1AHQA

Recombinant actophorin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
GIAVSDDCVQKFNELKLGHQHRYVTFKMNASNTEVVVEHVGGPNATYEDFKSQLPERDCRYAIFDYEFQVDGGQRNKITFILWAPDSAPIKSKMMYTSTKDSIKKKLVGIQVEVQATDAAEISEDAVSERAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the actin-binding protein actophorin from Acanthamoeba.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Actin binding protein
molecule keywords ACTOPHORIN
total genus 35
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1997-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1ahqA00
1ESVS 2D8BA 3EH1A 3CJBG 4CBWG 1TMWA 1PD0A 1F7SA 1M2VA 3A5LS 1WFSA 3EG9B 1VKKA 3DAWB 5KYXB 3FG7A 1SVYA 1KCQA 2NUPA 2LXXA 1D4XG 1T2LA 1RGIG 1V6FA 4S10C 3EGXA 1X67A 1NPHA 5KYYA 1Q8XA 1AHQA 5A1MA 1UDMA 5KYNA 1CFYA 3EGXB 1SVRA 1P8XA 1J72A 4Z94G 2LLFA 3EH2A 2VILA 5KYXA 2I2QA 5HVKD 3A5NS 5KYWB 2FH4A 4LIZA 1M2VB 2KVKA 2FF3A 3TU5B 1NMDG 4PKGG 2XFAA 1HQZ1 3EFOA 2VACA 5KYYB 4KEFA 5IVUA 2MOTA 2FGHA 1COFA 1YAGG 2L72A 3EGDA 4CBXG 1DEJS 5HVKB 2VIKA 5KYUB 1MDUA 5L6WC 4PKIG 2XF1A 3FFNA 2HD7A 5KYUA 3EGDB 3CI5G 1M4JA 2FH3A 1CNUA 1QPVA 2W0IA 3EFOB 3L50A 2NUTA 1Q8GA 4PKHB 1EQYS 1WM4A 1T3XA 3A5MS 1AK6A 3CIPG 1C0FS 1NM1G 2FH2A 1H1VG 3A5OS 1VFQA 5KYWA 3FG6A 3EG9A 5DD2A 4JD2H 4KEEA 4BEX1 5FAFA 2QTVA 4CBUG 2FH1A 1WNJA 1NLVG 2MP4A 2NUPB 1M2OA 1YVNG 1SVQA 3Q2BA 1JHWA 1TVJA 2MV2A 1P8ZG 4KEDA 5FAEA 1PCXA 2LJ8A 2FF6G 1T44G 3CJCG 1AK7A 3FFKA 1T3YA 1PD1A 2NUTB 1D0NA 1C0GS
chains in the Genus database with same CATH superfamily
1ESVS 2D8BA 3EH1A 3CJBG 4CBWG 1TMWA 1PD0A 1F7SA 1M2VA 3A5LS 1WFSA 3EG9B 1VKKA 3DAWB 5KYXB 3FG7A 1SVYA 1KCQA 2NUPA 2LXXA 1D4XG 1T2LA 1RGIG 1V6FA 4S10C 3EGXA 1X67A 1NPHA 5KYYA 1Q8XA 1AHQA 5A1MA 1UDMA 5KYNA 1CFYA 3EGXB 1SVRA 1P8XA 1J72A 4Z94G 2LLFA 3EH2A 2VILA 5KYXA 2I2QA 5HVKD 3A5NS 5KYWB 2FH4A 4LIZA 1M2VB 2KVKA 2FF3A 3TU5B 1NMDG 4PKGG 2XFAA 1HQZ1 3EFOA 2VACA 5KYYB 4KEFA 5IVUA 2MOTA 2FGHA 1COFA 1YAGG 2L72A 3EGDA 4CBXG 1DEJS 5HVKB 2VIKA 5KYUB 1MDUA 5L6WC 4PKIG 2XF1A 3FFNA 2HD7A 5KYUA 3EGDB 3CI5G 1M4JA 2FH3A 1CNUA 1QPVA 2W0IA 3EFOB 3L50A 2NUTA 1Q8GA 4PKHB 1EQYS 1WM4A 1T3XA 3A5MS 1AK6A 3CIPG 1C0FS 1NM1G 2FH2A 1H1VG 3A5OS 1VFQA 5KYWA 3FG6A 3EG9A 5DD2A 4JD2H 4KEEA 4BEX1 5FAFA 2QTVA 4CBUG 2FH1A 1WNJA 1NLVG 2MP4A 2NUPB 1M2OA 1YVNG 1SVQA 3Q2BA 1JHWA 1TVJA 2MV2A 1P8ZG 4KEDA 5FAEA 1PCXA 3DA7A 2LJ8A 2FF6G 1T44G 3CJCG 1AK7A 3FFKA 1T3YA 1PD1A 2NUTB 1D0NA 1C0GS
chains in the Genus database with same CATH topology
