1AIAA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSHNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 134
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1aiaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1aiaA01
1YIZA 4K2MA 1RV3A 2VLFA 1AMRA 1CQ6A 3FQAA 1B5OA 1WYTA 3N75A 3WCNA 4ADCA 1BW0A 3GZDC 1OATA 3GBXA 3BWNC 1AJRA 1DTYA 3MC6C 2ZY4A 1S0AA 4KXKA 3NNKA 1T3IA 1OHWA 4WYGA 4L0OA 1YAAA 4Q75A 1FC4A 1MDZA 4ZLVA 2BI2A 2EPJA 2JG2A 4MKKA 3BCBA 3KGXA 1AHYA 4IXOA 3RCHA 3A2BA 3QBOA 1EG5A 2W7EA 3HT4A 1AHEA 2ZJGA 3A9ZA 1AMSA 3PDBB 1J32A 4RM1A 1LK9A 3TCMA 2XH1A 1D7VA 3ASBA 4XJMA 4F5MA 2HOYA 2HUFA 4LNJA 2OKKA 3FZ7A 1SVVA 4CBSA 4JEZA 1V2FA 2JJHA 2W7IA 2JJEA 3EI8A 1G4XA 1Z7DA 4F4EA 3FRKA 3HL2A 2BI9A 1JG8A 2PB2A 2R0TA 3ZRQA 1O69A 1MAQA 2HUIA 1UU1A 2XBNA 4OYTA 1JS3A 2BWNA 3MAFB 3NU8A 4RKCA 1WKGA 1QGNA 3VP6A 3N0LA 1AY5A 1AJSA 1TOEA 2WK7A 2YKUA 4BHDA 4F5FA 1DFOA 1I41A 3R9AA 1N2TA 3ZRPA 2VIAA 2JJFA 1RV4A 4M2KA 1BJOB 5M49A 3LVJA 1N31A 1IX7A 1BS0A 1E5EA 1S06A 1WKHA 2Z9XA 3ZRRA 1IUGA 4IYOB 5FT8A 1IAYA 4EMYA 4IY7A 1QJ5A 4P3MA 3AEMA 2O0RA 1ZODA 2QLRA 1GC0A 4LW2A 1OXPA 1X29A 3NUBA 4W8IA 3PJ0A 1G7XA 1LKCA 2F8JA 5D5SA 3EI7A 2W7KA 4JE5A 4ZDLA 4CVQA 3ELEA 3PPLA 2HORA 1SZUA 2BI3A 1AMAA 2AY7A 4MKJA 1X0MA 4OT8A 4LW4A 1IX8A 3F0HA 4MQQA 3RBLA 1W7LA 1IVRA 1IBJA 1ASLA 1ORDA 3OP7A 3CAIA 4MGRA 2CINA 2WKAA 3B1CA 2GB3A 1ASCA 2OGEA 2VMSA 4XJPA 1Y4IA 1W3UA 4Y0HA 5EIGB 2W8JA 3NYSA 3W1IA 3LG0A 4JEXA 4K2BA 2CJGA 3FFHA 3FDDA 2BWPA 3E77A 3K40A 4F5GA 3LVMA 1SFFA 1X28A 5F9SA 4ZASA 5AX8A 4RLGA 4AO4A 4GEBA 1AHGA 2GMSA 2HOZA 2HOXA 2X3LA 5DJ1A 1WYTB 4UHNA 2VMVA 4F5KA 1M0QA 4Y0IA 2VGWA 3HMUA 4BA4A 1CQ7A 4ITGA 1ASAA 2BI1A 4OBVA 1BKGA 3G0TA 5M4DA 4KAMA 4K2IA 2WK8A 3LVKA 4J5UA 1MLYA 1BJNA 4KYOA 4U1TA 3RCHB 2AY5A 3W1HA 3DU4A 5DJ9A 2DKJA 4TV7A 3COGA 3QI6A 4WLJA 5EUDA 4E77A 1CL2A 1GEXA 2CJHA 3DR4A 4RIZA 1OXOA 3AOWA 1YJYA 3AEJA 5G0AA 2C44A 2QB2A 2VIBA 1KKPA 2YKVA 2Z1YA 2W8UA 4F5HA 5EAAA 5M46A 1FG3A 3FD0A 4WXGA 4A00A 3I16A 4W1WA 1CL1A 1Z3ZA 3I4JA 3AEPA 3ACZA 4ZAHA 4UQVA 1G4VA 3BN1A 2VMUA 4UOYA 2CY8A 4P7YA 4PVFA 2O1BA 4A6TA 1AJSB 1CZCA 3T32A 3UE8A 2X8UA 4DQ6A 3RBFA 3TFUA 4A0GA 1AY8A 1ARIA 3VK2A 2ZYJA 3AENA 2AY2A 3VOMA 5DB5A 5DX5A 4BA5A 4OCAA 1SZSA 1ARGA 4HVKA 9AATA 1RVUA 2W8WA 1J04A 3MEBA 1DJ9A 4GE7A 2D64A 1LS3A 1O4SA 1KMJA 3CBFA 1WYVA 1AIAA 1C7NA 3FKDA 1GEWA 5FT5A 1C9CA 3ELPA 3VAXA 3WGCA 1CQ8A 2X5FA 2VMYA 2BHXA 2YRIA 3E2FA 3AEJC 5LH9A 1TARA 1LC7A 4W91A 1BQAA 1KL2A 4ADDA 4JEVA 4O6ZA 4XQ2A 3GZCA 1VJOA 4JEYA 1MAPA 3AEOA 3EZ1A 4EB7A 2W8VA 2ZY2A 1QZ9A 3B1DA 2EO5A 4WYAA 4A72A 2DGLA 1MDOA 1TASA 4AZJA 4EU1A 1M0NA 1ASFA 2E54A 3KE3A 1QJ3A 1I43A 1MDXA 1ELQA 2Z9UA 3BV0A 3WLXA 2Z20A 2Z9WA 3ASAA 4Q31A 2OGAA 5E4ZA 2VMZA 2ZP7A 1CJ0A 4W5KA 3WZFA 1TOGA 3EIBA 3QHXA 2CFBA 5JAYA 1V2DA 3CQ6A 2E7UA 4Y0DA 1ARTA 2VGZA 3F9TA 1QISA 1V72A 3HDOA 4TN4A 1N8PA 2VGVA 4DBCA 1DJUA 2FNUA 3FSLA 2WK9A 4PIWA 4Q76A 1GDEA 8AATA 3RI6A 1D7RA 4RJYA 3E6GA 1YJZA 3PD6A 4RITA 2HZPA 2JGTA 1PMMA 1ASEA 2HUUA 2BKWA 3G8MA 1X2AA 2D65A 4PFNA 4A6UA 4B9BA 1ASDA 4ZSWA 3EI9A 5G09A 4JE5D 1ASNA 2YCPA 2BI5A 3UWCA 1LW4A 3FQ7A 2HP1A 3N5MA 2VGUA 1SZKA 1GCKA 3F6TA 2FN6A 1D7SA 2YKXA 1KMKA 2VMXA 3OKSA 1S08A 2AY1A 3GSBA 3E2ZA 5D95A 2AEVA 1O62A 2ZC0A 3MAUA 1BQDA 1MLZA 3A8UX 3AATA 3EI5A 4PFFA 2R5EA 4LNMA 4XJOA 1YOOA 4H51A 1WSTA 4M2JA 2AEUA 1C7GA 5HXXA 4WXBA 4LNLA 2Q7WA 1AKCA 1AX4A 3UAKA 1SPAA 4GE9A 4ADEA 4AH3A 3AENB 2W7GA 4RJ0A 2W7MA 3TATA 4WB0A 4XEWA 3DRDA 3II0A 3H14A 5EAVA 1DKAA 3AEMC 4ATQA 4EFFA 4AZKA 1PG8A 3AELA 2D7ZA 3IHJA 5FT4A 1GEYA 1TATA 2Z67A 4XAUA 3BCXA 1OHVA 1C4KA 2YOBA 1WYVB 4RKDA 2W7HA 2YKYA 3PAAA 2CANA 4WYDA 1BJWA 2BYLA 5EUNA 4ZWMA 2VLHA 5LHAA 4R8DA 4CXRA 2C81A 1BJ4A 1AICA 4GDYA 4WXFA 1ASMA 3GZDA 4Q6RA 3BWOA 3DZZA 3MC6A 4EB5A 3HVYA 4AOAA 1PFFA 3EUCA 3IF2A 2JISA 1JF9A 1RVYA 4ISYA 4ZDPA 2BWOA 3GR9A 1IAXA 4IXZA 1C0NA 2AY3A 1KKJA 2DGMA 1GC4A 2W7LA 4JF1A 2NMPA 2R5CA 2BIAA 2ZSLA 2EH6A 4FL0A 5J8QA 3RUYA 4BMKA 3M5UA 5G4IA 1M4NA 2AY8A 2VMQA 4MQPA 5FT6A 4OBUA 2CH1A 1W7MA 2QBTA 1UU0A 1BT4A 3RQ1A 3VK4A 4A0FA 3NUIA 4NOGA 2Z9VA 2OKJA 3I5TA 4E3RA 3DXVA 5K8BA 4MY5A 2V0YA 4W1XA 3B8XA 1AAMA 1DJEA 1ASGA 2PO3A 3FVUA 4RAEA 1AIBA 1B9IA 2EZ1A 3ZZJA 2ZY3A 3H7FA 1UU2A 4A0HA 3W1JA 4MSOA 4E3QA 2C7TA 3AOVA 2CB1A 3P1TA 1IJIA 2W7JA 2X5DA 5I92A 3ISLA 2E7JA 3P6KA 4ATPA 1S09A 5HDMA 3GJUA 4LC3A 1FG7A 1G7WA 2VMOA 2ZY5A 3FZ8A 3K7YA 1AAWA 1DGDA 1SF2A 3PD6B 1GC2A 3BC8A 2FM1A 2G6WA 1ECXA 2D5YA 2YCNA 1XEYA 3B46A 4IW7A 5G2PA 3WX9A 4M2MA 2AY9A 3FTBA 3NYUA 1B4XA 2VMWA 4WYFA 1I29A 2VGSA 3E2YA 3Q8NA 4DGTA 3BB8A 3USFA 1B5PA 3FFRA 3WKSA 5F8VA 2D7YA 2VI8A 3D6KA 1B8GA 3L8AA 4JF0A 3E2ZB 3PA9A 2Z1ZA 4B98A 4N0WA 2VMRA 4UHOA 2ORDA 2W8TA 1WYUA 3VK3A 3JTXA 3JW9A 1W7NA 3HBXA 4ADBA 2W7DA 1QIRA 1IX6A 4UHMA 1M7YA 4E1OA 4WB0B 1CS1A 1AHXA 3NTJA 3QM2A 2OQXA 5EUEA 3PDXA 3NRAA 5TF5A 4ZSYA 3MKJA 3MBBA 2W7FA 5HHYA 3LVLB 4HF8A 1QITA 4BQ0A 1M0OA 4IX8A 1CZEA 3WY7A 3WGBA 2GMUA 2O7CA 4ZM3A 1EJIA 2YRRA 1D2FA 3FDBA 3MADA 3NYTA 4CXQA 1MGVA 1TOIA 4ZWVA 2VMNA 2EGYA 2CH2A 2D63A 1AY4A 1VP4A 3PIUA 4I8AA 1TOJA 3CQ4A 1GC3A 3NX3A 4WP0A 1XI9A 1U08A 5G2QA 4R5FA 1AKAA 3JZLA 4F5IA 1E5FA 4XJLA 1TOKA 2AY4A 1ARHA 3A9YA 2CSTA 1OHYA 2VMTA 2BIGA 2RFVA 1I48A 4J8LA 4N0BA 2QA3A 2R5CB 3EZSA 2DR1A 1B9HA 2DGKA 2FNIA 2QB3A 3A9XA 3GETA 3QPGA 4W1VA 4F5JA 3ZZKA 1YIYA 1KL1A 4R5ZA 5E5IA 1M32A 2FQ6A 3PDBA 4MQRA 3FQ8A 2TPLA 4WYCA 3JWBA 3HQTA 1GBNA 1ZOBA 4XK1A 1VEFA 5BJ4A 1JS6A 4OC9A 2V1PA 1P3WA 2AY6A 5E3KA 2OATA 2ZSMA 2VGTA 2YHKA 4WBTA 5BJ3A 4A6RA 3ATHA 2C0RA 2ZUKA 1C7OA 4JEWA 5G4JA 3DC1A 5C6UA 2GQNA 1W23A 2JJGA 1YNUA 1V2EA 3FVSA 3JU7A 3QGUA 4FFCA 5EQCA 5M4BA 1M6SA 4AO9A 3TFTA 1ZC9A 3GWPA 1ASBA 3ECDA 1LC5A 2BIEA 3EI6A 3MAFA 4GRXA 3FCRA 1D7UA 3WKRA 2HP2A 1ELUA 3WCOA 4TMRA 1M0PA 3CQ5A 3K28A 2CTZA 1BJOA 4R2NA 4ZM4A 2VYCA 3BCAA 3DXWA 4U2HA 1AMQA 3JWAA 3BWNA 5IWQA 1ARSA 3B1EA 3G7QA 4IYOA 2QMAA 3PGYA 2DKBA 1S07A 2E7IA 2VI9A 2VMPA 3DODA 4WLHA 1YJSA 3L44A 1LC8A 2GSAA 1LW5A 2YCTA 1AKBA 1TPLA 1H1CA 3BS8A 4WYEA 2EZ2A 2R2NA 3DR7A 3TQXA 2D61A 1WYUB 1H0CA 3FVXA 3HLMA 1EQBA 1GD9A 2BYJA 2Z61A 3KGWA 3QN6A 2PB0A 2D66A 4QGRA 2DOUA 1O61A 3E9KA 3AV7A 4ZDOA 3LWSA 4ITXA 1UKJA 5EFSA 4OTLA 3NU7A 4IXSA 7AATA 3EIAA 4A0RA 3LV2A 2FYFA 4CBRA 1DGEA 4WD2A 4F5LA 3LY1A 3FZ6A 4GE4A 4OMAA 5EIGA 2CJDA 1PMOA 3R4TA 1AHFA 3NDNA 4GSAA 3DYDA 2AATA 3KKIA
