1AIRA

Pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Refined Three-Dimensional Structure of Pectate Lyase E from Erwinia chrysanthemi at 2.2 A Resolution.
pubmed rcsb
molecule tags Pectate cleavage
molecule keywords PECTATE LYASE C
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1airA00
3UW0A 4XN0A 1JRGA 4W8RA 4XKWA 4XLEA 1KTWA 3VSTA 2NTQA 4XLHA 4XN3A 4XM3A 4XORA 4YEJA 3ZPPA 2UVEA 1VBLA 1RWRA 4HWVA 3EQOA 1O8IA 1O8GA 3VMVA 2INUA 3B8YA 2VBEA 2X6YA 4PMHA 2ODLA 2X6WA 3FY3A 1JTAA 2VBMA 1O88A 3ZSCA 4XONA 4XOPA 3VSVA 2Z8GA 1PLUA 5AMVA 4XQFA 5C1EA 3B90A 2O17A 1NHCA 1H80A 1AIRA 1OFMA 1O8HA 1EE6A 2NT6A 4XLAA 2O04A 1OFLA 1RU4A 3GQ9A 1IDJA 2NZMA 4W8QA 4XMYA 3VSUA 1PXZA 4OJ6A 3GQ7A 4OJOA 1OGOX 4OJPA 3T9GA 4W8SA 2O1DA 2O0VA 4YZ0A 2NT9A 5C1CA 1O8DA 4XL9A 2BSPA 3VMWA 4YZQA 1IB4A 4OZZA 2X3HA 1O8LA 1XG2A 3GQAA 4I84A 1RMGA 2PYHA 1PE9A 1O8EA 4U4BA 1O8KA 4XNFA 4AVZA 1HG8A 1O8FA 1IA5A 3GRHA 3B4NA 2QX3A 1QJVA 2NSTA 4EW9A 2X6XA 1KCDA 1KCCA 4OJ5A 4OZYA 2PYGA 3WWGA 1GQ8A 3JURA 4XKVA 4URRA 2X85A 3LMWA 3KRGA 4C2LA 2PECA 1OGMX 4NK6A 1QCXA 2NTPA 4U49A 4OJLA 1BHEA 2EWEA 2UVFA 4Z03A 1DBGA 4MR0A 4W8TA 1X0CA 1OOCA 4XR6A 3EQNA 2QY1A 4MXNA 4XLFA 2IQ7A 4NK8A 4YZAA 2INVA 1BN8A 1WMRA 2VBKA 4Z06A 1CZFA 2NSPA 2NTBA 1IDKA 4YZXA 1K5CA 3SUCA 2VJIA 4XOTA 2VJJA 1O8MA 4XLCA 1DBOA 4Z05A 3GQ8A 2O0WA 4YELA 1O8JA 2QXZA
chains in the Genus database with same CATH superfamily
3UW0A 4YCQA 2BM5A 4XN0A 1JRGA 4W8RA 1K8FA 4XKWA 4XLEA 1KTWA 3VSTA 2NTQA 4XLHA 4XN3A 4XM3A 4XORA 4YEJA 3SQVA 5DNSA 3P4GA 3TH0A 3ZPPA 2UVEA 1VBLA 2VFQA 1RWRA 4HWVA 3PSSA 3BH6B 3EQOA 1O8IA 1O8GA 5JMCB 3N90A 3VMVA 2INUA 3DU1X 2V5IA 2VBEA 2X6YA 3B8YA 4PMHA 2ODLA 1QRCA 2X6WA 3FY3A 1TYWA 1JTAA 2VBMA 1O88A 3ZSCA 4XONA 4XOPA 3VSVA 1DABA 1EA0A 2Z8GA 1PLUA 5AMVA 4XQFA 5C1EA 3B90A 2O17A 1QA3A 1NHCA 3NAWA 2QYUA 2VFNA 1H80A 1AIRA 1OFMA 1O8HA 1EE6A 2NT6A 4XLAA 4KH3A 2O04A 4YDTA 1QA1A 1CLWA 1OFLA 1RU4A 3GQ9A 3ML3A 1IDJA 2NZMA 4W8QA 4XMYA 3VSUA 1QRBA 