1AIRA

Pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
b'ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PECTATE LYASE C
publication title The Refined Three-Dimensional Structure of Pectate Lyase E from Erwinia chrysanthemi at 2.2 A Resolution.
pubmed rcsb
molecule tags Pectate cleavage
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1airA00
1IDJA 4PMHA 1QCXA 1O8EA 1O8LA 1OFLA 1BHEA 1IDKA 1QJVA 4XOPA 4AVZA 4XN0A 4YELA 1IB4A 1O8HA 4XLCA 1IA5A 3GQ9A 4I84A 1DBGA 3VSTA 4URRA 4XLFA 4XKWA 4YEJA 3VSUA 3VMWA 4YZQA 2INUA 1VBLA 2X3HA 3GRHA 4W8TA 1EE6A 2O17A 1KTWA 5C1EA 4XLAA 2O0WA 2QXZA 1O8DA 2UVFA 1OFMA 2INVA 1XG2A 4XLHA 1RWRA 2EWEA 3JURA 4YZXA 2X6WA 1RU4A 4OZZA 4XOTA 4OJPA 3SUCA 1H80A 1GQ8A 1KCDA 3B8YA 4W8SA 3FY3A 2PYGA 2NSTA 1O8MA 4U4BA 2O0VA 4OZYA 2X6XA 1O8IA 1X0CA 1O8GA 5C1CA 3KRGA 3LMWA 1K5CA 2O04A 1DBOA 1PLUA 3T9GA 3GQAA 1BN8A 2Z8GA 4XKVA 4W8RA 4XR6A 2NTQA 2QY1A 1PE9A 2NT6A 1AIRA 4XORA 2NZMA 2X85A 3UW0A 4U49A 1OOCA 1O8KA 3GQ7A 4Z03A 4XONA 1WMRA 1NHCA 2NTBA 4XL9A 1HG8A 4MXNA 5AMVA 1JTAA 2BSPA 1CZFA 2NTPA 4YZ0A 2PYHA 2QX3A 2VJIA 2VJJA 3VSVA 3ZPPA 4OJLA 4MR0A 4W8QA 3B90A 1O8FA 1KCCA 4OJ5A 2ODLA 3EQOA 4OJ6A 4XNFA 4XQFA 2VBKA 3ZSCA 4C2LA 4EW9A 4NK6A 4Z06A 4NK8A 3GQ8A 3B4NA 3WWGA 2IQ7A 4YZAA 2X6YA 2NSPA 4HWVA 1O88A 4OJOA 4XMYA 1O8JA 4XLEA 1OGOX 2VBEA 4Z05A 1JRGA 3VMVA 1OGMX 4XN3A 1RMGA 2NT9A 2PECA 4XM3A 1PXZA 2O1DA 3EQNA 2UVEA 2VBMA
chains in the Genus database with same CATH superfamily
1IDJA 2XTXA 4PMHA 1CLWA 1QCXA 3DU1X 1O8EA 1O8LA 1OFLA 1BHEA 1IDKA 1QJVA 4XOPA 3SZEA 4AVZA 1EA0A 1K8FA 4XN0A 4YELA 1IB4A 1O8HA 2XTWA 2VFMA 4OPWA 3GQ9A 2F3LA 4I84A 4XLCA 1IA5A 1DBGA 2QZAA 3VSTA 4URRA 1QQ1A 4XLFA 4XKWA 1QRBA 4YEJA 3VSUA 3VMWA 3AK5A 4YZQA 1L1IA 2INUA 1VBLA 2X3HA 3GRHA 3H09A 1EE6A 3LYCA 4W8TA 3SY2A 2O17A 1KTWA 5C1EA 4XLAA 2O0WA 1KCDA 2QXZA 1O8DA 2XT2A 1TYWA 2UVFA 2VFOA 1OFMA 2INVA 1XG2A 3PSZA 2BM6A 1RWRA 4KH3A 2EWEA 3JURA 4XLHA 2X6WA 1RU4A 3JX8A 4YZXA 3N6ZA 1OFDA 4OZZA 4XOTA 