1AIAA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSHNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 134
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aiaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aiaA01
3PJ0A 3BN1A 3E2FA 3LVKA 1SVVA 4B98A 1BW0A 1CQ7A 4NOGA 3AELA 1JG8A 4DQ6A 1WYUA 4JEYA 3QI6A 3GZDC 2BI2A 3FD0A 2ZY5A 3BCAA 2Z1ZA 2AEUA 2D7YA 2JJHA 1U08A 4ZDOA 5JAYA 1AY4A 2AY6A 4HF8A 3NTJA 4ITXA 3FQAA 1CL2A 1EQBA 1BQDA 3HVYA 3R9AA 2X5DA 3AEPA 1RVYA 1IVRA 2AY8A 1PMOA 3LG0A 2C7TA 3BWNA 3MC6C 2W7LA 4A0GA 3W1IA 4ATPA 3ZRQA 9AATA 2AY2A 2VMWA 2VMTA 4MSOA 3JZLA 3LVJA 2D66A 3EUCA 2FM1A 1AMAA 3HQTA 4MQQA 2AY4A 4WYFA 5G2PA 4A0HA 2OGEA 4JEXA 1TATA 2AY7A 4HVKA 1MAQA 3BS8A 2OATA 2VLFA 1OHYA 5LH9A 1MDOA 3RI6A 1AJSB 2HUIA 2BWOA 3WLXA 4PFNA 2JISA 4M2JA 4F4EA 2C0RA 3HT4A 1TARA 4ZM4A 4LW4A 1P3WA 5M49A 3AEMA 2W8UA 3CAIA 3WKRA 4ADCA 3ACZA 3KGWA 3AENA 3MAFA 1DJ9A 2WKAA 1BJOB 1AMQA 1LC5A 4XK1A 2CINA 3MEBA 3AEOA 4E77A 1SZKA 1PMMA 1WSTA 2F8JA 2YKYA 3FZ7A 3B46A 3FRKA 1G4VA 3CQ5A 2W7KA 2QBTA 4KYOA 4ATQA 4B9BA 2E7IA 1X0MA 2VGUA 4W5KA 5DJ9A 4MKJA 3VK4A 4ZWVA 3K28A 3AEJC 4R5ZA 2PB0A 2ZUKA 3N75A 2HZPA 4IXOA 5F8VA 4XJOA 4K2MA 3HLMA 1B5PA 2DGMA 1SPAA 2VI9A 2VIAA 4RJYA 1DFOA 1G7XA 3DRDA 1TASA 1YIZA 3E2ZB 5G2QA 3RUYA 1VP4A 1KL1A 3F0HA 3P1TA 4ZDLA 3FVUA 3PAAA 3ZRRA 4ZWMA 1IUGA 3B8XA 1M0PA 3ATHA 2E7UA 1MDXA 3AENB 1GCKA 3MAFB 4CXQA 1ZC9A 3G0TA 4AH3A 2VMZA 5EAAA 1WYTA 1YIYA 3B1CA 1GEYA 1TOEA 4W1VA 3NU8A 5FT6A 2YKVA 5M46A 3DR7A 2HUUA 3H14A 3AATA 1D7RA 4JF1A 1RVUA 2V0YA 4WBTA 3RBFA 1I29A 1M4NA 1W3UA 3EZSA 4ZAHA 4FFCA 2ZSMA 1BS0A 4Y0IA 4JF0A 3JU7A 2HOXA 3GWPA 1LW5A 3QN6A 4MGRA 1ECXA 3GR9A 1N8PA 4CVQA 2O1BA 2PB2A 4A6UA 3BWOA 4AZJA 1AHGA 4XJPA 4BA5A 1GD9A 4M2MA 1I43A 1LKCA 4UOYA 1GC3A 2HP1A 2OQXA 3I5TA 4OMAA 4WYDA 3RQ1A 1AX4A 3HMUA 3LV2A 3IF2A 4J5UA 3MBBA 3K7YA 2Z9VA 2W8JA 3EI8A 3JWAA 2YHKA 2RFVA 2D65A 4IYOB 1D7VA 4RITA 1AHYA 1BJNA 1S07A 1QZ9A 1IAXA 4TN4A 3GJUA 2GSAA 2HORA 3FQ8A 4CBSA 2ZY2A 4FL0A 3EIBA 4M2KA 3FVXA 1MLYA 2VI8A 5C6UA 2VMQA 4IW7A 1DGDA 5BJ4A 4A6TA 4EU1A 1CZEA 4EMYA 1TOIA 5AX8A 2FNUA 2YCPA 3PGYA 4LNJA 2DKJA 2VLHA 1GC2A 1LC8A 4OT8A 2WK8A 4DBCA 4KXKA 4LC3A 1B9IA 4RJ0A 1VJOA 2HOZA 4AOAA 2QA3A 4BHDA 1KMKA 1AKAA 2VIBA 3WCNA 1AHFA 5M4BA 2AY5A 4ADDA 2AY1A 3TCMA 1BT4A 2VMSA 4A0FA 2CANA 4WLHA 2YCTA 3PDXA 2WK7A 1CQ8A 3F6TA 3FDBA 1CQ6A 4JE5D 1S06A 2CJHA 4K2IA 4WYAA 1B8GA 4R5FA 4RM1A 1O62A 2GQNA 5M4DA 4GE7A 1DJEA 5HXXA 1AJSA 4LNMA 1UU0A 1GEXA 2Q7WA 4AO4A 2AY3A 4N0BA 2BYLA 3HL2A 3CQ4A 1ARGA 3DC1A 1RV3A 2X8UA 1I48A 1TOJA 1IAYA 3LWSA 3E9KA 2BWPA 1ASDA 5LHAA 1JF9A 5DJ1A 4I8AA 2AATA 3ECDA 3GETA 2X3LA 2YCNA 4JEVA 1ARSA 2ZJGA 3UWCA 2HOYA 1M32A 2CSTA 4RAEA 1OHVA 2CTZA 3LVLB 8AATA 1C7OA 5EFSA 1AIAA 1UU2A 5G09A 1GBNA 1QISA 1DGEA 5EAVA 5HHYA 4WB0A 3VAXA 2BI5A 2W7MA 1GEWA 5E5IA 3B1EA 4UHOA 1BKGA 4F5IA 2JGTA 3BV0A 3MC6A 4MY5A 2EZ1A 4OTLA 4F5KA 1AMRA 2Z20A 4A72A 3ISLA 1GC4A 2BI3A 3CQ6A 3T32A 3TATA 5K8BA 1KKPA 4F5MA 3NYSA 3RCHA 1M7YA 2VMRA 4L0OA 3FFHA 3OP7A 1QIRA 4UQVA 2BIEA 2VMYA 4ZASA 4Q76A 1RV4A 4GEBA 3NYUA 2BIAA 1X2AA 4PVFA 4WD2A 3VK3A 2W7EA 3WX9A 3USFA 1O61A 5DB5A 1YJSA 2CFBA 3MKJA 1C7GA 1YJZA 2BWNA 2Z67A 1OXOA 1WKHA 1YOOA 3GZCA 3GZDA 1DKAA 3I16A 2D63A 1AY5A 1J32A 3L8AA 4ZSYA 1JS3A 3PIUA 1M0QA 3NYTA 1KMJA 5EQCA 2W8TA 3NUIA 1TOKA 3JW9A 1O69A 1SZSA 4E3RA 2BHXA 2HUFA 2Z61A 5D95A 3WGCA 1KL2A 1SF2A 1GDEA 1M0OA 3GBXA 1YNUA 4Y0HA 5EUEA 5J8QA 3I4JA 3TFUA 2DGKA 1IBJA 1XEYA 2VYCA 2X5FA 3R4TA 4ZLVA 2AY9A 3EI7A 1ASNA 3EI5A 3EIAA 4IY7A 2ZY4A 3A9YA 2AEVA 3WGBA 4BMKA 5DX5A 4GE4A 3PDBB 4ZSWA 1W7MA 1ASCA 4W91A 4WP0A 4IYOA 2VMXA 4WXFA 3HDOA 3PD6A 2XH1A 1ELQA 3PPLA 1PG8A 1C7NA 1EG5A 4OBVA 2BI9A 1WYTB 5EUDA 3AEMC 1AJRA 1FG7A 4JEZA 4RKDA 3DZZA 4WLJA 1QJ3A 1KKJA 3AOWA 2V1PA 2W7GA 3LVMA 1BQAA 4QGRA 3DYDA 2YRIA 3KE3A 4UHMA 2R5CB 3ZZJA 1JS6A 3DXWA 2C81A 3AOVA 2EPJA 4XAUA 3UAKA 1ZODA 2VGTA 2OKKA 5E3KA 4WYCA 4ZM3A 3ZZKA 1IX7A 3DXVA 4TMRA 4CBRA 3G8MA 1OXPA 4GRXA 1YJYA 1J04A 1EJIA 3GSBA 2W8WA 1FC4A 4XJLA 2DR1A 5EIGA 3ASAA 4ADEA 2DOUA 1ASBA 3BWNC 3PDBA 3NDNA 1Z7DA 2QMAA 4IXZA 1UU1A 5TF5A 1AKBA 1QJ5A 3JTXA 3N0LA 3WZFA 1QGNA 3BCBA 2VGZA 4LNLA 5FT8A 2CH1A 2EH6A 2CB1A 2ZP7A 3II0A 1ASAA 1WYVA 4H51A 1IX8A 1H0CA 4ISYA 3MADA 3WY7A 4BQ0A 4WXBA 3TFTA 5G4JA 3M5UA 1V2FA 4IXSA 4MKKA 5G4IA 3A8UX 4P3MA 4W1WA 5HDMA 1AKCA 1M0NA 4P7YA 4OCAA 3CBFA 1S08A 1X28A 1X29A 2ZC0A 2VGWA 3FFRA 1AY8A 1BJWA 2OGAA 2W7DA 4W1XA 5FT4A 3NX3A 4E1OA 3QGUA 1E5FA 2OKJA 3K40A 1W23A 1DTYA 2TPLA 3H7FA 2JJGA 3W1HA 4A00A 2WK9A 3HBXA 2BIGA 2D7ZA 4K2BA 3QBOA 2W8VA 3EI6A 1S0AA 3OKSA 4OBUA 1ASEA 3E2YA 2R2NA 2R0TA 1B5OA 3JWBA 4IX8A 5IWQA 1I41A 2BKWA 3FVSA 3AEJA 3ELPA 1AICA 2DGLA 3B1DA 1GC0A 2BI1A 1LC7A 3A9ZA 2VGSA 3UE8A 1MGVA 1CS1A 1V72A 4KAMA 4BA4A 3E2ZA 3QPGA 2XBNA 2GMUA 2FN6A 5FT5A 4J8LA 2R5EA 2VMOA 3WKSA 4MQPA 4N0WA 3FCRA 4UHNA 1MLZA 4XJMA 3D6KA 1M6SA 2W7IA 1CJ0A 3E77A 2VMVA 5E4ZA 4XQ2A 1WYUB 1YAAA 4Y0DA 2VGVA 1SFFA 2E54A 5EIGB 1PFFA 3ASBA 1FG3A 4OC9A 3TQXA 2ZSLA 3F9TA 4LW2A 1SZUA 3FDDA 1V2DA 2QB2A 2PO3A 2D64A 4WXGA 1ASFA 2Z9WA 4AZKA 1UKJA 1V2EA 1ASLA 2W7JA 3MAUA 1TOGA 3EI9A 4O6ZA 2GB3A 4RKCA 4W8IA 5I92A 1AIBA 2ORDA 3NNKA 5G0AA 5F9SA 1TPLA 2Z9UA 3COGA 3FSLA 1AHEA 2JJEA 4F5GA 1ELUA 2DKBA 2GMSA 3FQ7A 1O4SA 3FKDA 4A6RA 4U2HA 4ZDPA 1D7UA 3FZ6A 1WKGA 1MDZA 3G7QA 2NMPA 4EB7A 1C9CA 2YRRA 4E3QA 2YOBA 4Q31A 1Z3ZA 2FQ6A 1W7NA 2FYFA 4DGTA 3L44A 2FNIA 1S09A 2O7CA 1XI9A 1W7LA 4PFFA 3BC8A 3LY1A 3BB8A 3VP6A 4GE9A 4RIZA 3VK2A 4CXRA 2JG2A 3KGXA 3WCOA 1ZOBA 4ITGA 4GDYA 3VOMA 3W1JA 4Q75A 3P6KA 2Z9XA 4RLGA 2EGYA 3A2BA 3NUBA 3RCHB 1T3IA 3KKIA 4F5LA 1WYVB 4F5HA 3Q8NA 1BJ4A 4F5JA 1ORDA 2JJFA 2CH2A 5EUNA 4WB0B 4OYTA 1N31A 4XEWA 4F5FA 1BJOA 1LS3A 1AMSA 7AATA 2G6WA 3EZ1A 4MQRA 4TV7A 2CJDA 2VMUA 2EO5A 3NRAA 4WYEA 3ZRPA 3NU7A 2BYJA 2QLRA 1LK9A 1B4XA 4ADBA 1C0NA 1AAWA 1CZCA 1AAMA 2YKUA 3PD6B 4WYGA 1D2FA 1ARTA 4U1TA 3QM2A 1ASGA 3RBLA 2ZY3A 3DODA 1ARHA 5D5SA 3IHJA 4A0RA 1ARIA 4EB5A 4PIWA 1G4XA 1E5EA 3E6GA 3QHXA 2QB3A 2R5CA 1G7WA 2VMNA 2W7FA 4JE5A 4Q6RA 1IJIA 1OATA 3BCXA 3N5MA 4GSAA 1QITA 1C4KA 1B9HA 3ELEA 2EZ2A 4EFFA 3A9XA 2ZYJA 2O0RA 2Z1YA 4R2NA 4AO9A 3DR4A 2D61A 2VMPA 1IX6A 1ASMA 1LW4A 3FTBA 1H1CA 1VEFA 2HP2A 2W7HA 1CL1A 4R8DA 3DU4A 1MAPA 5BJ3A 3FZ8A 2E7JA 3PA9A 2YKXA 1AHXA 2CJGA 1OHWA 3AV7A 1DJUA 4JEWA 1Y4IA 2D5YA 1D7SA 1N2TA 2CY8A 2C44A