1LM1A 3LYCA 1PXZA 3LJYA 3GQ7A 2XTYA 4OJ6A 4OJOA 1OGOX 3SYJA 1TYUA 4OJPA 3T9GA 2VFPA 4W8SA 1KQ5A 3PETA 2O1DA 2O0VA 4YZ0A 2NT9A 5C1CA 1O8DA 3PSZA 4XL9A 1WXRA 2BSPA 3JX8A 3VMWA 4YC5A 2F3LA 4YZQA 2BM6A 1LLZA 1IB4A 4OZZA 2X3HA 1O8LA 1XG2A 3GQAA 1TYVA 4I84A 1RMGA 2VFMA 2PYHA 2G0YA 4YFOA 1PE9A 1O8EA 2BM7A 1O8KA 1OFDA 4U4BA 4XNFA 4AVZA 1HG8A 1O8FA 1IA5A 3AK5A 2BM4A 3GRHA 3B4NA 2QX3A 1QJVA 4OM9A 3SZEA 2QZAA 3NB2A 2NSTA 2VFOA 4EW9A 2X6XA 1KCDA 1KCCA 4OJ5A 1TSPA 4OZYA 2PYGA 3WWGA 1GQ8A 1K4ZA 3JURA 4XKVA 2O6WA 4URRA 1OFEA 3SY2A 2X85A 3LMWA 3KRGA 2YUHA 4C2LA 1OGMX 2PECA 4YEIA 4NK6A 1QCXA 2XC1A 2NTPA 4U49A 2XT4A 2XT2A 1LLWA 4OJLA 5JLVC 1BHEA 2EWEA 2UVFA 2XTXA 4Z03A 1DBGA 4MR0A 2J8KA 4W8TA 3RIQA 3H09A 1X0CA 2J8IA 2B0RA 1OOCA 4XR6A 3EQNA 2QY1A 4MXNA 1QA2A 4XLFA 1QQ1A 2IQ7A 4NK8A 2INVA 3BH7B 2IOUG 4YZAA 1BN8A 4JRAC 1WMRA 2W7ZA 1HF2A 2VBKA 4Z06A 1CZFA 2NSPA 1EZGA 1IDKA 1TYXA 2NTBA 2XTWA 4YZXA 1K5CA 3SUCA 2VJIA 1L1IA 4XOTA 4OPWA 4V02C 2VJJA 1O8MA 3N6ZA 1DBOA 4XLCA 4Z05A 3GQ8A 2O0WA 4YELA 1O8JA 2BX6A 2QXZA
chains in the Genus database with same CATH topology
3UW0A 4XN0A 1JRGA 4W8RA 4XKWA 4XLEA 1KTWA 3VSTA 2NTQA 4XLHA 4XN3A 4XM3A 4XORA 4YEJA 3ZPPA 2UVEA 1VBLA 1RWRA 4HWVA 3EQOA 1O8IA 1O8GA 3VMVA 2INUA 3B8YA 2VBEA 2X6YA 4PMHA 2ODLA 2X6WA 3FY3A 1JTAA 2VBMA 1O88A 3ZSCA 4XONA 4XOPA 3VSVA 2Z8GA 1PLUA 5AMVA 4XQFA 5C1EA 3B90A 2O17A 1NHCA 1H80A 1AIRA 1OFMA 1O8HA 1EE6A 2NT6A 4XLAA 2O04A 1OFLA 1RU4A 3GQ9A 1IDJA 2NZMA 4W8QA 4XMYA 3VSUA 1PXZA 4OJ6A 3GQ7A 4OJOA 1OGOX 4OJPA 3T9GA 4W8SA 2O1DA 2O0VA 4YZ0A 2NT9A 5C1CA 1O8DA 4XL9A 2BSPA 3VMWA 4YZQA 1IB4A 4OZZA 2X3HA 1O8LA 1XG2A 3GQAA 4I84A 1RMGA 2PYHA 1PE9A 1O8EA 4U4BA 1O8KA 4XNFA 4AVZA 1HG8A 1O8FA 1IA5A 3GRHA 3B4NA 2QX3A 1QJVA 2NSTA 4EW9A 2X6XA 1KCDA 1KCCA 4OJ5A 4OZYA 2PYGA 3WWGA 1GQ8A 3JURA 4XKVA 4URRA 2X85A 3LMWA 3KRGA 4C2LA 2PECA 1OGMX 4NK6A 1QCXA 2NTPA 4U49A 4OJLA 1BHEA 2EWEA 2UVFA 4Z03A 1DBGA 4MR0A 4W8TA 1X0CA 1OOCA 4XR6A 3EQNA 2QY1A 4MXNA 4XLFA 