME 4A63A 2DBJA 5BV7B 1OWRM 1E90A 4PJBB 4W4NA 3O0LA 3O6LL 2H2SC 2V2XB 4U1NB 2KYIA 5TQ0H 2R1YB 3DMMA 3LXUX 5E08L 3WEMA 3BOVA 5FYJD 1SBBA 1CVRA 1T66D 5FO7A 2GBVA 2R0ZH 3A4FA 4Z5RB 1CIDA 2VISB 2J43A 4M43L 1DLHA 3GI9L 4L1LA 4PJHA 1CL7I 4XO5A 4RA3A 1DVYA 1KLUB 1SN0A 4BQ9A 2O61B 4PB9L 3GM0A 1BX2A 4KXZH 1Z3GL 3QDGB 4FQXB 4JLRB 2WLJA 3OHXB 1JPFB 4N0UB 3VFOA 5L2JB 1ZT1B 3L1FA 3NZHL 4JREB 5BZDA 4MCMA 4U7SA 4FQXC 5FV1L 5C0JA 3CC5A 1J9SA 1RVFL 5E9DA 2WM0A 1BGXL 2Z8VC 3UTSA 4ZRGA 4A6YB 5AB9A 1V7NH 1L9MA 4FFWC 4ISVB 1KEGL 4LHUG 1DBBH 1DBAH 4FLOA 4ZOBA 5KVGL 3L3KB 2PWFA 3NJKA 2MTPA 2RMNA 2O5XL 4WFGE 2W59A 3ULVD 2A6KB 5JHDB 3Q43A 2WUBL 2IJ0C 2WXJA 4WEEA 4LEBA 3FHQA 4HOMA 1H6EA 5DEGA 1NEZB 2Z91A 1LO0H 2XBTA 3KWVA 4YZFE 2YK1L 1NBZB 1CF8H 1ZMYA 4U2YA 3AFLA 4S1DD 4OFDA 3LKSB 3SDCB 3UDWA 1W80A 2ICWB 5LVEA 4I1NB 3UGXA 4U1JB 4H0GA 2Y5TA 5KYWA 3CX2A 3NESA 5AVSB 5GZND 3RIFF 3CLEL 3IGAB 4Q0XH 1TFPA 3LS5H 4LOFA 3S5LB 2VDQL 2DQJH 1MNNA 5JW3L 3O0RH 4HWZA 2AK4B 3MOQA 4MAYA 4F58H 4NO5B 3GI8H 2IAMB 2G3MA 3PIQA 4TTDD 2JKWA 4U1GB 2R15A 2ITFA 3CDYA 1G1YA 4ETQB 3MGTB 4AYEC 3IVKB 3G5YB 3Q1EA 3D4CA 2ZUXA 4JREC 4LSUH 4LPYA 4Y4FC 1C12A 1XTMA 1WCQA 4Z23A 4H8WH 5T3XD 2KPWA 4JZOA 3I3BA 4NQSB 4N86A 3P3SA 4PJ7F 2XWZA 4HS6B 4JRYE 4Q6IB 3KMDA 1EFXD 2GSGB 3EYSH 4PG9B 4QKTA 5K1JA 4YEEA 3CVHH 1A6WL 1F2XK 5I6OA 3VFNA 2WO3B 1JWSA 4KAQL 5SWSD 3KJ6L 4AKOA 2PCPA 2FZ3A 4Z7OE 3NJLA 4HPYL 3OAZH 4CW1B 4RFOL 1CXKA 1AMYA 2DJSA 3CLFL 2CK2A 2HUHA 2JK5A 1B9KA 2X70A 2E9BA 2Z31D 4R5VA 1TLKA 2EACA 2VR8A 3WYRA 1QPXA 2D4DA 2NY1B 4JPVL 1R5VB 3V52L 2B5IC 4B3VA 4LK4A 2X88A 5CEXA 1NGXB 3BPLC 3QC6X 4AYSA 1VGEL 3TH3T 1WYJA 4W9LC 3B8SA 1G7PA 1U21A 2J6EA 5EPMB 3B5TA 1INQA 4O9HH 3QA3A 1DBJH 1ADQA 5E4EB 3BUTA 1LE9B 2L0DA 4FQLL 1TO5A 2HAZA 4XMVA 1G7IB 1NDGA 1SGKA 5L7XH 1FQ9C 1ZTMA 2E9WA 1S46A 1XMEB 1BZ9A 1DR9A 3ETBJ 4BFEA 4MQXC 3OKYA 1SDDA 4TUJA 2WTOA 3OKMA 4IRZA 3KE0A 3RPKA 5TQ2L 4NO3A 4PJCB 4OB5L 3EGDA 2DQ6A 3GMPB 1BOGA 2CBOA 3MFFB 3L7FA 4G7VL 2EO9A 2X1WL 3B7UX 1DP0A 4G8FB 1IGFH 4ZAKB 1UXSA 1F90H 2WKOA 2HMID 1EZVX 4U6YB 2L3BA 4BHUA 5KJ7E 3COOA 3ATAA 2JWYA 4YAQA 1BEYL 4PJHE 5D1XC 5JR1H 4DNLA 3UAJA 3BZ4A 4L29A 4PP1C 1E0OB 1P5UB 4GFXA 5F93C 5CP3H 1U3YA 1TZIA 4OLYH 4JEGB 5SX5H 1Q1PA 3WLWC 3FCGA 1R3LA 4TUKL 3P73A 4BSJA 