1AJEA

Cdc42 from human, nmr, 20 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
194
Chain Sequence
GSKIISAMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Definition of the switch surface in the solution structure of Cdc42Hs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags G-protein
molecule keywords CDC42HS
total genus 31
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1997-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ajeA00
2HCBA 2NPIA 2JATA 2FN4A 4CT4B 3T5DA 2XNDA 2HDNB 2JLSA 4MYHA 1RFLA 1UJ2A 4V03A 1II8B 1AZTA 4DBLC 4C2UA 2D62A 1W0JD 4EPRA 4GSYA 4G5OA 4CEIA 1HT1E 4IDOA 1UKEA 3EC2A 4PC1A 5JFGA 3OIWA 3M6AA 1FUKA 1G291 1O3YA 4DLUA 4MGKR 1M8PA 3ZLJA 4Q48A 4BLTA 2GKSA 3ADKA 5FTNA 4YMVA 1IBRA 1V43A 1G41A 2OHFA 3BAFA 1NVXQ 4V0OA 3DOEA 2AFHE 4D4JA 1GNRA 2ZRGA 1VYTA 3GJ6A 4DKXA 2QUZA 4RKEA 3CPEA 2WMOB 1OKKD 4IXNA 5DLQC 3T34A 1CTQA 1ANKA 1G7SA 1PZNA 2HLDD 4EFMA 1W2GA 3MAAC 4P4SB 4LPKA 2EU8A 3UK6A 1KO4A 1KMHA 5EP4A 1Z06A 3MJHA 2ANBA 3QXXA 3VHXA 4AURA 4JVLA 1NKSA 1KJZA 2ZAOA 1XEXA 1YU9A 3T15A 4PQYA 2VL7A 2O5VA 4BFVA 2KI5A 3LRPA 3RWMB 5AJWA 5L3SA 3GJ3A 1DO2A 1F2UB 4GDFA 1KY2A 3K8YA 4Q1BA 1CJUC 421PA 5FTMA 1DELA 1R10A 2D4HA 1E2DA 2A5JA 2FSFA 3DZ8A 3NH9A 2VSFA 4KBGA 1N25A 4JS0A 2KSQA 2W6JD 4JL8A 4I4LA 2AXNA 3K0FA 1HQYE 621PA 1UEJA 2ZITA 4X8OA 3HR7A 5F3WB 4QBGB 1NBME 1WA5A 5JS7A 4ZI2A 2IYSA 4R71A 1CS4C 3TW4A 5E95A 1PUJA 1A2KC 2G1KA 1E32A 2RGDA 3VU9B 1OYYA 2I4IA 3QUSA 4GOXA 3VR5A 3KQUA 1KO8A 1JXOA 3QXCA 1W7AA 1UFQA 3VFDA 1UKZA 3U5ZB 4B44A 1FTNA 2P65A 2JLYA 2FNAA 1S4QA 1OHHA 4P32A 4LJAA 3GJ0A 4KLNA 1TQ6A 3K70B 3GCGA 4QC2A 1GRNA 2FX3A 4LJYA 2PZFA 1VECA 5H70A 2ZS8A 4FN5A 2ZRNA 5JI3E 1SKQA 2JLXA 2KWIA 3MRSA 3C5CA 2PMKA 3FMOB 1N5LA 2VIIA 1NY5A 2G1JA 4LGMA 3GJ7A 1S1MA 2RGXA 1W36B 1VCIA 2GAOA 3AVTA 4G5RA 3REFA 2XB4A 4AG5A 4F91B 3R9IA 3ECCA 3PUVA 3QEOA 1SVKA 2NZ8A 4I1OA 1Z6AA 4AC9A 4M1YA 3P4XA 5JZVA 3LX5A 2ODWA 3OEED 2Q0HA 2R6FA 