1AIRA

Pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Refined Three-Dimensional Structure of Pectate Lyase E from Erwinia chrysanthemi at 2.2 A Resolution.
pubmed rcsb
molecule tags Pectate cleavage
molecule keywords PECTATE LYASE C
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1airA00
3JURA 1HG8A 2O0WA 2PYHA 2X6XA 4YZQA 2VBEA 4PMHA 1CZFA 2X85A 4MXNA 4OZZA 1QJVA 2NSTA 3B4NA 4EW9A 2Z8GA 3FY3A 4U4BA 3GQAA 3UW0A 1O8DA 2INUA 2VJJA 1KCDA 1O8EA 4XNFA 4W8QA 3B8YA 4Z03A 4OZYA 1DBOA 4XKWA 3EQNA 3KRGA 2O04A 1KTWA 2NTPA 3GQ9A 3GQ8A 1PXZA 1O8KA 3GQ7A 3VSUA 2O0VA 1O8LA 4OJLA 3VMVA 4U49A 4XORA 4W8SA 1DBGA 1IDJA 1WMRA 4XN3A 4XONA 4YZAA 4XQFA 4XM3A 2EWEA 2NSPA 4OJOA 1BHEA 1OFMA 2PECA 4W8TA 4C2LA 2NT9A 2UVFA 1PLUA 4Z06A 2O17A 1RMGA 4XN0A 4OJ6A 2BSPA 1O88A 2X6WA 1IA5A 4XOPA 1PE9A 1XG2A 1H80A 1X0CA 3B90A 4Z05A 3VMWA 2VJIA 2O1DA 4NK6A 4XLAA 1RWRA 1OOCA 2VBKA 1BN8A 4XKVA 2UVEA 2X6YA 1O8JA 1O8GA 4XR6A 1JRGA 1KCCA 2PYGA 4XLEA 2X3HA 4W8RA 1O8IA 2INVA 4HWVA 4MR0A 4YEJA 1IB4A 3GRHA 3WWGA 4YZXA 4YELA 3ZPPA 1QCXA 4XL9A 1O8FA 4XLCA 2NT6A 2QXZA 1AIRA 3EQOA 3T9GA 1O8HA 4XOTA 3ZSCA 1K5CA 1RU4A 1OGMX 2NZMA 3LMWA 3SUCA 4XMYA 4XLFA 2QX3A 2VBMA 4NK8A 4URRA 2NTQA 1O8MA 4XLHA 4I84A 2NTBA 1GQ8A 5AMVA 4YZ0A 2QY1A 4OJPA 2IQ7A 1EE6A 4AVZA 5C1CA 1JTAA 2ODLA 3VSVA 3VSTA 4OJ5A 1NHCA 1VBLA 1IDKA 5C1EA 1OFLA 1OGOX
chains in the Genus database with same CATH superfamily
3JURA 1HG8A 2O0WA 2PYHA 2X6XA 2B0RA 4YZQA 1EA0A 2VBEA 2VFPA 3LYCA 1QQ1A 1CZFA 2X85A 4MXNA 4PMHA 1L1IA 4OZZA 1QJVA 2NSTA 3B4NA 1TYWA 4EW9A 3JX8A 2Z8GA 3FY3A 4U4BA 1LLWA 3GQAA 3UW0A 1O8DA 2XT2A 1QA2A 2INUA 2VJJA 2BM7A 1KCDA 1O8EA 4XNFA 3NB2A 4W8QA 3B8YA 4Z03A 4OZYA 2XT4A 1DBOA 4XKWA 3EQNA 3H09A 3KRGA 3SYJA 2BM5A 2O04A 1KTWA 2BM6A 2NTPA 3GQ9A 3GQ8A 1EZGA 1WXRA 1PXZA 1O8KA 3GQ7A 3VSUA 2O0VA 3RIQA 1QA1A 2XTWA 3PSSA 5JMCB 1TYXA 1O8LA 4OJLA 3VMVA 4U49A 4XORA 4W8SA 1DBGA 2YUHA 2VFNA 1IDJA 1WMRA 1LM1A 4XN3A 4XONA 4YZAA 4XQFA 4XM3A 2EWEA 1DABA 