5DVPA 3UTSE 1AD0A 4HFWB 1JFQH 2VR5A 4QCIB 4YSAA 4ZFZA 4Q4IA 1AOHA 1CD9B 2WOYA 1AQHA 4ETQA 2GTZB 4R0LA 4WW1B 5BS0D 3Q2WA 4DPCX 3F8UB 4PRPA 2C5DC 2VZSA 4PU2A 2AXFA 2YGOA 1ULVA 4ENED 1PGRB 4PJ6A 1VHPA 4XH2A 1BHGA 1UD5A 2HT4C 2X89A 4HFUH 1QHOA 2YAOA 4BH8B 1P5UA 1AVAA 3U83A 1P4IL 4Y5XA 1MCNA 3DX3A 4J3VA 3C6LC 5GGUA 2F7IA 5DT1L 1LP9B 5LGHH 1U8OB 3TJHC 3ZYOA 1WUNT 4F8NA 3L3GA 4F1ZA 3LB6C 1GL4B 1YJDL 3GSNH 4JFDA 1I8KA 3D7PA 4XCFH 1A22B 4L3CA 5F0MB 2DLEA 1GSMA 2ERJC 4PRPB 3JSSA 4NSKA 5I19H 3CWGA 2X6MA 5MP6L 4G5AA 2HVJA 5DJ0B 1MW2A 1OVZA 1P4LA 1I7TA 2PCFA 1V3JA 4KFMA 1YRKA 5T3XE 1BLIA 2R9HD 4HCIA 1AD0B 4HFWA 2NNXA 5AAMC 2BZ7A 1A6AB 1FFRA 1KXVC 2X1QA 3PJNA 3TIDB 1SQMA 5I66A 4KZEH 1IVTA 5DJCA 1UACH 2EC9T 3P4OB 2IWGA 2AEPH 3GS0A 4BXVA 3AS3A 3ZT5A 3OL2A 1X7TA 1XMWA 3OTTA 4UMSA 1XZWA 4HPHA 2CK0H 4B41A 5SWZA 3MV7B 4GKNB 2Z8WC 4MZ2A 4BK5C 1B88A 3BDBA 2EE9A 2ZOUA 5F7EL 2HVJB 5DJ0A 1Q0XH 5EUOF 7CGTA 3LNIA 3R0NA 1JUFA 1G7MA 2HH0L 2QKIC 3BJ91 4N2FA 3OKMB 2ZKYA 2OSLB 4CU6A 1U8NA 4P57B 2FUTA 2GHZA 2W9EL 1TQBB 5ENWB 4JM2F 3G6DL 3PL6C 2YFNA 4ZFQA 4D8OA 3Q13A 2ZPKH 4BBWA 1F6LL 3TZVD 4RFNC 3S48A 4WUKL 2GW5A 3G9AB 3UCRA 4E42B 4LLAA 2O5NA 1BVZA 2VMEA 1SYSA 2OYPA 3X3GH 1BZ8A 1PZBA 2E8ZA 2XA3A 4HG4J 5IJVA 1PDKA 4MJ4A 4P23C 4RIRA 5JW4N 3I2CH 4TULL 1OHQA 4HUWB 2IALB 3M1BA 4M8QA 4KVCH 3K2MC 1H15B 4H8PA 4ADJA 4JFEA 3QEUB 1S7UB 3LCYA 2R8SL 2VQ4A 2AVGA 5A1AA 5DLMH 1KEML 3KS0H 4XC3H 3GK8H 5AB0A 4OT1H 1EVTC 4OD1H 1HH9B 1U33A 2QLYA 4PRBA 4QJ5B 3C08L 1RUKL 2EUVA 5G2NA 3QI9C 1XH0A 3DUSA 4IIQC 4YEFA 5KUKA 2QDWA 4GS7B 3DURB 2MQ3A 3LZOA 1BAGA 3HCVB 2NW2B 4MGXA 3RL1B 4BINA 3WMSA 3VX0A 1E9QA 2AK4E 3HBGA 1F1GA 4XBMA 3L8QA 2GJ6D 1I3UA 1KFAL 5ESVB 3L3GB 1DBJL 4ODSL 4I2XB 2QQQA 3QORB 3SGEH 2Z64C 4XTRC 2ROYA 1TTFA 4P2YA 5JQIB 4IDJH 4NQDD 4BA0A 2YKKA 3C5ZB 5EU5B 3B2XA 1C7TA 3BUQA 3FQWB 3O6KL 4HIPA 4LIQH 1X5KA 4JO3L 3ZTNH 1DQDL 1I7ZA 4LCWD 1G5GA 5LUMA 3NGBB 4NDMB 1TTUA 5EC2B 1WWCA 1ESOA 4ZTPL 3PP3K 4KTEH 1RERA 2Y07L 4N90E 1ZTXE 3BW9B 3I6LE 1A4BA 2E59A 1HN1A 3KGTA 1WEJL 4KI5E 4KXCA 5DQ9A 4L4JA 2NCEA 1KBVA 1SLVA 4OQTH 2ODHA 5DGQA 3L5WB 4XVUC 1AS8A 3D8MA 3UBXA 3PXLA 1CBVL 2CBPA 3K2UL 3VGAC 4R26L 1RK1B 1R33A 1U8LA 2F5AL 5GGVL 1G7MB 2G5RA 1SXCA 1J8SA 4QF1B 4R97C 2EDQA 3ZQWA 1B9ZA 1RSYA 5B1AB 