chains in the Genus database with same CATH superfamily
3PJ0A 3BN1A 3E2FA 3LVKA 1SVVA 4B98A 1BW0A 1CQ7A 4NOGA 3AELA 1JG8A 4DQ6A 1WYUA 4JEYA 3QI6A 3GZDC 2BI2A 3FD0A 2WB6A 2ZY5A 3BCAA 2Z1ZA 2AEUA 2D7YA 2JJHA 1U08A 4ZDOA 5JAYA 1AY4A 2AY6A 4HF8A 3NTJA 4ITXA 3FQAA 1CL2A 1EQBA 1BQDA 3HVYA 3R9AA 2X5DA 3AEPA 1RVYA 1IVRA 2AY8A 1PMOA 3LG0A 2C7TA 3BWNA 3MC6C 2W7LA 4A0GA 3W1IA 4ATPA 3ZRQA 9AATA 2AY2A 2VMWA 2VMTA 4MSOA 3JZLA 3LVJA 2D66A 3EUCA 2FM1A 1AMAA 3HQTA 4MQQA 2AY4A 4WYFA 5G2PA 4A0HA 2OGEA 3N4XA 4JEXA 1TATA 2AY7A 4HVKA 1MAQA 3BS8A 2OATA 2VLFA 1OHYA 5LH9A 1MDOA 3RI6A 1AJSB 2HUIA 2BWOA 2EYQA 3WLXA 4PFNA 2JISA 4M2JA 4F4EA 2C0RA 3HT4A 1TARA 4ZM4A 4LW4A 1P3WA 5M49A 3AEMA 2W8UA 3CAIA 3WKRA 4ADCA 3ACZA 3KGWA 3AENA 3MAFA 1DJ9A 2WKAA 1BJOB 1AMQA 1LC5A 4XK1A 2CINA 3MEBA 3AEOA 4E77A 1SZKA 1PMMA 1WSTA 2F8JA 2YKYA 3FZ7A 3B46A 3FRKA 1G4VA 3CQ5A 2W7KA 2QBTA 4KYOA 4ATQA 4B9BA 2E7IA 1X0MA 2VGUA 4W5KA 5DJ9A 4MKJA 3VK4A 4ZWVA 1KAFA 3K28A 3AEJC 4R5ZA 2PB0A 2ZUKA 3N75A 2HZPA 4IXOA 5F8VA 4XJOA 5KTBA 4K2MA 3HLMA 1B5PA 2DGMA 1SPAA 2VI9A 2VIAA 4RJYA 1DFOA 1G7XA 3DRDA 1TASA 1YIZA 3E2ZB 5G2QA 3RUYA 1VP4A 1KL1A 3F0HA 3P1TA 4ZDLA 3FVUA 3PAAA 3ZRRA 4ZWMA 1IUGA 3B8XA 1M0PA 3ATHA 2E7UA 1MDXA 3AENB 1GCKA 3MAFB 4CXQA 1ZC9A 3G0TA 4AH3A 2VMZA 5EAAA 1WYTA 1YIYA 3B1CA 1GEYA 1TOEA 4W1VA 3NU8A 5FT6A 2YKVA 5M46A 3DR7A 2HUUA 3H14A 3AATA 1D7RA 4JF1A 1RVUA 2V0YA 4WBTA 3RBFA 1I29A 1M4NA 1W3UA 3EZSA 4ZAHA 4FFCA 2ZSMA 1BS0A 4Y0IA 4JF0A 3JU7A 2HOXA 3GWPA 1LW5A 3QN6A 4MGRA 1ECXA 3GR9A 1N8PA 4CVQA 2O1BA 2PB2A 4A6UA 3BWOA 4AZJA 1AHGA 4XJPA 4BA5A 1GD9A 4M2MA 1I43A 1LKCA 4UOYA 1GC3A 2HP1A 2OQXA 3I5TA 4OMAA 4WYDA 3RQ1A 1AX4A 3HMUA 3LV2A 3IF2A 4J5UA 3MBBA 3K7YA 2Z9VA 2W8JA 3EI8A 3JWAA 2YHKA 2RFVA 2D65A 4IYOB 1D7VA 4RITA 1AHYA 1BJNA 1S07A 1QZ9A 1IAXA 4TN4A 3GJUA 2GSAA 2HORA 3FQ8A 4CBSA 2ZY2A 4FL0A 3EIBA 4M2KA 3FVXA 1MLYA 2VI8A 5C6UA 2VMQA 4IW7A 1DGDA 5BJ4A 4A6TA 4EU1A 1CZEA 4EMYA 1TOIA 5AX8A 2FNUA 2YCPA 3PGYA 4LNJA 2DKJA 2VLHA 1GC2A 1LC8A 4OT8A 2WK8A 4DBCA 4KXKA 4LC3A 1B9IA 4RJ0A 1VJOA 2HOZA 4AOAA 2QA3A 4BHDA 1KMKA 1AKAA 2VIBA 3WCNA 1AHFA 5M4BA 2AY5A 4ADDA 2AY1A 3TCMA 1BT4A 2VMSA 4A0FA 2CANA 4WLHA 2YCTA 3PDXA 2WK7A 1CQ8A 3F6TA 3FDBA 1CQ6A 4JE5D 1S06A 2CJHA 4K2IA 4WYAA 1B8GA 4R5FA 2FKIA 4RM1A 1O62A 2GQNA 5M4DA 4GE7A 1DJEA 5HXXA 1AJSA 4LNMA 1UU0A 1GEXA 2Q7WA 4AO4A 2AY3A 4N0BA 2BYLA 3HL2A 3CQ4A 1ARGA 3DC1A 1RV3A 2X8UA 1I48A 1TOJA 1IAYA 3LWSA 3E9KA 2BWPA 1ASDA 5LHAA 1JF9A 5DJ1A 4I8AA 2AATA 3ECDA 3GETA 2X3LA 2YCNA 4JEVA 1ARSA 2ZJGA 3UWCA 2HOYA 1M32A 2CSTA 4RAEA 2A1VA 1OHVA 2CTZA 3LVLB 8AATA 1C7OA 5EFSA 1AIAA 1UU2A 5G09A 1GBNA 1QISA 1DGEA 5EAVA 5HHYA 4WB0A 3VAXA 2BI5A 2W7MA 1GEWA 5E5IA 3B1EA 4UHOA 1BKGA 4F5IA 2JGTA 3BV0A 3MC6A 4MY5A 2EZ1A 4OTLA 4F5KA 1AMRA 2Z20A 4A72A 3ISLA 1GC4A 2BI3A 3CQ6A 3T32A 3TATA 5K8BA 1KKPA 4F5MA 3NYSA 3RCHA 1M7YA 2VMRA 4L0OA 3FFHA 3OP7A 1QIRA 4UQVA 2BIEA 2VMYA 4ZASA 4Q76A 1RV4A 4GEBA 3NYUA 2BIAA 1X2AA 4PVFA 4WD2A 3VK3A 2W7EA 3WX9A 3USFA 1O61A 5DB5A 1YJSA 2CFBA 3MKJA 1C7GA 1YJZA 2BWNA 2Z67A 1OXOA 1WKHA 1YOOA 3GZCA 3GZDA 1DKAA 3I16A 2D63A 1AY5A 1J32A 3L8AA 4ZSYA 1JS3A 3PIUA 1M0QA 3NYTA 1KMJA 5EQCA 2W8TA 3NUIA 1TOKA 3JW9A 1O69A 1SZSA 4E3RA 2BHXA 2HUFA 2Z61A 5D95A 3WGCA 1KL2A 1SF2A 1GDEA 1M0OA 3GBXA 1YNUA 4Y0HA 5EUEA 5J8QA 3I4JA 3TFUA 2DGKA 1IBJA 1XEYA 2VYCA 2X5FA 3R4TA 4ZLVA 2AY9A 3EI7A 1ASNA 3EI5A 3EIAA 4IY7A 2ZY4A 3A9YA 2AEVA 3WGBA 4BMKA 5DX5A 4GE4A 3PDBB 4ZSWA 1W7MA 1ASCA 4W91A 4WP0A 4IYOA 2VMXA 4WXFA 3HDOA 3PD6A 2XH1A 1ELQA 3PPLA 1PG8A 1C7NA 1EG5A 4OBVA 2BI9A 1WYTB 5EUDA 3AEMC 1AJRA 1FG7A 2G7JA 4JEZA 4RKDA 3DZZA 4WLJA 1QJ3A 1KKJA 3AOWA 2V1PA 2W7GA 3LVMA 3N4SA 1BQAA 4QGRA 3DYDA 2YRIA 3KE3A 4UHMA 2R5CB 3ZZJA 1JS6A 3DXWA 2C81A 3AOVA 2EPJA 4XAUA 3UAKA 1ZODA 2VGTA 2OKKA 5E3KA 4WYCA 4ZM3A 3ZZKA 1IX7A 3DXVA 4TMRA 4CBRA 3G8MA 1OXPA 4GRXA 1YJYA 1J04A 1EJIA 3GSBA 2W8WA 1FC4A 4XJLA 2DR1A 5EIGA 3ASAA 4ADEA 2DOUA 1ASBA 3BWNC 3PDBA 3NDNA 1Z7DA 2QMAA 4IXZA 1UU1A 5TF5A 1AKBA 1QJ5A 3JTXA 4H63Q 3N0LA 3WZFA 1QGNA 3BCBA 2VGZA 4LNLA 5FT8A 2CH1A 2EH6A 2CB1A 2ZP7A 3II0A 1ASAA 1WYVA 4H51A 1IX8A 1H0CA 4ISYA 3MADA 3WY7A 4BQ0A 4WXBA 3TFTA 5G4JA 3M5UA 1V2FA 4IXSA 4MKKA 5G4IA 3A8UX 4P3MA 4W1WA 5HDMA 1AKCA 1M0NA 4P7YA 4OCAA 3CBFA 1S08A 1X28A 1X29A 2ZC0A 2VGWA 3FFRA 1AY8A 1BJWA 2OGAA 2W7DA 4W1XA 5FT4A 3NX3A 4E1OA 3QGUA 1E5FA 2OKJA 3K40A 1W23A 1DTYA 2TPLA 3H7FA 2JJGA 3W1HA 4A00A 2WK9A 3HBXA 2BIGA 2D7ZA 4K2BA 3QBOA 2W8VA 3EI6A 1S0AA 3OKSA 3N7NA 4OBUA 1ASEA 3E2YA 2R2NA 2R0TA 1B5OA 3JWBA 4IX8A 5IWQA 1I41A 2BKWA 3FVSA 3AEJA 3ELPA 1AICA 2DGLA 3B1DA 1GC0A 2BI1A 1LC7A 3A9ZA 2VGSA 3UE8A 1MGVA 4K05A 1CS1A 1V72A 4KAMA 4BA4A 3E2ZA 3QPGA 2XBNA 2GMUA 2FN6A 5FT5A 4J8LA 2R5EA 2VMOA 3WKSA 4MQPA 4N0WA 3FCRA 4UHNA 1MLZA 4XJMA 3D6KA 1M6SA 2W7IA 1CJ0A 3E77A 2VMVA 5E4ZA 4XQ2A 1WYUB 1YAAA 4Y0DA 2VGVA 1SFFA 2E54A 5EIGB 1PFFA 3ASBA 1FG3A 4OC9A 3TQXA 2ZSLA 3F9TA 4LW2A 1SZUA 3FDDA 1V2DA 2QB2A 2PO3A 2D64A 4WXGA 1ASFA 2Z9WA 4AZKA 1UKJA 1V2EA 1ASLA 2W7JA 3MAUA 1TOGA 3EI9A 4O6ZA 2GB3A 4RKCA 4W8IA 5I92A 1AIBA 2ORDA 3NNKA 5G0AA 5F9SA 1TPLA 2Z9UA 3COGA 3FSLA 1AHEA 2JJEA 4F5GA 1ELUA 2DKBA 2GMSA 3FQ7A 1O4SA 3FKDA 4A6RA 4U2HA 4ZDPA 1D7UA 3FZ6A 1WKGA 1MDZA 3G7QA 2NMPA 4EB7A 1C9CA 2YRRA 4E3QA 2YOBA 4Q31A 1Z3ZA 2FQ6A 1W7NA 2FYFA 4DGTA 3L44A 2FNIA 1S09A 2O7CA 1XI9A 1W7LA 4PFFA 3BC8A 3LY1A 3BB8A 3VP6A 