1AIRA

Pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
352
structure length
352
Chain Sequence
ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTSTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Refined Three-Dimensional Structure of Pectate Lyase E from Erwinia chrysanthemi at 2.2 A Resolution.
pubmed rcsb
molecule tags Pectate cleavage
molecule keywords PECTATE LYASE C
total genus 134
structure length 352
sequence length 352
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 1997-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00544 Pec_lyase_C Pectate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1airA00
5C1CA 1PE9A 3EQOA 3GQ7A 1QJVA 3KRGA 2QXZA 2INVA 1OOCA 4YZAA 1QCXA 1KTWA 4URRA 4OZZA 1O8DA 4XL9A 4XONA 2UVFA 1O8IA 2X3HA 4XM3A 1O8EA 4NK6A 2NSPA 2VJIA 4XR6A 3LMWA 1EE6A 1O8FA 5C1EA 1OFMA 4U49A 4PMHA 4YZXA 2NTPA 3VSUA 4U4BA 1O8KA 1X0CA 2VJJA 3UW0A 3GQAA 4XORA 2NZMA 1RWRA 4OJLA 4YZ0A 2O17A 2UVEA 2PYGA 4XMYA 1GQ8A 4OJPA 2IQ7A 4XOTA 2X6YA 1OGMX 3FY3A 2O1DA 4EW9A 1O8MA 4YZQA 3ZSCA 3B90A 4XQFA 1DBOA 1IDJA 2O0VA 1IA5A 2NTQA 4YEJA 1WMRA 2X85A 2X6WA 1HG8A 2QY1A 2EWEA 2Z8GA 1O8GA 2NSTA 1K5CA 4C2LA 4HWVA 4AVZA 2QX3A 4XLHA 4W8QA 2X6XA 4XN3A 2NT6A 1O8HA 1RMGA 1KCDA 2O0WA 1PXZA 3T9GA 4XLEA 1DBGA 1O8LA 1PLUA 4XLCA 1OGOX 1O88A 4Z06A 3VMWA 2INUA 2PECA 3GQ9A 1CZFA 4MXNA 1BHEA 1OFLA 4W8SA 1XG2A 3GRHA 4OJ5A 1O8JA 2ODLA 4Z03A 4Z05A 2PYHA 4XOPA 1VBLA 3VSVA 4XLFA 1JRGA 3EQNA 1NHCA 4YELA 3WWGA 1IDKA 3B8YA 5AMVA 3VSTA 4MR0A 2NT9A 1JTAA 4NK8A 4XNFA 1AIRA 1RU4A 2BSPA 4W8RA 3B4NA 4OJOA 3GQ8A 4XLAA 3ZPPA 1IB4A 3JURA 1KCCA 2VBEA 4XKVA 3VMVA 1BN8A 1H80A 2NTBA 2VBMA 4I84A 4XN0A 4W8TA 2VBKA 4OJ6A 2O04A 4OZYA 3SUCA 4XKWA
chains in the Genus database with same CATH superfamily