1ESVS 2D8BA 3EH1A 3CJBG 4CBWG 1TMWA 1PD0A 1F7SA 1M2VA 3A5LS 1WFSA 3EG9B 1VKKA 3DAWB 5KYXB 3FG7A 1SVYA 1KCQA 2NUPA 2LXXA 1D4XG 1T2LA 1RGIG 1V6FA 4S10C 3EGXA 1X67A 1NPHA 5KYYA 1Q8XA 1AHQA 5A1MA 1UDMA 5KYNA 1CFYA 3EGXB 1SVRA 1P8XA 1J72A 4Z94G 2LLFA 3EH2A 2VILA 5KYXA 2I2QA 5HVKD 3A5NS 5KYWB 2FH4A 4LIZA 1M2VB 2KVKA 2FF3A 3TU5B 1NMDG 4PKGG 2XFAA 1HQZ1 3EFOA 2VACA 5KYYB 4KEFA 5IVUA 2MOTA 2FGHA 1COFA 1YAGG 2L72A 3EGDA 4CBXG 1DEJS 5HVKB 2VIKA 5KYUB 1MDUA 5L6WC 4PKIG 2XF1A 3FFNA 2HD7A 5KYUA 3EGDB 3CI5G 1M4JA 2FH3A 1CNUA 1QPVA 2W0IA 3EFOB 3L50A 2NUTA 1Q8GA 4PKHB 1EQYS 1WM4A 1T3XA 3A5MS 1AK6A 3CIPG 1C0FS 1NM1G 2FH2A 1H1VG 3A5OS 1VFQA 5KYWA 3FG6A 3EG9A 5DD2A 4JD2H 4KEEA 4BEX1 5FAFA 2QTVA 4CBUG 2FH1A 1WNJA 1NLVG 2MP4A 2NUPB 1M2OA 1YVNG 1SVQA 3Q2BA 1JHWA 1TVJA 2MV2A 1P8ZG 4KEDA 5FAEA 1PCXA 3DA7A 2LJ8A 2FF6G 1T44G 3CJCG 1AK7A 3FFKA 1T3YA 1PD1A 2NUTB 1D0NA 1C0GS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESV S;  2D8B A;  3EH1 A;  3CJB G;  4CBW G;  1TMW A;  1PD0 A;  1F7S A;  1M2V A;  3A5L S;  1WFS A;  3EG9 B;  1VKK A;  3DAW B;  5KYX B;  3FG7 A;  1SVY A;  1KCQ A;  2NUP A;  2LXX A;  1D4X G;  1T2L A;  1RGI G;  1V6F A;  4S10 C;  3EGX A;  1X67 A;  1NPH A;  5KYY A;  1Q8X A;  1AHQ A;  5A1M A;  1UDM A;  5KYN A;  1CFY A;  3EGX B;  1SVR A;  1P8X A;  1J72 A;  4Z94 G;  2LLF A;  3EH2 A;  2VIL A;  5KYX A;  2I2Q A;  5HVK D;  3A5N S;  5KYW B;  2FH4 A;  4LIZ A;  1M2V B;  2KVK A;  2FF3 A;  3TU5 B;  1NMD G;  4PKG G;  2XFA A;  1HQZ 1;  3EFO A;  2VAC A;  5KYY B;  4KEF A;  5IVU A;  2MOT A;  2FGH A;  1COF A;  1YAG G;  2L72 A;  3EGD A;  4CBX G;  1DEJ S;  5HVK B;  2VIK A;  5KYU B;  1MDU A;  5L6W C;  4PKI G;  2XF1 A;  3FFN A;  2HD7 A;  5KYU A;  3EGD B;  3CI5 G;  1M4J A;  2FH3 A;  1CNU A;  1QPV A;  2W0I A;  3EFO B;  3L50 A;  2NUT A;  1Q8G A;  4PKH B;  1EQY S;  1WM4 A;  1T3X A;  3A5M S;  1AK6 A;  3CIP G;  1C0F S;  1NM1 G;  2FH2 A;  1H1V G;  3A5O S;  1VFQ A;  5KYW A;  3FG6 A;  3EG9 A;  5DD2 A;  4JD2 H;  4KEE A;  4BEX 1;  5FAF A;  2QTV A;  4CBU G;  2FH1 A;  1WNJ A;  1NLV G;  2MP4 A;  2NUP B;  1M2O A;  1YVN G;  1SVQ A;  3Q2B A;  1JHW A;  1TVJ A;  2MV2 A;  1P8Z G;  4KED A;  5FAE A;  1PCX A;  2LJ8 A;  2FF6 G;  1T44 G;  3CJC G;  1AK7 A;  3FFK A;  1T3Y A;  1PD1 A;  2NUT B;  1D0N A;  1C0G S; 
#chains in the Genus database with same CATH topology
