The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
ETELAFLYERDIYRLLAECDNSRNPDLGLIVRICLATGARWSEAETLTQSQVMPYKITFTNTKSKKNRTVPISDELFDMLPKKRGRLFNDAYESFENAVLRAEIELPKGQLTHVLRHTFASHFMMNGGNILVLKEILGHSTIEMTMRYAHFAPSHLESAVKFNPLSNPAQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Dna integration
|
molecule keywords |
HP1 INTEGRASE
|
publication title |
Molecular organization in site-specific recombination: the catalytic domain of bacteriophage HP1 integrase at 2.7 A resolution.
pubmed doi rcsb |
source organism |
Haemophilus phage hp1
|
total genus |
51
|
structure length |
170
|
sequence length |
170
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 1997-04-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00589 | Phage_integrase | Phage integrase family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | hpI Integrase; Chain A | Intergrase catalytic core |
#chains in the Genus database with same CATH superfamily 1PVR A; 1NZB A; 1XNS A; 1P4E C; 2HOF A; 2CRX A; 1M6X A; 1DRG A; 3C28 A; 1OUQ A; 3VCF A; 2A3V A; 4A8E A; 1Q3U A; 1Z19 A; 3NKH A; 1AE9 A; 1P4E A; 1Z1B A; 1MA7 A; 1P7D A; 2HOI A; 1PVQ A; 1Q3V A; 1KBU A; 3CRX A; 5C6K A; 1A0P A; 5DOR A; 1PVP A; 1FLO A; 4CRX A; 3MGV A; 1XO0 A; 1M6X C; 3UXU A; 1F44 A; 5DCF A; 5CRX A; 1AIH A; 3C29 A; 1CRX A; 4DKS A; #chains in the Genus database with same CATH topology 4F41 A; 1PVR A; 1NZB A; 4ACO A; 4E0G A; 1XNS A; 1P4E C; 2HOF A; 4E0P A; 2CRX A; 1M6X A; 1DRG A; 3C28 A; 4F43 A; 1OUQ A; 3VCF A; 4E0Z A; 2A3V A; 3T79 A; 4A8E A; 1Q3U A; 1Z19 A; 3NKH A; 4E0J A; 2V6E A; 1AE9 A; 1P4E A; 1Z1B A; 1MA7 A; 3SQI A; 1P7D A; 2HOI A; 1PVQ A; 1Q3V A; 4DWP A; 1KBU A; 3CRX A; 5C6K A; 1A0P A; 5DOR A; 1PVP A; 1FLO A; 4CRX A; 3MGV A; 1XO0 A; 1M6X C; 3UXU A; 4E10 A; 1F44 A; 5DCF A; 5CRX A; 1AIH A; 3C29 A; 1CRX A; 4DKS A; 4E0Y A; #chains in the Genus database with same CATH homology 1PVR A; 1NZB A; 1XNS A; 1P4E C; 2HOF A; 2CRX A; 1M6X A; 1DRG A; 3C28 A; 1OUQ A; 3VCF A; 2A3V A; 4A8E A; 1Q3U A; 1Z19 A; 3NKH A; 1AE9 A; 1P4E A; 1Z1B A; 1MA7 A; 1P7D A; 2HOI A; 1PVQ A; 1Q3V A; 1KBU A; 3CRX A; 5C6K A; 1A0P A; 5DOR A; 1PVP A; 1FLO A; 4CRX A; 3MGV A; 1XO0 A; 1M6X C; 3UXU A; 1F44 A; 5DCF A; 5CRX A; 1AIH A; 3C29 A; 1CRX A; 4DKS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...