5ICZB 2Z8SA 4WW2B 3U6XS 1IGCL 2XDHA 2FT6A 4FD0A 3EFFB 4WI0A 3FQ2A 5IJCC 4P9HC 3AU0A 3BW9A 1OTTC 3KJ6H 1SOQA 2XTJB 2JKNA 3DX4A 2QHRH 1NBCA 4P23B 3K6SB 1TJIL 3A6OA 4NKMA 1KLGA 2V17H 4DGYH 3PDOB 1WS8A 3H9SB 4HJIA 4JM4L 2VDNH 5DA0B 2ZUYA 5A6LA 4HIXH 3KVDD 1W6LA 2WXFA 5B8CB 1NEZG 3UEQA 2IWEA 4AMKH 1AR2A 1Q9WB 3BKCL 3WL9A 1SY6A 1ZIAA 1UB5A 2FAUA 5AKSA 4DZ8B 5A2LH 4AGQA 5IF0B 4BQCA 4Z7UF 4GXVL 4HS3A 1CLOH 4LCCB 1J1OL 2I07A 4LRNL 2C4FU 2Y25A 4YNYA 3ZX1A 3QXDB 5EO9B 2XV0A 2ZX7A 1N18A 1HVXA 3D39A 1EBAA 1R3HB 4X9GA 3WEAA 4B3EA 1F6FB 1CGXA 3HB3D 3BJLA 3N42B 1HE7A 1OO2A 2FEDD 4CADA 3BAXA 4GQZA 3DURA 1AC6A 5DYFA 4N26A 1KFAH 3E8VA 5FFOA 1E28A 3QIUA 3SE3C 3FFOA 4XP4L 1EZSA 5B3NA 3G04A 4NX0A 3ZE0E 4S0HA 2VJ0A 5LHDA 2E4TA 1V5JA 4ZMOA 1SVCP 2MKLC 3QO1A 4J3WA 1NAMA 2CKBL 3D52A 1YVLA 5I8KL 1VRSA 2FE0A 5PAZA 4DK3A 4ZMWA 4RZKA 3QNFA 4OKDA 4DZBA 1URIA 2ZJSL 4Z7UA 5HJ3A 1M3IA 3VSUA 4JVUA 4R4BA 1XHHA 4Y16A 4WWKC 1KCKA 2AW2A 5BVPL 4PRIE 4TNVF 4KAQH 3MSPA 1QUNB 4IIQA 1L6ZA 1PZ2A 4NENA 5HPMA 4FADA 1XT5A 2GK0A 4OLVL 2HFEA 2WKLA 3G6JF 4XBEL 5DU7A 5F7DB 1XF5A 4DO6A 4NQXB 5I1HH 1PBYA 3QUYC 3OZ9H 3QIUB 4YH6A 1NFDF 5KYNA 5SWSB 1BVLA 2P28B 3JWOL 4QRPA 1IGTB 3A22A 1IGYB 4V1DB 5E1IA 3Q6GL 3GMLA 5FYLL 3T08A 1DQQB 2JJVA 2NZIA 4HT1H 1GGBL 2QPUA 2EYTB 5HYIA 1J0HA 1X5ZA 2F1AA 4YDVB 4N2OA 2ADIB 3UYOD 2XV3A 3H3BC 2EIZA 3OLGA 4JJ5B 4CKQA 3DVGB 3QHTC 4BGLA 3KLLA 1A65A 3SOTA 2FR4A 3LEVL 2AZAA 3ULUH 4OSUL 1NJ9B 1DFXA 1N19A 1JXGA 4EXPX 1QFWI 4P2OD 4GKLA 5SWSA 2I9TA 1T2XA 1A6UH 1HS6A 4G70B 2A9CA 3CHRA 3TZVB 3MLSH 3P3UA 3MN8A 4WI8A 3TPUB 1VEPA 2OJEA 4QRQA 5AW1B 3FT2A 1FE8L 3B9KB 1EMTL 1NC2B 2FX7H 3T04D 6PAZA 2F1BA 3LEYL 3MV9E 3NCJH 4NPJA 1E4XL 2VDPB 1TZHB 4HP5A 4M9OA 4XXWA 1HWWA 4A37A 4YUEH 1JJUA 1KTBA 3H2WA 4HMEA 4MTMA 5D7SH 5DD5L 5IBUB 1G6VK 4AWJC 4B96A 1M7UA 2Y06L 3QJXA 4Y0GA 2X2JA 3I75B 5TK4A 1I8UA 2BVEA 5IFJA 3HE7B 4HEPA 4K7PY 3QQXA 15C8H 1G6RA 3OGOE 2FATL 3QJTB 1NAKL 2I7SA 4YHYB 4G3YL 2PR4L 5FKAB 4X5PA 5CBEA 4K23H 2BIOA 4QDGA 5CLYA 1WSST 5KSAC 4BZ2L 3BSGA 2C7FA 4M4RA 1K72A 3GS7A 2Q8BL 3AM8A 1W8OA 3FN0H 4AY0A 3MJWA 4JRXD 3UZQA 1M05A 4M6MH 3WNLA 3NCXA 1T3FA 1C1EH 1PCXA 1UATA 2Z6FA 4KV5E 4XMKH 1GOGA 4R5XA 1CURA 1OP5H 3SDCA 1OB1A 4HS8L 1V8HA 2JB5H 1RHHB 1ECZA 4N90D 2QQKL 2XUWA 3EO0A 