4OJPA 3SUCA 3PETA 1H80A 1GQ8A 4YCQA 3RIQA 1OFEA 3B8YA 4JRAC 3SQVA 1TYVA 3FY3A 3N90A 2PYGA 2NSTA 4W8SA 3SYJA 1O8MA 4U4BA 1DABA 2O0VA 1KQ5A 4OZYA 2X6XA 1O8IA 1TYUA 1O8GA 1X0CA 2G0YA 3KRGA 5C1CA 1QRCA 3LMWA 2J8KA 1K5CA 2O04A 1DBOA 1PLUA 3T9GA 3GQAA 1BN8A 2Z8GA 4XKVA 4W8RA 5DNSA 4XR6A 3P4GA 2NTQA 4YEIA 2B0RA 1PE9A 2QY1A 2NT6A 1AIRA 2XT4A 5JMCB 1LLZA 2NZMA 2X85A 4XORA 3BH7B 4U49A 1OOCA 3UW0A 1QA1A 1O8KA 3GQ7A 4Z03A 4XONA 4YC5A 1WMRA 5JLVC 1NHCA 2BM5A 2NTBA 2VFQA 4XL9A 4V02C 2BX6A 1HG8A 2J8IA 1WXRA 2XTYA 4MXNA 5AMVA 1JTAA 1QA3A 1K4ZA 1CZFA 2BSPA 2NTPA 4YZ0A 2PYHA 2BM7A 2QX3A 2VFPA 2VJIA 2VJJA 3VSVA 3ZPPA 3BH6B 3PSSA 4OJLA 3NB2A 3LJYA 1EZGA 2IOUG 4MR0A 4OM9A 3B90A 1O8FA 4W8QA 2V5IA 1KCCA 4OJ5A 1QA2A 2ODLA 3EQOA 4OJ6A 2BM4A 3ML3A 4XNFA 4XQFA 1LM1A 2VBKA 2VFNA 3ZSCA 4C2LA 4EW9A 4NK6A 4YFOA 4Z06A 4NK8A 3GQ8A 3B4NA 3WWGA 2IQ7A 1HF2A 1TYXA 2YUHA 4YZAA 2X6YA 2NSPA 3NAWA 1O88A 4HWVA 4OJOA 4XMYA 1O8JA 2W7ZA 2XC1A 4XLEA 1OGOX 2VBEA 1TSPA 4Z05A 1JRGA 3TH0A 3VMVA 1OGMX 4XN3A 1RMGA 2NT9A 2O6WA 2PECA 4XM3A 1PXZA 1LLWA 2QYUA 4YDTA 2O1DA 3EQNA 2UVEA 2VBMA
chains in the Genus database with same CATH topology
1IDJA 4PMHA 1QCXA 1O8EA 1O8LA 1OFLA 1BHEA 1IDKA 1QJVA 4XOPA 4AVZA 4XN0A 4YELA 1IB4A 1O8HA 4XLCA 1IA5A 3GQ9A 4I84A 1DBGA 3VSTA 4URRA 4XLFA 4XKWA 4YEJA 3VSUA 3VMWA 4YZQA 2INUA 1VBLA 2X3HA 3GRHA 4W8TA 1EE6A 2O17A 1KTWA 5C1EA 4XLAA 2O0WA 2QXZA 1O8DA 2UVFA 1OFMA 2INVA 1XG2A 4XLHA 1RWRA 2EWEA 3JURA 4YZXA 2X6WA 1RU4A 4OZZA 4XOTA 4OJPA 3SUCA 1H80A 1GQ8A 1KCDA 3B8YA 4W8SA 3FY3A 2PYGA 2NSTA 1O8MA 4U4BA 2O0VA 4OZYA 2X6XA 1O8IA 1X0CA 1O8GA 5C1CA 3KRGA 3LMWA 1K5CA 2O04A 1DBOA 1PLUA 3T9GA 3GQAA 1BN8A 2Z8GA 4XKVA 4W8RA 4XR6A 2NTQA 2QY1A 1PE9A 2NT6A 1AIRA 4XORA 2NZMA 2X85A 3UW0A 4U49A 1OOCA 1O8KA 3GQ7A 4Z03A 4XONA 1WMRA 1NHCA 2NTBA 4XL9A 1HG8A 4MXNA 5AMVA 1JTAA 2BSPA 1CZFA 2NTPA 4YZ0A 2PYHA 2QX3A 2VJIA 2VJJA 3VSVA 3ZPPA 4OJLA 4MR0A 4W8QA 3B90A 1O8FA 1KCCA 4OJ5A 2ODLA 3EQOA 4OJ6A 4XNFA 4XQFA 2VBKA 3ZSCA 4C2LA 