4GE9A 4RIZA 3VK2A 2KFPA 4CXRA 2JG2A 3KGXA 3WCOA 1ZOBA 4ITGA 4GDYA 3VOMA 3W1JA 4Q75A 3P6KA 2Z9XA 4RLGA 2EGYA 3A2BA 3NUBA 3RCHB 1T3IA 3KKIA 4F5LA 1WYVB 4F5HA 3Q8NA 1BJ4A 4F5JA 1ORDA 2JJFA 2CH2A 5EUNA 4WB0B 4OYTA 1N31A 4XEWA 4F5FA 1BJOA 1LS3A 1AMSA 7AATA 2G6WA 3EZ1A 4MQRA 4TV7A 2CJDA 2VMUA 2EO5A 3NRAA 4WYEA 3ZRPA 3NU7A 2BYJA 2QLRA 1LK9A 1B4XA 4ADBA 1C0NA 1AAWA 1CZCA 1AAMA 2YKUA 3PD6B 4WYGA 1D2FA 1ARTA 4U1TA 3QM2A 1ASGA 3RBLA 2ZY3A 3DODA 1ARHA 5D5SA 3N4RA 3IHJA 4A0RA 1ARIA 4EB5A 4PIWA 1G4XA 1E5EA 3E6GA 3QHXA 2QB3A 2R5CA 1G7WA 2VMNA 2W7FA 4JE5A 4Q6RA 1IJIA 1OATA 3BCXA 3N5MA 4GSAA 1QITA 1C4KA 1B9HA 3ELEA 2EZ2A 4EFFA 3A9XA 2ZYJA 2O0RA 2Z1YA 4R2NA 4AO9A 3DR4A 2QSRA 2D61A 2VMPA 1IX6A 1ASMA 1LW4A 3FTBA 1H1CA 1VEFA 2HP2A 2W7HA 1CL1A 4R8DA 3DU4A 1MAPA 5BJ3A 3FZ8A 3H9XA 2E7JA 3PA9A 2YKXA 1AHXA 2CJGA 1OHWA 3AV7A 1DJUA 4JEWA 1Y4IA 2D5YA 1D7SA 1N2TA 2CY8A 2C44A
chains in the Genus database with same CATH topology
3PJ0A 3BN1A 3E2FA 3LVKA 1SVVA 4B98A 1BW0A 1CQ7A 4NOGA 3AELA 1JG8A 4DQ6A 1WYUA 4JEYA 3QI6A 3GZDC 2BI2A 3FD0A 2WB6A 2ZY5A 3BCAA 2Z1ZA 2AEUA 2D7YA 2JJHA 1U08A 4ZDOA 5JAYA 1AY4A 2AY6A 4HF8A 3NTJA 4ITXA 3FQAA 1CL2A 1EQBA 1BQDA 3HVYA 3R9AA 2X5DA 3AEPA 1RVYA 1IVRA 2AY8A 1PMOA 3LG0A 2C7TA 3BWNA 3MC6C 2W7LA 4A0GA 3W1IA 4ATPA 3ZRQA 9AATA 2AY2A 2VMWA 2VMTA 4MSOA 3JZLA 3LVJA 2D66A 3EUCA 2FM1A 1AMAA 3HQTA 4MQQA 2AY4A 4WYFA 5G2PA 4A0HA 2OGEA 3N4XA 4JEXA 1TATA 2AY7A 4HVKA 1MAQA 3BS8A 2OATA 2VLFA 1OHYA 5LH9A 1MDOA 3RI6A 1AJSB 2HUIA 2BWOA 2EYQA 3WLXA 4PFNA 2JISA 4M2JA 4F4EA 2C0RA 3HT4A 1TARA 4ZM4A 4LW4A 1P3WA 5M49A 3AEMA 2W8UA 3CAIA 3WKRA 4ADCA 3ACZA 3KGWA 3AENA 3MAFA 1DJ9A 2WKAA 1BJOB 1AMQA 1LC5A 4XK1A 2CINA 3MEBA 3AEOA 4E77A 1SZKA 1PMMA 1WSTA 2F8JA 2YKYA 3FZ7A 3B46A 3FRKA 1G4VA 3CQ5A 2W7KA 2QBTA 4KYOA 4ATQA 4B9BA 2E7IA 1X0MA 2VGUA 4W5KA 5DJ9A 4MKJA 3VK4A 4ZWVA 3K28A 3AEJC 4R5ZA 2PB0A 2ZUKA 3N75A 2HZPA 4IXOA 5F8VA 4XJOA 5KTBA 4K2MA 3HLMA 1B5PA 2DGMA 1SPAA 2VI9A 2VIAA 4RJYA 1DFOA 1G7XA 3DRDA 1TASA 1YIZA 3E2ZB 5G2QA 3RUYA 1VP4A 1KL1A 3F0HA 3P1TA 4ZDLA 3FVUA 3PAAA 3ZRRA 4ZWMA 1IUGA 3B8XA 1M0PA 3ATHA 2E7UA 1MDXA 3AENB 1GCKA 3MAFB 4CXQA 1ZC9A 3G0TA 4AH3A 2VMZA 5EAAA 1WYTA 1YIYA 3B1CA 1GEYA 1TOEA 4W1VA 3NU8A 5FT6A 2YKVA 5M46A 3DR7A 2HUUA 3H14A 3AATA 1D7RA 4JF1A 1RVUA 2V0YA 4WBTA 3RBFA 1I29A 1M4NA 1W3UA 3EZSA 4ZAHA 4FFCA 2ZSMA 1BS0A 4Y0IA 4JF0A 3JU7A 2HOXA 3GWPA 1LW5A 3QN6A 4MGRA 1ECXA 3GR9A 1N8PA 4CVQA 2O1BA 2PB2A 4A6UA 3BWOA 4AZJA 1AHGA 4XJPA 4BA5A 1GD9A 4M2MA 1I43A 1LKCA 4UOYA 1GC3A 2HP1A 2OQXA 3I5TA 4OMAA 4WYDA 3RQ1A 1AX4A 3HMUA 3LV2A 3IF2A 4J5UA 3MBBA 3K7YA 2Z9VA 2W8JA 3EI8A 3JWAA 2YHKA 2RFVA 2D65A 4IYOB 1D7VA 4RITA 1AHYA 1BJNA 1S07A 1QZ9A 1IAXA 4TN4A 3GJUA 2GSAA 2HORA 3FQ8A 4CBSA 2ZY2A 4FL0A 3EIBA 4M2KA 3FVXA 1MLYA 2VI8A 5C6UA 2VMQA 4IW7A 1DGDA 5BJ4A 4A6TA 4EU1A 1CZEA 4EMYA 1TOIA 5AX8A 2FNUA 2YCPA 3PGYA 4LNJA 2DKJA 2VLHA 1GC2A 1LC8A 4OT8A 2WK8A 4DBCA 4KXKA 4LC3A 1B9IA 4RJ0A 1VJOA 2HOZA 4AOAA 2QA3A 4BHDA 1KMKA 1AKAA 2VIBA 3WCNA 1AHFA 5M4BA 2AY5A 4ADDA 2AY1A 3TCMA 1BT4A 2VMSA 4A0FA 2CANA 4WLHA 2YCTA 3PDXA 2WK7A 1CQ8A 3F6TA 3FDBA 1CQ6A 4JE5D 1S06A 2CJHA 4K2IA 4WYAA 1B8GA 4R5FA 2FKIA 4RM1A 1O62A 2GQNA 5M4DA 4GE7A 1DJEA 5HXXA 1AJSA 4LNMA 1UU0A 1GEXA 2Q7WA 4AO4A 2AY3A 4N0BA 2BYLA 3HL2A 3CQ4A 1ARGA 3DC1A 1RV3A 2X8UA 1I48A 1TOJA 1IAYA 3LWSA 3E9KA 2BWPA 1ASDA 5LHAA 1JF9A 5DJ1A 4I8AA 2AATA 3ECDA 3GETA 2X3LA 2YCNA 4JEVA 1ARSA 2ZJGA 3UWCA 2HOYA 1M32A 2CSTA 4RAEA 2A1VA 1OHVA 2CTZA 3LVLB 8AATA 1C7OA 5EFSA 1AIAA 1UU2A 5G09A 1GBNA 1QISA 1DGEA 5EAVA 5HHYA 4WB0A 3VAXA 2BI5A 2W7MA 1GEWA 5E5IA 3B1EA 4UHOA 1BKGA 4F5IA 2JGTA 3BV0A 3MC6A 4MY5A 2EZ1A 4OTLA 4F5KA 1AMRA 2Z20A 4A72A 3ISLA 1GC4A 2BI3A 3CQ6A 3T32A 3TATA 5K8BA 1KKPA 4F5MA 3NYSA 3RCHA 1M7YA 2VMRA 4L0OA 3FFHA 3OP7A 1QIRA 4UQVA 2BIEA 2VMYA 4ZASA 4Q76A 1RV4A 4GEBA 3NYUA 2BIAA 1X2AA 4PVFA 4WD2A 3VK3A 2W7EA 3WX9A 3USFA 1O61A 5DB5A 1YJSA 2CFBA 3MKJA 1C7GA 1YJZA 2BWNA 2Z67A 1OXOA 1WKHA 1YOOA 3GZCA 3GZDA 1DKAA 3I16A 2D63A 1AY5A 1J32A 3L8AA 4ZSYA 1JS3A 3PIUA 1M0QA 3NYTA 1KMJA 5EQCA 2W8TA 3NUIA 1TOKA 3JW9A 1O69A 1SZSA 4E3RA 2BHXA 2HUFA 2Z61A 5D95A 3WGCA 1KL2A 1SF2A 1GDEA 1M0OA 3GBXA 1YNUA 4Y0HA 5EUEA 5J8QA 3I4JA 3TFUA 2DGKA 1IBJA 1XEYA 2VYCA 2X5FA 3R4TA 4ZLVA 2AY9A 3EI7A 1ASNA 3EI5A 3EIAA 4IY7A 2ZY4A 3A9YA 2AEVA 3WGBA 4BMKA 5DX5A 4GE4A 3PDBB 4ZSWA 1W7MA 1ASCA 4W91A 4WP0A 4IYOA 2VMXA 4WXFA 3HDOA 3PD6A 2XH1A 1ELQA 3PPLA 1PG8A 1C7NA 1EG5A 4OBVA 2BI9A 1WYTB 5EUDA 3AEMC 1AJRA 1FG7A 2G7JA 4JEZA 4RKDA 3DZZA 4WLJA 1QJ3A 1KKJA 3AOWA 2V1PA 2W7GA 3LVMA 3N4SA 1BQAA 4QGRA 3DYDA 2YRIA 3KE3A 4UHMA 2R5CB 3ZZJA 1JS6A 3DXWA 2C81A 3AOVA 2EPJA 4XAUA 3UAKA 1ZODA 2VGTA 2OKKA 5E3KA 4WYCA 4ZM3A 3ZZKA 1IX7A 3DXVA 4TMRA 4CBRA 3G8MA 1OXPA 4GRXA 1YJYA 1J04A 1EJIA 3GSBA 2W8WA 1FC4A 4XJLA 2DR1A 5EIGA 3ASAA 4ADEA 2DOUA 1ASBA 3BWNC 3PDBA 3NDNA 1Z7DA 2QMAA 4IXZA 1UU1A 5TF5A 1AKBA 1QJ5A 3JTXA 4H63Q 3N0LA 3WZFA 1QGNA 3BCBA 2VGZA 4LNLA 5FT8A 2CH1A 2EH6A 2CB1A 2ZP7A 3II0A 1ASAA 1WYVA 4H51A 1IX8A 1H0CA 4ISYA 3MADA 3WY7A 4BQ0A 4WXBA 3TFTA 5G4JA 3M5UA 1V2FA 4IXSA 4MKKA 5G4IA 3A8UX 4P3MA 4W1WA 5HDMA 1AKCA 1M0NA 4P7YA 4OCAA 3CBFA 1S08A 1X28A 1X29A 2ZC0A 2VGWA 3FFRA 1AY8A 1BJWA 2OGAA 2W7DA 4W1XA 5FT4A 3NX3A 4E1OA 3QGUA 1E5FA 2OKJA 3K40A 1W23A 1DTYA 2TPLA 3H7FA 2JJGA 3W1HA 4A00A 2WK9A 3HBXA 2BIGA 2D7ZA 4K2BA 3QBOA 2W8VA 3EI6A 1S0AA 3OKSA 3N7NA 4OBUA 1ASEA 3E2YA 2R2NA 2R0TA 1B5OA 3JWBA 4IX8A 5IWQA 1I41A 2BKWA 3FVSA 3AEJA 3ELPA 1AICA 2DGLA 3B1DA 1GC0A 2BI1A 1LC7A 3A9ZA 2VGSA 3UE8A 1MGVA 4K05A 1CS1A 1V72A 4KAMA 4BA4A 3E2ZA 3QPGA 2XBNA 2GMUA 2FN6A 5FT5A 4J8LA 2R5EA 2VMOA 3WKSA 4MQPA 4N0WA 3FCRA 4UHNA 1MLZA 4XJMA 3D6KA 1M6SA 2W7IA 1CJ0A 3E77A 2VMVA 5E4ZA 4XQ2A 1WYUB 1YAAA 4Y0DA 2VGVA 1SFFA 2E54A 5EIGB 1PFFA 3ASBA 1FG3A 4OC9A 3TQXA 2ZSLA 3F9TA 4LW2A 1SZUA 3FDDA 1V2DA 2QB2A 2PO3A 2D64A 4WXGA 1ASFA 