2NSPA 4OJOA 1BHEA 1OFMA 2PECA 4KH3A 4YDTA 2XC1A 3BH6B 4W8TA 2NT9A 2UVFA 4C2LA 1PLUA 4Z06A 2O17A 3SY2A 1RMGA 3TH0A 1TSPA 4XN0A 2XTYA 4OJ6A 2BSPA 1O88A 2X6WA 1IA5A 4XOPA 1PE9A 1XG2A 1H80A 1X0CA 1OFDA 3B90A 3LJYA 4Z05A 3VMWA 1OFEA 4OM9A 2O1DA 2VJIA 4NK6A 1QA3A 1QRBA 4XLAA 1RWRA 1OOCA 2VBKA 1BN8A 4XKVA 2UVEA 2X6YA 1O8JA 1O8GA 4XR6A 1JRGA 1KCCA 2PYGA 4XLEA 2X3HA 4W8RA 1O8IA 3NAWA 2INVA 2VFMA 3ML3A 1HF2A 4HWVA 4MR0A 4YEJA 1IB4A 3SQVA 1LLZA 3GRHA 4V02C 2QYUA 3WWGA 4YZXA 2QZAA 4YELA 3ZPPA 4YFOA 1QCXA 4XL9A 1O8FA 4XLCA 3N6ZA 2NT6A 2QXZA 3AK5A 1AIRA 2BX6A 3EQOA 4YCQA 1O8HA 4XOTA 3T9GA 3ZSCA 1K5CA 2VFOA 3SZEA 1RU4A 1OGMX 2G0YA 2NZMA 3LMWA 4YC5A 5DNSA 3SUCA 4XMYA 5JLVC 4XLFA 3N90A 2QX3A 3P4GA 2VBMA 1KQ5A 1K8FA 4NK8A 1CLWA 4URRA 2NTQA 1O8MA 4YEIA 2V5IA 4XLHA 4OPWA 3PETA 2J8KA 2NTBA 4I84A 1GQ8A 5AMVA 4YZ0A 2QY1A 4OJPA 2IQ7A 1EE6A 1K4ZA 1QRCA 2XTXA 3PSZA 1TYVA 3BH7B 4AVZA 5C1CA 1JTAA 2IOUG 2ODLA 4JRAC 3VSTA 2J8IA 3VSVA 1TYUA 4OJ5A 2VFQA 1NHCA 1VBLA 2W7ZA 2O6WA 1IDKA 3DU1X 2F3LA 5C1EA 2BM4A 1OFLA 1OGOX
chains in the Genus database with same CATH topology
3JURA 1HG8A 2O0WA 2PYHA 2X6XA 4YZQA 2VBEA 4PMHA 1CZFA 2X85A 4MXNA 4OZZA 1QJVA 2NSTA 3B4NA 4EW9A 2Z8GA 3FY3A 4U4BA 3GQAA 3UW0A 1O8DA 2INUA 2VJJA 1KCDA 1O8EA 4XNFA 4W8QA 3B8YA 4Z03A 4OZYA 1DBOA 4XKWA 3EQNA 3KRGA 2O04A 1KTWA 2NTPA 3GQ9A 3GQ8A 1PXZA 1O8KA 3GQ7A 3VSUA 2O0VA 1O8LA 4OJLA 3VMVA 4U49A 4XORA 4W8SA 1DBGA 1IDJA 1WMRA 4XN3A 4XONA 4YZAA 4XQFA 4XM3A 2EWEA 2NSPA 4OJOA 1BHEA 1OFMA 2PECA 4W8TA 4C2LA 2NT9A 2UVFA 1PLUA 4Z06A 2O17A 1RMGA 4XN0A 4OJ6A 2BSPA 1O88A 2X6WA 1IA5A 4XOPA 1PE9A 1XG2A 1H80A 1X0CA 3B90A 4Z05A 3VMWA 2VJIA 2O1DA 4NK6A 4XLAA 1RWRA 1OOCA 2VBKA 1BN8A 4XKVA 2UVEA 2X6YA 1O8JA 1O8GA 4XR6A 1JRGA 1KCCA 2PYGA 4XLEA 2X3HA 4W8RA 1O8IA 2INVA 4HWVA 4MR0A 4YEJA 1IB4A 3GRHA 3WWGA 4YZXA 4YELA 3ZPPA 1QCXA 4XL9A 1O8FA 4XLCA 2NT6A 2QXZA 1AIRA 3EQOA 3T9GA 1O8HA 4XOTA 3ZSCA 1K5CA 1RU4A 1OGMX 2NZMA 3LMWA 3SUCA 4XMYA 4XLFA 2QX3A 2VBMA 