4OL0A 1ZMXA 5DYIA 3FHOA 1RRPA 3R9WA 3JVVA 3OZXA 3GJ8A 4BUJA 2AXPA 2B8WA 4TLEA 4RD1A 4BRWA 4Q19A 1E2LA 2CK3D 3TUJC 2QRZA 2HYDA 1XZPA 3WP0A 5KHOC 4ZDJA 4MDEA 2ZE5A 3KDSE 3P20A 3UMSA 4HZUB 1NG9A 1T3LA 4Z54A 4ZI3A 1GG2A 4HAYA 4LWZA 1EWRA 3B1VA 5KSYA 3UATA 2ZANA 5EXPA 3ZD7A 1AS2A 1UBEA 3EW9A 1KZ7B 4LDJA 4B2PA 3MWLA 1E2MA 3KKOA 2H18A 1KI1A 2F1HA 3MWJA 1ZIPA 3HWSA 3UG6A 3U7FB 2BCJQ 2ZJYA 4DT1A 1G6HA 1T3SA 4AKIA 4LPSA 4B34A 4FXPA 4B75A 4RD2A 2CMKA 4HUTA 1VCMA 2EQBA 3AF4A 4F4CA 2Z5FA 1JPJA 2ZROA 3RRNA 4RJLA 4DCNA 2ZPTX 4PZZA 1KNXA 4RCZA 1E1RD 3VR4A 1K5GA 1Q20A 4QKQA 5HKKA 1OYWA 4PAQA 1BMFD 2IYZA 1MO5A 4NYJR 1UPTA 4MITA 2RHMA 1KAOA 5A5GA 4O3MA 4IOMA 2AK3A 2JJ1A 3W8NA 5B30A 5JWHA 3SN6A 1J70A 1ESNA 2JJ2A 4HAVA 2GNOA 2W58A 4PHHA 1E2IA 3A36A 2GCOB 1KSHA 1Z2CA 2ZYWX 3VAAA 2H5EA 1G1MA 5G41A 5G3ZA 2ZI5A 2L0XA 4PC7A 4C3ZA 2AKYA 2ZI7A 2JIZD 2OXRA 1TX4B 1M1YE 1YZUA 3CUEF 1DG1G 4PANA 4AYWA 4LC0A 1LS1A 3M4YA 1XB2A 1US8A 2A2ZA 1NN5A 4LJ4A 3PJRA 4FMDB 4G5GA 1ZNWA 2WV9A 4QJ5A 1VCNA 5JJIA 3A4MA 2ONJA 5GJVC 1EFTA 4PSAA 5EZ6B 5CLLA 1YZGA 3FVQA 5JEEA 1Z5ZA 3NBXX 1NI3A 1TMKA 5TDHA 3D31A 3I8XA 5TMPA 3FMFA 1AQYA 3L82B 3LLUA 4WIAA 2IS4A 1NL3A 3H0KA 2XJ4A 2ZUBA 2EFEB 4GMXA 4GRAA 4PQFA 2OILA 2BKUA 2Q3FA 3AH8A 3O8DA 5BXQC 3ADDA 2RGEA 4WXRA 3EAQA 4GOKA 1CJKC 2H57A 4TT3D 5GVRA 2FU5C 1NLZA 3NDBB 5FUVA 3KL4A 1T3HA 2N42A 4KU4A 1HQCA 2IXEA 3K9HA 1E0AA 2EYUA 3PIRA 5KNDA 3BK7A 3CPJB 4DSTA 3BB1A 1ZRHA 1NVUQ 1IY2A 3RYTC 1TTTA 4NBSA 3U3OA 4B6EA 4NPHA 3AF1A 3K0FB 5FOSA 3QKUA 4Z8YA 2REOA 3DPUA 4ESVA 1LS6A 1N0UA 5BWMA 1TF2A 3DEFA 1XCPA 4OHWA 2ZRAA 1DAHA 1FQJA 1XEXB 3B1XA 4NYIQ 5GVSA 3CONA 3PEWA 4LC1A 3PUWA 4ZO4A 5F9FA 1E9FA 5C4MA 2I1VB 5EUMA 4PPQA 1LW7A 3CWQA 3NC1C 1G5TA 1N6KA 3LY5A 1G4AE 5CLQA 4EJSC 2R62A 4MYTA 1J8YF 2AWNA 3LBIA 4A6PA 3M1IA 3I32A 2ZRBA 3RSOA 4A0HA 4AYXA 4RD6A 2X2FA 1P9WA 2F3RA 1TU4A 2XSZD 4MKGA 4PO9A 4NU0A 2R6DA 5GJBA 2YC4C 5CB8A 3I5YA 4DLXA 2IS1A 1T9HA 3FMIA 2GDJA 2X8AA 