chains in the Genus database with same CATH superfamily
1YIZA 2A1VA 4K2MA 1RV3A 2VLFA 1AMRA 1CQ6A 3FQAA 1B5OA 1WYTA 3N75A 3WCNA 4ADCA 1BW0A 3GZDC 1OATA 3GBXA 3BWNC 1AJRA 1DTYA 3MC6C 2ZY4A 1S0AA 4KXKA 3NNKA 1T3IA 1OHWA 4WYGA 4L0OA 1YAAA 4Q75A 1FC4A 1MDZA 4ZLVA 2BI2A 2EPJA 2JG2A 4MKKA 3BCBA 3KGXA 1AHYA 4IXOA 3RCHA 3A2BA 3QBOA 1EG5A 2W7EA 3HT4A 1AHEA 2ZJGA 3A9ZA 1AMSA 3PDBB 1J32A 4RM1A 1LK9A 3TCMA 2XH1A 1D7VA 3ASBA 4XJMA 4F5MA 2HOYA 2HUFA 4LNJA 2OKKA 3FZ7A 1SVVA 4CBSA 4JEZA 1V2FA 2JJHA 2W7IA 2JJEA 3EI8A 1G4XA 1Z7DA 4F4EA 3FRKA 3HL2A 2BI9A 1JG8A 2PB2A 2R0TA 3ZRQA 5KTBA 1O69A 1MAQA 2HUIA 1UU1A 2XBNA 4OYTA 1JS3A 2BWNA 3MAFB 3NU8A 4RKCA 1WKGA 1QGNA 3VP6A 3N0LA 1AY5A 1AJSA 1TOEA 2WK7A 2YKUA 4BHDA 4F5FA 1DFOA 1I41A 3R9AA 1N2TA 3ZRPA 2VIAA 2JJFA 1RV4A 4M2KA 1BJOB 5M49A 3LVJA 1N31A 1IX7A 1BS0A 1E5EA 1S06A 1WKHA 2Z9XA 3ZRRA 1IUGA 4IYOB 5FT8A 1IAYA 4EMYA 1KAFA 4IY7A 1QJ5A 4P3MA 3AEMA 2O0RA 1ZODA 2QLRA 1GC0A 4LW2A 1OXPA 1X29A 3NUBA 4W8IA 3PJ0A 1G7XA 1LKCA 2FKIA 2F8JA 5D5SA 3EI7A 2W7KA 4JE5A 4ZDLA 4CVQA 3ELEA 3PPLA 2HORA 1SZUA 2BI3A 1AMAA 2AY7A 4MKJA 1X0MA 4OT8A 4LW4A 1IX8A 3F0HA 4MQQA 3RBLA 1W7LA 1IVRA 1IBJA 1ASLA 1ORDA 3OP7A 3CAIA 4MGRA 2CINA 2WKAA 3B1CA 2GB3A 1ASCA 2OGEA 2VMSA 4XJPA 1Y4IA 1W3UA 4Y0HA 5EIGB 2W8JA 3NYSA 3W1IA 3LG0A 4JEXA 4K2BA 2CJGA 3FFHA 3FDDA 2BWPA 3E77A 3K40A 4F5GA 3LVMA 1SFFA 1X28A 5F9SA 4ZASA 5AX8A 4RLGA 4AO4A 4GEBA 1AHGA 2GMSA 2HOZA 2HOXA 2X3LA 5DJ1A 1WYTB 4UHNA 2VMVA 4F5KA 1M0QA 4Y0IA 2VGWA 3HMUA 4BA4A 1CQ7A 4ITGA 3H9XA 1ASAA 2BI1A 4OBVA 1BKGA 3G0TA 5M4DA 4KAMA 4K2IA 2WK8A 3LVKA 4J5UA 1MLYA 1BJNA 4KYOA 4U1TA 3RCHB 2AY5A 3W1HA 3DU4A 5DJ9A 2DKJA 2EYQA 4TV7A 3COGA 3QI6A 4WLJA 5EUDA 4E77A 1CL2A 1GEXA 2CJHA 3DR4A 4RIZA 1OXOA 3AOWA 1YJYA 3AEJA 5G0AA 2C44A 2QB2A 2VIBA 1KKPA 3N7NA 2KFPA 2YKVA 2Z1YA 2W8UA 4F5HA 5EAAA 5M46A 1FG3A 3FD0A 4WXGA 4A00A 3I16A 4W1WA 1CL1A 1Z3ZA 3I4JA 3AEPA 3ACZA 4ZAHA 4UQVA 4H63Q 1G4VA 3BN1A 2VMUA 4UOYA 2CY8A 4P7YA 4PVFA 2O1BA 4A6TA 1AJSB 1CZCA 3T32A 3UE8A 2X8UA 4DQ6A 3RBFA 3TFUA 4A0GA 1AY8A 1ARIA 3VK2A 2ZYJA 3AENA 2AY2A 3VOMA 5DB5A 5DX5A 4BA5A 4OCAA 1SZSA 1ARGA 4HVKA 9AATA 1RVUA 2W8WA 1J04A 3MEBA 1DJ9A 4GE7A 2D64A 1LS3A 1O4SA 1KMJA 3CBFA 1WYVA 1AIAA 1C7NA 3FKDA 1GEWA 5FT5A 1C9CA 3ELPA 3VAXA 3WGCA 1CQ8A 2X5FA 2VMYA 2BHXA 2YRIA 3E2FA 3AEJC 5LH9A 1TARA 1LC7A 4W91A 1BQAA 1KL2A 4ADDA 4JEVA 4O6ZA 4XQ2A 3GZCA 1VJOA 4JEYA 1MAPA 3AEOA 3EZ1A 4EB7A 2W8VA 2ZY2A 1QZ9A 3B1DA 2EO5A 4WYAA 4A72A 2DGLA 1MDOA 1TASA 4AZJA 4EU1A 1M0NA 1ASFA 2E54A 3KE3A 1QJ3A 1I43A 1MDXA 2G7JA 1ELQA 2Z9UA 3BV0A 3WLXA 2Z20A 2Z9WA 3ASAA 4Q31A 2OGAA 5E4ZA 2VMZA 2ZP7A 1CJ0A 4W5KA 3WZFA 1TOGA 3EIBA 3QHXA 2CFBA 5JAYA 1V2DA 3CQ6A 2E7UA 4Y0DA 1ARTA 2VGZA 2WB6A 3F9TA 1QISA 1V72A 3HDOA 4TN4A 1N8PA 2VGVA 4DBCA 1DJUA 2FNUA 3FSLA 2WK9A 4PIWA 4Q76A 1GDEA 8AATA 3RI6A 1D7RA 4RJYA 3E6GA 1YJZA 3PD6A 4RITA 2HZPA 2JGTA 1PMMA 1ASEA 2HUUA 2BKWA 3G8MA 1X2AA 2D65A 4PFNA 4A6UA 4B9BA 1ASDA 4ZSWA 3EI9A 5G09A 4JE5D 1ASNA 3N4XA 2YCPA 2BI5A 3UWCA 1LW4A 3FQ7A 2HP1A 3N5MA 2VGUA 1SZKA 1GCKA 3F6TA 2FN6A 1D7SA 2YKXA 1KMKA 2VMXA 3OKSA 1S08A 2AY1A 3GSBA 3E2ZA 5D95A 2AEVA 1O62A 2ZC0A 3MAUA 1BQDA 1MLZA 3A8UX 3AATA 3EI5A 4PFFA 2R5EA 4LNMA 4XJOA 1YOOA 4H51A 1WSTA 4M2JA 2AEUA 1C7GA 5HXXA 4WXBA 4LNLA 2Q7WA 1AKCA 1AX4A 3UAKA 1SPAA 4GE9A 4ADEA 4AH3A 3AENB 2W7GA 4RJ0A 2W7MA 3TATA 4WB0A 4XEWA 3DRDA 3II0A 3H14A 5EAVA 1DKAA 3AEMC 4ATQA 4EFFA 4AZKA 1PG8A 3AELA 2D7ZA 3IHJA 5FT4A 1GEYA 1TATA 2Z67A 4XAUA 3BCXA 1OHVA 1C4KA 2YOBA 1WYVB 4RKDA 2W7HA 2YKYA 3PAAA 2CANA 4WYDA 1BJWA 2BYLA 5EUNA 4ZWMA 2VLHA 5LHAA 4R8DA 4K05A 4CXRA 2C81A 1BJ4A 1AICA 4GDYA 4WXFA 1ASMA 3GZDA 4Q6RA 3BWOA 3DZZA 3MC6A 4EB5A 3HVYA 4AOAA 1PFFA 3EUCA 3IF2A 2JISA 1JF9A 1RVYA 4ISYA 4ZDPA 2BWOA 3GR9A 1IAXA 4IXZA 1C0NA 2AY3A 1KKJA 2DGMA 1GC4A 2W7LA 4JF1A 2NMPA 2R5CA 2BIAA 2ZSLA 2EH6A 4FL0A 5J8QA 3RUYA 4BMKA 3N4RA 3M5UA 5G4IA 1M4NA 2AY8A 2VMQA 4MQPA 5FT6A 4OBUA 2CH1A 1W7MA 2QBTA 1UU0A 1BT4A 3RQ1A 3VK4A 4A0FA 3NUIA 4NOGA 2Z9VA 2OKJA 3I5TA 4E3RA 3DXVA 5K8BA 4MY5A 2V0YA 4W1XA 3B8XA 1AAMA 1DJEA 1ASGA 2PO3A 3FVUA 4RAEA 1AIBA 1B9IA 2EZ1A 3ZZJA 2ZY3A 3H7FA 1UU2A 4A0HA 3W1JA 4MSOA 4E3QA 2C7TA 3AOVA 2CB1A 3P1TA 1IJIA 2W7JA 2X5DA 5I92A 3ISLA 2E7JA 3P6KA 4ATPA 1S09A 5HDMA 3GJUA 4LC3A 1FG7A 1G7WA 2VMOA 2ZY5A 3FZ8A 3K7YA 1AAWA 1DGDA 1SF2A 3PD6B 1GC2A 3BC8A 2FM1A 2G6WA 1ECXA 2D5YA 2YCNA 1XEYA 3B46A 4IW7A 5G2PA 3WX9A 4M2MA 2AY9A 3FTBA 3NYUA 1B4XA 2VMWA 4WYFA 1I29A 2VGSA 3E2YA 3Q8NA 4DGTA 3BB8A 3USFA 1B5PA 3FFRA 3WKSA 3N4SA 5F8VA 2D7YA 2VI8A 3D6KA 1B8GA 3L8AA 4JF0A 3E2ZB 3PA9A 2Z1ZA 4B98A 4N0WA 2VMRA 4UHOA 2ORDA 2W8TA 1WYUA 3VK3A 3JTXA 3JW9A 1W7NA 3HBXA 4ADBA 2W7DA 1QIRA 1IX6A 4UHMA 1M7YA 4E1OA 4WB0B 1CS1A 1AHXA 3NTJA 3QM2A 2OQXA 5EUEA 3PDXA 3NRAA 5TF5A 4ZSYA 3MKJA 3MBBA 2W7FA 5HHYA 3LVLB 4HF8A 1QITA 4BQ0A 1M0OA 4IX8A 1CZEA 3WY7A 3WGBA 2GMUA 2O7CA 4ZM3A 1EJIA 2YRRA 1D2FA 3FDBA 3MADA 3NYTA 4CXQA 1MGVA 1TOIA 4ZWVA 2VMNA 2EGYA 2CH2A 2D63A 1AY4A 1VP4A 3PIUA 4I8AA 1TOJA 3CQ4A 1GC3A 3NX3A 4WP0A 1XI9A 1U08A 5G2QA 4R5FA 1AKAA 3JZLA 4F5IA 1E5FA 4XJLA 1TOKA 2AY4A 1ARHA 3A9YA 2CSTA 1OHYA 2VMTA 2BIGA 2RFVA 1I48A 4J8LA 4N0BA 2QA3A 2R5CB 3EZSA 2DR1A 1B9HA 2DGKA 2FNIA 2QB3A 3A9XA 3GETA 3QPGA 4W1VA 4F5JA 3ZZKA 1YIYA 1KL1A 4R5ZA 5E5IA 1M32A 2FQ6A 3PDBA 4MQRA 3FQ8A 2TPLA 4WYCA 3JWBA 3HQTA 1GBNA 1ZOBA 4XK1A 1VEFA 5BJ4A 1JS6A 