5C1CA 1PE9A 3EQOA 3GQ7A 1QJVA 3SYJA 3KRGA 1QA2A 2G0YA 2QXZA 1QA3A 2IOUG 2INVA 2J8IA 1OOCA 3PETA 4YZAA 1QCXA 1KTWA 4URRA 4OZZA 1O8DA 4XL9A 2XC1A 3AK5A 3LYCA 3P4GA 1DABA 4XONA 2UVFA 1O8IA 2X3HA 3NAWA 1O8EA 4NK6A 4XM3A 1QRCA 2NSPA 2VJIA 2O6WA 3LMWA 4XR6A 2QZAA 1EE6A 1O8FA 5C1EA 1OFMA 4U49A 4PMHA 4YC5A 2BX6A 4YZXA 2NTPA 3VSUA 4U4BA 1O8KA 1X0CA 2VJJA 3UW0A 2B0RA 2VFOA 3GQAA 3DU1X 4XORA 1TSPA 1OFDA 2NZMA 1RWRA 4OJLA 3SUCA 4YZ0A 2O17A 2UVEA 2PYGA 4XMYA 1GQ8A 4OJPA 2IQ7A 3LJYA 4XOTA 3RIQA 1EZGA 1K8FA 1LLWA 2X6YA 1OGMX 3BH7B 2O1DA 1TYWA 3FY3A 1K4ZA 4YFOA 4EW9A 1O8MA 4YZQA 3ZSCA 3B90A 4V02C 4XQFA 1DBOA 4OM9A 1CLWA 1IDJA 1QA1A 1TYVA 2BM7A 2O0VA 1IA5A 3H09A 2NTQA 4YEJA 1LLZA 1WMRA 2X85A 2X6WA 1HG8A 2QY1A 2EWEA 1OFEA 2Z8GA 1O8GA 2NSTA 2VFNA 3BH6B 1K5CA 4C2LA 3N90A 4KH3A 4HWVA 2F3LA 4AVZA 2QX3A 4XLHA 4W8QA 2BM4A 2X6XA 4XN3A 2NT6A 1KQ5A 1O8HA 2XT2A 3SY2A 1RMGA 2QYUA 4YCQA 5DNSA 2O0WA 5JLVC 1PXZA 3T9GA 1KCDA 2XT4A 4XLEA 1DBGA 1LM1A 1O8LA 1PLUA 3ML3A 4XLCA 5JMCB 1OGOX 1O88A 4Z06A 3VMWA 2INUA 2PECA 3GQ9A 1CZFA 4MXNA 1BHEA 1OFLA 4W8SA 1XG2A 3GRHA 3PSZA 3SZEA 2VFQA 4OJ5A 1O8JA 2ODLA 2XTWA 4Z03A 1QQ1A 4Z05A 2PYHA 4XOPA 2BM5A 1VBLA 3VSVA 1QRBA 1JRGA 2YUHA 3EQNA 4XLFA 4YELA 3WWGA 1IDKA 1NHCA 3B8YA 4OPWA 4YDTA 5AMVA 3VSTA 2VFPA 3N6ZA 2XTYA 2BM6A 4MR0A 1EA0A 1TYUA 4JRAC 2NT9A 1JTAA 4NK8A 4XNFA 1AIRA 1RU4A 2BSPA 4W8RA 3B4NA 4OJOA 3GQ8A 4XLAA 3PSSA 3ZPPA 4YEIA 2J8KA 1HF2A 1IB4A 3JURA 3JX8A 1KCCA 2VBEA 4XKVA 3VMVA 1BN8A 1H80A 2NTBA 2VBMA 1WXRA 4I84A 3NB2A 4W8TA 4XN0A 3SQVA 2VBKA 2W7ZA 2O04A 2V5IA 2XTXA 4OJ6A 4OZYA 1L1IA 2VFMA 3TH0A 1TYXA 4XKWA
chains in the Genus database with same CATH topology
5C1CA 1PE9A 3EQOA 3GQ7A 1QJVA 3KRGA 2QXZA 2INVA 1OOCA 4YZAA 1QCXA 1KTWA 4URRA 4OZZA 1O8DA 4XL9A 4XONA 2UVFA 1O8IA 2X3HA 4XM3A 1O8EA 4NK6A 2NSPA 2VJIA 4XR6A 3LMWA 1EE6A 1O8FA 5C1EA 1OFMA 4U49A 4PMHA 4YZXA 2NTPA 3VSUA 4U4BA 1O8KA 1X0CA 2VJJA 3UW0A 3GQAA 4XORA 2NZMA 1RWRA 4OJLA 4YZ0A 2O17A 2UVEA 2PYGA 4XMYA 1GQ8A 4OJPA 2IQ7A 4XOTA 2X6YA 1OGMX 3FY3A 2O1DA 4EW9A 1O8MA 4YZQA 3ZSCA 3B90A 4XQFA 1DBOA 1IDJA 2O0VA 1IA5A 2NTQA 4YEJA 1WMRA 2X85A 2X6WA 1HG8A 2QY1A 2EWEA 2Z8GA 1O8GA 2NSTA 1K5CA 4C2LA 4HWVA 4AVZA 2QX3A 4XLHA 4W8QA 2X6XA 4XN3A 2NT6A 1O8HA 1RMGA 1KCDA 2O0WA 1PXZA 3T9GA 4XLEA 1DBGA 1O8LA 1PLUA 4XLCA 1OGOX 1O88A 4Z06A 3VMWA 