3EJZC 1ZGLM 1XCXA 3B43A 1G7HA 4ZMQA 2GK0B 3GDCA 5T5FH 4K94H 5IUSA 2ZOTA 4M1CC 1QR1A 2B20A 1DBKH 4YHZH 2J1WA 2VB5A 1E27B 1BQHB 2Y6TE 4LLUA 5GRYA 4A04A 1I8IB 3DJTA 3BT2L 4V11A 3EYVA 1SRDA 2ZUUA 2ICWA 3GMOA 4DQAA 2EDMA 4J8QA 1JGDA 1W0WA 2Y06H 4W9CC 3ZUNC 4LNVA 1QNZL 2GAZB 2IAND 2M2DA 2NY5L 4HWUA 4WV1A 2KERA 1BJ8A 2XN9E 2WZ6A 1GA2A 4C56D 1HIMH 1ROCA 2G30A 5FO9B 5DJ2B 4QT5B 1AI1H 3F6JA 2B16A 1OGTA 2DMBA 1SM3H 1T21B 2AQRA 4OCSL 1E2VA 3HI6H 1UEYA 3QGVA 1CZ8H 2V2WA 4Q9BA 4PRIA 2WSKA 3E8UL 2J44A 3RKPA 3QIWC 4L8DB 2BCKA 2IDUA 4PLKC 3VD5A 1EHLL 1JNHA 2CMRL 5D1ZC 3UAEA 4F7MB 5JPNA 4JFXA 5IOPB 1TF4A 1JGIA 2OSXA 4YDZA 1KJVA 4Z8FH 2V4LA 5HYSB 2AITA 3OM3B 4UIMA 2H7WA 4QRRA 3GSUA 4KUZL 1TCMA 1AJ7L 2APWA 1QLEL 2ILLA 5MENE 2RQEA 3RP1A 4J2QA 4E41D 2IH9A 3ARFA 3HAEG 5I15L 1YYMH 2JKSA 3GTVA 3BMVA 4HBCL 3WSQL 5I73C 3OKNB 2CRIA 4FXKA 4X8CA 4Z3GA 3SCMD 4KXDA 3IDGB 4WI9A 3BP6A 3HZYA 5FFLA 1SEBB 4PEEA 3O4OC 1OAUL 2BK8A 3SE4C 1NCUA 4LZKA 4OIIL 1IKNC 1NMBL 2W81C 5SWSE 1AXTL 4HEME 4MCYA 2K9UA 3O81A 4L8DA 4WCYL 3P3YA 3O2DH 2D7NA 3I6KB 2VR7A 5DI8B 2ICES 5FW8A 2CJUL 1D5XA 1OTUD 4AEHL 2YRZA 4PH8A 3FU3A 4KMLB 5F6IC 1AQKH 1NCWH 1UM5L 3CFMA 2VLJE 3EYQD 5CZVH 5HJDA 2F58H 4JQVC 4F15B 4AQ8A 3OZKA 3HC4H 3P0GB 1TQWA 2DQUL 4JDTL 5C0FA 2ATKA 4IDJL 4P3DA 3CFCL 3CFBB 2QBWA 3KM1A 3FDWA 3UPRB 3EYVB 4X7TA 5EZOL 4NLAA 3O0RL 4IS6A 2O26U 4KH9A 5C7XL 1WFMA 1MCQA 4A6YA 5DI8A 3OB0H 2PF6A 4YSRA 1BFVH 3BXNB 3CFCH 1N68A 3F7YB 1TZIB 2AXFB 2HRPL 4UQAA 2VW7A 4HC1L 1YEGL 1PX3A 5I1GL 3OKDA 1TO4A 2VN3A 1BWWA 4QOKD 4P2QE 1FCCA 4HKJA 2AC0A 4UNTA 3ESOA 1HQ4B 3P0VL 3K1KC 5F44A 4D9LL 1OB0A 3GLDA 2PETA 3LKOB 2Z35B 4IRZH 5BVJB 1BIIB 1WPCA 2V8MA 3GSOB 3IMVA 2R0ZL 4ADIA 3LSOA 4HOWA 4P3CH 5I1CL 2VIRA 3KDMB 1ERNA 4D3CH 2WD0A 3A6BL 3D2UA 4RGNE 4FERA 4N6QA 5T5FA 3S8FB 3NIDE 5HGBA 2D73A 5I9QB 3QG6B 3ARGD 2B59B 4C56A 3ULUD 3RWDA 5DQDL 2WZ5A 5HYSA 3D2TA 4FEMA 2WYIA 5E6IC 3SKMB 4E2OA 1PKQB 5IVXA 3RY4A 2PCFB 3HR5A 4PGEA 1EXHA 3MLZL 4PJDE 5T1LD 5EPMA 2W60B 3MODL 1BEXA 1XCTA 3O11A 4M62L 2B7DT 2APSA 1E65A 2VZ1A 1DCLA 3BAEL 3UBXG 4AJWA 2WYHA 4DP4X 3ULUE 1U3HA 1EX0A 5SX4I 3BUYA 5TFSH 3SDYH 5F7WC 3JV6B 4GQ9H 3VXSD 1YQVL 4LVNB 1JD9A 3FFDA 2A73A 3CG8A 3INOA 4OQTL 4Q6IA 3MHZA 4CDHA 2NY2C 1F3RB 3BLKA 3QR2A 2YXWA 4N3TA 5AD0B 