4EW9A 4NK6A 4Z06A 4NK8A 3GQ8A 3B4NA 3WWGA 2IQ7A 4YZAA 2X6YA 2NSPA 4HWVA 1O88A 4OJOA 4XMYA 1O8JA 4XLEA 1OGOX 2VBEA 4Z05A 1JRGA 3VMVA 1OGMX 4XN3A 1RMGA 2NT9A 2PECA 4XM3A 1PXZA 2O1DA 3EQNA 2UVEA 2VBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDJ A;  4PMH A;  1QCX A;  1O8E A;  1O8L A;  1OFL A;  1BHE A;  1IDK A;  1QJV A;  4XOP A;  4AVZ A;  4XN0 A;  4YEL A;  1IB4 A;  1O8H A;  4XLC A;  1IA5 A;  3GQ9 A;  4I84 A;  1DBG A;  3VST A;  4URR A;  4XLF A;  4XKW A;  4YEJ A;  3VSU A;  3VMW A;  4YZQ A;  2INU A;  1VBL A;  2X3H A;  3GRH A;  4W8T A;  1EE6 A;  2O17 A;  1KTW A;  5C1E A;  4XLA A;  2O0W A;  2QXZ A;  1O8D A;  2UVF A;  1OFM A;  2INV A;  1XG2 A;  4XLH A;  1RWR A;  2EWE A;  3JUR A;  4YZX A;  2X6W A;  1RU4 A;  4OZZ A;  4XOT A;  4OJP A;  3SUC A;  1H80 A;  1GQ8 A;  1KCD A;  3B8Y A;  4W8S A;  3FY3 A;  2PYG A;  2NST A;  1O8M A;  4U4B A;  2O0V A;  4OZY A;  2X6X A;  1O8I A;  1X0C A;  1O8G A;  5C1C A;  3KRG A;  3LMW A;  1K5C A;  2O04 A;  1DBO A;  1PLU A;  3T9G A;  3GQA A;  1BN8 A;  2Z8G A;  4XKV A;  4W8R A;  4XR6 A;  2NTQ A;  2QY1 A;  1PE9 A;  2NT6 A;  1AIR A;  4XOR A;  2NZM A;  2X85 A;  3UW0 A;  4U49 A;  1OOC A;  1O8K A;  3GQ7 A;  4Z03 A;  4XON A;  1WMR A;  1NHC A;  2NTB A;  4XL9 A;  1HG8 A;  4MXN A;  5AMV A;  1JTA A;  2BSP A;  1CZF A;  2NTP A;  4YZ0 A;  2PYH A;  2QX3 A;  2VJI A;  2VJJ A;  3VSV A;  3ZPP A;  4OJL A;  4MR0 A;  4W8Q A;  3B90 A;  1O8F A;  1KCC A;  4OJ5 A;  2ODL A;  3EQO A;  4OJ6 A;  4XNF A;  4XQF A;  2VBK A;  3ZSC A;  4C2L A;  4EW9 A;  4NK6 A;  4Z06 A;  4NK8 A;  3GQ8 A;  3B4N A;  3WWG A;  2IQ7 A;  4YZA A;  2X6Y A;  2NSP A;  4HWV A;  1O88 A;  4OJO A;  4XMY A;  1O8J A;  4XLE A;  1OGO X;  2VBE A;  4Z05 A;  1JRG A;  3VMV A;  1OGM X;  4XN3 A;  1RMG A;  2NT9 A;  2PEC A;  4XM3 A;  1PXZ A;  2O1D A;  3EQN A;  2UVE A;  2VBM A; 
#chains in the Genus database with same CATH topology