2Z9WA 4AZKA 1UKJA 1V2EA 1ASLA 2W7JA 3MAUA 1TOGA 3EI9A 4O6ZA 2GB3A 4RKCA 4W8IA 5I92A 1AIBA 2ORDA 3NNKA 5G0AA 5F9SA 1TPLA 2Z9UA 3COGA 3FSLA 1AHEA 2JJEA 4F5GA 1ELUA 2DKBA 2GMSA 3FQ7A 1O4SA 3FKDA 4A6RA 4U2HA 4ZDPA 1D7UA 3FZ6A 1WKGA 1MDZA 3G7QA 2NMPA 4EB7A 1C9CA 2YRRA 4E3QA 2YOBA 4Q31A 1Z3ZA 2FQ6A 1W7NA 2FYFA 4DGTA 3L44A 2FNIA 1S09A 2O7CA 1XI9A 1W7LA 4PFFA 3BC8A 3LY1A 3BB8A 3VP6A 4GE9A 4RIZA 3VK2A 2KFPA 4CXRA 2JG2A 3KGXA 3WCOA 1ZOBA 4ITGA 4GDYA 3VOMA 3W1JA 4Q75A 3P6KA 2Z9XA 4RLGA 2EGYA 3A2BA 3NUBA 3RCHB 1T3IA 3KKIA 4F5LA 1WYVB 4F5HA 3Q8NA 1BJ4A 4F5JA 1ORDA 2JJFA 2CH2A 5EUNA 4WB0B 4OYTA 1N31A 4XEWA 4F5FA 1BJOA 1LS3A 1AMSA 7AATA 2G6WA 3EZ1A 4MQRA 4TV7A 2CJDA 2VMUA 2EO5A 3NRAA 4WYEA 3ZRPA 3NU7A 2BYJA 2QLRA 1LK9A 1B4XA 4ADBA 1C0NA 1AAWA 1CZCA 1AAMA 2YKUA 3PD6B 4WYGA 1D2FA 1ARTA 4U1TA 3QM2A 1ASGA 3RBLA 2ZY3A 3DODA 1ARHA 5D5SA 3N4RA 3IHJA 4A0RA 1ARIA 4EB5A 4PIWA 1G4XA 1E5EA 3E6GA 3QHXA 2QB3A 2R5CA 1G7WA 2VMNA 2W7FA 4JE5A 4Q6RA 1IJIA 1OATA 3BCXA 3N5MA 4GSAA 1QITA 1C4KA 1B9HA 3ELEA 2EZ2A 4EFFA 3A9XA 2ZYJA 2O0RA 2Z1YA 4R2NA 4AO9A 3DR4A 2QSRA 2D61A 2VMPA 1IX6A 1ASMA 1LW4A 3FTBA 1H1CA 1VEFA 2HP2A 2W7HA 1CL1A 4R8DA 3DU4A 1MAPA 5BJ3A 3FZ8A 3H9XA 2E7JA 3PA9A 2YKXA 1AHXA 2CJGA 1OHWA 3AV7A 1DJUA 4JEWA 1Y4IA 2D5YA 1D7SA 1N2TA 2CY8A 2C44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJ0 A;  3BN1 A;  3E2F A;  3LVK A;  1SVV A;  4B98 A;  1BW0 A;  1CQ7 A;  4NOG A;  3AEL A;  1JG8 A;  4DQ6 A;  1WYU A;  4JEY A;  3QI6 A;  3GZD C;  2BI2 A;  3FD0 A;  2ZY5 A;  3BCA A;  2Z1Z A;  2AEU A;  2D7Y A;  2JJH A;  1U08 A;  4ZDO A;  5JAY A;  1AY4 A;  2AY6 A;  4HF8 A;  3NTJ A;  4ITX A;  3FQA A;  1CL2 A;  1EQB A;  1BQD A;  3HVY A;  3R9A A;  2X5D A;  3AEP A;  1RVY A;  1IVR A;  2AY8 A;  1PMO A;  3LG0 A;  2C7T A;  3BWN A;  3MC6 C;  2W7L A;  4A0G A;  3W1I A;  4ATP A;  3ZRQ A;  9AAT A;  2AY2 A;  2VMW A;  2VMT A;  4MSO A;  3JZL A;  3LVJ A;  2D66 A;  3EUC A;  2FM1 A;  1AMA A;  3HQT A;  4MQQ A;  2AY4 A;  4WYF A;  5G2P A;  4A0H A;  2OGE A;  4JEX A;  1TAT A;  2AY7 A;  4HVK A;  1MAQ A;  3BS8 A;  2OAT A;  2VLF A;  1OHY A;  5LH9 A;  1MDO A;  3RI6 A;  1AJS B;  2HUI A;  2BWO A;  3WLX A;  4PFN A;  2JIS A;  4M2J A;  4F4E A;  2C0R A;  3HT4 A;  1TAR A;  4ZM4 A;  4LW4 A;  1P3W A;  5M49 A;  3AEM A;  2W8U A;  3CAI A;  3WKR A;  4ADC A;  3ACZ A;  3KGW A;  3AEN A;  3MAF A;  1DJ9 A;  2WKA A;  1BJO B;  1AMQ A;  1LC5 A;  4XK1 A;  2CIN A;  3MEB A;  3AEO A;  4E77 A;  1SZK A;  1PMM A;  1WST A;  2F8J A;  2YKY A;  3FZ7 A;  3B46 A;  3FRK A;  1G4V A;  3CQ5 A;  2W7K A;  2QBT A;  4KYO A;  4ATQ A;  4B9B A;  2E7I A;  1X0M A;  2VGU A;  4W5K A;  5DJ9 A;  4MKJ A;  3VK4 A;  4ZWV A;  3K28 A;  3AEJ C;  4R5Z A;  2PB0 A;  2ZUK A;  3N75 A;  2HZP A;  4IXO A;  5F8V A;  4XJO A;  4K2M A;  3HLM A;  1B5P A;  2DGM A;  1SPA A;  2VI9 A;  2VIA A;  4RJY A;  1DFO A;  1G7X A;  3DRD A;  1TAS A;  1YIZ A;  3E2Z B;  5G2Q A;  3RUY A;  1VP4 A;  1KL1 A;  3F0H A;  3P1T A;  4ZDL A;  3FVU A;  3PAA A;  3ZRR A;  4ZWM A;  1IUG A;  3B8X A;  1M0P A;  3ATH A;  2E7U A;  1MDX A;  3AEN B;  1GCK A;  3MAF B;  4CXQ A;  1ZC9 A;  3G0T A;  4AH3 A;  2VMZ A;  5EAA A;  1WYT A;  1YIY A;  3B1C A;  1GEY A;  1TOE A;  4W1V A;  3NU8 A;  5FT6 A;  2YKV A;  5M46 A;  3DR7 A;  2HUU A;  3H14 A;  3AAT A;  1D7R A;  4JF1 A;  1RVU A;  2V0Y A;  4WBT A;  3RBF A;  1I29 A;  1M4N A;  1W3U A;  3EZS A;  4ZAH A;  4FFC A;  2ZSM A;  1BS0 A;  4Y0I A;  4JF0 A;  3JU7 A;  2HOX A;  3GWP A;  1LW5 A;  3QN6 A;  4MGR A;  1ECX A;  3GR9 A;  1N8P A;  4CVQ A;  2O1B A;  2PB2 A;  4A6U A;  3BWO A;  4AZJ A;  1AHG A;  4XJP A;  4BA5 A;  1GD9 A;  4M2M A;  1I43 A;  1LKC A;  4UOY A;  1GC3 A;  2HP1 A;  2OQX A;  3I5T A;  4OMA A;  4WYD A;  3RQ1 A;  1AX4 A;  3HMU A;  3LV2 A;  3IF2 A;  4J5U A;  3MBB A;  3K7Y A;  2Z9V A;  2W8J A;  3EI8 A;  3JWA A;  2YHK A;  2RFV A;  2D65 A;  4IYO B;  1D7V A;  4RIT A;  1AHY A;  1BJN A;  1S07 A;  1QZ9 A;  1IAX A;  4TN4 A;  3GJU A;  2GSA A;  2HOR A;  3FQ8 A;  4CBS A;  2ZY2 A;  4FL0 A;  3EIB A;  4M2K A;  3FVX A;  1MLY A;  2VI8 A;  5C6U A;  2VMQ A;  4IW7 A;  1DGD A;  5BJ4 A;  4A6T A;  4EU1 A;  1CZE A;  4EMY A;  1TOI A;  5AX8 A;  2FNU A;  2YCP A;  3PGY A;  4LNJ A;  2DKJ A;  2VLH A;  1GC2 A;  1LC8 A;  4OT8 A;  2WK8 A;  4DBC A;  4KXK A;  4LC3 A;  1B9I A;  4RJ0 A;  1VJO A;  2HOZ A;  4AOA A;  2QA3 A;  4BHD A;  1KMK A;  1AKA A;  2VIB A;  3WCN A;  1AHF A;  5M4B A;  2AY5 A;  4ADD A;  2AY1 A;  3TCM A;  1BT4 A;  2VMS A;  4A0F A;  2CAN A;  4WLH A;  2YCT A;  3PDX A;  2WK7 A;  1CQ8 A;  3F6T A;  3FDB A;  1CQ6 A;  4JE5 D;  1S06 A;  2CJH A;  4K2I A;  4WYA A;  1B8G A;  4R5F A;  4RM1 A;  1O62 A;  2GQN A;  5M4D A;  4GE7 A;  1DJE A;  5HXX A;  1AJS A;  4LNM A;  1UU0 A;  1GEX A;  2Q7W A;  4AO4 A;  2AY3 A;  4N0B A;  2BYL A;  3HL2 A;  3CQ4 A;  1ARG A;  3DC1 A;  1RV3 A;  2X8U A;  1I48 A;  1TOJ A;  1IAY A;  3LWS A;  3E9K A;  2BWP A;  1ASD A;  5LHA A;  1JF9 A;  5DJ1 A;  4I8A A;  2AAT A;  3ECD A;  3GET A;  2X3L A;  2YCN A;  4JEV A;  1ARS A;  2ZJG A;  3UWC A;  2HOY A;  1M32 A;  2CST A;  4RAE A;  1OHV A;  2CTZ A;  3LVL B;  8AAT A;  1C7O A;  5EFS A;  1AIA A;  1UU2 A;  5G09 A;  1GBN A;  1QIS A;  1DGE A;  5EAV A;  5HHY A;  4WB0 A;  3VAX A;  2BI5 A;  2W7M A;  1GEW A;  5E5I A;  3B1E A;  4UHO A;  1BKG A;  4F5I A;  2JGT A;  3BV0 A;  3MC6 A;  4MY5 A;  2EZ1 A;  4OTL A;  4F5K A;  1AMR A;  2Z20 A;  4A72 A;  3ISL A;  1GC4 A;  2BI3 A;  3CQ6 A;  3T32 A;  3TAT A;  5K8B A;  1KKP A;  4F5M A;  3NYS A;  3RCH A;  1M7Y A;  2VMR A;  4L0O A;  3FFH A;  3OP7 A;  1QIR A;  4UQV A;  2BIE A;  2VMY A;  4ZAS A;  4Q76 A;  1RV4 A;  4GEB A;  3NYU A;  2BIA A;  1X2A A;  4PVF A;  4WD2 A;  3VK3 A;  2W7E A;  3WX9 A;  3USF A;  1O61 A;  5DB5 A;  1YJS A;  2CFB A;  3MKJ A;  1C7G A;  1YJZ A;  2BWN A;  2Z67 A;  1OXO A;  1WKH A;  1YOO A;  3GZC A;  3GZD A;  1DKA A;  3I16 A;  2D63 