2IYLD 2QA5A 5AK0A 5J5CA 1F2TB 4L9WA 1UF9A 1N5JA 4XWAA 4Y0VA 4QM6A 5IHPA 4NP6A 1JQJC 1XTKA 4TYYA 1YRAA 2OV2A 3Q7QA 2VHCA 4URZR 1X8LA 4RKFA 3SDZA 2EVWX 3KJHA 4C7OB 4FCTA 3QF4A 2IK8A 1QHNA 5J47A 4B71A 1CR0A 1YQTA 1FMJA 1JJ7A 3A6PC 1YR8A 4DUGD 1P2VA 4Z1MA 2QT1A 4B32A 1P61B 2ODEA 2WKRA 5CIWA 3PITA 3PENA 4PPGA 1ZJ6A 4AKGA 4Q1EA 1NG1A 4MUBA 3TSZA 1IM2A 3W8RA 3U61B 1W4CA 1N2CE 2MSEB 4J0QA 2WM9B 2FEMA 2C03A 1H8HD 2OCPA 1LNZA 2QI9C 3VX3A 4TYNA 3BFKA 3BFVA 2QQ0A 1MO6A 2QSYA 3WNBA 4DT1B 1TQDA 4IOKA 5AUNB 2QN6A 1COWD 5CJ2A 3EARA 4F4IA 1U0HC 3M0EA 2W2VA 4QBHA 1G5PA 2CK3A 1YR7A 2IT1A 1LV7A 3BH7A 3K0EA 2W6JA 4P31A 4Z1MD 1E1QA 3OEHD 4DUGA 3RC3A 5JSZB 2A5GA 3KB1A 4G01B 1Z8FA 4TL7A 1ESMA 2FE4A 2J87A 4MKFA 4POAA 2QY9A 2C2HA 3W6NA 4KV9A 3D6TB 4FCVA 4R98A 4A0GA 4M9XA 4C0SA 1KY3A 1UM8A 1DAKA 4QXAA 2V7QD 4E5UA 5TY0A 1R0WA 2MSCB 2CL6X 4FMDF 1NMXA 4R7ZA 2OG2A 3KTAA 1QHXA 2VBCA 4PSKA 3OE7D 1BS1A 4NH0A 1II8A 2FSIA 2VP6A 4GP6A 1ZUNB 2UVQA 3F5FA 1JXMA 2ZRPA 2IX3A 3U44A 1Q1QA 4RZXA 2DBYA 3QKTA 4TMKA 5DI9A 3TW8B 3W9YA 1CULC 1CU1A 1EX7A 1L4YA 2PJZA 5FFMA 1OFUX 1CR4A 1SVMA 2IXGA 4KFSA 3VTKA 2BBTA 1PJRA 1P2TA 1WCV1 2V6IA 3PQCA 2NPFA 4OJKA 4S2EA 5L3RA 2FFBA 2OBNA 1AKYA 1ETUA 3PVSA 1VCOA 2BMJA 4TMTA 4FMCB 4GBMA 3WMGA 4TSFA 5FTLA 4PC6A 1WQ1R 1KYIA 2XEXA 5DGXA 4DDWA 2IEZA 4A8JB 5BW8A 2KB0A 2ZRIA 5TB5A 1KIMA 3I73A 1ZNXA 4F92B 4Q4AB 3L0SA 1AA9A 1IN4A 1OXXK 1U0JA 2GA8A 4KCGA 4PFSA 1E9SA 1NN0A 1JBKA 4IFBA 3LNCA 4HUQB 4F7WA 1X8JA 3CH4B 2GCPA 3ZIAD 2CJWA 5JHHB 3RNLA 2IS2A 3GLFE 1JR3E 4OQNA 4CT5A 4GOJA 2GF0A 5J4KA 3SS8A 4D0LB 3IBYA 1KSFX 2PEYA 1KK1A 4US1R 4UJ5A 4TYQA 3WMFA 3ASZA 1I4DD 1A5TA 1OW3B 5CM8B 5JLJA 1F60A 3OESA 1U8AA 1JNYA 3QBTA 3F8TA 4UKDA 2QGNA 4IOLA 3A1TA 3K9LA 3GEHA 2J46A 4TYWA 4CGZA 4UQOA 4A36A 1CR2A 4HAUA 2GAAA 4CDGA 2OAQ1 4FW9A 4BFTA 4BASA 1XCMA 4M9SA 4QFMA 3R7WB 3OFND 1GNQA 1QHIA 4V0KA 2WMNB 1E2NA 3G82C 3NH6A 1PLJA 3ZS8A 1GITA 1AJEA 2JASA 3B9PA 3GPLA 2ODNA 4OI4A 3GFTA 