4OC9A 2V1PA 1P3WA 2AY6A 5E3KA 2OATA 2ZSMA 2VGTA 2YHKA 4WBTA 5BJ3A 4A6RA 3ATHA 2C0RA 2ZUKA 1C7OA 4JEWA 5G4JA 3DC1A 5C6UA 2GQNA 1W23A 2JJGA 1YNUA 1V2EA 3FVSA 3JU7A 3QGUA 4FFCA 5EQCA 5M4BA 1M6SA 4AO9A 3TFTA 1ZC9A 3GWPA 1ASBA 3ECDA 1LC5A 2BIEA 3EI6A 3MAFA 4GRXA 3FCRA 1D7UA 3WKRA 2HP2A 1ELUA 3WCOA 4TMRA 1M0PA 3CQ5A 3K28A 2CTZA 1BJOA 4R2NA 4ZM4A 2VYCA 3BCAA 3DXWA 4U2HA 1AMQA 3JWAA 3BWNA 5IWQA 1ARSA 3B1EA 3G7QA 4IYOA 2QMAA 3PGYA 2DKBA 1S07A 2E7IA 2VI9A 2VMPA 3DODA 4WLHA 1YJSA 3L44A 1LC8A 2GSAA 1LW5A 2YCTA 1AKBA 1TPLA 1H1CA 3BS8A 4WYEA 2EZ2A 2R2NA 2QSRA 3DR7A 3TQXA 2D61A 1WYUB 1H0CA 3FVXA 3HLMA 1EQBA 1GD9A 2BYJA 2Z61A 3KGWA 3QN6A 2PB0A 2D66A 4QGRA 2DOUA 1O61A 3E9KA 3AV7A 4ZDOA 3LWSA 4ITXA 1UKJA 5EFSA 4OTLA 3NU7A 4IXSA 7AATA 3EIAA 4A0RA 3LV2A 2FYFA 4CBRA 1DGEA 4WD2A 4F5LA 3LY1A 3FZ6A 4GE4A 4OMAA 5EIGA 2CJDA 1PMOA 3R4TA 1AHFA 3NDNA 4GSAA 3DYDA 2AATA 3KKIA
chains in the Genus database with same CATH topology
1YIZA 2A1VA 4K2MA 1RV3A 2VLFA 1AMRA 1CQ6A 3FQAA 1B5OA 1WYTA 3N75A 3WCNA 4ADCA 1BW0A 3GZDC 1OATA 3GBXA 3BWNC 1AJRA 1DTYA 3MC6C 2ZY4A 1S0AA 4KXKA 3NNKA 1T3IA 1OHWA 4WYGA 4L0OA 1YAAA 4Q75A 1FC4A 1MDZA 4ZLVA 2BI2A 2EPJA 2JG2A 4MKKA 3BCBA 3KGXA 1AHYA 4IXOA 3RCHA 3A2BA 3QBOA 1EG5A 2W7EA 3HT4A 1AHEA 2ZJGA 3A9ZA 1AMSA 3PDBB 1J32A 4RM1A 1LK9A 3TCMA 2XH1A 1D7VA 3ASBA 4XJMA 4F5MA 2HOYA 2HUFA 4LNJA 2OKKA 3FZ7A 1SVVA 4CBSA 4JEZA 1V2FA 2JJHA 2W7IA 2JJEA 3EI8A 1G4XA 1Z7DA 4F4EA 3FRKA 3HL2A 2BI9A 1JG8A 2PB2A 2R0TA 3ZRQA 5KTBA 1O69A 1MAQA 2HUIA 1UU1A 2XBNA 4OYTA 1JS3A 2BWNA 3MAFB 3NU8A 4RKCA 1WKGA 1QGNA 3VP6A 3N0LA 1AY5A 1AJSA 1TOEA 2WK7A 2YKUA 4BHDA 4F5FA 1DFOA 1I41A 3R9AA 1N2TA 3ZRPA 2VIAA 2JJFA 1RV4A 4M2KA 1BJOB 5M49A 3LVJA 1N31A 1IX7A 1BS0A 1E5EA 1S06A 1WKHA 2Z9XA 3ZRRA 1IUGA 4IYOB 5FT8A 1IAYA 4EMYA 4IY7A 1QJ5A 4P3MA 3AEMA 2O0RA 1ZODA 2QLRA 1GC0A 4LW2A 1OXPA 1X29A 3NUBA 4W8IA 3PJ0A 1G7XA 1LKCA 2FKIA 2F8JA 5D5SA 3EI7A 2W7KA 4JE5A 4ZDLA 4CVQA 3ELEA 3PPLA 2HORA 1SZUA 2BI3A 1AMAA 2AY7A 4MKJA 1X0MA 4OT8A 4LW4A 1IX8A 3F0HA 4MQQA 3RBLA 1W7LA 1IVRA 1IBJA 1ASLA 1ORDA 3OP7A 3CAIA 4MGRA 2CINA 2WKAA 3B1CA 2GB3A 1ASCA 2OGEA 2VMSA 4XJPA 1Y4IA 1W3UA 4Y0HA 5EIGB 2W8JA 3NYSA 3W1IA 3LG0A 4JEXA 4K2BA 2CJGA 3FFHA 3FDDA 2BWPA 3E77A 3K40A 4F5GA 3LVMA 1SFFA 1X28A 5F9SA 4ZASA 5AX8A 4RLGA 4AO4A 4GEBA 1AHGA 2GMSA 2HOZA 2HOXA 2X3LA 5DJ1A 1WYTB 4UHNA 2VMVA 4F5KA 1M0QA 4Y0IA 2VGWA 3HMUA 4BA4A 1CQ7A 4ITGA 3H9XA 1ASAA 2BI1A 4OBVA 1BKGA 3G0TA 5M4DA 4KAMA 4K2IA 2WK8A 3LVKA 4J5UA 1MLYA 1BJNA 4KYOA 4U1TA 3RCHB 2AY5A 3W1HA 3DU4A 5DJ9A 2DKJA 2EYQA 4TV7A 3COGA 3QI6A 4WLJA 5EUDA 4E77A 1CL2A 1GEXA 2CJHA 3DR4A 4RIZA 1OXOA 3AOWA 1YJYA 3AEJA 5G0AA 2C44A 2QB2A 2VIBA 1KKPA 3N7NA 2KFPA 2YKVA 2Z1YA 2W8UA 4F5HA 5EAAA 5M46A 1FG3A 3FD0A 4WXGA 4A00A 3I16A 4W1WA 1CL1A 1Z3ZA 3I4JA 3AEPA 3ACZA 4ZAHA 4UQVA 4H63Q 1G4VA 3BN1A 2VMUA 4UOYA 2CY8A 4P7YA 4PVFA 2O1BA 4A6TA 1AJSB 1CZCA 3T32A 3UE8A 2X8UA 4DQ6A 3RBFA 3TFUA 4A0GA 1AY8A 1ARIA 3VK2A 2ZYJA 3AENA 2AY2A 3VOMA 5DB5A 5DX5A 4BA5A 4OCAA 1SZSA 1ARGA 4HVKA 9AATA 1RVUA 2W8WA 1J04A 3MEBA 1DJ9A 4GE7A 2D64A 1LS3A 1O4SA 1KMJA 3CBFA 1WYVA 1AIAA 1C7NA 3FKDA 1GEWA 5FT5A 1C9CA 3ELPA 3VAXA 3WGCA 1CQ8A 2X5FA 2VMYA 2BHXA 2YRIA 3E2FA 3AEJC 5LH9A 1TARA 1LC7A 4W91A 1BQAA 1KL2A 4ADDA 4JEVA 4O6ZA 4XQ2A 3GZCA 1VJOA 4JEYA 1MAPA 3AEOA 3EZ1A 4EB7A 2W8VA 2ZY2A 1QZ9A 3B1DA 2EO5A 4WYAA 4A72A 2DGLA 1MDOA 1TASA 4AZJA 4EU1A 1M0NA 1ASFA 2E54A 3KE3A 1QJ3A 1I43A 1MDXA 2G7JA 1ELQA 2Z9UA 3BV0A 3WLXA 2Z20A 2Z9WA 3ASAA 4Q31A 2OGAA 5E4ZA 2VMZA 2ZP7A 1CJ0A 4W5KA 3WZFA 1TOGA 3EIBA 3QHXA 2CFBA 5JAYA 1V2DA 3CQ6A 2E7UA 4Y0DA 1ARTA 2VGZA 2WB6A 3F9TA 1QISA 1V72A 3HDOA 4TN4A 1N8PA 2VGVA 4DBCA 1DJUA 2FNUA 3FSLA 2WK9A 4PIWA 4Q76A 1GDEA 8AATA 3RI6A 1D7RA 4RJYA 3E6GA 1YJZA 3PD6A 4RITA 2HZPA 2JGTA 1PMMA 1ASEA 2HUUA 2BKWA 3G8MA 1X2AA 2D65A 4PFNA 4A6UA 4B9BA 1ASDA 4ZSWA 3EI9A 5G09A 4JE5D 1ASNA 3N4XA 2YCPA 2BI5A 3UWCA 1LW4A 3FQ7A 2HP1A 3N5MA 2VGUA 1SZKA 1GCKA 3F6TA 2FN6A 1D7SA 2YKXA 1KMKA 2VMXA 3OKSA 1S08A 2AY1A 3GSBA 3E2ZA 5D95A 2AEVA 1O62A 2ZC0A 3MAUA 1BQDA 1MLZA 3A8UX 3AATA 3EI5A 4PFFA 2R5EA 4LNMA 4XJOA 1YOOA 4H51A 1WSTA 4M2JA 2AEUA 1C7GA 5HXXA 4WXBA 4LNLA 2Q7WA 1AKCA 1AX4A 3UAKA 1SPAA 4GE9A 4ADEA 4AH3A 3AENB 2W7GA 4RJ0A 2W7MA 3TATA 4WB0A 4XEWA 3DRDA 3II0A 3H14A 5EAVA 1DKAA 3AEMC 4ATQA 4EFFA 4AZKA 1PG8A 3AELA 2D7ZA 3IHJA 5FT4A 1GEYA 1TATA 2Z67A 4XAUA 3BCXA 1OHVA 1C4KA 2YOBA 1WYVB 4RKDA 2W7HA 2YKYA 3PAAA 2CANA 4WYDA 1BJWA 2BYLA 5EUNA 4ZWMA 2VLHA 5LHAA 4R8DA 4K05A 4CXRA 2C81A 1BJ4A 1AICA 4GDYA 4WXFA 1ASMA 3GZDA 4Q6RA 3BWOA 3DZZA 3MC6A 4EB5A 3HVYA 4AOAA 1PFFA 3EUCA 3IF2A 2JISA 1JF9A 1RVYA 4ISYA 4ZDPA 2BWOA 3GR9A 1IAXA 4IXZA 1C0NA 2AY3A 1KKJA 2DGMA 1GC4A 2W7LA 4JF1A 2NMPA 2R5CA 2BIAA 2ZSLA 2EH6A 4FL0A 5J8QA 3RUYA 4BMKA 3N4RA 3M5UA 5G4IA 1M4NA 2AY8A 2VMQA 4MQPA 5FT6A 4OBUA 2CH1A 1W7MA 2QBTA 1UU0A 1BT4A 3RQ1A 3VK4A 4A0FA 3NUIA 4NOGA 2Z9VA 2OKJA 3I5TA 4E3RA 3DXVA 5K8BA 4MY5A 2V0YA 4W1XA 3B8XA 1AAMA 1DJEA 1ASGA 2PO3A 3FVUA 4RAEA 1AIBA 1B9IA 2EZ1A 3ZZJA 2ZY3A 3H7FA 1UU2A 4A0HA 3W1JA 4MSOA 4E3QA 2C7TA 3AOVA 2CB1A 3P1TA 1IJIA 2W7JA 2X5DA 5I92A 3ISLA 2E7JA 3P6KA 4ATPA 1S09A 5HDMA 3GJUA 4LC3A 1FG7A 1G7WA 2VMOA 2ZY5A 3FZ8A 3K7YA 1AAWA 1DGDA 1SF2A 3PD6B 1GC2A 3BC8A 2FM1A 2G6WA 1ECXA 2D5YA 2YCNA 1XEYA 3B46A 4IW7A 5G2PA 3WX9A 4M2MA 2AY9A 3FTBA 3NYUA 1B4XA 2VMWA 4WYFA 1I29A 2VGSA 3E2YA 3Q8NA 4DGTA 3BB8A 3USFA 1B5PA 3FFRA 3WKSA 3N4SA 5F8VA 2D7YA 2VI8A 3D6KA 1B8GA 3L8AA 4JF0A 3E2ZB 3PA9A 2Z1ZA 4B98A 4N0WA 2VMRA 4UHOA 2ORDA 2W8TA 1WYUA 3VK3A 3JTXA 3JW9A 1W7NA 3HBXA 4ADBA 2W7DA 1QIRA 1IX6A 4UHMA 1M7YA 4E1OA 4WB0B 1CS1A 1AHXA 3NTJA 3QM2A 2OQXA 5EUEA 3PDXA 3NRAA 5TF5A 4ZSYA 3MKJA 3MBBA 2W7FA 5HHYA 3LVLB 4HF8A 1QITA 4BQ0A 1M0OA 4IX8A 1CZEA 3WY7A 3WGBA 2GMUA 2O7CA 4ZM3A 1EJIA 2YRRA 1D2FA 3FDBA 3MADA 3NYTA 4CXQA 1MGVA 1TOIA 4ZWVA 2VMNA 2EGYA 2CH2A 2D63A 