A;  1AY5 A;  1J32 A;  3L8A A;  4ZSY A;  1JS3 A;  3PIU A;  1M0Q A;  3NYT A;  1KMJ A;  5EQC A;  2W8T A;  3NUI A;  1TOK A;  3JW9 A;  1O69 A;  1SZS A;  4E3R A;  2BHX A;  2HUF A;  2Z61 A;  5D95 A;  3WGC A;  1KL2 A;  1SF2 A;  1GDE A;  1M0O A;  3GBX A;  1YNU A;  4Y0H A;  5EUE A;  5J8Q A;  3I4J A;  3TFU A;  2DGK A;  1IBJ A;  1XEY A;  2VYC A;  2X5F A;  3R4T A;  4ZLV A;  2AY9 A;  3EI7 A;  1ASN A;  3EI5 A;  3EIA A;  4IY7 A;  2ZY4 A;  3A9Y A;  2AEV A;  3WGB A;  4BMK A;  5DX5 A;  4GE4 A;  3PDB B;  4ZSW A;  1W7M A;  1ASC A;  4W91 A;  4WP0 A;  4IYO A;  2VMX A;  4WXF A;  3HDO A;  3PD6 A;  2XH1 A;  1ELQ A;  3PPL A;  1PG8 A;  1C7N A;  1EG5 A;  4OBV A;  2BI9 A;  1WYT B;  5EUD A;  3AEM C;  1AJR A;  1FG7 A;  4JEZ A;  4RKD A;  3DZZ A;  4WLJ A;  1QJ3 A;  1KKJ A;  3AOW A;  2V1P A;  2W7G A;  3LVM A;  1BQA A;  4QGR A;  3DYD A;  2YRI A;  3KE3 A;  4UHM A;  2R5C B;  3ZZJ A;  1JS6 A;  3DXW A;  2C81 A;  3AOV A;  2EPJ A;  4XAU A;  3UAK A;  1ZOD A;  2VGT A;  2OKK A;  5E3K A;  4WYC A;  4ZM3 A;  3ZZK A;  1IX7 A;  3DXV A;  4TMR A;  4CBR A;  3G8M A;  1OXP A;  4GRX A;  1YJY A;  1J04 A;  1EJI A;  3GSB A;  2W8W A;  1FC4 A;  4XJL A;  2DR1 A;  5EIG A;  3ASA A;  4ADE A;  2DOU A;  1ASB A;  3BWN C;  3PDB A;  3NDN A;  1Z7D A;  2QMA A;  4IXZ A;  1UU1 A;  5TF5 A;  1AKB A;  1QJ5 A;  3JTX A;  3N0L A;  3WZF A;  1QGN A;  3BCB A;  2VGZ A;  4LNL A;  5FT8 A;  2CH1 A;  2EH6 A;  2CB1 A;  2ZP7 A;  3II0 A;  1ASA A;  1WYV A;  4H51 A;  1IX8 A;  1H0C A;  4ISY A;  3MAD A;  3WY7 A;  4BQ0 A;  4WXB A;  3TFT A;  5G4J A;  3M5U A;  1V2F A;  4IXS A;  4MKK A;  5G4I A;  3A8U X;  4P3M A;  4W1W A;  5HDM A;  1AKC A;  1M0N A;  4P7Y A;  4OCA A;  3CBF A;  1S08 A;  1X28 A;  1X29 A;  2ZC0 A;  2VGW A;  3FFR A;  1AY8 A;  1BJW A;  2OGA A;  2W7D A;  4W1X A;  5FT4 A;  3NX3 A;  4E1O A;  3QGU A;  1E5F A;  2OKJ A;  3K40 A;  1W23 A;  1DTY A;  2TPL A;  3H7F A;  2JJG A;  3W1H A;  4A00 A;  2WK9 A;  3HBX A;  2BIG A;  2D7Z A;  4K2B A;  3QBO A;  2W8V A;  3EI6 A;  1S0A A;  3OKS A;  4OBU A;  1ASE A;  3E2Y A;  2R2N A;  2R0T A;  1B5O A;  3JWB A;  4IX8 A;  5IWQ A;  1I41 A;  2BKW A;  3FVS A;  3AEJ A;  3ELP A;  1AIC A;  2DGL A;  3B1D A;  1GC0 A;  2BI1 A;  1LC7 A;  3A9Z A;  2VGS A;  3UE8 A;  1MGV A;  1CS1 A;  1V72 A;  4KAM A;  4BA4 A;  3E2Z A;  3QPG A;  2XBN A;  2GMU A;  2FN6 A;  5FT5 A;  4J8L A;  2R5E A;  2VMO A;  3WKS A;  4MQP A;  4N0W A;  3FCR A;  4UHN A;  1MLZ A;  4XJM A;  3D6K A;  1M6S A;  2W7I A;  1CJ0 A;  3E77 A;  2VMV A;  5E4Z A;  4XQ2 A;  1WYU B;  1YAA A;  4Y0D A;  2VGV A;  1SFF A;  2E54 A;  5EIG B;  1PFF A;  3ASB A;  1FG3 A;  4OC9 A;  3TQX A;  2ZSL A;  3F9T A;  4LW2 A;  1SZU A;  3FDD A;  1V2D A;  2QB2 A;  2PO3 A;  2D64 A;  4WXG A;  1ASF A;  2Z9W A;  4AZK A;  1UKJ A;  1V2E A;  1ASL A;  2W7J A;  3MAU A;  1TOG A;  3EI9 A;  4O6Z A;  2GB3 A;  4RKC A;  4W8I A;  5I92 A;  1AIB A;  2ORD A;  3NNK A;  5G0A A;  5F9S A;  1TPL A;  2Z9U A;  3COG A;  3FSL A;  1AHE A;  2JJE A;  4F5G A;  1ELU A;  2DKB A;  2GMS A;  3FQ7 A;  1O4S A;  3FKD A;  4A6R A;  4U2H A;  4ZDP A;  1D7U A;  3FZ6 A;  1WKG A;  1MDZ A;  3G7Q A;  2NMP A;  4EB7 A;  1C9C A;  2YRR A;  4E3Q A;  2YOB A;  4Q31 A;  1Z3Z A;  2FQ6 A;  1W7N A;  2FYF A;  4DGT A;  3L44 A;  2FNI A;  1S09 A;  2O7C A;  1XI9 A;  1W7L A;  4PFF A;  3BC8 A;  3LY1 A;  3BB8 A;  3VP6 A;  4GE9 A;  4RIZ A;  3VK2 A;  4CXR A;  2JG2 A;  3KGX A;  3WCO A;  1ZOB A;  4ITG A;  4GDY A;  3VOM A;  3W1J A;  4Q75 A;  3P6K A;  2Z9X A;  4RLG A;  2EGY A;  3A2B A;  3NUB A;  3RCH B;  1T3I A;  3KKI A;  4F5L A;  1WYV B;  4F5H A;  3Q8N A;  1BJ4 A;  4F5J A;  1ORD A;  2JJF A;  2CH2 A;  5EUN A;  4WB0 B;  4OYT A;  1N31 A;  4XEW A;  4F5F A;  1BJO A;  1LS3 A;  1AMS A;  7AAT A;  2G6W A;  3EZ1 A;  4MQR A;  4TV7 A;  2CJD A;  2VMU A;  2EO5 A;  3NRA A;  4WYE A;  3ZRP A;  3NU7 A;  2BYJ A;  2QLR A;  1LK9 A;  1B4X A;  4ADB A;  1C0N A;  1AAW A;  1CZC A;  1AAM A;  2YKU A;  3PD6 B;  4WYG A;  1D2F A;  1ART A;  4U1T A;  3QM2 A;  1ASG A;  3RBL A;  2ZY3 A;  3DOD A;  1ARH A;  5D5S A;  3IHJ A;  4A0R A;  1ARI A;  4EB5 A;  4PIW A;  1G4X A;  1E5E A;  3E6G A;  3QHX A;  2QB3 A;  2R5C A;  1G7W A;  2VMN A;  2W7F A;  4JE5 A;  4Q6R A;  1IJI A;  1OAT A;  3BCX A;  3N5M A;  4GSA A;  1QIT A;  1C4K A;  1B9H A;  3ELE A;  2EZ2 A;  4EFF A;  3A9X A;  2ZYJ A;  2O0R A;  2Z1Y A;  4R2N A;  4AO9 A;  3DR4 A;  2D61 A;  2VMP A;  1IX6 A;  1ASM A;  1LW4 A;  3FTB A;  1H1C A;  1VEF A;  2HP2 A;  2W7H A;  1CL1 A;  4R8D A;  3DU4 A;  1MAP A;  5BJ3 A;  3FZ8 A;  2E7J A;  3PA9 A;  2YKX A;  1AHX A;  2CJG A;  1OHW A;  3AV7 A;  1DJU A;  4JEW A;  1Y4I A;  2D5Y A;  1D7S A;  1N2T A;  2CY8 A;  2C44 A; 
#chains in the Genus database with same CATH topology
 3PJ0 A;  3BN1 A;  3E2F A;  3LVK A;  1SVV A;  4B98 A;  1BW0 A;  1CQ7 A;  4NOG A;  3AEL A;  1JG8 A;  4DQ6 A;  1WYU A;  4JEY A;  3QI6 A;  3GZD C;  2BI2 A;  3FD0 A;  2WB6 A;  2ZY5 A;  3BCA A;  2Z1Z A;  2AEU A;  2D7Y A;  2JJH A;  1U08 A;  4ZDO A;  5JAY A;  1AY4 A;  2AY6 A;  4HF8 A;  3NTJ A;  4ITX A;  3FQA A;  1CL2 A;  1EQB A;  1BQD A;  3HVY A;  3R9A A;  2X5D A;  3AEP A;  1RVY A;  1IVR A;  2AY8 A;  1PMO A;  3LG0 A;  2C7T A;  3BWN A;  3MC6 C;  2W7L A;  4A0G A;  3W1I A;  4ATP A;  3ZRQ A;  9AAT A;  2AY2 A;  2VMW A;  2VMT A;  4MSO A;  3JZL A;  3LVJ A;  2D66 A;  3EUC A;  2FM1 A;  1AMA A;  3HQT A;  4MQQ A;  2AY4 A;  4WYF A;  5G2P A;  4A0H A;  2OGE A;  3N4X A;  4JEX A;  1TAT A;  2AY7 A;  4HVK A;  1MAQ A;  3BS8 A;  2OAT A;  2VLF A;  1OHY A;  5LH9 A;  1MDO A;  3RI6 A;  1AJS B;  2HUI A;  2BWO A;  2EYQ A;  3WLX A;  4PFN A;  2JIS A;  4M2J A;  4F4E A;  2C0R A;  3HT4 A;  1TAR A;  4ZM4 A;  4LW4 A;  1P3W A;  5M49 A;  3AEM A;  2W8U A;  3CAI A;  3WKR A;  4ADC A;  3ACZ A;  3KGW A;  3AEN A;  3MAF A;  1DJ9 A;  2WKA A;  1BJO B;  1AMQ A;  1LC5 A;  4XK1 A;  2CIN A;  3MEB A;  3AEO A;  4E77 A;  1SZK A;  