2IF0A 1QDEA 4BQSA 3MJRA 1SHZA 2OCYC 2OFXA 3TSWA 3KKNA 1KTVA 3AVQA 4G1UC 2J45A 2OESA 1JR3A 2I3BA 4BRUA 1MKYA 1KK3A 1Z07A 2BM0A 4Q4HB 4Z51A 2CCKA 3O8CA 1F5NA 3AV0B 3SNHA 2WHXA 4B6FA 4EPWA 2WWYA 1DEKA 1NLYA 2NO7A 3RC8A 4HLUC 3WRYC 4ZDIA 1Q21A 2GTPA 4XD7A 5DE3A 3B1WA 3WNCA 2GILA 3L8YA 3OIYA 5IK2A 1DAGA 2OCAA 2HLDA 1Z6TA 2J9RA 3LWNA 3FPAA 4ERNA 2J0SA 3PUZA 4RZ3A 1RYHA 1W4RA 3IIKA 4P33A 3TRFA 2V3CC 4BFUA 5FPKA 3UPUA 4C30A 2D2FA 4IJMA 5AJVB 4B3FX 1DARA 2C9CA 1GKUB 3E5HA 5P21A 1GKIA 3KJIA 4MRSA 2FPLA 3PEUA 1WE2A 2OO7A 2OM2A 1KO1A 2ZETA 3VR2A 1W44A 2J0QA 3R9XA 2AL7A 2C5LA 4C4PA 2ZR0A 1W5SA 2P0EA 3IILA 1PV4A 5LD2C 4L15A 4NTZA 3BFXA 3RS4A 5KDLA 3GEEA 4KJZA 3SBEA 2F55A 1E2JA 3VHLB 2JLZA 1H8ED 1G8YA 1VHTA 3ZZ0A 4JBYA 5D3QA 3RS0A 4M4SA 1YVDA 4QOSA 2WZQA 3AP3A 4B48A 2Q6TA 3CBQA 4XH9B 1Y63A 3S1AB 1OIVA 2RGCA 2W6IA 4GZLA 1ZUHA 2ZXUA 2QE7A 1P9NA 3ZD6A 2J59A 2JLVA 4KBFA 4YMUA 1IQPA 4B47A 3Q8XB 4JYBA 3RS3A 1TADA 5KPDA 1P9RA 3U3JA 3ADCA 3SU8A 1DAFA 4RZUA 3T1VA 3T5GA 1AM4D 2PLRA 2JLWA 3CNOA 3OEHA 3TR5A 1Q3TA 1NLFA 2KE5A 3AF3A 4A2QA 3LX8A 3QE0A 3BBPA 3C7KA 2NTYC 5BN3A 3H84A 4KSCA 4ABYA 1QBKC 2HT1A 1XXHA 1R4AA 4JL5A 4URUR 1WF3A 2GCOA 1FZQA 4DVGA 3SR0A 4HAZA 1NIJA 3P1JA 2D2EA 2VH5R 2XX3A 2NOAA 1G3MA 3QPUA 1M34E 5EXTA 3KB2A 4PR0A 3TBKA 4ZDKA 2JJ8A 4TMZA 4KYUA 3THXB 1T4GA 4BPBA 1GZSA 2P67A 3Q5DA 3O8RA 2BWJA 1HT2E 3KJEA 1E98A 3X1ZA 3W90A 2G9NA 2YNMA 2DB3A 4LK2A 3LXRA 4KHZA 1Q22A 3LD9A 1G64A 2R65A 1P5ZB 1Z0IA 2CHVA 3FHCB 1ELOA 2ZSBA 3VR1A 3WHLA 1Q1EA 3AKDA 121PA 2R9VA 2VF7A 2O8BB 3CO5A 3QEJA 1NN1A 3ZIAA 1QZXA 4TSFD 2QG6A 3QBVA 1TU3A 1UBGA 3UKDA 4TL8A 4B73A 3LVQE 3EWSA 3MD0A 2P2LA 1KJWA 2GETA 3SYLA 1E3MA 3IBGA 4ITRC 3IO3A 1A4RA 4RFSB 1RKBA 1XMVA 4N0EA 1VMAA 2DYKA 5AWFC 3TLXA 2V8OA 4TL9A 5J4LA 2O8CA 2GHIA 5K8TA 2ZSFA 3QOFA 3T35A 1G8HA 4HAXA 3CPHA 3EZ2A 1CEEA 2WSSA 2ATXA 1F6BA 1A82A 1EK0A 3AQ4A 4E07A 3QXHA 1WXQA 4NKRA 1G6OA 4LOAA 4B3DA 3KUCA 1SXJD 2ZYVX 1IJEA 1Z6XA 