1AY4A 1VP4A 3PIUA 4I8AA 1TOJA 3CQ4A 1GC3A 3NX3A 4WP0A 1XI9A 1U08A 5G2QA 4R5FA 1AKAA 3JZLA 4F5IA 1E5FA 4XJLA 1TOKA 2AY4A 1ARHA 3A9YA 2CSTA 1OHYA 2VMTA 2BIGA 2RFVA 1I48A 4J8LA 4N0BA 2QA3A 2R5CB 3EZSA 2DR1A 1B9HA 2DGKA 2FNIA 2QB3A 3A9XA 3GETA 3QPGA 4W1VA 4F5JA 3ZZKA 1YIYA 1KL1A 4R5ZA 5E5IA 1M32A 2FQ6A 3PDBA 4MQRA 3FQ8A 2TPLA 4WYCA 3JWBA 3HQTA 1GBNA 1ZOBA 4XK1A 1VEFA 5BJ4A 1JS6A 4OC9A 2V1PA 1P3WA 2AY6A 5E3KA 2OATA 2ZSMA 2VGTA 2YHKA 4WBTA 5BJ3A 4A6RA 3ATHA 2C0RA 2ZUKA 1C7OA 4JEWA 5G4JA 3DC1A 5C6UA 2GQNA 1W23A 2JJGA 1YNUA 1V2EA 3FVSA 3JU7A 3QGUA 4FFCA 5EQCA 5M4BA 1M6SA 4AO9A 3TFTA 1ZC9A 3GWPA 1ASBA 3ECDA 1LC5A 2BIEA 3EI6A 3MAFA 4GRXA 3FCRA 1D7UA 3WKRA 2HP2A 1ELUA 3WCOA 4TMRA 1M0PA 3CQ5A 3K28A 2CTZA 1BJOA 4R2NA 4ZM4A 2VYCA 3BCAA 3DXWA 4U2HA 1AMQA 3JWAA 3BWNA 5IWQA 1ARSA 3B1EA 3G7QA 4IYOA 2QMAA 3PGYA 2DKBA 1S07A 2E7IA 2VI9A 2VMPA 3DODA 4WLHA 1YJSA 3L44A 1LC8A 2GSAA 1LW5A 2YCTA 1AKBA 1TPLA 1H1CA 3BS8A 4WYEA 2EZ2A 2R2NA 2QSRA 3DR7A 3TQXA 2D61A 1WYUB 1H0CA 3FVXA 3HLMA 1EQBA 1GD9A 2BYJA 2Z61A 3KGWA 3QN6A 2PB0A 2D66A 4QGRA 2DOUA 1O61A 3E9KA 3AV7A 4ZDOA 3LWSA 4ITXA 1UKJA 5EFSA 4OTLA 3NU7A 4IXSA 7AATA 3EIAA 4A0RA 3LV2A 2FYFA 4CBRA 1DGEA 4WD2A 4F5LA 3LY1A 3FZ6A 4GE4A 4OMAA 5EIGA 2CJDA 1PMOA 3R4TA 1AHFA 3NDNA 4GSAA 3DYDA 2AATA 3KKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIZ A;  4K2M A;  1RV3 A;  2VLF A;  1AMR A;  1CQ6 A;  3FQA A;  1B5O A;  1WYT A;  3N75 A;  3WCN A;  4ADC A;  1BW0 A;  3GZD C;  1OAT A;  3GBX A;  3BWN C;  1AJR A;  1DTY A;  3MC6 C;  2ZY4 A;  1S0A A;  4KXK A;  3NNK A;  1T3I A;  1OHW A;  4WYG A;  4L0O A;  1YAA A;  4Q75 A;  1FC4 A;  1MDZ A;  4ZLV A;  2BI2 A;  2EPJ A;  2JG2 A;  4MKK A;  3BCB A;  3KGX A;  1AHY A;  4IXO A;  3RCH A;  3A2B A;  3QBO A;  1EG5 A;  2W7E A;  3HT4 A;  1AHE A;  2ZJG A;  3A9Z A;  1AMS A;  3PDB B;  1J32 A;  4RM1 A;  1LK9 A;  3TCM A;  2XH1 A;  1D7V A;  3ASB A;  4XJM A;  4F5M A;  2HOY A;  2HUF A;  4LNJ A;  2OKK A;  3FZ7 A;  1SVV A;  4CBS A;  4JEZ A;  1V2F A;  2JJH A;  2W7I A;  2JJE A;  3EI8 A;  1G4X A;  1Z7D A;  4F4E A;  3FRK A;  3HL2 A;  2BI9 A;  1JG8 A;  2PB2 A;  2R0T A;  3ZRQ A;  1O69 A;  1MAQ A;  2HUI A;  1UU1 A;  2XBN A;  4OYT A;  1JS3 A;  2BWN A;  3MAF B;  3NU8 A;  4RKC A;  1WKG A;  1QGN A;  3VP6 A;  3N0L A;  1AY5 A;  1AJS A;  1TOE A;  2WK7 A;  2YKU A;  4BHD A;  4F5F A;  1DFO A;  1I41 A;  3R9A A;  1N2T A;  3ZRP A;  2VIA A;  2JJF A;  1RV4 A;  4M2K A;  1BJO B;  5M49 A;  3LVJ A;  1N31 A;  1IX7 A;  1BS0 A;  1E5E A;  1S06 A;  1WKH A;  2Z9X A;  3ZRR A;  1IUG A;  4IYO B;  5FT8 A;  1IAY A;  4EMY A;  4IY7 A;  1QJ5 A;  4P3M A;  3AEM A;  2O0R A;  1ZOD A;  2QLR A;  1GC0 A;  4LW2 A;  1OXP A;  1X29 A;  3NUB A;  4W8I A;  3PJ0 A;  1G7X A;  1LKC A;  2F8J A;  5D5S A;  3EI7 A;  2W7K A;  4JE5 A;  4ZDL A;  4CVQ A;  3ELE A;  3PPL A;  2HOR A;  1SZU A;  2BI3 A;  1AMA A;  2AY7 A;  4MKJ A;  1X0M A;  4OT8 A;  4LW4 A;  1IX8 A;  3F0H A;  4MQQ A;  3RBL A;  1W7L A;  1IVR A;  1IBJ A;  1ASL A;  1ORD A;  3OP7 A;  3CAI A;  4MGR A;  2CIN A;  2WKA A;  3B1C A;  2GB3 A;  1ASC A;  2OGE A;  2VMS A;  4XJP A;  1Y4I A;  1W3U A;  4Y0H A;  5EIG B;  2W8J A;  3NYS A;  3W1I A;  3LG0 A;  4JEX A;  4K2B A;  2CJG A;  3FFH A;  3FDD A;  2BWP A;  3E77 A;  3K40 A;  4F5G A;  3LVM A;  1SFF A;  1X28 A;  5F9S A;  4ZAS A;  5AX8 A;  4RLG A;  4AO4 A;  4GEB A;  1AHG A;  2GMS A;  2HOZ A;  2HOX A;  2X3L A;  5DJ1 A;  1WYT B;  4UHN A;  2VMV A;  4F5K A;  1M0Q A;  4Y0I A;  2VGW A;  3HMU A;  4BA4 A;  1CQ7 A;  4ITG A;  1ASA A;  2BI1 A;  4OBV A;  1BKG A;  3G0T A;  5M4D A;  4KAM A;  4K2I A;  2WK8 A;  3LVK A;  4J5U A;  1MLY A;  1BJN A;  4KYO A;  4U1T A;  3RCH B;  2AY5 A;  3W1H A;  3DU4 A;  5DJ9 A;  2DKJ A;  4TV7 A;  3COG A;  3QI6 A;  4WLJ A;  5EUD A;  4E77 A;  1CL2 A;  1GEX A;  2CJH A;  3DR4 A;  4RIZ A;  1OXO A;  3AOW A;  1YJY A;  3AEJ A;  5G0A A;  2C44 A;  2QB2 A;  2VIB A;  1KKP A;  2YKV A;  2Z1Y A;  2W8U A;  4F5H A;  5EAA A;  5M46 A;  1FG3 A;  3FD0 A;  4WXG A;  4A00 A;  3I16 A;  4W1W A;  1CL1 A;  1Z3Z A;  3I4J A;  3AEP A;  3ACZ A;  4ZAH A;  4UQV A;  1G4V A;  3BN1 A;  2VMU A;  4UOY A;  2CY8 A;  4P7Y A;  4PVF A;  2O1B A;  4A6T A;  1AJS B;  1CZC A;  3T32 A;  3UE8 A;  2X8U A;  4DQ6 A;  3RBF A;  3TFU A;  4A0G A;  1AY8 A;  1ARI A;  3VK2 A;  2ZYJ A;  3AEN A;  2AY2 A;  3VOM A;  5DB5 A;  5DX5 A;  4BA5 A;  4OCA A;  1SZS A;  1ARG A;  4HVK A;  9AAT A;  1RVU A;  2W8W A;  1J04 A;  3MEB A;  1DJ9 A;  4GE7 A;  2D64 A;  1LS3 A;  1O4S A;  1KMJ A;  3CBF A;  1WYV A;  1AIA A;  1C7N A;  3FKD A;  1GEW A;  5FT5 A;  1C9C A;  3ELP A;  3VAX A;  3WGC A;  1CQ8 A;  2X5F A;  2VMY A;  2BHX A;  2YRI A;  3E2F A;  3AEJ C;  5LH9 A;  1TAR A;  1LC7 A;  4W91 A;  1BQA A;  1KL2 A;  4ADD A;  4JEV A;  4O6Z A;  4XQ2 A;  3GZC A;  1VJO A;  4JEY A;  1MAP A;  3AEO A;  3EZ1 A;  4EB7 A;  2W8V A;  2ZY2 A;  1QZ9 A;  3B1D A;  2EO5 A;  4WYA A;  4A72 A;  2DGL A;  1MDO A;  1TAS A;  4AZJ A;  4EU1 A;  1M0N A;  1ASF A;  2E54 A;  3KE3 A;  1QJ3 A;  1I43 A;  1MDX A;  1ELQ A;  2Z9U A;  3BV0 A;  3WLX A;  2Z20 A;  2Z9W A;  3ASA A;  4Q31 A;  2OGA A;  5E4Z A;  2VMZ A;  2ZP7 A;  1CJ0 A;  4W5K A;  3WZF A;  1TOG A;  3EIB A;  3QHX A;  2CFB A;  5JAY A;  1V2D A;  3CQ6 A;  2E7U A;  4Y0D A;  1ART A;  2VGZ A;  3F9T A;  1QIS A;  1V72 A;  3HDO A;  4TN4 A;  1N8P A;  2VGV A;  4DBC A;  1DJU A;  2FNU A;  3FSL A;  2WK9 A;  4PIW A;  4Q76 A;  1GDE A;  8AAT A;  3RI6 A;  1D7R A;  4RJY A;  3E6G A;  1YJZ A;  3PD6 A;  4RIT A;  2HZP A;  2JGT A;  1PMM A;  1ASE A;  2HUU A;  2BKW A;  3G8M A;  1X2A A;  2D65 A;  4PFN A;  4A6U A;  4B9B A;  1ASD A;  4ZSW A;  3EI9 A;  5G09 A;  4JE5 D;  1ASN A;  2YCP A;  2BI5 A;  3UWC A;  1LW4 A;  3FQ7 A;  2HP1 A;  3N5M A;  2VGU A;  1SZK A;  1GCK A;  3F6T A;  2FN6 A;  1D7S A;  2YKX A;  1KMK A;  2VMX A;  3OKS A;  1S08 A;  2AY1 A;  3GSB A;  3E2Z A;  5D95 A;  2AEV