1PMM A;  1WST A;  2F8J A;  2YKY A;  3FZ7 A;  3B46 A;  3FRK A;  1G4V A;  3CQ5 A;  2W7K A;  2QBT A;  4KYO A;  4ATQ A;  4B9B A;  2E7I A;  1X0M A;  2VGU A;  4W5K A;  5DJ9 A;  4MKJ A;  3VK4 A;  4ZWV A;  1KAF A;  3K28 A;  3AEJ C;  4R5Z A;  2PB0 A;  2ZUK A;  3N75 A;  2HZP A;  4IXO A;  5F8V A;  4XJO A;  5KTB A;  4K2M A;  3HLM A;  1B5P A;  2DGM A;  1SPA A;  2VI9 A;  2VIA A;  4RJY A;  1DFO A;  1G7X A;  3DRD A;  1TAS A;  1YIZ A;  3E2Z B;  5G2Q A;  3RUY A;  1VP4 A;  1KL1 A;  3F0H A;  3P1T A;  4ZDL A;  3FVU A;  3PAA A;  3ZRR A;  4ZWM A;  1IUG A;  3B8X A;  1M0P A;  3ATH A;  2E7U A;  1MDX A;  3AEN B;  1GCK A;  3MAF B;  4CXQ A;  1ZC9 A;  3G0T A;  4AH3 A;  2VMZ A;  5EAA A;  1WYT A;  1YIY A;  3B1C A;  1GEY A;  1TOE A;  4W1V A;  3NU8 A;  5FT6 A;  2YKV A;  5M46 A;  3DR7 A;  2HUU A;  3H14 A;  3AAT A;  1D7R A;  4JF1 A;  1RVU A;  2V0Y A;  4WBT A;  3RBF A;  1I29 A;  1M4N A;  1W3U A;  3EZS A;  4ZAH A;  4FFC A;  2ZSM A;  1BS0 A;  4Y0I A;  4JF0 A;  3JU7 A;  2HOX A;  3GWP A;  1LW5 A;  3QN6 A;  4MGR A;  1ECX A;  3GR9 A;  1N8P A;  4CVQ A;  2O1B A;  2PB2 A;  4A6U A;  3BWO A;  4AZJ A;  1AHG A;  4XJP A;  4BA5 A;  1GD9 A;  4M2M A;  1I43 A;  1LKC A;  4UOY A;  1GC3 A;  2HP1 A;  2OQX A;  3I5T A;  4OMA A;  4WYD A;  3RQ1 A;  1AX4 A;  3HMU A;  3LV2 A;  3IF2 A;  4J5U A;  3MBB A;  3K7Y A;  2Z9V A;  2W8J A;  3EI8 A;  3JWA A;  2YHK A;  2RFV A;  2D65 A;  4IYO B;  1D7V A;  4RIT A;  1AHY A;  1BJN A;  1S07 A;  1QZ9 A;  1IAX A;  4TN4 A;  3GJU A;  2GSA A;  2HOR A;  3FQ8 A;  4CBS A;  2ZY2 A;  4FL0 A;  3EIB A;  4M2K A;  3FVX A;  1MLY A;  2VI8 A;  5C6U A;  2VMQ A;  4IW7 A;  1DGD A;  5BJ4 A;  4A6T A;  4EU1 A;  1CZE A;  4EMY A;  1TOI A;  5AX8 A;  2FNU A;  2YCP A;  3PGY A;  4LNJ A;  2DKJ A;  2VLH A;  1GC2 A;  1LC8 A;  4OT8 A;  2WK8 A;  4DBC A;  4KXK A;  4LC3 A;  1B9I A;  4RJ0 A;  1VJO A;  2HOZ A;  4AOA A;  2QA3 A;  4BHD A;  1KMK A;  1AKA A;  2VIB A;  3WCN A;  1AHF A;  5M4B A;  2AY5 A;  4ADD A;  2AY1 A;  3TCM A;  1BT4 A;  2VMS A;  4A0F A;  2CAN A;  4WLH A;  2YCT A;  3PDX A;  2WK7 A;  1CQ8 A;  3F6T A;  3FDB A;  1CQ6 A;  4JE5 D;  1S06 A;  2CJH A;  4K2I A;  4WYA A;  1B8G A;  4R5F A;  2FKI A;  4RM1 A;  1O62 A;  2GQN A;  5M4D A;  4GE7 A;  1DJE A;  5HXX A;  1AJS A;  4LNM A;  1UU0 A;  1GEX A;  2Q7W A;  4AO4 A;  2AY3 A;  4N0B A;  2BYL A;  3HL2 A;  3CQ4 A;  1ARG A;  3DC1 A;  1RV3 A;  2X8U A;  1I48 A;  1TOJ A;  1IAY A;  3LWS A;  3E9K A;  2BWP A;  1ASD A;  5LHA A;  1JF9 A;  5DJ1 A;  4I8A A;  2AAT A;  3ECD A;  3GET A;  2X3L A;  2YCN A;  4JEV A;  1ARS A;  2ZJG A;  3UWC A;  2HOY A;  1M32 A;  2CST A;  4RAE A;  2A1V A;  1OHV A;  2CTZ A;  3LVL B;  8AAT A;  1C7O A;  5EFS A;  1AIA A;  1UU2 A;  5G09 A;  1GBN A;  1QIS A;  1DGE A;  5EAV A;  5HHY A;  4WB0 A;  3VAX A;  2BI5 A;  2W7M A;  1GEW A;  5E5I A;  3B1E A;  4UHO A;  1BKG A;  4F5I A;  2JGT A;  3BV0 A;  3MC6 A;  4MY5 A;  2EZ1 A;  4OTL A;  4F5K A;  1AMR A;  2Z20 A;  4A72 A;  3ISL A;  1GC4 A;  2BI3 A;  3CQ6 A;  3T32 A;  3TAT A;  5K8B A;  1KKP A;  4F5M A;  3NYS A;  3RCH A;  1M7Y A;  2VMR A;  4L0O A;  3FFH A;  3OP7 A;  1QIR A;  4UQV A;  2BIE A;  2VMY A;  4ZAS A;  4Q76 A;  1RV4 A;  4GEB A;  3NYU A;  2BIA A;  1X2A A;  4PVF A;  4WD2 A;  3VK3 A;  2W7E A;  3WX9 A;  3USF A;  1O61 A;  5DB5 A;  1YJS A;  2CFB A;  3MKJ A;  1C7G A;  1YJZ A;  2BWN A;  2Z67 A;  1OXO A;  1WKH A;  1YOO A;  3GZC A;  3GZD A;  1DKA A;  3I16 A;  2D63 A;  1AY5 A;  1J32 A;  3L8A A;  4ZSY A;  1JS3 A;  3PIU A;  1M0Q A;  3NYT A;  1KMJ A;  5EQC A;  2W8T A;  3NUI A;  1TOK A;  3JW9 A;  1O69 A;  1SZS A;  4E3R A;  2BHX A;  2HUF A;  2Z61 A;  5D95 A;  3WGC A;  1KL2 A;  1SF2 A;  1GDE A;  1M0O A;  3GBX A;  1YNU A;  4Y0H A;  5EUE A;  5J8Q A;  3I4J A;  3TFU A;  2DGK A;  1IBJ A;  1XEY A;  2VYC A;  2X5F A;  3R4T A;  4ZLV A;  2AY9 A;  3EI7 A;  1ASN A;  3EI5 A;  3EIA A;  4IY7 A;  2ZY4 A;  3A9Y A;  2AEV A;  3WGB A;  4BMK A;  5DX5 A;  4GE4 A;  3PDB B;  4ZSW A;  1W7M A;  1ASC A;  4W91 A;  4WP0 A;  4IYO A;  2VMX A;  4WXF A;  3HDO A;  3PD6 A;  2XH1 A;  1ELQ A;  3PPL A;  1PG8 A;  1C7N A;  1EG5 A;  4OBV A;  2BI9 A;  1WYT B;  5EUD A;  3AEM C;  1AJR A;  1FG7 A;  2G7J A;  4JEZ A;  4RKD A;  3DZZ A;  4WLJ A;  1QJ3 A;  1KKJ A;  3AOW A;  2V1P A;  2W7G A;  3LVM A;  3N4S A;  1BQA A;  4QGR A;  3DYD A;  2YRI A;  3KE3 A;  4UHM A;  2R5C B;  3ZZJ A;  1JS6 A;  3DXW A;  2C81 A;  3AOV A;  2EPJ A;  4XAU A;  3UAK A;  1ZOD A;  2VGT A;  2OKK A;  5E3K A;  4WYC A;  4ZM3 A;  3ZZK A;  1IX7 A;  3DXV A;  4TMR A;  4CBR A;  3G8M A;  1OXP A;  4GRX A;  1YJY A;  1J04 A;  1EJI A;  3GSB A;  2W8W A;  1FC4 A;  4XJL A;  2DR1 A;  5EIG A;  3ASA A;  4ADE A;  2DOU A;  1ASB A;  3BWN C;  3PDB A;  3NDN A;  1Z7D A;  2QMA A;  4IXZ A;  1UU1 A;  5TF5 A;  1AKB A;  1QJ5 A;  3JTX A;  4H63 Q;  3N0L A;  3WZF A;  1QGN A;  3BCB A;  2VGZ A;  4LNL A;  5FT8 A;  2CH1 A;  2EH6 A;  2CB1 A;  2ZP7 A;  3II0 A;  1ASA A;  1WYV A;  4H51 A;  1IX8 A;  1H0C A;  4ISY A;  3MAD A;  3WY7 A;  4BQ0 A;  4WXB A;  3TFT A;  5G4J A;  3M5U A;  1V2F A;  4IXS A;  4MKK A;  5G4I A;  3A8U X;  4P3M A;  4W1W A;  5HDM A;  1AKC A;  1M0N A;  4P7Y A;  4OCA A;  3CBF A;  1S08 A;  1X28 A;  1X29 A;  2ZC0 A;  2VGW A;  3FFR A;  1AY8 A;  1BJW A;  2OGA A;  2W7D A;  4W1X A;  5FT4 A;  3NX3 A;  4E1O A;  3QGU A;  1E5F A;  2OKJ A;  3K40 A;  1W23 A;  1DTY A;  2TPL A;  3H7F A;  2JJG A;  3W1H A;  4A00 A;  2WK9 A;  3HBX A;  2BIG A;  2D7Z A;  4K2B A;  3QBO A;  2W8V A;  3EI6 A;  1S0A A;  3OKS A;  3N7N A;  4OBU A;  1ASE A;  3E2Y A;  2R2N A;  2R0T A;  1B5O A;  3JWB A;  4IX8 A;  5IWQ A;  1I41 A;  2BKW A;  3FVS A;  3AEJ A;  3ELP A;  1AIC A;  2DGL A;  3B1D A;  1GC0 A;  2BI1 A;  1LC7 A;  3A9Z A;  2VGS A;  3UE8 A;  1MGV A;  4K05 A;  1CS1 A;  1V72 A;  4KAM A;  4BA4 A;  3E2Z A;  3QPG A;  2XBN A;  2GMU A;  2FN6 A;  5FT5 A;  4J8L A;  2R5E A;  2VMO A;  3WKS A;  