2INUA 2PECA 3GQ9A 1CZFA 4MXNA 1BHEA 1OFLA 4W8SA 1XG2A 3GRHA 4OJ5A 1O8JA 2ODLA 4Z03A 4Z05A 2PYHA 4XOPA 1VBLA 3VSVA 4XLFA 1JRGA 3EQNA 1NHCA 4YELA 3WWGA 1IDKA 3B8YA 5AMVA 3VSTA 4MR0A 2NT9A 1JTAA 4NK8A 4XNFA 1AIRA 1RU4A 2BSPA 4W8RA 3B4NA 4OJOA 3GQ8A 4XLAA 3ZPPA 1IB4A 3JURA 1KCCA 2VBEA 4XKVA 3VMVA 1BN8A 1H80A 2NTBA 2VBMA 4I84A 4XN0A 4W8TA 2VBKA 4OJ6A 2O04A 4OZYA 3SUCA 4XKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  1PE9 A;  3EQO A;  3GQ7 A;  1QJV A;  3KRG A;  2QXZ A;  2INV A;  1OOC A;  4YZA A;  1QCX A;  1KTW A;  4URR A;  4OZZ A;  1O8D A;  4XL9 A;  4XON A;  2UVF A;  1O8I A;  2X3H A;  4XM3 A;  1O8E A;  4NK6 A;  2NSP A;  2VJI A;  4XR6 A;  3LMW A;  1EE6 A;  1O8F A;  5C1E A;  1OFM A;  4U49 A;  4PMH A;  4YZX A;  2NTP A;  3VSU A;  4U4B A;  1O8K A;  1X0C A;  2VJJ A;  3UW0 A;  3GQA A;  4XOR A;  2NZM A;  1RWR A;  4OJL A;  4YZ0 A;  2O17 A;  2UVE A;  2PYG A;  4XMY A;  1GQ8 A;  4OJP A;  2IQ7 A;  4XOT A;  2X6Y A;  1OGM X;  3FY3 A;  2O1D A;  4EW9 A;  1O8M A;  4YZQ A;  3ZSC A;  3B90 A;  4XQF A;  1DBO A;  1IDJ A;  2O0V A;  1IA5 A;  2NTQ A;  4YEJ A;  1WMR A;  2X85 A;  2X6W A;  1HG8 A;  2QY1 A;  2EWE A;  2Z8G A;  1O8G A;  2NST A;  1K5C A;  4C2L A;  4HWV A;  4AVZ A;  2QX3 A;  4XLH A;  4W8Q A;  2X6X A;  4XN3 A;  2NT6 A;  1O8H A;  1RMG A;  1KCD A;  2O0W A;  1PXZ A;  3T9G A;  4XLE A;  1DBG A;  1O8L A;  1PLU A;  4XLC A;  1OGO X;  1O88 A;  4Z06 A;  3VMW A;  2INU A;  2PEC A;  3GQ9 A;  1CZF A;  4MXN A;  1BHE A;  1OFL A;  4W8S A;  1XG2 A;  3GRH A;  4OJ5 A;  1O8J A;  2ODL A;  4Z03 A;  4Z05 A;  2PYH A;  4XOP A;  1VBL A;  3VSV A;  4XLF A;  1JRG A;  3EQN A;  1NHC A;  4YEL A;  3WWG A;  1IDK A;  3B8Y A;  5AMV A;  3VST A;  4MR0 A;  2NT9 A;  1JTA A;  4NK8 A;  4XNF A;  1AIR A;  1RU4 A;  2BSP A;  4W8R A;  3B4N A;  4OJO A;  3GQ8 A;  4XLA A;  3ZPP A;  1IB4 A;  3JUR A;  1KCC A;  2VBE A;  4XKV A;  3VMV A;  1BN8 A;  1H80 A;  2NTB A;  2VBM A;  4I84 A;  4XN0 A;  4W8T A;  2VBK A;  4OJ6 A;  2O04 A;  4OZY A;  3SUC A;  4XKW A; 
#chains in the Genus database with same CATH topology