A;  1O62 A;  2ZC0 A;  3MAU A;  1BQD A;  1MLZ A;  3A8U X;  3AAT A;  3EI5 A;  4PFF A;  2R5E A;  4LNM A;  4XJO A;  1YOO A;  4H51 A;  1WST A;  4M2J A;  2AEU A;  1C7G A;  5HXX A;  4WXB A;  4LNL A;  2Q7W A;  1AKC A;  1AX4 A;  3UAK A;  1SPA A;  4GE9 A;  4ADE A;  4AH3 A;  3AEN B;  2W7G A;  4RJ0 A;  2W7M A;  3TAT A;  4WB0 A;  4XEW A;  3DRD A;  3II0 A;  3H14 A;  5EAV A;  1DKA A;  3AEM C;  4ATQ A;  4EFF A;  4AZK A;  1PG8 A;  3AEL A;  2D7Z A;  3IHJ A;  5FT4 A;  1GEY A;  1TAT A;  2Z67 A;  4XAU A;  3BCX A;  1OHV A;  1C4K A;  2YOB A;  1WYV B;  4RKD A;  2W7H A;  2YKY A;  3PAA A;  2CAN A;  4WYD A;  1BJW A;  2BYL A;  5EUN A;  4ZWM A;  2VLH A;  5LHA A;  4R8D A;  4CXR A;  2C81 A;  1BJ4 A;  1AIC A;  4GDY A;  4WXF A;  1ASM A;  3GZD A;  4Q6R A;  3BWO A;  3DZZ A;  3MC6 A;  4EB5 A;  3HVY A;  4AOA A;  1PFF A;  3EUC A;  3IF2 A;  2JIS A;  1JF9 A;  1RVY A;  4ISY A;  4ZDP A;  2BWO A;  3GR9 A;  1IAX A;  4IXZ A;  1C0N A;  2AY3 A;  1KKJ A;  2DGM A;  1GC4 A;  2W7L A;  4JF1 A;  2NMP A;  2R5C A;  2BIA A;  2ZSL A;  2EH6 A;  4FL0 A;  5J8Q A;  3RUY A;  4BMK A;  3M5U A;  5G4I A;  1M4N A;  2AY8 A;  2VMQ A;  4MQP A;  5FT6 A;  4OBU A;  2CH1 A;  1W7M A;  2QBT A;  1UU0 A;  1BT4 A;  3RQ1 A;  3VK4 A;  4A0F A;  3NUI A;  4NOG A;  2Z9V A;  2OKJ A;  3I5T A;  4E3R A;  3DXV A;  5K8B A;  4MY5 A;  2V0Y A;  4W1X A;  3B8X A;  1AAM A;  1DJE A;  1ASG A;  2PO3 A;  3FVU A;  4RAE A;  1AIB A;  1B9I A;  2EZ1 A;  3ZZJ A;  2ZY3 A;  3H7F A;  1UU2 A;  4A0H A;  3W1J A;  4MSO A;  4E3Q A;  2C7T A;  3AOV A;  2CB1 A;  3P1T A;  1IJI A;  2W7J A;  2X5D A;  5I92 A;  3ISL A;  2E7J A;  3P6K A;  4ATP A;  1S09 A;  5HDM A;  3GJU A;  4LC3 A;  1FG7 A;  1G7W A;  2VMO A;  2ZY5 A;  3FZ8 A;  3K7Y A;  1AAW A;  1DGD A;  1SF2 A;  3PD6 B;  1GC2 A;  3BC8 A;  2FM1 A;  2G6W A;  1ECX A;  2D5Y A;  2YCN A;  1XEY A;  3B46 A;  4IW7 A;  5G2P A;  3WX9 A;  4M2M A;  2AY9 A;  3FTB A;  3NYU A;  1B4X A;  2VMW A;  4WYF A;  1I29 A;  2VGS A;  3E2Y A;  3Q8N A;  4DGT A;  3BB8 A;  3USF A;  1B5P A;  3FFR A;  3WKS A;  5F8V A;  2D7Y A;  2VI8 A;  3D6K A;  1B8G A;  3L8A A;  4JF0 A;  3E2Z B;  3PA9 A;  2Z1Z A;  4B98 A;  4N0W A;  2VMR A;  4UHO A;  2ORD A;  2W8T A;  1WYU A;  3VK3 A;  3JTX A;  3JW9 A;  1W7N A;  3HBX A;  4ADB A;  2W7D A;  1QIR A;  1IX6 A;  4UHM A;  1M7Y A;  4E1O A;  4WB0 B;  1CS1 A;  1AHX A;  3NTJ A;  3QM2 A;  2OQX A;  5EUE A;  3PDX A;  3NRA A;  5TF5 A;  4ZSY A;  3MKJ A;  3MBB A;  2W7F A;  5HHY A;  3LVL B;  4HF8 A;  1QIT A;  4BQ0 A;  1M0O A;  4IX8 A;  1CZE A;  3WY7 A;  3WGB A;  2GMU A;  2O7C A;  4ZM3 A;  1EJI A;  2YRR A;  1D2F A;  3FDB A;  3MAD A;  3NYT A;  4CXQ A;  1MGV A;  1TOI A;  4ZWV A;  2VMN A;  2EGY A;  2CH2 A;  2D63 A;  1AY4 A;  1VP4 A;  3PIU A;  4I8A A;  1TOJ A;  3CQ4 A;  1GC3 A;  3NX3 A;  4WP0 A;  1XI9 A;  1U08 A;  5G2Q A;  4R5F A;  1AKA A;  3JZL A;  4F5I A;  1E5F A;  4XJL A;  1TOK A;  2AY4 A;  1ARH A;  3A9Y A;  2CST A;  1OHY A;  2VMT A;  2BIG A;  2RFV A;  1I48 A;  4J8L A;  4N0B A;  2QA3 A;  2R5C B;  3EZS A;  2DR1 A;  1B9H A;  2DGK A;  2FNI A;  2QB3 A;  3A9X A;  3GET A;  3QPG A;  4W1V A;  4F5J A;  3ZZK A;  1YIY A;  1KL1 A;  4R5Z A;  5E5I A;  1M32 A;  2FQ6 A;  3PDB A;  4MQR A;  3FQ8 A;  2TPL A;  4WYC A;  3JWB A;  3HQT A;  1GBN A;  1ZOB A;  4XK1 A;  1VEF A;  5BJ4 A;  1JS6 A;  4OC9 A;  2V1P A;  1P3W A;  2AY6 A;  5E3K A;  2OAT A;  2ZSM A;  2VGT A;  2YHK A;  4WBT A;  5BJ3 A;  4A6R A;  3ATH A;  2C0R A;  2ZUK A;  1C7O A;  4JEW A;  5G4J A;  3DC1 A;  5C6U A;  2GQN A;  1W23 A;  2JJG A;  1YNU A;  1V2E A;  3FVS A;  3JU7 A;  3QGU A;  4FFC A;  5EQC A;  5M4B A;  1M6S A;  4AO9 A;  3TFT A;  1ZC9 A;  3GWP A;  1ASB A;  3ECD A;  1LC5 A;  2BIE A;  3EI6 A;  3MAF A;  4GRX A;  3FCR A;  1D7U A;  3WKR A;  2HP2 A;  1ELU A;  3WCO A;  4TMR A;  1M0P A;  3CQ5 A;  3K28 A;  2CTZ A;  1BJO A;  4R2N A;  4ZM4 A;  2VYC A;  3BCA A;  3DXW A;  4U2H A;  1AMQ A;  3JWA A;  3BWN A;  5IWQ A;  1ARS A;  3B1E A;  3G7Q A;  4IYO A;  2QMA A;  3PGY A;  2DKB A;  1S07 A;  2E7I A;  2VI9 A;  2VMP A;  3DOD A;  4WLH A;  1YJS A;  3L44 A;  1LC8 A;  2GSA A;  1LW5 A;  2YCT A;  1AKB A;  1TPL A;  1H1C A;  3BS8 A;  4WYE A;  2EZ2 A;  2R2N A;  3DR7 A;  3TQX A;  2D61 A;  1WYU B;  1H0C A;  3FVX A;  3HLM A;  1EQB A;  1GD9 A;  2BYJ A;  2Z61 A;  3KGW A;  3QN6 A;  2PB0 A;  2D66 A;  4QGR A;  2DOU A;  1O61 A;  3E9K A;  3AV7 A;  4ZDO A;  3LWS A;  4ITX A;  1UKJ A;  5EFS A;  4OTL A;  3NU7 A;  4IXS A;  7AAT A;  3EIA A;  4A0R A;  3LV2 A;  2FYF A;  4CBR A;  1DGE A;  4WD2 A;  4F5L A;  3LY1 A;  3FZ6 A;  4GE4 A;  4OMA A;  5EIG A;  2CJD A;  1PMO A;  3R4T A;  1AHF A;  3NDN A;  4GSA A;  3DYD A;  2AAT A;  3KKI A; 
#chains in the Genus database with same CATH topology
 1YIZ A;  2A1V A;  4K2M A;  1RV3 A;  2VLF A;  1AMR A;  1CQ6 A;  3FQA A;  1B5O A;  1WYT A;  3N75 A;  3WCN A;  4ADC A;  1BW0 A;  3GZD C;  1OAT A;  3GBX A;  3BWN C;  1AJR A;  1DTY A;  3MC6 C;  2ZY4 A;  1S0A A;  4KXK A;  3NNK A;  1T3I A;  1OHW A;  4WYG A;  4L0O A;  1YAA A;  4Q75 A;  1FC4 A;  1MDZ A;  4ZLV A;  2BI2 A;  2EPJ A;  2JG2 A;  4MKK A;  3BCB A;  3KGX A;  1AHY A;  4IXO A;  3RCH A;  3A2B A;  3QBO A;  1EG5 A;  2W7E A;  3HT4 A;  1AHE A;  2ZJG A;  3A9Z A;  1AMS A;  3PDB B;  1J32 A;  4RM1 A;  1LK9 A;  3TCM A;  2XH1 A;  1D7V A;  3ASB A;  4XJM A;  4F5M A;  2HOY A;  2HUF A;  4LNJ A;  2OKK A;  3FZ7 A;  1SVV A;  4CBS A;  4JEZ A;  1V2F A;  2JJH A;  2W7I A;  2JJE A;  3EI8 A;  1G4X A;  1Z7D A;  4F4E A;  3FRK A;  3HL2 A;  2BI9 A;  1JG8 A;  2PB2 A;  2R0T A;  3ZRQ A;  5KTB A;  1O69 A;  1MAQ A;  2HUI A;  1UU1 A;  2XBN A;  4OYT A;  1JS3 A;  2BWN A;  3MAF B;  3NU8 A;  4RKC A;  1WKG A;  1QGN A;  3VP6 A;  3N0L A;  1AY5 A;  1AJS A;  1TOE A;  2WK7 A;  2YKU A;  4BHD A;  4F5F A;  1DFO A;  1I41 A;  3R9A A;  1N2T A;  3ZRP A;  2VIA A;  2JJF A;  1RV4 A;  4M2K A;  1BJO B;  5M49 A;  3LVJ A;  1N31 A;  