1ZD9A 2OCBA 4JSYA 1OF1A 1HE1C 5HCNA 3RS5A 4ZDWA 4PHGA 2YOFA 4H1VA 4PAMA 3KXKA 1EFRD 1QHSA 2WKPA 3PXGA 1II9A 4UNNA 3A4LA 4EPTA 4NDZA 1YZNA 5HE9A 1E94E 2XXAB 4ARZB 4CEIB 2BMDA 4JLBA 4LUCA 2HV8A 4CVNA 2JAQA 5BQ5A 4EIWA 1XJCA 1H8EA 4XIGS 2IEYA 5KTYA 2HJGA 3CW2A 1P73A 3C15C 5DI3B 1LB1B 4PHTA 3KUDA 3FOZA 2Z43A 2PEZA 1JI0A 4JLJA 2GEVA 1MABB 4C0AC 1SXJA 2CL7X 5FOTA 5BYJA 2AHOA 2OE2A 1W48A 1GKYA 2HF8A 1KI7A 3J81k 2OFOA 3HU1A 5J4YA 3NHBA 2BBOA 2PMDA 1K5DA 5KSOA 4KSBA 1TNDA 2A5FA 2XTNA 2DFNA 3QI2A 5C1BA 3HPQA 2KJQA 1VDZA 2QROA 2WJJA 1E2FA 5J4VA 1F48A 3QF4B 2FMXA 2X19A 3AVPA 3I8SA 4NYMR 2NIPA 4P4UA 1L8QA 4O2RA 1E1RA 1N6PA 2QRNA 2VF8A 3PEVA 3SEAA 1P3JA 1T6NA 4OQFA 3KQLA 2YINC 3W3AA 4PC2A 3ZZUA 3IQXA 3SC3A 3BERA 3Q5EA 4YMWA 2YKGA 1S9HA 1AIPA 3EIQA 4C0KA 2FFAA 3SYKA 2TMKA 2P3SA 4JBWA 3ZVNA 1XMSA 3EZ6A 1DPFA 2I1QA 4IDNA 4NMMA 1GILA 4HAWA 1DS6A 5CITA 4HLCA 1SQ5A 5D3MB 2W2XA 3W6OA 1BKDR 4JVNA 4CW7A 1WMSA 2CNWA 1OH6A 4Q4JA 4KXFB 3GLIB 3ADBA 2IF2A 4V0LA 2CBZA 4LYJA 2IHBA 3U3RA 2H16A 3OIUA 3V00A 1E2EA 2ZRMA 4JVSB 4L9SA 4XVQA 1D6JA 1R8QA 3K1JA 1RVDA 3WYFA 4DEYA 2REBA 3KZ1E 4R9UC 1IAQA 4NCIA 3X1DA 1ZCAA 1EESA 2FV8A 4WZBE 3FB4A 3IHWA 521PA 4F38A 3NVAA 3DM5A 5KDOA 5HE8A 3GJ5A 1UBFA 2PX3A 3KXLA 5KSPA 2VP2A 4H1UA 5FL7A 4IDPA 1VTKA 4EKDA 4YC7A 1Z0KA 1CXZA 1JEEA 2A30A 1KMQA 2O0HA 1JQLB 1KJYA 2MMGA 2ZAMA 2V1UA 4DCSA 3I72A 2CNWD 1TQ2A 1OT3A 2NO0A 2C99A 4YLGA 2XZLA 2O0KA 4Y0AA 2JEOA 4IHQA 4V0ME 4BGDA 2GWHA 2C04A 5FOVA 4BFZA 4XVUA 4HSEA 1E2KA 5DH9A 3CX6A 2BIFA 1XEWY 2FPKA 3A37A 1N0VC 4W7SA 3DKPA 1G3QA 2REXB 5E7JA 2EFGA 2ZRFA 1NBMD 2WJGA 3U7HB 1XTJA 2CCJA 1ONBA 4M1MA 4G5SA 4U02A 3FFAA 4JYCA 2YZ2A 4NL4H 5FTKA 2YWEA 1MRSA 5H1YA 4LJ8A 5EJEA 2IYQA 4OBEA 3FE2A 3N5CA 4QHTA 4GNKA 2RGGA 2Z6VA 1OJLA 2Q9BA 4RSGA 4BLPA 1DOAA 1E9AA 1II0A 4Q1DA 5BYKA 4AY2A 3CKLA 1IY1A 1M6NA 2F9LA 4EJSA 3R7WA 3VKGA 2GJSA 2GZAA 3O8BA 3LO5A 3QF7A 1DAIA 3U3KA 2G88A 3SJCA 1PVOA 2RGNC 1QHHA 3K0SA 4D4LA 1GWNA 