 1IDJ A;  2XTX A;  4PMH A;  1CLW A;  1QCX A;  3DU1 X;  1O8E A;  1O8L A;  1OFL A;  1BHE A;  1IDK A;  1QJV A;  4XOP A;  3SZE A;  4AVZ A;  1EA0 A;  1K8F A;  4XN0 A;  4YEL A;  1IB4 A;  1O8H A;  2XTW A;  2VFM A;  4OPW A;  3GQ9 A;  2F3L A;  4I84 A;  4XLC A;  1IA5 A;  1DBG A;  2QZA A;  3VST A;  4URR A;  1QQ1 A;  4XLF A;  4XKW A;  1QRB A;  4YEJ A;  3VSU A;  3VMW A;  3AK5 A;  4YZQ A;  1L1I A;  2INU A;  1VBL A;  2X3H A;  3GRH A;  3H09 A;  1EE6 A;  3LYC A;  4W8T A;  3SY2 A;  2O17 A;  1KTW A;  5C1E A;  4XLA A;  2O0W A;  1KCD A;  2QXZ A;  1O8D A;  2XT2 A;  1TYW A;  2UVF A;  2VFO A;  1OFM A;  2INV A;  1XG2 A;  3PSZ A;  2BM6 A;  1RWR A;  4KH3 A;  2EWE A;  3JUR A;  4XLH A;  2X6W A;  1RU4 A;  3JX8 A;  4YZX A;  3N6Z A;  1OFD A;  4OZZ A;  4XOT A;  4OJP A;  3SUC A;  3PET A;  1H80 A;  1GQ8 A;  4YCQ A;  3RIQ A;  1OFE A;  3B8Y A;  4JRA C;  3SQV A;  1TYV A;  3FY3 A;  3N90 A;  2PYG A;  2NST A;  4W8S A;  3SYJ A;  1O8M A;  4U4B A;  1DAB A;  2O0V A;  1KQ5 A;  4OZY A;  2X6X A;  1O8I A;  1TYU A;  1O8G A;  1X0C A;  2G0Y A;  3KRG A;  5C1C A;  1QRC A;  3LMW A;  2J8K A;  1K5C A;  2O04 A;  1DBO A;  1PLU A;  3T9G A;  3GQA A;  1BN8 A;  2Z8G A;  4XKV A;  4W8R A;  5DNS A;  4XR6 A;  3P4G A;  2NTQ A;  4YEI A;  2B0R A;  1PE9 A;  2QY1 A;  2NT6 A;  1AIR A;  2XT4 A;  5JMC B;  1LLZ A;  2NZM A;  2X85 A;  4XOR A;  3BH7 B;  4U49 A;  1OOC A;  3UW0 A;  1QA1 A;  1O8K A;  3GQ7 A;  4Z03 A;  4XON A;  4YC5 A;  1WMR A;  5JLV C;  1NHC A;  2BM5 A;  2NTB A;  2VFQ A;  4XL9 A;  4V02 C;  2BX6 A;  1HG8 A;  2J8I A;  1WXR A;  2XTY A;  4MXN A;  5AMV A;  1JTA A;  1QA3 A;  1K4Z A;  1CZF A;  2BSP A;  2NTP A;  4YZ0 A;  2PYH A;  2BM7 A;  2QX3 A;  2VFP A;  2VJI A;  2VJJ A;  3VSV A;  3ZPP A;  3BH6 B;  3PSS A;  4OJL A;  3NB2 A;  3LJY A;  1EZG A;  2IOU G;  4MR0 A;  4OM9 A;  3B90 A;  1O8F A;  4W8Q A;  2V5I A;  1KCC A;  4OJ5 A;  1QA2 A;  2ODL A;  3EQO A;  4OJ6 A;  2BM4 A;  3ML3 A;  4XNF A;  4XQF A;  1LM1 A;  2VBK A;  2VFN A;  3ZSC A;  4C2L A;  4EW9 A;  4NK6 A;  4YFO A;  4Z06 A;  4NK8 A;  3GQ8 A;  3B4N A;  3WWG A;  2IQ7 A;  1HF2 A;  1TYX A;  2YUH A;  4YZA