1IX7 A;  1BS0 A;  1E5E A;  1S06 A;  1WKH A;  2Z9X A;  3ZRR A;  1IUG A;  4IYO B;  5FT8 A;  1IAY A;  4EMY A;  1KAF A;  4IY7 A;  1QJ5 A;  4P3M A;  3AEM A;  2O0R A;  1ZOD A;  2QLR A;  1GC0 A;  4LW2 A;  1OXP A;  1X29 A;  3NUB A;  4W8I A;  3PJ0 A;  1G7X A;  1LKC A;  2FKI A;  2F8J A;  5D5S A;  3EI7 A;  2W7K A;  4JE5 A;  4ZDL A;  4CVQ A;  3ELE A;  3PPL A;  2HOR A;  1SZU A;  2BI3 A;  1AMA A;  2AY7 A;  4MKJ A;  1X0M A;  4OT8 A;  4LW4 A;  1IX8 A;  3F0H A;  4MQQ A;  3RBL A;  1W7L A;  1IVR A;  1IBJ A;  1ASL A;  1ORD A;  3OP7 A;  3CAI A;  4MGR A;  2CIN A;  2WKA A;  3B1C A;  2GB3 A;  1ASC A;  2OGE A;  2VMS A;  4XJP A;  1Y4I A;  1W3U A;  4Y0H A;  5EIG B;  2W8J A;  3NYS A;  3W1I A;  3LG0 A;  4JEX A;  4K2B A;  2CJG A;  3FFH A;  3FDD A;  2BWP A;  3E77 A;  3K40 A;  4F5G A;  3LVM A;  1SFF A;  1X28 A;  5F9S A;  4ZAS A;  5AX8 A;  4RLG A;  4AO4 A;  4GEB A;  1AHG A;  2GMS A;  2HOZ A;  2HOX A;  2X3L A;  5DJ1 A;  1WYT B;  4UHN A;  2VMV A;  4F5K A;  1M0Q A;  4Y0I A;  2VGW A;  3HMU A;  4BA4 A;  1CQ7 A;  4ITG A;  3H9X A;  1ASA A;  2BI1 A;  4OBV A;  1BKG A;  3G0T A;  5M4D A;  4KAM A;  4K2I A;  2WK8 A;  3LVK A;  4J5U A;  1MLY A;  1BJN A;  4KYO A;  4U1T A;  3RCH B;  2AY5 A;  3W1H A;  3DU4 A;  5DJ9 A;  2DKJ A;  2EYQ A;  4TV7 A;  3COG A;  3QI6 A;  4WLJ A;  5EUD A;  4E77 A;  1CL2 A;  1GEX A;  2CJH A;  3DR4 A;  4RIZ A;  1OXO A;  3AOW A;  1YJY A;  3AEJ A;  5G0A A;  2C44 A;  2QB2 A;  2VIB A;  1KKP A;  3N7N A;  2KFP A;  2YKV A;  2Z1Y A;  2W8U A;  4F5H A;  5EAA A;  5M46 A;  1FG3 A;  3FD0 A;  4WXG A;  4A00 A;  3I16 A;  4W1W A;  1CL1 A;  1Z3Z A;  3I4J A;  3AEP A;  3ACZ A;  4ZAH A;  4UQV A;  4H63 Q;  1G4V A;  3BN1 A;  2VMU A;  4UOY A;  2CY8 A;  4P7Y A;  4PVF A;  2O1B A;  4A6T A;  1AJS B;  1CZC A;  3T32 A;  3UE8 A;  2X8U A;  4DQ6 A;  3RBF A;  3TFU A;  4A0G A;  1AY8 A;  1ARI A;  3VK2 A;  2ZYJ A;  3AEN A;  2AY2 A;  3VOM A;  5DB5 A;  5DX5 A;  4BA5 A;  4OCA A;  1SZS A;  1ARG A;  4HVK A;  9AAT A;  1RVU A;  2W8W A;  1J04 A;  3MEB A;  1DJ9 A;  4GE7 A;  2D64 A;  1LS3 A;  1O4S A;  1KMJ A;  3CBF A;  1WYV A;  1AIA A;  1C7N A;  3FKD A;  1GEW A;  5FT5 A;  1C9C A;  3ELP A;  3VAX A;  3WGC A;  1CQ8 A;  2X5F A;  2VMY A;  2BHX A;  2YRI A;  3E2F A;  3AEJ C;  5LH9 A;  1TAR A;  1LC7 A;  4W91 A;  1BQA A;  1KL2 A;  4ADD A;  4JEV A;  4O6Z A;  4XQ2 A;  3GZC A;  1VJO A;  4JEY A;  1MAP A;  3AEO A;  3EZ1 A;  4EB7 A;  2W8V A;  2ZY2 A;  1QZ9 A;  3B1D A;  2EO5 A;  4WYA A;  4A72 A;  2DGL A;  1MDO A;  1TAS A;  4AZJ A;  4EU1 A;  1M0N A;  1ASF A;  2E54 A;  3KE3 A;  1QJ3 A;  1I43 A;  1MDX A;  2G7J A;  1ELQ A;  2Z9U A;  3BV0 A;  3WLX A;  2Z20 A;  2Z9W A;  3ASA A;  4Q31 A;  2OGA A;  5E4Z A;  2VMZ A;  2ZP7 A;  1CJ0 A;  4W5K A;  3WZF A;  1TOG A;  3EIB A;  3QHX A;  2CFB A;  5JAY A;  1V2D A;  3CQ6 A;  2E7U A;  4Y0D A;  1ART A;  2VGZ A;  2WB6 A;  3F9T A;  1QIS A;  1V72 A;  3HDO A;  4TN4 A;  1N8P A;  2VGV A;  4DBC A;  1DJU A;  2FNU A;  3FSL A;  2WK9 A;  4PIW A;  4Q76 A;  1GDE A;  8AAT A;  3RI6 A;  1D7R A;  4RJY A;  3E6G A;  1YJZ A;  3PD6 A;  4RIT A;  2HZP A;  2JGT A;  1PMM A;  1ASE A;  2HUU A;  2BKW A;  3G8M A;  1X2A A;  2D65 A;  4PFN A;  4A6U A;  4B9B A;  1ASD A;  4ZSW A;  3EI9 A;  5G09 A;  4JE5 D;  1ASN A;  3N4X A;  2YCP A;  2BI5 A;  3UWC A;  1LW4 A;  3FQ7 A;  2HP1 A;  3N5M A;  2VGU A;  1SZK A;  1GCK A;  3F6T A;  2FN6 A;  1D7S A;  2YKX A;  1KMK A;  2VMX A;  3OKS A;  1S08 A;  2AY1 A;  3GSB A;  3E2Z A;  5D95 A;  2AEV A;  1O62 A;  2ZC0 A;  3MAU A;  1BQD A;  1MLZ A;  3A8U X;  3AAT A;  3EI5 A;  4PFF A;  2R5E A;  4LNM A;  4XJO A;  1YOO A;  4H51 A;  1WST A;  4M2J A;  2AEU A;  1C7G A;  5HXX A;  4WXB A;  4LNL A;  2Q7W A;  1AKC A;  1AX4 A;  3UAK A;  1SPA A;  4GE9 A;  4ADE A;  4AH3 A;  3AEN B;  2W7G A;  4RJ0 A;  2W7M A;  3TAT A;  4WB0 A;  4XEW A;  3DRD A;  3II0 A;  3H14 A;  5EAV A;  1DKA A;  3AEM C;  4ATQ A;  4EFF A;  4AZK A;  1PG8 A;  3AEL A;  2D7Z A;  3IHJ A;  5FT4 A;  1GEY A;  1TAT A;  2Z67 A;  4XAU A;  3BCX A;  1OHV A;  1C4K A;  2YOB A;  1WYV B;  4RKD A;  2W7H A;  2YKY A;  3PAA A;  2CAN A;  4WYD A;  1BJW A;  2BYL A;  5EUN A;  4ZWM A;  2VLH A;  5LHA A;  4R8D A;  4K05 A;  4CXR A;  2C81 A;  1BJ4 A;  1AIC A;  4GDY A;  4WXF A;  1ASM A;  3GZD A;  4Q6R A;  3BWO A;  3DZZ A;  3MC6 A;  4EB5 A;  3HVY A;  4AOA A;  1PFF A;  3EUC A;  3IF2 A;  2JIS A;  1JF9 A;  1RVY A;  4ISY A;  4ZDP A;  2BWO A;  3GR9 A;  1IAX A;  4IXZ A;  1C0N A;  2AY3 A;  1KKJ A;  2DGM A;  1GC4 A;  2W7L A;  4JF1 A;  2NMP A;  2R5C A;  2BIA A;  2ZSL A;  2EH6 A;  4FL0 A;  5J8Q A;  3RUY A;  4BMK A;  3N4R A;  3M5U A;  5G4I A;  1M4N A;  2AY8 A;  2VMQ A;  4MQP A;  5FT6 A;  4OBU A;  2CH1 A;  1W7M A;  2QBT A;  1UU0 A;  1BT4 A;  3RQ1 A;  3VK4 A;  4A0F A;  3NUI A;  4NOG A;  2Z9V A;  2OKJ A;  3I5T A;  4E3R A;  3DXV A;  5K8B A;  4MY5 A;  2V0Y A;  4W1X A;  3B8X A;  1AAM A;  1DJE A;  1ASG A;  2PO3 A;  3FVU A;  4RAE A;  1AIB A;  1B9I A;  2EZ1 A;  3ZZJ A;  2ZY3 A;  3H7F A;  1UU2 A;  4A0H A;  3W1J A;  4MSO A;  4E3Q A;  2C7T A;  3AOV A;  2CB1 A;  3P1T A;  1IJI A;  2W7J A;  2X5D A;  5I92 A;  3ISL A;  2E7J A;  3P6K A;  4ATP A;  1S09 A;  5HDM A;  3GJU A;  4LC3 A;  1FG7 A;  1G7W A;  2VMO A;  2ZY5 A;  3FZ8 A;  3K7Y A;  1AAW A;  1DGD A;  1SF2 A;  3PD6 B;  1GC2 A;  3BC8 A;  2FM1 A;  2G6W A;  1ECX A;  2D5Y A;  2YCN A;  1XEY A;  3B46 A;  4IW7 A;  5G2P A;  3WX9 A;  4M2M A;  2AY9 A;  3FTB A;  3NYU A;  1B4X A;  2VMW A;  4WYF A;  1I29 A;  2VGS A;  3E2Y A;  3Q8N A;  4DGT A;  3BB8 A;  3USF A;  1B5P A;  3FFR A;  3WKS A;  3N4S A;  5F8V A;  2D7Y A;  2VI8 A;  3D6K A;  1B8G A;  3L8A A;  4JF0 A;  3E2Z B;  3PA9 A;  2Z1Z A;  4B98 A;  4N0W A;  2VMR A;  4UHO A;  2ORD A;  2W8T A;  1WYU A;  3VK3 A;  3JTX A;  3JW9 A;  1W7N A;  3HBX A;  4ADB A;  2W7D A;  1QIR A;  1IX6 A;  4UHM A;  1M7Y A;  4E1O A;  4WB0 B;  1CS1 A;  1AHX A;  3NTJ A;  