 5C1C A;  1PE9 A;  3EQO A;  3GQ7 A;  1QJV A;  3SYJ A;  3KRG A;  1QA2 A;  2G0Y A;  2QXZ A;  1QA3 A;  2IOU G;  2INV A;  2J8I A;  1OOC A;  3PET A;  4YZA A;  1QCX A;  1KTW A;  4URR A;  4OZZ A;  1O8D A;  4XL9 A;  2XC1 A;  3AK5 A;  3LYC A;  3P4G A;  1DAB A;  4XON A;  2UVF A;  1O8I A;  2X3H A;  3NAW A;  1O8E A;  4NK6 A;  4XM3 A;  1QRC A;  2NSP A;  2VJI A;  2O6W A;  3LMW A;  4XR6 A;  2QZA A;  1EE6 A;  1O8F A;  5C1E A;  1OFM A;  4U49 A;  4PMH A;  4YC5 A;  2BX6 A;  4YZX A;  2NTP A;  3VSU A;  4U4B A;  1O8K A;  1X0C A;  2VJJ A;  3UW0 A;  2B0R A;  2VFO A;  3GQA A;  3DU1 X;  4XOR A;  1TSP A;  1OFD A;  2NZM A;  1RWR A;  4OJL A;  3SUC A;  4YZ0 A;  2O17 A;  2UVE A;  2PYG A;  4XMY A;  1GQ8 A;  4OJP A;  2IQ7 A;  3LJY A;  4XOT A;  3RIQ A;  1EZG A;  1K8F A;  1LLW A;  2X6Y A;  1OGM X;  3BH7 B;  2O1D A;  1TYW A;  3FY3 A;  1K4Z A;  4YFO A;  4EW9 A;  1O8M A;  4YZQ A;  3ZSC A;  3B90 A;  4V02 C;  4XQF A;  1DBO A;  4OM9 A;  1CLW A;  1IDJ A;  1QA1 A;  1TYV A;  2BM7 A;  2O0V A;  1IA5 A;  3H09 A;  2NTQ A;  4YEJ A;  1LLZ A;  1WMR A;  2X85 A;  2X6W A;  1HG8 A;  2QY1 A;  2EWE A;  1OFE A;  2Z8G A;  1O8G A;  2NST A;  2VFN A;  3BH6 B;  1K5C A;  4C2L A;  3N90 A;  4KH3 A;  4HWV A;  2F3L A;  4AVZ A;  2QX3 A;  4XLH A;  4W8Q A;  2BM4 A;  2X6X A;  4XN3 A;  2NT6 A;  1KQ5 A;  1O8H A;  2XT2 A;  3SY2 A;  1RMG A;  2QYU A;  4YCQ A;  5DNS A;  2O0W A;  5JLV C;  1PXZ A;  3T9G A;  1KCD A;  2XT4 A;  4XLE A;  1DBG A;  1LM1 A;  1O8L A;  1PLU A;  3ML3 A;  4XLC A;  5JMC B;  1OGO X;  1O88 A;  4Z06 A;  3VMW A;  2INU A;  2PEC A;  3GQ9 A;  1CZF A;  4MXN A;  1BHE A;  1OFL A;  4W8S A;  1XG2 A;  3GRH A;  3PSZ A;  3SZE A;  2VFQ A;  4OJ5 A;  1O8J A;  2ODL A;  2XTW A;  4Z03 A;  1QQ1 A;  4Z05 A;  2PYH A;  4XOP A;  2BM5 A;  1VBL A;  3VSV A;  1QRB A;  1JRG A;  2YUH A;  3EQN A;  4XLF A;  4YEL A;  3WWG A;  1IDK A;  1NHC A;  3B8Y A;  4OPW A;  4YDT A;  5AMV A;  3VST A;  2VFP A;  3N6Z A;  2XTY A;  2BM6 A;  4MR0 A;  1EA0 A;  1TYU A;  4JRA C;  2NT9 A;  1JTA A;  4NK8 A;  4XNF A;  1AIR A;  1RU4 A;  2BSP