1I4LD 2FG5A 4UNPA 1XTQA 3GFPA 4AKEA 1CLUA 1I4TD 4TT3A 1U9IC 4EQ6B 1GIAA 1U0LA 1XP8A 3PG5A 2P5SA 2F1RA 3RVBA 2V6JA 4DC9A 2C98A 1ZIOA 2E9SA 4P4TA 1DAMA 2DR3A 2WWWA 4XSGA 2ZI4A 2D3WA 1IJFA 4N0DA 3U7GA 4Q18A 3KTAB 1Z08A 4M22A 4NCJA 3IEVA 1S9DA 1XFAA 4WW0A 3NIBA 3GLGA 4DB2A 4HLUA 2QPTA 5GADl 5E4FA 2QTFA 1Q1ZA 2WICA 4JT4A 5LB4A 2GZDA 3HDTA 4TN1A 3C8UA 2PBRA 4OHXA 1KSGA 1CR1A 3QKRB 1ZC4A 4BEBA 4YMTA 4ZIRB 1U2RA 4MRVA 4MGIR 2ECKA 1NN3A 5DISB 4AWXA 4LI0A 1G3IA 3AGPA 3DL0A 1JECA 1VG9B 3UIEA 1XNJA 2OT3B 1M74A 2CLSA 1KMHB 4RFVA 5IRCD 4E03A 2PL3A 4HZIA 4LBVA 3C41J 2F6RA 1OKKA 4E22A 3QY0A 4DDUA 1D2NA 2QMEA 2QM7A 4URXR 2O52A 4WAUA 2FPMA 2JIZA 2OXCA 4LJ7A 2ZTSA 1Z0FA 2WIAA 4LYFA 1G20E 2QMOA 4JIMA 1JALA 4O0MA 1GSIA 1YE8A 3V9PA 5L8VA 3KFXA 4IW3B 3LW8A 2HJVA 4EFNA 5LDDC 3GP8A 4O25A 5HTKA 3U4QA 3D8BA 2E87A 3FTQA 1GAJA 1XTIA 4UNQA 1ZUIA 2A7QA 4CYMA 3TQFA 1UAAA 3FKSA 1S0UA 3OF5A 4ACBA 2P5TB 4KVAA 8OHMA 2WBLC 1SVIA 2QL6A 3MWYW 3EX7C 3CNNA 4PTLA 4CEHB 1HURA 5EP3A 1X1SA 4NE2A 4IDHA 1CKEA 4PO1A 1E69A 3BJIC 3TUZC 5JSZA 1E4YA 4D25A 3K09C 4IEIA 5EXXA 4NHOA 1XBTA 3EA0A 1P60A 4X8HA 3U6KA 2CDNA 3ZJYA 2QTHA 2DFLA 5EE9A 3UXMA 3QKSB 3BXZA 4A4DA 1ZVQA 3AKEA 3LFUA 2LCFA 4UNRA 5TXGA 4OHYA 3AM1A 3LA6A 1YZQA 4W9MC 3AF2A 1VIAA 3IHLA 1M2OB 4YDHB 4KI0A 2IYYA 2ZRDA 1QG2A 2XZPA 3A58B 4US2R 1EFCA 1AGPA 4I1UA 3C16C 2N46A 4MYCA 3KFVA 2D7DA 1D9ZA 3CNLA 1XMIA 4A8JC 2WWIA 4TQUS 4B3GA 4YXWA 1W36C 2QMUA 2E1RA 1L2TA 1ZCBA 4HB3A 3EIHA 2GBLA 1XCGB 3WMEA 1FP7A 1XRJA 4HDOB 4UXHA 4EPXA 1OPXA 5A0FA 2FJUA 1AK2A 3OFNA 4P4SA 3B2EA 1TF5A 1I2MA 4EUNA 2HXYA 1OH7A 2FSHA 3JZMA 1G9XA 4QM7A 2RGBA 1N6HA 5FBQB 3ZYCA 1FFHA 3THYB 3P4YA 4BFSA 1NNEA 1IXRC 4Q9LA 1Y3AA 2W6ID 4PZYA 4WBSA 3X1YA 3AP2A 5FPTA 3UG7A 5B57C 2MMCA 1BIFA 1P75A 2FOLA 2GRJA 1XEWX 1MRNA 3VX4A 5F9HA 1N0WA 1G7TA 2ZE8A 3AKYA 5H8WA 4XJXA 1X8KA 3GLHA 1KI6B 1E99A 2IBMA 2RGNA 2J0UA 2IA5A 3R8CA 5IK2D 1RRCA 4LHVA 5G40A 2F7SA 1U9IA 2XNDD 1COWA 4RCYA 4UNSA 