4MQP A;  4N0W A;  3FCR A;  4UHN A;  1MLZ A;  4XJM A;  3D6K A;  1M6S A;  2W7I A;  1CJ0 A;  3E77 A;  2VMV A;  5E4Z A;  4XQ2 A;  1WYU B;  1YAA A;  4Y0D A;  2VGV A;  1SFF A;  2E54 A;  5EIG B;  1PFF A;  3ASB A;  1FG3 A;  4OC9 A;  3TQX A;  2ZSL A;  3F9T A;  4LW2 A;  1SZU A;  3FDD A;  1V2D A;  2QB2 A;  2PO3 A;  2D64 A;  4WXG A;  1ASF A;  2Z9W A;  4AZK A;  1UKJ A;  1V2E A;  1ASL A;  2W7J A;  3MAU A;  1TOG A;  3EI9 A;  4O6Z A;  2GB3 A;  4RKC A;  4W8I A;  5I92 A;  1AIB A;  2ORD A;  3NNK A;  5G0A A;  5F9S A;  1TPL A;  2Z9U A;  3COG A;  3FSL A;  1AHE A;  2JJE A;  4F5G A;  1ELU A;  2DKB A;  2GMS A;  3FQ7 A;  1O4S A;  3FKD A;  4A6R A;  4U2H A;  4ZDP A;  1D7U A;  3FZ6 A;  1WKG A;  1MDZ A;  3G7Q A;  2NMP A;  4EB7 A;  1C9C A;  2YRR A;  4E3Q A;  2YOB A;  4Q31 A;  1Z3Z A;  2FQ6 A;  1W7N A;  2FYF A;  4DGT A;  3L44 A;  2FNI A;  1S09 A;  2O7C A;  1XI9 A;  1W7L A;  4PFF A;  3BC8 A;  3LY1 A;  3BB8 A;  3VP6 A;  4GE9 A;  4RIZ A;  3VK2 A;  2KFP A;  4CXR A;  2JG2 A;  3KGX A;  3WCO A;  1ZOB A;  4ITG A;  4GDY A;  3VOM A;  3W1J A;  4Q75 A;  3P6K A;  2Z9X A;  4RLG A;  2EGY A;  3A2B A;  3NUB A;  3RCH B;  1T3I A;  3KKI A;  4F5L A;  1WYV B;  4F5H A;  3Q8N A;  1BJ4 A;  4F5J A;  1ORD A;  2JJF A;  2CH2 A;  5EUN A;  4WB0 B;  4OYT A;  1N31 A;  4XEW A;  4F5F A;  1BJO A;  1LS3 A;  1AMS A;  7AAT A;  2G6W A;  3EZ1 A;  4MQR A;  4TV7 A;  2CJD A;  2VMU A;  2EO5 A;  3NRA A;  4WYE A;  3ZRP A;  3NU7 A;  2BYJ A;  2QLR A;  1LK9 A;  1B4X A;  4ADB A;  1C0N A;  1AAW A;  1CZC A;  1AAM A;  2YKU A;  3PD6 B;  4WYG A;  1D2F A;  1ART A;  4U1T A;  3QM2 A;  1ASG A;  3RBL A;  2ZY3 A;  3DOD A;  1ARH A;  5D5S A;  3N4R A;  3IHJ A;  4A0R A;  1ARI A;  4EB5 A;  4PIW A;  1G4X A;  1E5E A;  3E6G A;  3QHX A;  2QB3 A;  2R5C A;  1G7W A;  2VMN A;  2W7F A;  4JE5 A;  4Q6R A;  1IJI A;  1OAT A;  3BCX A;  3N5M A;  4GSA A;  1QIT A;  1C4K A;  1B9H A;  3ELE A;  2EZ2 A;  4EFF A;  3A9X A;  2ZYJ A;  2O0R A;  2Z1Y A;  4R2N A;  4AO9 A;  3DR4 A;  2QSR A;  2D61 A;  2VMP A;  1IX6 A;  1ASM A;  1LW4 A;  3FTB A;  1H1C A;  1VEF A;  2HP2 A;  2W7H A;  1CL1 A;  4R8D A;  3DU4 A;  1MAP A;  5BJ3 A;  3FZ8 A;  3H9X A;  2E7J A;  3PA9 A;  2YKX A;  1AHX A;  2CJG A;  1OHW A;  3AV7 A;  1DJU A;  4JEW A;  1Y4I A;  2D5Y A;  1D7S A;  1N2T A;  2CY8 A;  2C44 A; 
#chains in the Genus database with same CATH homology
 3PJ0 A;  3BN1 A;  3E2F A;  3LVK A;  1SVV A;  4B98 A;  1BW0 A;  1CQ7 A;  4NOG A;  3AEL A;  1JG8 A;  4DQ6 A;  1WYU A;  4JEY A;  3QI6 A;  3GZD C;  2BI2 A;  3FD0 A;  2WB6 A;  2ZY5 A;  3BCA A;  2Z1Z A;  2AEU A;  2D7Y A;  2JJH A;  1U08 A;  4ZDO A;  5JAY A;  1AY4 A;  2AY6 A;  4HF8 A;  3NTJ A;  4ITX A;  3FQA A;  1CL2 A;  1EQB A;  1BQD A;  3HVY A;  3R9A A;  2X5D A;  3AEP A;  1RVY A;  1IVR A;  2AY8 A;  1PMO A;  3LG0 A;  2C7T A;  3BWN A;  3MC6 C;  2W7L A;  4A0G A;  3W1I A;  4ATP A;  3ZRQ A;  9AAT A;  2AY2 A;  2VMW A;  2VMT A;  4MSO A;  3JZL A;  3LVJ A;  2D66 A;  3EUC A;  2FM1 A;  1AMA A;  3HQT A;  4MQQ A;  2AY4 A;  4WYF A;  5G2P A;  4A0H A;  2OGE A;  3N4X A;  4JEX A;  1TAT A;  2AY7 A;  4HVK A;  1MAQ A;  3BS8 A;  2OAT A;  2VLF A;  1OHY A;  5LH9 A;  1MDO A;  3RI6 A;  1AJS B;  2HUI A;  2BWO A;  2EYQ A;  3WLX A;  4PFN A;  2JIS A;  4M2J A;  4F4E A;  2C0R A;  3HT4 A;  1TAR A;  4ZM4 A;  4LW4 A;  1P3W A;  5M49 A;  3AEM A;  2W8U A;  3CAI A;  3WKR A;  4ADC A;  3ACZ A;  3KGW A;  3AEN A;  3MAF A;  1DJ9 A;  2WKA A;  1BJO B;  1AMQ A;  1LC5 A;  4XK1 A;  2CIN A;  3MEB A;  3AEO A;  4E77 A;  1SZK A;  1PMM A;  1WST A;  2F8J A;  2YKY A;  3FZ7 A;  3B46 A;  3FRK A;  1G4V A;  3CQ5 A;  2W7K A;  2QBT A;  4KYO A;  4ATQ A;  4B9B A;  2E7I A;  1X0M A;  2VGU A;  4W5K A;  5DJ9 A;  4MKJ A;  3VK4 A;  4ZWV A;  3K28 A;  3AEJ C;  4R5Z A;  2PB0 A;  2ZUK A;  3N75 A;  2HZP A;  4IXO A;  5F8V A;  4XJO A;  5KTB A;  4K2M A;  3HLM A;  1B5P A;  2DGM A;  1SPA A;  2VI9 A;  2VIA A;  4RJY A;  1DFO A;  1G7X A;  3DRD A;  1TAS A;  1YIZ A;  3E2Z B;  5G2Q A;  3RUY A;  1VP4 A;  1KL1 A;  3F0H A;  3P1T A;  4ZDL A;  3FVU A;  3PAA A;  3ZRR A;  4ZWM A;  1IUG A;  3B8X A;  1M0P A;  3ATH A;  2E7U A;  1MDX A;  3AEN B;  1GCK A;  3MAF B;  4CXQ A;  1ZC9 A;  3G0T A;  4AH3 A;  2VMZ A;  5EAA A;  1WYT A;  1YIY A;  3B1C A;  1GEY A;  1TOE A;  4W1V A;  3NU8 A;  5FT6 A;  2YKV A;  5M46 A;  3DR7 A;  2HUU A;  3H14 A;  3AAT A;  1D7R A;  4JF1 A;  1RVU A;  2V0Y A;  4WBT A;  3RBF A;  1I29 A;  1M4N A;  1W3U A;  3EZS A;  4ZAH A;  4FFC A;  2ZSM A;  1BS0 A;  4Y0I A;  4JF0 A;  3JU7 A;  2HOX A;  3GWP A;  1LW5 A;  3QN6 A;  4MGR A;  1ECX A;  3GR9 A;  1N8P A;  4CVQ A;  2O1B A;  2PB2 A;  4A6U A;  3BWO A;  4AZJ A;  1AHG A;  4XJP A;  4BA5 A;  1GD9 A;  4M2M A;  1I43 A;  1LKC A;  4UOY A;  1GC3 A;  2HP1 A;  2OQX A;  3I5T A;  4OMA A;  4WYD A;  3RQ1 A;  1AX4 A;  3HMU A;  3LV2 A;  3IF2 A;  4J5U A;  3MBB A;  3K7Y A;  2Z9V A;  2W8J A;  3EI8 A;  3JWA A;  2YHK A;  2RFV A;  2D65 A;  4IYO B;  1D7V A;  4RIT A;  1AHY A;  1BJN A;  1S07 A;  1QZ9 A;  1IAX A;  4TN4 A;  3GJU A;  2GSA A;  2HOR A;  3FQ8 A;  4CBS A;  2ZY2 A;  4FL0 A;  3EIB A;  4M2K A;  3FVX A;  1MLY A;  2VI8 A;  5C6U A;  2VMQ A;  4IW7 A;  1DGD A;  5BJ4 A;  4A6T A;  4EU1 A;  1CZE A;  4EMY A;  1TOI A;  5AX8 A;  2FNU A;  2YCP A;  3PGY A;  4LNJ A;  2DKJ A;  2VLH A;  1GC2 A;  1LC8 A;  4OT8 A;  2WK8 A;  4DBC A;  4KXK A;  4LC3 A;  1B9I A;  4RJ0 A;  1VJO A;  2HOZ A;  4AOA A;  2QA3 A;  4BHD A;  1KMK A;  1AKA A;  2VIB A;  3WCN A;  1AHF A;  5M4B A;  2AY5 A;  4ADD A;  2AY1 A;  3TCM A;  1BT4 A;  2VMS A;  4A0F A;  2CAN A;  4WLH A;  2YCT A;  3PDX A;  2WK7 A;  1CQ8 A;  3F6T A;  3FDB A;  1CQ6 A;  4JE5 D;  1S06 A;  2CJH A;  4K2I A;  4WYA A;  1B8G A;  4R5F A;  2FKI A;  4RM1 A;  1O62 A;  2GQN A;  5M4D A;  4GE7 A;  1DJE A;  5HXX A;  1AJS A;  4LNM A;  1UU0 A;  1GEX A;  2Q7W A;  4AO4 A;  2AY3 A;  4N0B A;  2BYL A;  3HL2 A;  3CQ4 A;  1ARG