1BIIA 3GSOA 4U1LA 4XNBA 4R4FL 3ATDA 2W60A 2XPYA 5EORH 1INDH 4L8SB 1WWBX 2LU7A 1NSNL 3AAZA 4CVXB 3QWRA 1D5XB 4PW4A 5JYLA 2AF2A 3QJFA 4Q2ZB 1D7CA 2IPKA 4AYID 3BP4B 4B0MB 3DK2A 3LYRA 2RALA 2LW3A 1R1CA 4NC1C 1H5BB 2A9AA 5GHWH 1PMYA 1IMHC 4HZLA 1E4XI 1RIUL 4ZYKA 1JK8A 4WFFE 3RI5F 4X7FC 2TSBA 4P5KB 2WLLA 2CIKB 2BIHA 4IGBA 3UPRA 3WIHL 2M1KA 1I53A 4HUWA 4JFQB 3K0WA 4Y4FB 1NUNB 3CN4A 1YAIA 3TURA 1NL0H 5ETUB 3UCQA 1DBKL 4YHZL 5EUOE 5K69A 2UWEF 3KHQA 4N2MA 5DHVH 2X6UA 4S1QH 4H44C 3VW3L 2ZONA 3U9WA 4JDEA 2IALA 4M8QB 1J8HA 1WJ3A 3DUSB 2PP8A 5JW4R 2F19L 1IFHL 4ONFH 2WBWB 4XXCC 1SYVA 3O6ML 3QQ9C 3K8LA 3RTLA 2EDEA 4LPTA 5HYFA 4LLDB 4PP2A 4EQ2A 4AGMA 2J2ZB 4AQAA 1JP5A 4PGCB 4L37B 3VWKB 5AAMA 3KLQA 5LDUA 2MCPL 4EAEA 2ZKMX 3FQYA 3RY6A 2F7QA 3NJVA 4JN2A 4FXLA 3TBTA 1AZCA 4J5VA 3DJZA 1IQWH 3NCCB 2CKBH 3IT8D 3FCTA 1VFAB 3VE0A 4GG6A 2E47A 3P73B 5D6DA 3C5JB 4NC0B 1TG8A 2VW6A 5ENWA 1RZJC 3SGKC 2MPVA 5JMOC 4HX1A 2HTKD 4YPJA 2YQ3A 1MFBH 5D6CB 4DW2L 4HALA 4YWGL 3T0XA 5KVMC 1EDYA 4HQQH 5DR5L 2KT6A 3IDUA 2Y7LA 1Z9SB 5D2NC 4OB5H 2UZPA 3U4EB 1HJCA 1SN2A 3O9WD 4W9FC 1KJ2B 4KK5C 4WEBL 4Y16D 5HVWA 3TWCH 3NT0A 4U6HA 1E7UA 4CKVX 4WZ9A 2WPGA 1MJUL 5E6ID 4H0IA 2PO6A 2IMMA 4AXWB 4QEGA 3IGKA 3U82B 3PFQA 4ALAH 3TV3L 1PD6A 2R7EA 3CZKA 4N5EC 2QR0A 4GW4B 3Q5TA 1HHGA 4KUCD 1QQDB 3V7AG 4N0FA 5JORB 5L0QB 4OCRH 3OPUA 5LG6A 3RFZA 2A9ML 1KCUH 5DVOA 5DJZA 2O72A 2FO8A 1RMFL 1LO5A 1VFMA 4NOFA 3WHE1 1JRHI 1EGJL 1A8ZA 1IQWL 4MA7L 4QF1A 1HL9A 1UHVA 4WUUB 2XACC 3FU6A 1A3RL 4XP6L 1UURA 3QO0B 2GITA 5G4MA 1ET5A 3D2UD 3QS2A 3U46A 2FK9A 3FU7A 3W82A 5L4FA 1THCA 4H25A 4UM8B 3WKMH 2WXIA 5LNDA 1ACZA 4MJ5A 2Z31A 3G08B 2P52A 1JK9A 4G8GB 1YMMB 3LZRA 5B7EA 1E6JH 2UZIH 1WA1X 1FL5A 4R2GC 5ANMB 1HI6A 2B1AL 3NJJA 4J4PA 1OCWH 3PLYA 3HG4A 4OCLC 3CVHL 5CXPA 2OMUB 4MZIA 1H3PH 4HJEA 4HWEL 5IG7A 4PJIA 3VD0A 1XZ0A 1AKJA 3B6SA 4PP1D 5AZ2H 4N0FB 4XP5H 4FG4A 3K81A 5DHMC 3QO0A 2V9TA 3ZQ9A 3BPOB 1GOFA 4NPKA 3QXDA 1PG7X 3WKQA 5I6NA 1IBZA 2I60L 2DQHL 1JNLH 4PJ5E 2P3YA 4LPCA 4WNQA 4YSPA 1ITCA 1MLCB 1GY2A 4FYSA 3B37A 5FO8A 3B7RL 2ZF8A 1MPAH 4M8VA 3N55A 4P9HL 1EFQA 3FB5B 4X5WB 3CXDH 4IGBD 1LYQA 5GGTL 4LP5A 2OXGA 4IBQA 4OTXL 5F89B 3T6VA 3IJ7A 5TDNB 4ZQKB 1MPAL 2Y1ZA 2IWFA 3RZCD 1T1YB 4Y2LA 2NXZC 2WZ0A 1J87A 4I18B 1YZZA 2F58L 