3TUIC 5JBQA 4LYAA 4ARZA 2BCGY 2PZGA 4EDHA 2IWHA 1HY3A 1UDXA 1CIPA 2C9OA 4D81A 3BOSA 1GL6A 1IY0A 2PZEA 3F0TA 3CF0A 2ZVQX 1FL9A 2IYVA 2WWXA 3B8HA 2SHKA 5FL3A 2PCJA 1IN6A 2IUTA 3T1OA 4DLTA 2XXAA 1U98A 4LHWA 4RD3A 1G16A 3EZ9A 3QVUA 4ZIRA 4NONA 1TF7A 3KQKA 2ZU0C 1BMFA 3R20A 4JZKA 3PV0A 2GZHA 1KDPA 4WXPA 1E79A 2CEAA 3RABA 1KOFA 5LPNA 3WHKA 1UDWA 3GLFB 2JGNA 1G3UA 1EFUA 2VSXA 3CZPA 3TE6A 2VEDA 5C2JB 3EPKA 4ESHA 1MABA 1M7HA 2XGJA 1GM5A 4MYUA 1HE8B 1OXTA 5GJWC 1CRQA 2D7CA 4GFDA 2DCUA 4V0NA 3K0AA 5DI3A 2F1IA 3SE0A 4A0FA 2X1VA 5HPYB 1DTSA 3ICQB 4W5HA 2JDIA 4Q9IA 4XSHA 3TAUA 2UKDA 5FPYA 3ZVMA 2WSSD 2B7CA 2FSGA 4M1SA 1IXSB 2WOJA 1UEIA 3I3SR 4AK9A 2WWHA 2RHDA 2CLDX 1CJVC 1YZLA 2G6BA 3BRWD 4OK3A 1LFDB 1FX0B 3PUYA 1ZM2A 3I1FA 3VKHA 4L4UA 1KO7A 2GF9A 1B23P 2FF7A 4FMCF 4K8OA 4Q01A 4BEJA 5L3QB 3E2IA 2O8EB 2ZR9A 3EASA 2H92A 3NTUA 3GD7A 3OHMA 4CEHA 1H65A 5CYOA 4CZ2A 1YHNA 3TMKA 4DZZA 4D2IA 5G53C 4ZCLA 1G4UR 1VHLA 4C0BA 1CRPA 4D80A 4JLPA 5FR2A 4C0HA 4TTRA 3JZAA 5AJYA 2YYZA 1CP2A 1R8SA 4DJTA 2VP0A 3OAAD 2ZRHA 3NHAA 3GLHE 4QGGA 3BD9A 5FBVB 4M1OA 5KO2A 2FH5B 1Z29A 1SVWA 4BFWA 2PH1A 2BDTA 3IIJA 4LJ6A 5KPJA 2QSZA 1LY1A 1N6RA 5FL7D 1KI3A 1P2SA 4C9BA 1E2PA 1E1QD 3IGFA 3K0CC 2ZREA 2UZIR 4ZPXA 2B92A 5CK4A 1W4AA 1VPLA 4DB4A 1J99A 2QNRA 1KKMA 1ZM9A 2VP5A 2C78A 4E09A 5L3VA 2V7QA 1G8PA 3X1XA 4UXIA 2GCNA 2NQ2C 3DM9B 2FEOA 2Q3MA 2QZ4A 4Q03A 5FOWA 1XWIA 3DMDA 3NEYA 1NIPA 1Q57A 1RJ9A 4JKYA 4PPNA 4Q9HA 2HT6A 2F43A 4IFEA 5KSZA 1U8YA 3HPRA 4OQMA 1XXHE 2WVJA 4B76A 3ICEA 3WYGA 3K70D 3LBHA 1VG0B 2CXXA 3BH0A 2BJWA 4NCKA 2GVDC 1Q12A 1OFIA 1ZD8A 4O2LA 3LBNA 1I2DA 3WBJA 3ND8A 3DO6A 1SGWA 1TAGA 3K53A 1OIWA 1R0ZA 4RZ2A 4Q4AA 1XF9A 2WWFA 1D9XA 1TL7C 1Z22A 4CF7A 1N6NA 5FBLB 1GP2A 3LVRE 4BLSA 2KBEA 3WP1B 1FPMA 4M1KA 2XJ9A 5GJCA 1Z63A 2EFCB 4EPYA 2G83A 1W4BA 3RHFA 3CRMA 2O8BA 4M53A 5FPHA 3WNDA 2N1BA 1OLOA 3CRVA 2G3YA 3HYTA 1CJTC 1G19A 1W5TA 2OBMA 4B3CA 2BVNA 1J8MF 4ON9A 2AWOA 2P6RA 3NKVA 1WRBA 