4NK8A 4URRA 2NTQA 1O8MA 4XLHA 4I84A 2NTBA 1GQ8A 5AMVA 4YZ0A 2QY1A 4OJPA 2IQ7A 1EE6A 4AVZA 5C1CA 1JTAA 2ODLA 3VSVA 3VSTA 4OJ5A 1NHCA 1VBLA 1IDKA 5C1EA 1OFLA 1OGOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUR A;  1HG8 A;  2O0W A;  2PYH A;  2X6X A;  4YZQ A;  2VBE A;  4PMH A;  1CZF A;  2X85 A;  4MXN A;  4OZZ A;  1QJV A;  2NST A;  3B4N A;  4EW9 A;  2Z8G A;  3FY3 A;  4U4B A;  3GQA A;  3UW0 A;  1O8D A;  2INU A;  2VJJ A;  1KCD A;  1O8E A;  4XNF A;  4W8Q A;  3B8Y A;  4Z03 A;  4OZY A;  1DBO A;  4XKW A;  3EQN A;  3KRG A;  2O04 A;  1KTW A;  2NTP A;  3GQ9 A;  3GQ8 A;  1PXZ A;  1O8K A;  3GQ7 A;  3VSU A;  2O0V A;  1O8L A;  4OJL A;  3VMV A;  4U49 A;  4XOR A;  4W8S A;  1DBG A;  1IDJ A;  1WMR A;  4XN3 A;  4XON A;  4YZA A;  4XQF A;  4XM3 A;  2EWE A;  2NSP A;  4OJO A;  1BHE A;  1OFM A;  2PEC A;  4W8T A;  4C2L A;  2NT9 A;  2UVF A;  1PLU A;  4Z06 A;  2O17 A;  1RMG A;  4XN0 A;  4OJ6 A;  2BSP A;  1O88 A;  2X6W A;  1IA5 A;  4XOP A;  1PE9 A;  1XG2 A;  1H80 A;  1X0C A;  3B90 A;  4Z05 A;  3VMW A;  2VJI A;  2O1D A;  4NK6 A;  4XLA A;  1RWR A;  1OOC A;  2VBK A;  1BN8 A;  4XKV A;  2UVE A;  2X6Y A;  1O8J A;  1O8G A;  4XR6 A;  1JRG A;  1KCC A;  2PYG A;  4XLE A;  2X3H A;  4W8R A;  1O8I A;  2INV A;  4HWV A;  4MR0 A;  4YEJ A;  1IB4 A;  3GRH A;  3WWG A;  4YZX A;  4YEL A;  3ZPP A;  1QCX A;  4XL9 A;  1O8F A;  4XLC A;  2NT6 A;  2QXZ A;  1AIR A;  3EQO A;  3T9G A;  1O8H A;  4XOT A;  3ZSC A;  1K5C A;  1RU4 A;  1OGM X;  2NZM A;  3LMW A;  3SUC A;  4XMY A;  4XLF A;  2QX3 A;  2VBM A;  4NK8 A;  4URR A;  2NTQ A;  1O8M A;  4XLH A;  4I84 A;  2NTB A;  1GQ8 A;  5AMV A;  4YZ0 A;  2QY1 A;  4OJP A;  2IQ7 A;  1EE6 A;  4AVZ A;  5C1C A;  1JTA A;  2ODL A;  3VSV A;  3VST A;  4OJ5 A;  1NHC A;  1VBL A;  1IDK A;  5C1E A;  1OFL A;  1OGO X; 
#chains in the Genus database with same CATH topology