1UZGA 5GS1A 1IJ9A 4UTCA 3SCMC 4I88A 3F01A 2W07A 2DJMA 1BFTA 3MV7D 1SHSA 4Z7VB 1S4IA 5F72S 5IW6A 4RQQA 3OD3A 5FO8B 1VENA 1Y6MR 2X2YA 3NIFE 2WUBH 3PL6D 3L3JB 2VABA 4F8LA 4HU2A 5GJTH 3NH7L 2VDOB 4F8PA 4YE4H 1PY9A 3OGCB 1OAYL 4YDVA 3VXOB 1NDMB 4Y9GA 5TDNA 2V17L 1TQCC 1ILUA 2DQUH 1I7UB 5D1XB 4FI7A 4OIFA 3P9LB 5ICXB 3HE6D 3QDMA 3ZTCC 1MJJA 2C1OB 2ZUQC 3O2DA 4CU8A 2BSTA 2OV0A 4DP8X 2AQ3A 4JZJC 4N2BA 4OQ1A 4S2SA 3IDXL 5EBMB 2XWRA 2HRLA 1EDHA 2W38A 4ZQKA 3QUKA 4JDVB 1R5IB 4HBCH 4Y89A 2IOOA 4Z3HA 3VMNA 1W9XA 3GSNA 2CH8A 1B2YA 4CNIA 4N5UA 2OX5B 3BC9A 2OBGA 5FDWB 5B39A 4ZFOL 4TM9A 1X5GA 1DO5A 1WBYA 2VE6A 4NRZA 4KO9A 2VO5A 4OFVA 2CR0A 1IT9H 1YEFL 1FAKT 4MJIE 3UYRL 2XWTB 1A1NA 3UJIL 5ANMA 3WDIA 4RAUA 3G5ZA 4D8PA 1WVZA 1T5XB 3FO9B 3Q8AA 1X5JA 2J8OA 5EU6E 3SDCC 3MI6A 3D3VE 5BJTA 3WSQH 1B4JH 3J07A 3RB5A 1MCIA 1BIHA 3DXAA 5CP7B 2NY1D 2DMKA 5JHLA 1ASQA 3EJZD 4ODWA 1RCYA 1HNYA 5EOQL 1TNNA 2E7HA 4J3OF 4NQXA 1QACA 1E4JA 3CLEH 4AJYV 4N0YL 2IMNA 4HW6A 1N4XL 2WUCH 5CSZB 5E8OB 3WFEL 4HUVB 2XN0A 4XBGB 1EANA 1ECYA 1T2JA 4P46B 4QTHA 4UTAH 1JZEA 1MJ7L 3GSNB 3TU6A 1Z0MA 4P0DA 2IQAA 2GABA 5IB3B 2QKSA 4AEHH 3B56A 1CFBA 1RLWA 4DQOL 2OFQA 4NQUA 1EJFA 1QTYT 2XZZA 4ONHB 3MXWH 3CK0H 4WWPA 3RDTB 1BVOA 4HS3B 4D0BA 5K1VA 3UJJL 5TF1L 4OGXH 4K3JH 4AE1A 3H42L 4JHAH 5I1IH 3B2VH 3H0TA 4BSWA 3NABH 4WI3A 5CFAA 1F3JA 1RD6A 4IKLA 4OF7A 3MYJB 2DYRB 1ET8A 4Y2OB 4ODUA 2IF7A 2JI1A 2YEQA 1RZFH 4JQIL 4EI6B 4FAAB 4KY1L 4PRAB 3TASA 1YEIL 5DZNA 3JT0A 4X99B 3EBGA 3HKFA 4Z0BL 4UNIA 5C0AD 4GW5A 3KWTA 3QXAB 4OCYH 1PPIA 2NR6A 1OGPA 2Y36H 5T1KB 2K78A 4KOCA 1J1XH 1I8LA 2JLLA 3O41A 3D87B 4Z0BH 2F0CA 4PBDA 5EOCJ 5T1DH 4U1IA 5KW9H 4UAOB 4XC1H 1AJ7H 1T1ZB 2WP3T 15C8L 2CRMA 3VFPB 1QFUH 2BCKB 2Q9OA 4HXAL 1MCPH 3WHE0 3BH4A 4B53A 1X4YA 3CFEA 2F54D 3MRLA 3VO0A 3FN0L 3CH8A 1YN7A 3WLBB 1YSOA 4GKOA 1EJOH 1WC7B 2EDJA 3QQ3B 4GKSA 1PLGL 4KI1A 2X05A 3DMMC 5HHXH 4DW2H 3GUTB 3TH4T 3ETBF 4XN4A 3ESVF 1K6QL 4OLZH 3N1FC 3VJ6B 5D2LB 3QNZA 4KQ0A 2VDKH 3OG4B 1MY5A 3G9VA 3QH3B 4XRCB 4DKFL 4HV8A 5HYJB 2VL5B 1U8IB 3QWQB 4G6AC 3KPNA 1PTZA 4XODA 3LZPA 2FD6H 4G8EB 2DQTH 4I3SH 3RVTD 2DQDL 3TCTA 2NNAB 1IAKA 3ZL4L 1YO4A 3HZVA 1U41A 1YECH 3V9EA 5C09B 3F7RA 2XWJA 4YDNA 3QS3A 2K7QA 4X6DB 1ZT7B 4U1MA 5E2UH 5C0CA 3V4PH 1UQSA 3V7MA 3ARSA 