A;  2X6Y A;  2NSP A;  3NAW A;  1O88 A;  4HWV A;  4OJO A;  4XMY A;  1O8J A;  2W7Z A;  2XC1 A;  4XLE A;  1OGO X;  2VBE A;  1TSP A;  4Z05 A;  1JRG A;  3TH0 A;  3VMV A;  1OGM X;  4XN3 A;  1RMG A;  2NT9 A;  2O6W A;  2PEC A;  4XM3 A;  1PXZ A;  1LLW A;  2QYU A;  4YDT A;  2O1D A;  3EQN A;  2UVE A;  2VBM A; 
#chains in the Genus database with same CATH homology
 1IDJ A;  4PMH A;  1QCX A;  1O8E A;  1O8L A;  1OFL A;  1BHE A;  1IDK A;  1QJV A;  4XOP A;  4AVZ A;  4XN0 A;  4YEL A;  1IB4 A;  1O8H A;  4XLC A;  1IA5 A;  3GQ9 A;  4I84 A;  1DBG A;  3VST A;  4URR A;  4XLF A;  4XKW A;  4YEJ A;  3VSU A;  3VMW A;  4YZQ A;  2INU A;  1VBL A;  2X3H A;  3GRH A;  4W8T A;  1EE6 A;  2O17 A;  1KTW A;  5C1E A;  4XLA A;  2O0W A;  2QXZ A;  1O8D A;  2UVF A;  1OFM A;  2INV A;  1XG2 A;  4XLH A;  1RWR A;  2EWE A;  3JUR A;  4YZX A;  2X6W A;  1RU4 A;  4OZZ A;  4XOT A;  4OJP A;  3SUC A;  1H80 A;  1GQ8 A;  1KCD A;  3B8Y A;  4W8S A;  3FY3 A;  2PYG A;  2NST A;  1O8M A;  4U4B A;  2O0V A;  4OZY A;  2X6X A;  1O8I A;  1X0C A;  1O8G A;  5C1C A;  3KRG A;  3LMW A;  1K5C A;  2O04 A;  1DBO A;  1PLU A;  3T9G A;  3GQA A;  1BN8 A;  2Z8G A;  4XKV A;  4W8R A;  4XR6 A;  2NTQ A;  2QY1 A;  1PE9 A;  2NT6 A;  1AIR A;  4XOR A;  2NZM A;  2X85 A;  3UW0 A;  4U49 A;  1OOC A;  1O8K A;  3GQ7 A;  4Z03 A;  4XON A;  1WMR A;  1NHC A;  2NTB A;  4XL9 A;  1HG8 A;  4MXN A;  5AMV A;  1JTA A;  2BSP A;  1CZF A;  2NTP A;  4YZ0 A;  2PYH A;  2QX3 A;  2VJI A;  2VJJ A;  3VSV A;  3ZPP A;  4OJL A;  4MR0 A;  4W8Q A;  3B90 A;  1O8F A;  1KCC A;  4OJ5 A;  2ODL A;  3EQO A;  4OJ6 A;  4XNF A;  4XQF A;  2VBK A;  3ZSC A;  4C2L A;  4EW9 A;  4NK6 A;  4Z06 A;  4NK8 A;  3GQ8 A;  3B4N A;  3WWG A;  2IQ7 A;  4YZA A;  2X6Y A;  2NSP A;  4HWV A;  1O88 A;  4OJO A;  4XMY A;  1O8J A;  4XLE A;  1OGO X;  2VBE A;  4Z05 A;  1JRG A;  3VMV A;  1OGM X;  4XN3 A;  1RMG A;  2NT9 A;  2PEC A;  4XM3 A;  1PXZ A;  2O1D A;  3EQN A;  2UVE A;  2VBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...