 3JUR A;  1HG8 A;  2O0W A;  2PYH A;  2X6X A;  2B0R A;  4YZQ A;  1EA0 A;  2VBE A;  2VFP A;  3LYC A;  1QQ1 A;  1CZF A;  2X85 A;  4MXN A;  4PMH A;  1L1I A;  4OZZ A;  1QJV A;  2NST A;  3B4N A;  1TYW A;  4EW9 A;  3JX8 A;  2Z8G A;  3FY3 A;  4U4B A;  1LLW A;  3GQA A;  3UW0 A;  1O8D A;  2XT2 A;  1QA2 A;  2INU A;  2VJJ A;  2BM7 A;  1KCD A;  1O8E A;  4XNF A;  3NB2 A;  4W8Q A;  3B8Y A;  4Z03 A;  4OZY A;  2XT4 A;  1DBO A;  4XKW A;  3EQN A;  3H09 A;  3KRG A;  3SYJ A;  2BM5 A;  2O04 A;  1KTW A;  2BM6 A;  2NTP A;  3GQ9 A;  3GQ8 A;  1EZG A;  1WXR A;  1PXZ A;  1O8K A;  3GQ7 A;  3VSU A;  2O0V A;  3RIQ A;  1QA1 A;  2XTW A;  3PSS A;  5JMC B;  1TYX A;  1O8L A;  4OJL A;  3VMV A;  4U49 A;  4XOR A;  4W8S A;  1DBG A;  2YUH A;  2VFN A;  1IDJ A;  1WMR A;  1LM1 A;  4XN3 A;  4XON A;  4YZA A;  4XQF A;  4XM3 A;  2EWE A;  1DAB A;  2NSP A;  4OJO A;  1BHE A;  1OFM A;  2PEC A;  4KH3 A;  4YDT A;  2XC1 A;  3BH6 B;  4W8T A;  2NT9 A;  2UVF A;  4C2L A;  1PLU A;  4Z06 A;  2O17 A;  3SY2 A;  1RMG A;  3TH0 A;  1TSP A;  4XN0 A;  2XTY A;  4OJ6 A;  2BSP A;  1O88 A;  2X6W A;  1IA5 A;  4XOP A;  1PE9 A;  1XG2 A;  1H80 A;  1X0C A;  1OFD A;  3B90 A;  3LJY A;  4Z05 A;  3VMW A;  1OFE A;  4OM9 A;  2O1D A;  2VJI A;  4NK6 A;  1QA3 A;  1QRB A;  4XLA A;  1RWR A;  1OOC A;  2VBK A;  1BN8 A;  4XKV A;  2UVE A;  2X6Y A;  1O8J A;  1O8G A;  4XR6 A;  1JRG A;  1KCC A;  2PYG A;  4XLE A;  2X3H A;  4W8R A;  1O8I A;  3NAW A;  2INV A;  2VFM A;  3ML3 A;  1HF2 A;  4HWV A;  4MR0 A;  4YEJ A;  1IB4 A;  3SQV A;  1LLZ A;  3GRH A;  4V02 C;  2QYU A;  3WWG A;  4YZX A;  2QZA A;  4YEL A;  3ZPP A;  4YFO A;  1QCX A;  4XL9 A;  1O8F A;  4XLC A;  3N6Z A;  2NT6 A;  2QXZ A;  3AK5 A;  1AIR A;  2BX6 A;  3EQO A;  4YCQ A;  1O8H A;  4XOT A;  3T9G A;  3ZSC A;  1K5C A;  2VFO A;  3SZE A;  1RU4 A;  1OGM X;  2G0Y A;  2NZM A;  3LMW A;  4YC5 A;  5DNS A;  3SUC A;  4XMY A;  5JLV C;  4XLF A;  3N90 A;  2QX3 A;  3P4G A;  2VBM A;  1KQ5 A;  1K8F A;  4NK8 A;  1CLW A;  4URR A;  2NTQ A;  1O8M A;  4YEI A;  2V5I A;  4XLH A;  4OPW A;  3PET A;  2J8K A;  2NTB A;  4I84 A;  1GQ8 A;  5AMV A;  4YZ0 A;  2QY1 A;  