3QM2 A;  2OQX A;  5EUE A;  3PDX A;  3NRA A;  5TF5 A;  4ZSY A;  3MKJ A;  3MBB A;  2W7F A;  5HHY A;  3LVL B;  4HF8 A;  1QIT A;  4BQ0 A;  1M0O A;  4IX8 A;  1CZE A;  3WY7 A;  3WGB A;  2GMU A;  2O7C A;  4ZM3 A;  1EJI A;  2YRR A;  1D2F A;  3FDB A;  3MAD A;  3NYT A;  4CXQ A;  1MGV A;  1TOI A;  4ZWV A;  2VMN A;  2EGY A;  2CH2 A;  2D63 A;  1AY4 A;  1VP4 A;  3PIU A;  4I8A A;  1TOJ A;  3CQ4 A;  1GC3 A;  3NX3 A;  4WP0 A;  1XI9 A;  1U08 A;  5G2Q A;  4R5F A;  1AKA A;  3JZL A;  4F5I A;  1E5F A;  4XJL A;  1TOK A;  2AY4 A;  1ARH A;  3A9Y A;  2CST A;  1OHY A;  2VMT A;  2BIG A;  2RFV A;  1I48 A;  4J8L A;  4N0B A;  2QA3 A;  2R5C B;  3EZS A;  2DR1 A;  1B9H A;  2DGK A;  2FNI A;  2QB3 A;  3A9X A;  3GET A;  3QPG A;  4W1V A;  4F5J A;  3ZZK A;  1YIY A;  1KL1 A;  4R5Z A;  5E5I A;  1M32 A;  2FQ6 A;  3PDB A;  4MQR A;  3FQ8 A;  2TPL A;  4WYC A;  3JWB A;  3HQT A;  1GBN A;  1ZOB A;  4XK1 A;  1VEF A;  5BJ4 A;  1JS6 A;  4OC9 A;  2V1P A;  1P3W A;  2AY6 A;  5E3K A;  2OAT A;  2ZSM A;  2VGT A;  2YHK A;  4WBT A;  5BJ3 A;  4A6R A;  3ATH A;  2C0R A;  2ZUK A;  1C7O A;  4JEW A;  5G4J A;  3DC1 A;  5C6U A;  2GQN A;  1W23 A;  2JJG A;  1YNU A;  1V2E A;  3FVS A;  3JU7 A;  3QGU A;  4FFC A;  5EQC A;  5M4B A;  1M6S A;  4AO9 A;  3TFT A;  1ZC9 A;  3GWP A;  1ASB A;  3ECD A;  1LC5 A;  2BIE A;  3EI6 A;  3MAF A;  4GRX A;  3FCR A;  1D7U A;  3WKR A;  2HP2 A;  1ELU A;  3WCO A;  4TMR A;  1M0P A;  3CQ5 A;  3K28 A;  2CTZ A;  1BJO A;  4R2N A;  4ZM4 A;  2VYC A;  3BCA A;  3DXW A;  4U2H A;  1AMQ A;  3JWA A;  3BWN A;  5IWQ A;  1ARS A;  3B1E A;  3G7Q A;  4IYO A;  2QMA A;  3PGY A;  2DKB A;  1S07 A;  2E7I A;  2VI9 A;  2VMP A;  3DOD A;  4WLH A;  1YJS A;  3L44 A;  1LC8 A;  2GSA A;  1LW5 A;  2YCT A;  1AKB A;  1TPL A;  1H1C A;  3BS8 A;  4WYE A;  2EZ2 A;  2R2N A;  2QSR A;  3DR7 A;  3TQX A;  2D61 A;  1WYU B;  1H0C A;  3FVX A;  3HLM A;  1EQB A;  1GD9 A;  2BYJ A;  2Z61 A;  3KGW A;  3QN6 A;  2PB0 A;  2D66 A;  4QGR A;  2DOU A;  1O61 A;  3E9K A;  3AV7 A;  4ZDO A;  3LWS A;  4ITX A;  1UKJ A;  5EFS A;  4OTL A;  3NU7 A;  4IXS A;  7AAT A;  3EIA A;  4A0R A;  3LV2 A;  2FYF A;  4CBR A;  1DGE A;  4WD2 A;  4F5L A;  3LY1 A;  3FZ6 A;  4GE4 A;  4OMA A;  5EIG A;  2CJD A;  1PMO A;  3R4T A;  1AHF A;  3NDN A;  4GSA A;  3DYD A;  2AAT A;  3KKI A; 
#chains in the Genus database with same CATH homology
 1YIZ A;  2A1V A;  4K2M A;  1RV3 A;  2VLF A;  1AMR A;  1CQ6 A;  3FQA A;  1B5O A;  1WYT A;  3N75 A;  3WCN A;  4ADC A;  1BW0 A;  3GZD C;  1OAT A;  3GBX A;  3BWN C;  1AJR A;  1DTY A;  3MC6 C;  2ZY4 A;  1S0A A;  4KXK A;  3NNK A;  1T3I A;  1OHW A;  4WYG A;  4L0O A;  1YAA A;  4Q75 A;  1FC4 A;  1MDZ A;  4ZLV A;  2BI2 A;  2EPJ A;  2JG2 A;  4MKK A;  3BCB A;  3KGX A;  1AHY A;  4IXO A;  3RCH A;  3A2B A;  3QBO A;  1EG5 A;  2W7E A;  3HT4 A;  1AHE A;  2ZJG A;  3A9Z A;  1AMS A;  3PDB B;  1J32 A;  4RM1 A;  1LK9 A;  3TCM A;  2XH1 A;  1D7V A;  3ASB A;  4XJM A;  4F5M A;  2HOY A;  2HUF A;  4LNJ A;  2OKK A;  3FZ7 A;  1SVV A;  4CBS A;  4JEZ A;  1V2F A;  2JJH A;  2W7I A;  2JJE A;  3EI8 A;  1G4X A;  1Z7D A;  4F4E A;  3FRK A;  3HL2 A;  2BI9 A;  1JG8 A;  2PB2 A;  2R0T A;  3ZRQ A;  5KTB A;  1O69 A;  1MAQ A;  2HUI A;  1UU1 A;  2XBN A;  4OYT A;  1JS3 A;  2BWN A;  3MAF B;  3NU8 A;  4RKC A;  1WKG A;  1QGN A;  3VP6 A;  3N0L A;  1AY5 A;  1AJS A;  1TOE A;  2WK7 A;  2YKU A;  4BHD A;  4F5F A;  1DFO A;  1I41 A;  3R9A A;  1N2T A;  3ZRP A;  2VIA A;  2JJF A;  1RV4 A;  4M2K A;  1BJO B;  5M49 A;  3LVJ A;  1N31 A;  1IX7 A;  1BS0 A;  1E5E A;  1S06 A;  1WKH A;  2Z9X A;  3ZRR A;  1IUG A;  4IYO B;  5FT8 A;  1IAY A;  4EMY A;  4IY7 A;  1QJ5 A;  4P3M A;  3AEM A;  2O0R A;  1ZOD A;  2QLR A;  1GC0 A;  4LW2 A;  1OXP A;  1X29 A;  3NUB A;  4W8I A;  3PJ0 A;  1G7X A;  1LKC A;  2FKI A;  2F8J A;  5D5S A;  3EI7 A;  2W7K A;  4JE5 A;  4ZDL A;  4CVQ A;  3ELE A;  3PPL A;  2HOR A;  1SZU A;  2BI3 A;  1AMA A;  2AY7 A;  4MKJ A;  1X0M A;  4OT8 A;  4LW4 A;  1IX8 A;  3F0H A;  4MQQ A;  3RBL A;  1W7L A;  1IVR A;  1IBJ A;  1ASL A;  1ORD A;  3OP7 A;  3CAI A;  4MGR A;  2CIN A;  2WKA A;  3B1C A;  2GB3 A;  1ASC A;  2OGE A;  2VMS A;  4XJP A;  1Y4I A;  1W3U A;  4Y0H A;  5EIG B;  2W8J A;  3NYS A;  3W1I A;  3LG0 A;  4JEX A;  4K2B A;  2CJG A;  3FFH A;  3FDD A;  2BWP A;  3E77 A;  3K40 A;  4F5G A;  3LVM A;  1SFF A;  1X28 A;  5F9S A;  4ZAS A;  5AX8 A;  4RLG A;  4AO4 A;  4GEB A;  1AHG A;  2GMS A;  2HOZ A;  2HOX A;  2X3L A;  5DJ1 A;  1WYT B;  4UHN A;  2VMV A;  4F5K A;  1M0Q A;  4Y0I A;  2VGW A;  3HMU A;  4BA4 A;  1CQ7 A;  4ITG A;  3H9X A;  1ASA A;  2BI1 A;  4OBV A;  1BKG A;  3G0T A;  5M4D A;  4KAM A;  4K2I A;  2WK8 A;  3LVK A;  4J5U A;  1MLY A;  1BJN A;  4KYO A;  4U1T A;  3RCH B;  2AY5 A;  3W1H A;  3DU4 A;  5DJ9 A;  2DKJ A;  2EYQ A;  4TV7 A;  3COG A;  3QI6 A;  4WLJ A;  5EUD A;  4E77 A;  1CL2 A;  1GEX A;  2CJH A;  3DR4 A;  4RIZ A;  1OXO A;  3AOW A;  1YJY A;  3AEJ A;  5G0A A;  2C44 A;  2QB2 A;  2VIB A;  1KKP A;  3N7N A;  2KFP A;  2YKV A;  2Z1Y A;  2W8U A;  4F5H A;  5EAA A;  5M46 A;  1FG3 A;  3FD0 A;  4WXG A;  4A00 A;  3I16 A;  4W1W A;  1CL1 A;  1Z3Z A;  3I4J A;  3AEP A;  3ACZ A;  4ZAH A;  4UQV A;  4H63 Q;  1G4V A;  3BN1 A;  2VMU A;  4UOY A;  2CY8 A;  4P7Y A;  4PVF A;  2O1B A;  4A6T A;  1AJS B;  1CZC A;  3T32 A;  3UE8 A;  2X8U A;  4DQ6 A;  3RBF A;  3TFU A;  4A0G A;  1AY8 A;  1ARI A;  3VK2 A;  2ZYJ A;  3AEN A;  2AY2 A;  3VOM A;  5DB5 A;  5DX5 A;  4BA5 A;  4OCA A;  1SZS A;  1ARG A;  4HVK A;  9AAT A;  1RVU A;  2W8W A;  1J04 A;  3MEB A;  1DJ9 A;  4GE7 A;  2D64 A;  1LS3 A;  1O4S A;  1KMJ A;  3CBF A;  1WYV A;  1AIA A;  1C7N A;  3FKD A;  1GEW A;  5FT5 A;  1C9C A;  3ELP A;  3VAX A;  3WGC A;  1CQ8 A;  2X5F A;  2VMY A;  2BHX A;  2YRI A;  3E2F A;  3AEJ C;  5LH9 A;  1TAR A;  1LC7 A;  4W91 A;  1BQA A;  1KL2 A;  4ADD A;  4JEV A;  4O6Z A;  4XQ2 A;  3GZC A;  