2IQ7A 4NK8A 4YZAA 2INVA 1BN8A 1WMRA 2VBKA 4Z06A 1CZFA 2NSPA 2NTBA 1IDKA 4YZXA 1K5CA 3SUCA 2VJIA 4XOTA 2VJJA 1O8MA 4XLCA 1DBOA 4Z05A 3GQ8A 2O0WA 4YELA 1O8JA 2QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW0 A;  4XN0 A;  1JRG A;  4W8R A;  4XKW A;  4XLE A;  1KTW A;  3VST A;  2NTQ A;  4XLH A;  4XN3 A;  4XM3 A;  4XOR A;  4YEJ A;  3ZPP A;  2UVE A;  1VBL A;  1RWR A;  4HWV A;  3EQO A;  1O8I A;  1O8G A;  3VMV A;  2INU A;  3B8Y A;  2VBE A;  2X6Y A;  4PMH A;  2ODL A;  2X6W A;  3FY3 A;  1JTA A;  2VBM A;  1O88 A;  3ZSC A;  4XON A;  4XOP A;  3VSV A;  2Z8G A;  1PLU A;  5AMV A;  4XQF A;  5C1E A;  3B90 A;  2O17 A;  1NHC A;  1H80 A;  1AIR A;  1OFM A;  1O8H A;  1EE6 A;  2NT6 A;  4XLA A;  2O04 A;  1OFL A;  1RU4 A;  3GQ9 A;  1IDJ A;  2NZM A;  4W8Q A;  4XMY A;  3VSU A;  1PXZ A;  4OJ6 A;  3GQ7 A;  4OJO A;  1OGO X;  4OJP A;  3T9G A;  4W8S A;  2O1D A;  2O0V A;  4YZ0 A;  2NT9 A;  5C1C A;  1O8D A;  4XL9 A;  2BSP A;  3VMW A;  4YZQ A;  1IB4 A;  4OZZ A;  2X3H A;  1O8L A;  1XG2 A;  3GQA A;  4I84 A;  1RMG A;  2PYH A;  1PE9 A;  1O8E A;  4U4B A;  1O8K A;  4XNF A;  4AVZ A;  1HG8 A;  1O8F A;  1IA5 A;  3GRH A;  3B4N A;  2QX3 A;  1QJV A;  2NST A;  4EW9 A;  2X6X A;  1KCD A;  1KCC A;  4OJ5 A;  4OZY A;  2PYG A;  3WWG A;  1GQ8 A;  3JUR A;  4XKV A;  4URR A;  2X85 A;  3LMW A;  3KRG A;  4C2L A;  2PEC A;  1OGM X;  4NK6 A;  1QCX A;  2NTP A;  4U49 A;  4OJL A;  1BHE A;  2EWE A;  2UVF A;  4Z03 A;  1DBG A;  4MR0 A;  4W8T A;  1X0C A;  1OOC A;  4XR6 A;  3EQN A;  2QY1 A;  4MXN A;  4XLF A;  2IQ7 A;  4NK8 A;  4YZA A;  2INV A;  1BN8 A;  1WMR A;  2VBK A;  4Z06 A;  1CZF A;  2NSP A;  2NTB A;  1IDK A;  4YZX A;  1K5C A;  3SUC A;  2VJI A;  4XOT A;  2VJJ A;  1O8M A;  4XLC A;  1DBO A;  4Z05 A;  3GQ8 A;  2O0W A;  4YEL A;  1O8J A;  2QXZ A; 
#chains in the Genus database with same CATH topology