4OJP A;  2IQ7 A;  1EE6 A;  1K4Z A;  1QRC A;  2XTX A;  3PSZ A;  1TYV A;  3BH7 B;  4AVZ A;  5C1C A;  1JTA A;  2IOU G;  2ODL A;  4JRA C;  3VST A;  2J8I A;  3VSV A;  1TYU A;  4OJ5 A;  2VFQ A;  1NHC A;  1VBL A;  2W7Z A;  2O6W A;  1IDK A;  3DU1 X;  2F3L A;  5C1E A;  2BM4 A;  1OFL A;  1OGO X; 
#chains in the Genus database with same CATH homology
 3JUR A;  1HG8 A;  2O0W A;  2PYH A;  2X6X A;  4YZQ A;  2VBE A;  4PMH A;  1CZF A;  2X85 A;  4MXN A;  4OZZ A;  1QJV A;  2NST A;  3B4N A;  4EW9 A;  2Z8G A;  3FY3 A;  4U4B A;  3GQA A;  3UW0 A;  1O8D A;  2INU A;  2VJJ A;  1KCD A;  1O8E A;  4XNF A;  4W8Q A;  3B8Y A;  4Z03 A;  4OZY A;  1DBO A;  4XKW A;  3EQN A;  3KRG A;  2O04 A;  1KTW A;  2NTP A;  3GQ9 A;  3GQ8 A;  1PXZ A;  1O8K A;  3GQ7 A;  3VSU A;  2O0V A;  1O8L A;  4OJL A;  3VMV A;  4U49 A;  4XOR A;  4W8S A;  1DBG A;  1IDJ A;  1WMR A;  4XN3 A;  4XON A;  4YZA A;  4XQF A;  4XM3 A;  2EWE A;  2NSP A;  4OJO A;  1BHE A;  1OFM A;  2PEC A;  4W8T A;  4C2L A;  2NT9 A;  2UVF A;  1PLU A;  4Z06 A;  2O17 A;  1RMG A;  4XN0 A;  4OJ6 A;  2BSP A;  1O88 A;  2X6W A;  1IA5 A;  4XOP A;  1PE9 A;  1XG2 A;  1H80 A;  1X0C A;  3B90 A;  4Z05 A;  3VMW A;  2VJI A;  2O1D A;  4NK6 A;  4XLA A;  1RWR A;  1OOC A;  2VBK A;  1BN8 A;  4XKV A;  2UVE A;  2X6Y A;  1O8J A;  1O8G A;  4XR6 A;  1JRG A;  1KCC A;  2PYG A;  4XLE A;  2X3H A;  4W8R A;  1O8I A;  2INV A;  4HWV A;  4MR0 A;  4YEJ A;  1IB4 A;  3GRH A;  3WWG A;  4YZX A;  4YEL A;  3ZPP A;  1QCX A;  4XL9 A;  1O8F A;  4XLC A;  2NT6 A;  2QXZ A;  1AIR A;  3EQO A;  3T9G A;  1O8H A;  4XOT A;  3ZSC A;  1K5C A;  1RU4 A;  1OGM X;  2NZM A;  3LMW A;  3SUC A;  4XMY A;  4XLF A;  2QX3 A;  2VBM A;  4NK8 A;  4URR A;  2NTQ A;  1O8M A;  4XLH A;  4I84 A;  2NTB A;  1GQ8 A;  5AMV A;  4YZ0 A;  2QY1 A;  4OJP A;  2IQ7 A;  1EE6 A;  4AVZ A;  5C1C A;  1JTA A;  2ODL A;  3VSV A;  3VST A;  4OJ5 A;  1NHC A;  1VBL A;  1IDK A;  5C1E A;  1OFL A;  1OGO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...