2YN5A 5EEWA 2Z9TA 2WWKO 5E7BA 5EU3A 2PXYD 5DZLA 1QW8A 3I9GH 1KY7A 2VN6A 2FX8L 3ECQA 2RH0A 2B2XH 4GEJA 5F2FA 1BPLB 4H1LA 5ALCL 1R3IH 3NDYE 5DZJA 2WLIB 3QDGA 4FQXA 4JLRA 1KOAA 2NZ9D 1ND0A 5F7HA 3GLZA 5EBWB 2HX8A 4JKWA 4NJ9L 4Y4HD 3IXAA 4CDGC 3KPOB 4XPTL 3CQPA 3V10A 1UD4A 5AOLA 3HC3H 3BSZL 1XXFC 3DXAE 1F00I 3VJ6A 4QAWA 4Y2DC 2WBJA 2A6IB 3DOSB 3VFRA 4FQ1H 1LL1A 3VSTA 3VAEA 2I7OA 3D50A 3MLUL 2WCSA 3MNVA 3QR1A 1ID2A 1I9IH 4LSUL 4CAGA 5DTFA 2CR3A 2X44D 1AS6A 5GISH 3CBRA 2CIIB 4RMTA 2Y1VA 1GC1C 1U58B 4OCMC 4EKJA 2NY0C 3NACH 3RUGB 1XGYH 4KTDL 3DIFA 4P2RA 4NQVA 3ZMRA 3ARZA 2MHAA 3UTQB 4JPQA 3AT9A 4KC3B 3RIAK 4BCXA 4L4VD 5LBSH 3CDCA 2DLHA 4KXAA 4IRSA 4ZTOL 2C9QA 2UUDH 4TNWF 2J21A 5LAPA 3ABZA 3LSOB 4H1LB 2R0KH 4PI0A 1X9RA 4IJTA 4FABH 3EGXA 1J0YA 1MAML 2J5LC 2VXSH 3I50H 4HKZB 2ZOLB 4HC1H 2N0KA 1NM4A 1S8DA 4HKJB 3KWWB 2FH6A 3OJ2C 5L8LB 1E5AA 2B1HL 2MOGA 4LLUB 2WUCL 3QCUL 1JPFA 4N0UA 3TCXA 3LMJL 5HD8C 3GB7A 2BNRB 5J56B 3FTYA 2EDWA 3FQNA 3GWJA 4GQQA 3EDFA 1YNTF 3ZTEA 4WV1B 1FVCA 4YBLB 5TD4A 3K4DA 5D4JA 1D5ZB 3L1GA 3EJCA 2ED9A 1D5IL 3FQTA 5EZIL 5FECB 5D6DC 2WV3A 5JXAH 5CAYB 5DVKA 4L1DA 3ZL1A 2LU4A 1OE1A 3FS9A 2PYEE 4X8GA 3VD9A 2VDMB 5HDOA 3V6FA 3QUMA 4IBSA 5D71L 4UWQB 5J9PA 2VM3A 1RZIB 2V37A 1CXIA 3MTXA 3MBEA 4GRLD 4IS6B 4NQEE 4U1SB 4XBPA 1QHPA 4ZO6A 4ES9A 4QWWD 5CD5C 3PWVB 3Q06A 3TN0D 3O6LH 2O6EA 2J7LA 2J3SA 2BNUB 2E56A 2Q86A 2F53A 5D5MA 4KNQA 4Y4HA 1SXZA 4LGRB 3RBSA 3IDXH 2WXNA 4PJDF 1L9NA 2EVGA 3AREB 3WJLA 3QRFM 1LP9A 5J13B 3UIYA 3KLAB 3I02B 1ZGLB 3ARFB 3BAKA 3OKEA 5E2WL 4G5ZL 2D0HA 2AMUA 3GRWA 2G75A 3BAYA 4X5LA 1XD1A 1MFDL 2MH4A 2XA8L 3BFQG 2P45B 1BQHG 1KIQB 3P4MA 3VXUD 1Y1UA 3ARQA 5C0BA 3BKYH 4LCYB 4GIPD 3V0GA 4TRPH 1M57B 2C4XA 5F88A 1U95B 1T0PB 4ZUSA 3CH1B 3V95A 2LVEA 5AQ0A 4Z7WB 1KXQA 4H26B 5CILL 3TYFA 1UT1A 2C3XA 3HE6B 1T7VA 3PHAA 2DKMA 4BRJA 3UPCA 4P2RB 4XP9L 4E9WA 3DVNA 4UV4L 2YPVL 5HGBB 1M9SA 4GMTL 1KT2B 2VDMH 4HZ1A 1MHHA 1JCKA 1HKLL 2J2ZA 3ILPA 1IJNA 5L4MA 4OCSH 1P1ZB 1KEMH 5E23A 1DANU 3W39A 1FLRH 2JCCF 5JQHC 4OI8A 3HUJB 1DJGA 3GMQB 4OFYA 4Q6YA 5KBKA 3S9DB 1E4KA 3T9WA 3F3HA 1MCSA 2G75B 4LU5H 1ILSA 2CDGA 4PJXE 3MMEA 2X4SB 3A47A 3HEIB 1RZGA 4PGDA 4YN3A 4NRXA 4X0KB 5FUCC 5F88B 3R7QA 2A0LD 2R2HB 4AT6B 2YPKA 4PJFB 1TVHA 4PGJA 1S5HB 2NY0D 2UWEE 3VXMA 