A;  4W8R A;  3B4N A;  4OJO A;  3GQ8 A;  4XLA A;  3PSS A;  3ZPP A;  4YEI A;  2J8K A;  1HF2 A;  1IB4 A;  3JUR A;  3JX8 A;  1KCC A;  2VBE A;  4XKV A;  3VMV A;  1BN8 A;  1H80 A;  2NTB A;  2VBM A;  1WXR A;  4I84 A;  3NB2 A;  4W8T A;  4XN0 A;  3SQV A;  2VBK A;  2W7Z A;  2O04 A;  2V5I A;  2XTX A;  4OJ6 A;  4OZY A;  1L1I A;  2VFM A;  3TH0 A;  1TYX A;  4XKW A; 
#chains in the Genus database with same CATH homology
 5C1C A;  1PE9 A;  3EQO A;  3GQ7 A;  1QJV A;  3KRG A;  2QXZ A;  2INV A;  1OOC A;  4YZA A;  1QCX A;  1KTW A;  4URR A;  4OZZ A;  1O8D A;  4XL9 A;  4XON A;  2UVF A;  1O8I A;  2X3H A;  4XM3 A;  1O8E A;  4NK6 A;  2NSP A;  2VJI A;  4XR6 A;  3LMW A;  1EE6 A;  1O8F A;  5C1E A;  1OFM A;  4U49 A;  4PMH A;  4YZX A;  2NTP A;  3VSU A;  4U4B A;  1O8K A;  1X0C A;  2VJJ A;  3UW0 A;  3GQA A;  4XOR A;  2NZM A;  1RWR A;  4OJL A;  4YZ0 A;  2O17 A;  2UVE A;  2PYG A;  4XMY A;  1GQ8 A;  4OJP A;  2IQ7 A;  4XOT A;  2X6Y A;  1OGM X;  3FY3 A;  2O1D A;  4EW9 A;  1O8M A;  4YZQ A;  3ZSC A;  3B90 A;  4XQF A;  1DBO A;  1IDJ A;  2O0V A;  1IA5 A;  2NTQ A;  4YEJ A;  1WMR A;  2X85 A;  2X6W A;  1HG8 A;  2QY1 A;  2EWE A;  2Z8G A;  1O8G A;  2NST A;  1K5C A;  4C2L A;  4HWV A;  4AVZ A;  2QX3 A;  4XLH A;  4W8Q A;  2X6X A;  4XN3 A;  2NT6 A;  1O8H A;  1RMG A;  1KCD A;  2O0W A;  1PXZ A;  3T9G A;  4XLE A;  1DBG A;  1O8L A;  1PLU A;  4XLC A;  1OGO X;  1O88 A;  4Z06 A;  3VMW A;  2INU A;  2PEC A;  3GQ9 A;  1CZF A;  4MXN A;  1BHE A;  1OFL A;  4W8S A;  1XG2 A;  3GRH A;  4OJ5 A;  1O8J A;  2ODL A;  4Z03 A;  4Z05 A;  2PYH A;  4XOP A;  1VBL A;  3VSV A;  4XLF A;  1JRG A;  3EQN A;  1NHC A;  4YEL A;  3WWG A;  1IDK A;  3B8Y A;  5AMV A;  3VST A;  4MR0 A;  2NT9 A;  1JTA A;  4NK8 A;  4XNF A;  1AIR A;  1RU4 A;  2BSP A;  4W8R A;  3B4N A;  4OJO A;  3GQ8 A;  4XLA A;  3ZPP A;  1IB4 A;  3JUR A;  1KCC A;  2VBE A;  4XKV A;  3VMV A;  1BN8 A;  1H80 A;  2NTB A;  2VBM A;  4I84 A;  4XN0 A;  4W8T A;  2VBK A;  4OJ6 A;  2O04 A;  4OZY A;  3SUC A;  4XKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...