 1ESV S;  2D8B A;  3EH1 A;  3CJB G;  4CBW G;  1TMW A;  1PD0 A;  1F7S A;  1M2V A;  3A5L S;  1WFS A;  3EG9 B;  1VKK A;  3DAW B;  5KYX B;  3FG7 A;  1SVY A;  1KCQ A;  2NUP A;  2LXX A;  1D4X G;  1T2L A;  1RGI G;  1V6F A;  4S10 C;  3EGX A;  1X67 A;  1NPH A;  5KYY A;  1Q8X A;  1AHQ A;  5A1M A;  1UDM A;  5KYN A;  1CFY A;  3EGX B;  1SVR A;  1P8X A;  1J72 A;  4Z94 G;  2LLF A;  3EH2 A;  2VIL A;  5KYX A;  2I2Q A;  5HVK D;  3A5N S;  5KYW B;  2FH4 A;  4LIZ A;  1M2V B;  2KVK A;  2FF3 A;  3TU5 B;  1NMD G;  4PKG G;  2XFA A;  1HQZ 1;  3EFO A;  2VAC A;  5KYY B;  4KEF A;  5IVU A;  2MOT A;  2FGH A;  1COF A;  1YAG G;  2L72 A;  3EGD A;  4CBX G;  1DEJ S;  5HVK B;  2VIK A;  5KYU B;  1MDU A;  5L6W C;  4PKI G;  2XF1 A;  3FFN A;  2HD7 A;  5KYU A;  3EGD B;  3CI5 G;  1M4J A;  2FH3 A;  1CNU A;  1QPV A;  2W0I A;  3EFO B;  3L50 A;  2NUT A;  1Q8G A;  4PKH B;  1EQY S;  1WM4 A;  1T3X A;  3A5M S;  1AK6 A;  3CIP G;  1C0F S;  1NM1 G;  2FH2 A;  1H1V G;  3A5O S;  1VFQ A;  5KYW A;  3FG6 A;  3EG9 A;  5DD2 A;  4JD2 H;  4KEE A;  4BEX 1;  5FAF A;  2QTV A;  4CBU G;  2FH1 A;  1WNJ A;  1NLV G;  2MP4 A;  2NUP B;  1M2O A;  1YVN G;  1SVQ A;  3Q2B A;  1JHW A;  1TVJ A;  2MV2 A;  1P8Z G;  4KED A;  5FAE A;  1PCX A;  3DA7 A;  2LJ8 A;  2FF6 G;  1T44 G;  3CJC G;  1AK7 A;  3FFK A;  1T3Y A;  1PD1 A;  2NUT B;  1D0N A;  1C0G S; 
#chains in the Genus database with same CATH homology
 1ESV S;  2D8B A;  3EH1 A;  3CJB G;  4CBW G;  1TMW A;  1PD0 A;  1F7S A;  1M2V A;  3A5L S;  1WFS A;  3EG9 B;  1VKK A;  3DAW B;  5KYX B;  3FG7 A;  1SVY A;  1KCQ A;  2NUP A;  2LXX A;  1D4X G;  1T2L A;  1RGI G;  1V6F A;  4S10 C;  3EGX A;  1X67 A;  1NPH A;  5KYY A;  1Q8X A;  1AHQ A;  5A1M A;  1UDM A;  5KYN A;  1CFY A;  3EGX B;  1SVR A;  1P8X A;  1J72 A;  4Z94 G;  2LLF A;  3EH2 A;  2VIL A;  5KYX A;  2I2Q A;  5HVK D;  3A5N S;  5KYW B;  2FH4 A;  4LIZ A;  1M2V B;  2KVK A;  2FF3 A;  3TU5 B;  1NMD G;  4PKG G;  2XFA A;  1HQZ 1;  3EFO A;  2VAC A;  5KYY B;  4KEF A;  5IVU A;  2MOT A;  2FGH A;  1COF A;  1YAG G;  2L72 A;  3EGD A;  4CBX G;  1DEJ S;  5HVK B;  2VIK A;  5KYU B;  1MDU A;  5L6W C;  4PKI G;  2XF1 A;  3FFN A;  2HD7 A;  5KYU A;  3EGD B;  3CI5 G;  1M4J A;  2FH3 A;  1CNU A;  1QPV A;  2W0I A;  3EFO B;  3L50 A;  2NUT A;  1Q8G A;  4PKH B;  1EQY S;  1WM4 A;  1T3X A;  3A5M S;  1AK6 A;  3CIP G;  1C0F S;  1NM1 G;  2FH2 A;  1H1V G;  3A5O S;  1VFQ A;  5KYW A;  3FG6 A;  3EG9 A;  5DD2 A;  4JD2 H;  4KEE A;  4BEX 1;  5FAF A;  2QTV A;  4CBU G;  2FH1 A;  1WNJ A;  1NLV G;  2MP4 A;  2NUP B;  1M2O A;  1YVN G;  1SVQ A;  3Q2B A;  1JHW A;  1TVJ A;  2MV2 A;  1P8Z G;  4KED A;  5FAE A;  1PCX A;  3DA7 A;  2LJ8 A;  2FF6 G;  1T44 G;  3CJC G;  1AK7 A;  3FFK A;  1T3Y A;  1PD1 A;  2NUT B;  1D0N A;  1C0G S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...