2AEQL 4JFFE 4NYLA 4Q56A 4QRTA 2E75C 5GIRB 4UZSA 1A66A 4IU3A 1XF2B 5IQ7H 1NMAL 4GY4A 4NRYA 2DD8L 2I24N 3JYBA 4HZLB 1YPZF 1M7IB 2N4IA 1I8KB 1LEKB 3SDDB 1R17A 4BELD 4FLSA 5TE7H 4PCSA 4TSAL 3WFBL 4JHAL 3HR6A 5I1IL 5I0WA 1G9NL 4A2FA 2FL5A 4TTDC 1A3RH 4XP6H 4K3DL 1HZKA 4LPXA 5GSRB 1IIKA 5H2BB 3C12A 3DV4A 1GZHA 2NNFA 3U2SA 1I3RB 3FB8A 5BS0A 3VG0L 4MWFB 4QHMB 2HFGH 3KZ8A 1QUPA 4PRDB 4UQ3A 5A2KH 3CXFA 3SQRA 3S34H 3BP5A 2XWBB 3TO2A 4JFQA 4Y4FA 5HYJE 1U8MB 1Z32X 2GTZA 3MJ6A 4WW1A 3T71A 1C8PA 1ED3A 3QWRD 1S9VB 1DTUA 4YDLB 2KLSA 5FGBA 2AABH 4UIKL 5DUPL 3D3VB 4AQOA 3CFUA 5IROD 4PJGB 4X5QA 3WEOA 4R3SB 2JVUA 3KYKL 3JUYA 1CBJA 1JK9B 5CLZA 4HVBA 4JHZA 3AZUA 4JKPH 3AGVA 2KI6A 3NTCH 4JRYA 4TF4A 4AJVA 3OZLA 4UQBA 5I8OL 2CKNA 2P8MA 3F83A 1CFTA 3V4VA 3VD4A 1KELH 1MFBL 3F84A 4K07A 4K7FB 1NCAL 2F53E 1MW3A 5D5ME 2N1TE 2JJTA 3DC0A 4LMQI 4YHMH 4RMVA 4TQEH 1MRCH 4G8AC 3ZRCC 5K59F 4TTGA 1OSZA 2V2TB 2C1PA 2JSFA 2WVTA 4ZUTA 2WWMC 3U4EA 4KDTC 3ROLA 4L3FA 2GVYA 1X5IA 3FTVA 2IAMC 4JRYB 4MLSA 4BFNA 1SBSH 1A5FH 4HT1L 5C0BE 3UAJD 4KY1H 1Y0LA 4PGBB 3IJ8A 2DTMH 5IEKB 1XXDC 5J7CC 1NBQA 5DQDH 4LCUA 2WINA 3LS4H 1N70A 1VA9A 4V1DE 2HH0H 1G1KA 1T20A 1RURL 4OGXL 1FNEB 3STZB 1JGUL 2VCOA 4N5ED 5EIQA 2FWOB 2FNWA 2CBMA 3FXIC 1OCCB 3B2PA 4ZXBD 2VUKA 3VWKD 1JPTL 3NABL 4PWEA 3WIIH 4EMZA 4XPBH 1KPVA 3S7GA 5HHPA 4AEFA 1U8NB 1MCRA 4P57A 1PY4A 1P9MC 2P42B 4G7VH 5E0FA 3CK0L 5HP5A 2VTFA 4G7RB 1L9RA 2J6EH 2NTFB 1UOLA 5MEPA 4IYKA 4XN8A 1IKOP 1OSPH 2OPCA 5CHNA 1P7HL 3WN5B 5DSCA 4XNYH 1T6BX 2HLFC 2MQGA 3POCA 5H37G 4QRFA 4I2XE 2DV6A 4HAFA 1CG9A 2R2CA 3WFCL 1KULA 4QUOA 3OJVC 3QK0A 1XF3B 3O9WB 3EO1A 2A0LC 3QUXD 3LKNA 4KY2A 1S9VA 3ZYJA 2DYPB 2NQCA 1VLXA 3ZMNA 1JNLL 2VO8A 4CNIB 2DDQL 2FCBA 5ISZB 5EU6D 2X4NB 2NQ3A 5CO1A 3HVDA 2CNZA 3MLRH 1BSIA 3SQOH 1PLAA 1L5GB 2YXFA 1QA9A 1HH9A 2PYEB 4DP7X 1WUZA 2FWLB 2R51A 2OS7A 5KG9B 3MRPB 1OM9A 2ORBL 4RH4A 4E9LA 3HCVA 2GQHA 4ZAKC 2QQLH 4JFFB 5BJTB 2AJZB 3DSFL 3HG1E 2W5PA 3U1PA 2QR0B 4JFHD 2OMWB 1CTNA 3BKML 5IVOA 3WIFA 3GEFA 4NN6B 5DK0A 4P2RD 3L48A 1HCYA 1R3JA 3JWNG 3FUHA 3DO4A 1CFNB 1D5RA 3F7VA 5JLZB 1E4KC 1U8QB 4S1DC 4YBLC 1P1VA 5KSUB 4EPSA 4EKXA 3IDJA 4MAYD 4O58L 1IEBB 1CGYA 2J8UA 4KXZI 1Q9WA 3HRZA 3KCPA 3BE1L 3MRDA 3GXMA 4RQQB 2A74B 1B3JA 5HHQB 1GMEA 5GS1C 5IMKB