 3UW0 A;  4YCQ A;  2BM5 A;  4XN0 A;  1JRG A;  4W8R A;  1K8F A;  4XKW A;  4XLE A;  1KTW A;  3VST A;  2NTQ A;  4XLH A;  4XN3 A;  4XM3 A;  4XOR A;  4YEJ A;  3SQV A;  5DNS A;  3P4G A;  3TH0 A;  3ZPP A;  2UVE A;  1VBL A;  2VFQ A;  1RWR A;  4HWV A;  3PSS A;  3BH6 B;  3EQO A;  1O8I A;  1O8G A;  5JMC B;  3N90 A;  3VMV A;  2INU A;  3DU1 X;  2V5I A;  2VBE A;  2X6Y A;  3B8Y A;  4PMH A;  2ODL A;  1QRC A;  2X6W A;  3FY3 A;  1TYW A;  1JTA A;  2VBM A;  1O88 A;  3ZSC A;  4XON A;  4XOP A;  3VSV A;  1DAB A;  1EA0 A;  2Z8G A;  1PLU A;  5AMV A;  4XQF A;  5C1E A;  3B90 A;  2O17 A;  1QA3 A;  1NHC A;  3NAW A;  2QYU A;  2VFN A;  1H80 A;  1AIR A;  1OFM A;  1O8H A;  1EE6 A;  2NT6 A;  4XLA A;  4KH3 A;  2O04 A;  4YDT A;  1QA1 A;  1CLW A;  1OFL A;  1RU4 A;  3GQ9 A;  3ML3 A;  1IDJ A;  2NZM A;  4W8Q A;  4XMY A;  3VSU A;  1QRB A;  1LM1 A;  3LYC A;  1PXZ A;  3LJY A;  3GQ7 A;  2XTY A;  4OJ6 A;  4OJO A;  1OGO X;  3SYJ A;  1TYU A;  4OJP A;  3T9G A;  2VFP A;  4W8S A;  1KQ5 A;  3PET A;  2O1D A;  2O0V A;  4YZ0 A;  2NT9 A;  5C1C A;  1O8D A;  3PSZ A;  4XL9 A;  1WXR A;  2BSP A;  3JX8 A;  3VMW A;  4YC5 A;  2F3L A;  4YZQ A;  2BM6 A;  1LLZ A;  1IB4 A;  4OZZ A;  2X3H A;  1O8L A;  1XG2 A;  3GQA A;  1TYV A;  4I84 A;  1RMG A;  2VFM A;  2PYH A;  2G0Y A;  4YFO A;  1PE9 A;  1O8E A;  2BM7 A;  1O8K A;  1OFD A;  4U4B A;  4XNF A;  4AVZ A;  1HG8 A;  1O8F A;  1IA5 A;  3AK5 A;  2BM4 A;  3GRH A;  3B4N A;  2QX3 A;  1QJV A;  4OM9 A;  3SZE A;  2QZA A;  3NB2 A;  2NST A;  2VFO A;  4EW9 A;  2X6X A;  1KCD A;  1KCC A;  4OJ5 A;  1TSP A;  4OZY A;  2PYG A;  3WWG A;  1GQ8 A;  1K4Z A;  3JUR A;  4XKV A;  2O6W A;  4URR A;  1OFE A;  3SY2 A;  2X85 A;  3LMW A;  3KRG A;  2YUH A;  4C2L A;  1OGM X;  2PEC A;  4YEI A;  4NK6 A;  1QCX A;  2XC1 A;  2NTP A;  4U49 A;  2XT4 A;  2XT2 A;  1LLW A;  4OJL A;  5JLV C;  1BHE A;  2EWE A;  2UVF A;  2XTX A;  4Z03 A;  1DBG A;  4MR0 A;  2J8K A;  4W8T A;  3RIQ A;  3H09 A;  1X0C A;  2J8I A;  2B0R A;  1OOC A;  4XR6 A;  3EQN A;  2QY1 A;  4MXN A;  1QA2 A;  4XLF A;  1QQ1 A;  2IQ7 A;  4NK8 A;  2INV A;  3BH7 B;  2IOU G;  4YZA A;  1BN8 A;  4JRA C;  