A;  3DC1 A;  1RV3 A;  2X8U A;  1I48 A;  1TOJ A;  1IAY A;  3LWS A;  3E9K A;  2BWP A;  1ASD A;  5LHA A;  1JF9 A;  5DJ1 A;  4I8A A;  2AAT A;  3ECD A;  3GET A;  2X3L A;  2YCN A;  4JEV A;  1ARS A;  2ZJG A;  3UWC A;  2HOY A;  1M32 A;  2CST A;  4RAE A;  2A1V A;  1OHV A;  2CTZ A;  3LVL B;  8AAT A;  1C7O A;  5EFS A;  1AIA A;  1UU2 A;  5G09 A;  1GBN A;  1QIS A;  1DGE A;  5EAV A;  5HHY A;  4WB0 A;  3VAX A;  2BI5 A;  2W7M A;  1GEW A;  5E5I A;  3B1E A;  4UHO A;  1BKG A;  4F5I A;  2JGT A;  3BV0 A;  3MC6 A;  4MY5 A;  2EZ1 A;  4OTL A;  4F5K A;  1AMR A;  2Z20 A;  4A72 A;  3ISL A;  1GC4 A;  2BI3 A;  3CQ6 A;  3T32 A;  3TAT A;  5K8B A;  1KKP A;  4F5M A;  3NYS A;  3RCH A;  1M7Y A;  2VMR A;  4L0O A;  3FFH A;  3OP7 A;  1QIR A;  4UQV A;  2BIE A;  2VMY A;  4ZAS A;  4Q76 A;  1RV4 A;  4GEB A;  3NYU A;  2BIA A;  1X2A A;  4PVF A;  4WD2 A;  3VK3 A;  2W7E A;  3WX9 A;  3USF A;  1O61 A;  5DB5 A;  1YJS A;  2CFB A;  3MKJ A;  1C7G A;  1YJZ A;  2BWN A;  2Z67 A;  1OXO A;  1WKH A;  1YOO A;  3GZC A;  3GZD A;  1DKA A;  3I16 A;  2D63 A;  1AY5 A;  1J32 A;  3L8A A;  4ZSY A;  1JS3 A;  3PIU A;  1M0Q A;  3NYT A;  1KMJ A;  5EQC A;  2W8T A;  3NUI A;  1TOK A;  3JW9 A;  1O69 A;  1SZS A;  4E3R A;  2BHX A;  2HUF A;  2Z61 A;  5D95 A;  3WGC A;  1KL2 A;  1SF2 A;  1GDE A;  1M0O A;  3GBX A;  1YNU A;  4Y0H A;  5EUE A;  5J8Q A;  3I4J A;  3TFU A;  2DGK A;  1IBJ A;  1XEY A;  2VYC A;  2X5F A;  3R4T A;  4ZLV A;  2AY9 A;  3EI7 A;  1ASN A;  3EI5 A;  3EIA A;  4IY7 A;  2ZY4 A;  3A9Y A;  2AEV A;  3WGB A;  4BMK A;  5DX5 A;  4GE4 A;  3PDB B;  4ZSW A;  1W7M A;  1ASC A;  4W91 A;  4WP0 A;  4IYO A;  2VMX A;  4WXF A;  3HDO A;  3PD6 A;  2XH1 A;  1ELQ A;  3PPL A;  1PG8 A;  1C7N A;  1EG5 A;  4OBV A;  2BI9 A;  1WYT B;  5EUD A;  3AEM C;  1AJR A;  1FG7 A;  2G7J A;  4JEZ A;  4RKD A;  3DZZ A;  4WLJ A;  1QJ3 A;  1KKJ A;  3AOW A;  2V1P A;  2W7G A;  3LVM A;  3N4S A;  1BQA A;  4QGR A;  3DYD A;  2YRI A;  3KE3 A;  4UHM A;  2R5C B;  3ZZJ A;  1JS6 A;  3DXW A;  2C81 A;  3AOV A;  2EPJ A;  4XAU A;  3UAK A;  1ZOD A;  2VGT A;  2OKK A;  5E3K A;  4WYC A;  4ZM3 A;  3ZZK A;  1IX7 A;  3DXV A;  4TMR A;  4CBR A;  3G8M A;  1OXP A;  4GRX A;  1YJY A;  1J04 A;  1EJI A;  3GSB A;  2W8W A;  1FC4 A;  4XJL A;  2DR1 A;  5EIG A;  3ASA A;  4ADE A;  2DOU A;  1ASB A;  3BWN C;  3PDB A;  3NDN A;  1Z7D A;  2QMA A;  4IXZ A;  1UU1 A;  5TF5 A;  1AKB A;  1QJ5 A;  3JTX A;  4H63 Q;  3N0L A;  3WZF A;  1QGN A;  3BCB A;  2VGZ A;  4LNL A;  5FT8 A;  2CH1 A;  2EH6 A;  2CB1 A;  2ZP7 A;  3II0 A;  1ASA A;  1WYV A;  4H51 A;  1IX8 A;  1H0C A;  4ISY A;  3MAD A;  3WY7 A;  4BQ0 A;  4WXB A;  3TFT A;  5G4J A;  3M5U A;  1V2F A;  4IXS A;  4MKK A;  5G4I A;  3A8U X;  4P3M A;  4W1W A;  5HDM A;  1AKC A;  1M0N A;  4P7Y A;  4OCA A;  3CBF A;  1S08 A;  1X28 A;  1X29 A;  2ZC0 A;  2VGW A;  3FFR A;  1AY8 A;  1BJW A;  2OGA A;  2W7D A;  4W1X A;  5FT4 A;  3NX3 A;  4E1O A;  3QGU A;  1E5F A;  2OKJ A;  3K40 A;  1W23 A;  1DTY A;  2TPL A;  3H7F A;  2JJG A;  3W1H A;  4A00 A;  2WK9 A;  3HBX A;  2BIG A;  2D7Z A;  4K2B A;  3QBO A;  2W8V A;  3EI6 A;  1S0A A;  3OKS A;  3N7N A;  4OBU A;  1ASE A;  3E2Y A;  2R2N A;  2R0T A;  1B5O A;  3JWB A;  4IX8 A;  5IWQ A;  1I41 A;  2BKW A;  3FVS A;  3AEJ A;  3ELP A;  1AIC A;  2DGL A;  3B1D A;  1GC0 A;  2BI1 A;  1LC7 A;  3A9Z A;  2VGS A;  3UE8 A;  1MGV A;  4K05 A;  1CS1 A;  1V72 A;  4KAM A;  4BA4 A;  3E2Z A;  3QPG A;  2XBN A;  2GMU A;  2FN6 A;  5FT5 A;  4J8L A;  2R5E A;  2VMO A;  3WKS A;  4MQP A;  4N0W A;  3FCR A;  4UHN A;  1MLZ A;  4XJM A;  3D6K A;  1M6S A;  2W7I A;  1CJ0 A;  3E77 A;  2VMV A;  5E4Z A;  4XQ2 A;  1WYU B;  1YAA A;  4Y0D A;  2VGV A;  1SFF A;  2E54 A;  5EIG B;  1PFF A;  3ASB A;  1FG3 A;  4OC9 A;  3TQX A;  2ZSL A;  3F9T A;  4LW2 A;  1SZU A;  3FDD A;  1V2D A;  2QB2 A;  2PO3 A;  2D64 A;  4WXG A;  1ASF A;  2Z9W A;  4AZK A;  1UKJ A;  1V2E A;  1ASL A;  2W7J A;  3MAU A;  1TOG A;  3EI9 A;  4O6Z A;  2GB3 A;  4RKC A;  4W8I A;  5I92 A;  1AIB A;  2ORD A;  3NNK A;  5G0A A;  5F9S A;  1TPL A;  2Z9U A;  3COG A;  3FSL A;  1AHE A;  2JJE A;  4F5G A;  1ELU A;  2DKB A;  2GMS A;  3FQ7 A;  1O4S A;  3FKD A;  4A6R A;  4U2H A;  4ZDP A;  1D7U A;  3FZ6 A;  1WKG A;  1MDZ A;  3G7Q A;  2NMP A;  4EB7 A;  1C9C A;  2YRR A;  4E3Q A;  2YOB A;  4Q31 A;  1Z3Z A;  2FQ6 A;  1W7N A;  2FYF A;  4DGT A;  3L44 A;  2FNI A;  1S09 A;  2O7C A;  1XI9 A;  1W7L A;  4PFF A;  3BC8 A;  3LY1 A;  3BB8 A;  3VP6 A;  4GE9 A;  4RIZ A;  3VK2 A;  2KFP A;  4CXR A;  2JG2 A;  3KGX A;  3WCO A;  1ZOB A;  4ITG A;  4GDY A;  3VOM A;  3W1J A;  4Q75 A;  3P6K A;  2Z9X A;  4RLG A;  2EGY A;  3A2B A;  3NUB A;  3RCH B;  1T3I A;  3KKI A;  4F5L A;  1WYV B;  4F5H A;  3Q8N A;  1BJ4 A;  4F5J A;  1ORD A;  2JJF A;  2CH2 A;  5EUN A;  4WB0 B;  4OYT A;  1N31 A;  4XEW A;  4F5F A;  1BJO A;  1LS3 A;  1AMS A;  7AAT A;  2G6W A;  3EZ1 A;  4MQR A;  4TV7 A;  2CJD A;  2VMU A;  2EO5 A;  3NRA A;  4WYE A;  3ZRP A;  3NU7 A;  2BYJ A;  2QLR A;  1LK9 A;  1B4X A;  4ADB A;  1C0N A;  1AAW A;  1CZC A;  1AAM A;  2YKU A;  3PD6 B;  4WYG A;  1D2F A;  1ART A;  4U1T A;  3QM2 A;  1ASG A;  3RBL A;  2ZY3 A;  3DOD A;  1ARH A;  5D5S A;  3N4R A;  3IHJ A;  4A0R A;  1ARI A;  4EB5 A;  4PIW A;  1G4X A;  1E5E A;  3E6G A;  3QHX A;  2QB3 A;  2R5C A;  1G7W A;  2VMN A;  2W7F A;  4JE5 A;  4Q6R A;  1IJI A;  1OAT A;  3BCX A;  3N5M A;  4GSA A;  1QIT A;  1C4K A;  1B9H A;  3ELE A;  2EZ2 A;  4EFF A;  3A9X A;  2ZYJ A;  2O0R A;  2Z1Y A;  4R2N A;  4AO9 A;  3DR4 A;  2QSR A;  2D61 A;  2VMP A;  1IX6 A;  1ASM A;  1LW4 A;  3FTB A;  1H1C A;  1VEF A;  2HP2 A;  2W7H A;  1CL1 A;  4R8D A;  3DU4 A;  1MAP A;  5BJ3 A;  3FZ8 A;  3H9X A;  2E7J A;  3PA9 A;  2YKX A;  1AHX A;  2CJG A;  1OHW A;  3AV7 A;  1DJU A;  4JEW A;  1Y4I A;  2D5Y A;  1D7S A;  1N2T A;  2CY8 A;  2C44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...