1VJO A;  4JEY A;  1MAP A;  3AEO A;  3EZ1 A;  4EB7 A;  2W8V A;  2ZY2 A;  1QZ9 A;  3B1D A;  2EO5 A;  4WYA A;  4A72 A;  2DGL A;  1MDO A;  1TAS A;  4AZJ A;  4EU1 A;  1M0N A;  1ASF A;  2E54 A;  3KE3 A;  1QJ3 A;  1I43 A;  1MDX A;  2G7J A;  1ELQ A;  2Z9U A;  3BV0 A;  3WLX A;  2Z20 A;  2Z9W A;  3ASA A;  4Q31 A;  2OGA A;  5E4Z A;  2VMZ A;  2ZP7 A;  1CJ0 A;  4W5K A;  3WZF A;  1TOG A;  3EIB A;  3QHX A;  2CFB A;  5JAY A;  1V2D A;  3CQ6 A;  2E7U A;  4Y0D A;  1ART A;  2VGZ A;  2WB6 A;  3F9T A;  1QIS A;  1V72 A;  3HDO A;  4TN4 A;  1N8P A;  2VGV A;  4DBC A;  1DJU A;  2FNU A;  3FSL A;  2WK9 A;  4PIW A;  4Q76 A;  1GDE A;  8AAT A;  3RI6 A;  1D7R A;  4RJY A;  3E6G A;  1YJZ A;  3PD6 A;  4RIT A;  2HZP A;  2JGT A;  1PMM A;  1ASE A;  2HUU A;  2BKW A;  3G8M A;  1X2A A;  2D65 A;  4PFN A;  4A6U A;  4B9B A;  1ASD A;  4ZSW A;  3EI9 A;  5G09 A;  4JE5 D;  1ASN A;  3N4X A;  2YCP A;  2BI5 A;  3UWC A;  1LW4 A;  3FQ7 A;  2HP1 A;  3N5M A;  2VGU A;  1SZK A;  1GCK A;  3F6T A;  2FN6 A;  1D7S A;  2YKX A;  1KMK A;  2VMX A;  3OKS A;  1S08 A;  2AY1 A;  3GSB A;  3E2Z A;  5D95 A;  2AEV A;  1O62 A;  2ZC0 A;  3MAU A;  1BQD A;  1MLZ A;  3A8U X;  3AAT A;  3EI5 A;  4PFF A;  2R5E A;  4LNM A;  4XJO A;  1YOO A;  4H51 A;  1WST A;  4M2J A;  2AEU A;  1C7G A;  5HXX A;  4WXB A;  4LNL A;  2Q7W A;  1AKC A;  1AX4 A;  3UAK A;  1SPA A;  4GE9 A;  4ADE A;  4AH3 A;  3AEN B;  2W7G A;  4RJ0 A;  2W7M A;  3TAT A;  4WB0 A;  4XEW A;  3DRD A;  3II0 A;  3H14 A;  5EAV A;  1DKA A;  3AEM C;  4ATQ A;  4EFF A;  4AZK A;  1PG8 A;  3AEL A;  2D7Z A;  3IHJ A;  5FT4 A;  1GEY A;  1TAT A;  2Z67 A;  4XAU A;  3BCX A;  1OHV A;  1C4K A;  2YOB A;  1WYV B;  4RKD A;  2W7H A;  2YKY A;  3PAA A;  2CAN A;  4WYD A;  1BJW A;  2BYL A;  5EUN A;  4ZWM A;  2VLH A;  5LHA A;  4R8D A;  4K05 A;  4CXR A;  2C81 A;  1BJ4 A;  1AIC A;  4GDY A;  4WXF A;  1ASM A;  3GZD A;  4Q6R A;  3BWO A;  3DZZ A;  3MC6 A;  4EB5 A;  3HVY A;  4AOA A;  1PFF A;  3EUC A;  3IF2 A;  2JIS A;  1JF9 A;  1RVY A;  4ISY A;  4ZDP A;  2BWO A;  3GR9 A;  1IAX A;  4IXZ A;  1C0N A;  2AY3 A;  1KKJ A;  2DGM A;  1GC4 A;  2W7L A;  4JF1 A;  2NMP A;  2R5C A;  2BIA A;  2ZSL A;  2EH6 A;  4FL0 A;  5J8Q A;  3RUY A;  4BMK A;  3N4R A;  3M5U A;  5G4I A;  1M4N A;  2AY8 A;  2VMQ A;  4MQP A;  5FT6 A;  4OBU A;  2CH1 A;  1W7M A;  2QBT A;  1UU0 A;  1BT4 A;  3RQ1 A;  3VK4 A;  4A0F A;  3NUI A;  4NOG A;  2Z9V A;  2OKJ A;  3I5T A;  4E3R A;  3DXV A;  5K8B A;  4MY5 A;  2V0Y A;  4W1X A;  3B8X A;  1AAM A;  1DJE A;  1ASG A;  2PO3 A;  3FVU A;  4RAE A;  1AIB A;  1B9I A;  2EZ1 A;  3ZZJ A;  2ZY3 A;  3H7F A;  1UU2 A;  4A0H A;  3W1J A;  4MSO A;  4E3Q A;  2C7T A;  3AOV A;  2CB1 A;  3P1T A;  1IJI A;  2W7J A;  2X5D A;  5I92 A;  3ISL A;  2E7J A;  3P6K A;  4ATP A;  1S09 A;  5HDM A;  3GJU A;  4LC3 A;  1FG7 A;  1G7W A;  2VMO A;  2ZY5 A;  3FZ8 A;  3K7Y A;  1AAW A;  1DGD A;  1SF2 A;  3PD6 B;  1GC2 A;  3BC8 A;  2FM1 A;  2G6W A;  1ECX A;  2D5Y A;  2YCN A;  1XEY A;  3B46 A;  4IW7 A;  5G2P A;  3WX9 A;  4M2M A;  2AY9 A;  3FTB A;  3NYU A;  1B4X A;  2VMW A;  4WYF A;  1I29 A;  2VGS A;  3E2Y A;  3Q8N A;  4DGT A;  3BB8 A;  3USF A;  1B5P A;  3FFR A;  3WKS A;  3N4S A;  5F8V A;  2D7Y A;  2VI8 A;  3D6K A;  1B8G A;  3L8A A;  4JF0 A;  3E2Z B;  3PA9 A;  2Z1Z A;  4B98 A;  4N0W A;  2VMR A;  4UHO A;  2ORD A;  2W8T A;  1WYU A;  3VK3 A;  3JTX A;  3JW9 A;  1W7N A;  3HBX A;  4ADB A;  2W7D A;  1QIR A;  1IX6 A;  4UHM A;  1M7Y A;  4E1O A;  4WB0 B;  1CS1 A;  1AHX A;  3NTJ A;  3QM2 A;  2OQX A;  5EUE A;  3PDX A;  3NRA A;  5TF5 A;  4ZSY A;  3MKJ A;  3MBB A;  2W7F A;  5HHY A;  3LVL B;  4HF8 A;  1QIT A;  4BQ0 A;  1M0O A;  4IX8 A;  1CZE A;  3WY7 A;  3WGB A;  2GMU A;  2O7C A;  4ZM3 A;  1EJI A;  2YRR A;  1D2F A;  3FDB A;  3MAD A;  3NYT A;  4CXQ A;  1MGV A;  1TOI A;  4ZWV A;  2VMN A;  2EGY A;  2CH2 A;  2D63 A;  1AY4 A;  1VP4 A;  3PIU A;  4I8A A;  1TOJ A;  3CQ4 A;  1GC3 A;  3NX3 A;  4WP0 A;  1XI9 A;  1U08 A;  5G2Q A;  4R5F A;  1AKA A;  3JZL A;  4F5I A;  1E5F A;  4XJL A;  1TOK A;  2AY4 A;  1ARH A;  3A9Y A;  2CST A;  1OHY A;  2VMT A;  2BIG A;  2RFV A;  1I48 A;  4J8L A;  4N0B A;  2QA3 A;  2R5C B;  3EZS A;  2DR1 A;  1B9H A;  2DGK A;  2FNI A;  2QB3 A;  3A9X A;  3GET A;  3QPG A;  4W1V A;  4F5J A;  3ZZK A;  1YIY A;  1KL1 A;  4R5Z A;  5E5I A;  1M32 A;  2FQ6 A;  3PDB A;  4MQR A;  3FQ8 A;  2TPL A;  4WYC A;  3JWB A;  3HQT A;  1GBN A;  1ZOB A;  4XK1 A;  1VEF A;  5BJ4 A;  1JS6 A;  4OC9 A;  2V1P A;  1P3W A;  2AY6 A;  5E3K A;  2OAT A;  2ZSM A;  2VGT A;  2YHK A;  4WBT A;  5BJ3 A;  4A6R A;  3ATH A;  2C0R A;  2ZUK A;  1C7O A;  4JEW A;  5G4J A;  3DC1 A;  5C6U A;  2GQN A;  1W23 A;  2JJG A;  1YNU A;  1V2E A;  3FVS A;  3JU7 A;  3QGU A;  4FFC A;  5EQC A;  5M4B A;  1M6S A;  4AO9 A;  3TFT A;  1ZC9 A;  3GWP A;  1ASB A;  3ECD A;  1LC5 A;  2BIE A;  3EI6 A;  3MAF A;  4GRX A;  3FCR A;  1D7U A;  3WKR A;  2HP2 A;  1ELU A;  3WCO A;  4TMR A;  1M0P A;  3CQ5 A;  3K28 A;  2CTZ A;  1BJO A;  4R2N A;  4ZM4 A;  2VYC A;  3BCA A;  3DXW A;  4U2H A;  1AMQ A;  3JWA A;  3BWN A;  5IWQ A;  1ARS A;  3B1E A;  3G7Q A;  4IYO A;  2QMA A;  3PGY A;  2DKB A;  1S07 A;  2E7I A;  2VI9 A;  2VMP A;  3DOD A;  4WLH A;  1YJS A;  3L44 A;  1LC8 A;  2GSA A;  1LW5 A;  2YCT A;  1AKB A;  1TPL A;  1H1C A;  3BS8 A;  4WYE A;  2EZ2 A;  2R2N A;  2QSR A;  3DR7 A;  3TQX A;  2D61 A;  1WYU B;  1H0C A;  3FVX A;  3HLM A;  1EQB A;  1GD9 A;  2BYJ A;  2Z61 A;  3KGW A;  3QN6 A;  2PB0 A;  2D66 A;  4QGR A;  2DOU A;  1O61 A;  3E9K A;  3AV7 A;  4ZDO A;  3LWS A;  4ITX A;  1UKJ A;  5EFS A;  4OTL A;  3NU7 A;  4IXS A;  7AAT A;  3EIA A;  4A0R A;  3LV2 A;  2FYF A;  4CBR A;  1DGE A;  4WD2 A;  4F5L A;  3LY1 A;  3FZ6 A;  4GE4 A;  4OMA A;  5EIG A;  2CJD A;  1PMO A;  3R4T A;  1AHF A;  3NDN A;  4GSA A;  3DYD A;  2AAT A;  3KKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...