1WMR A;  2W7Z A;  1HF2 A;  2VBK A;  4Z06 A;  1CZF A;  2NSP A;  1EZG A;  1IDK A;  1TYX A;  2NTB A;  2XTW A;  4YZX A;  1K5C A;  3SUC A;  2VJI A;  1L1I A;  4XOT A;  4OPW A;  4V02 C;  2VJJ A;  1O8M A;  3N6Z A;  1DBO A;  4XLC A;  4Z05 A;  3GQ8 A;  2O0W A;  4YEL A;  1O8J A;  2BX6 A;  2QXZ A; 
#chains in the Genus database with same CATH homology
 3UW0 A;  4XN0 A;  1JRG A;  4W8R A;  4XKW A;  4XLE A;  1KTW A;  3VST A;  2NTQ A;  4XLH A;  4XN3 A;  4XM3 A;  4XOR A;  4YEJ A;  3ZPP A;  2UVE A;  1VBL A;  1RWR A;  4HWV A;  3EQO A;  1O8I A;  1O8G A;  3VMV A;  2INU A;  3B8Y A;  2VBE A;  2X6Y A;  4PMH A;  2ODL A;  2X6W A;  3FY3 A;  1JTA A;  2VBM A;  1O88 A;  3ZSC A;  4XON A;  4XOP A;  3VSV A;  2Z8G A;  1PLU A;  5AMV A;  4XQF A;  5C1E A;  3B90 A;  2O17 A;  1NHC A;  1H80 A;  1AIR A;  1OFM A;  1O8H A;  1EE6 A;  2NT6 A;  4XLA A;  2O04 A;  1OFL A;  1RU4 A;  3GQ9 A;  1IDJ A;  2NZM A;  4W8Q A;  4XMY A;  3VSU A;  1PXZ A;  4OJ6 A;  3GQ7 A;  4OJO A;  1OGO X;  4OJP A;  3T9G A;  4W8S A;  2O1D A;  2O0V A;  4YZ0 A;  2NT9 A;  5C1C A;  1O8D A;  4XL9 A;  2BSP A;  3VMW A;  4YZQ A;  1IB4 A;  4OZZ A;  2X3H A;  1O8L A;  1XG2 A;  3GQA A;  4I84 A;  1RMG A;  2PYH A;  1PE9 A;  1O8E A;  4U4B A;  1O8K A;  4XNF A;  4AVZ A;  1HG8 A;  1O8F A;  1IA5 A;  3GRH A;  3B4N A;  2QX3 A;  1QJV A;  2NST A;  4EW9 A;  2X6X A;  1KCD A;  1KCC A;  4OJ5 A;  4OZY A;  2PYG A;  3WWG A;  1GQ8 A;  3JUR A;  4XKV A;  4URR A;  2X85 A;  3LMW A;  3KRG A;  4C2L A;  2PEC A;  1OGM X;  4NK6 A;  1QCX A;  2NTP A;  4U49 A;  4OJL A;  1BHE A;  2EWE A;  2UVF A;  4Z03 A;  1DBG A;  4MR0 A;  4W8T A;  1X0C A;  1OOC A;  4XR6 A;  3EQN A;  2QY1 A;  4MXN A;  4XLF A;  2IQ7 A;  4NK8 A;  4YZA A;  2INV A;  1BN8 A;  1WMR A;  2VBK A;  4Z06 A;  1CZF A;  2NSP A;  2NTB A;  1IDK A;  4YZX A;  1K5C A;  3SUC A;  2VJI A;  4XOT A;  2VJJ A;  1O8M A;  4XLC A;  1DBO A;  4Z05 A;  3GQ8 A;  2O0W A;  4YEL A;  1O8J A;  2QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...