3MG9A 5KYKA 4ASUD 3CZQA 4B74A 3IEUA 4LHZA 4U00A 2DFKB 4W5WA 4QGFA 2P6NA 4D0NA 3SJBA 2C77A 4M1WA 5JJLA 1S3GA 1JAIA 3KXIA 3T06B 2BHRA 4BFYA 2QU8A 1F3OA 2JJ2D 3EA5A 1FMLA 4IOJA 2VP4A 4URWR 1LTQA 1OIXA 4AG6A 1NY6A 4CRWB 4LX0A 3LV8A 2WTUA 3AVVA 3SOPA 5A4JA 4R2IA 1D2EA 1XJ0A 3CX8A 2DWQA 3K70C 1P6XA 3FDIA 1L7VC 2K5UA 2ZRLA 4F93B 1KK0A 4DWJA 1T0JB 3ZZTA 1XD8A 2JCSA 4TL6A 4DSNA 3PUXA 1CBUA 5CYPA 3B1ZA 3FFBA 3QG5A 2FDCA 1ZC3A 3L2OB 3NC0C 5FPSA 4NYMQ 2IWRA 1SULA 3CM0A 1ZU5A 2JA1A 5CDFA 1ZBDA 5DYGA 1OXVA 5G3YA 3MGCA 4OI2A 4LBWA 4KVGA 3TIFA 5FH9A 4KFRA 1G5RA 3GLFA 4Q4LA 2ZJAA 3TAHA 4L5BA 2QP4A 4QHSA 2GJ9A 1IHUA 4XTCS 3UWOA 5SZJA 4DIEA 1FP6A 4GP7A 5EXSA 3I61A 1YRBA 3RDPA 4DCVA 4QBFA 1E9DA 1H8HA 3BORA 3BWDD 4DHEA 1YZTA 2GK7A 1T5LA 2VLIA 5IF9A 1UKVY 3RRMA 3X2SA 3GJ4A 1KDTA 2XTZA 2QPOA 2ZYUX 3KKMA 2YC2C 4B43A 4B35A 5L3SB 2RH5A 4JLKA 1FUUA 2AN9A 2EWVA 1RE0A 4P0TA 2IYTA 2RCNA 3MMPA 1XPUA 2WJIA 1FW6A 4GMDA 2IW3A 2J7PA 2PCLA 4A2WA 1P2UA 5F98A 2AD5A 4XVRA 4URVR 4KYIB 2O8EA 1IN5A 1EFRA 5FOXA 4JMPA 2NO9A 4PQRA 1Z3IX 3RAPR 3VU9A 1SKYE 2Q21A 1WBBA 3B60A 2IS6A 1XD9A 2KBFA 1J90A 1XD2B 1O87A 4PHFA 4Q7JB 2O8DA 4FD2A 2Z83A 1ZM3A 5L3QA 3FWYA 1ZAKA 1FOEB 2ZJ2A 3SHFA 1RRFA 3U4QB 1G3RA 3N2EA 5KOYA 1VIYA 3CLVA 1HA3A 1UBCA 2A3RA 2BC9A 3DMNA 5C4GB 5M04A 3EC1A 3NWJA 1OXSC 2FZ4A 2WAXA 2ZE6A 2QEQA 3K09A 4OJQA 2XOKA 1G7RA 3CRRA 1JAHA 4TQAA 5CK5A 1NVWQ 1TUEA 1KAGA 1NSTA 1U99A 2NGRA 3CWZA 4HB2A 4MGYR 1Z83A 2NO1A 4Q1CA 1LF0A 4JLVA 3SHWA 3Q7PA 4ZCMA 4AIIA 4IVPA 2ZUDA 4JVMA 1F2TA 3DVLA 3TVDA 2UZ3A 1XJQA 1ZINA 5TV2A 3R8FA 1XXHB 4TQ9A 4D0GA 4RD4A 2W0MA 3RANA 2WJHA 4HI0E 4PSVA 4Q9KA 2FGJA 1XZQA 1E9CA 3FGNA 4MGZR 3U6BA 4G5QA 3ONWA 4TTQA 1QVAA 2CLCX 1HYQA 4XTRA 3MWKA 1P72A 2ZVPX 2VHUA 3NBFA 4ACAA 2RGAA 4B3BA 4AYTA 5FI0B 2ZEJA 5SZIA 3THXA 1W1WA 1Z2AA 3QENA 3VQTA 4IRUB 4Q7LA 3IIMA 1NJGA 3SFVA 3LAWA 1X6VA 221PA 2F1JA 4Q7MB 2QE7D 1XU4A 2IYXA 1Z0AA 2ANCA 4HDQB 1E9BA 5K8UA 2GEUA 1KI8A 2XAUA 3CIOA 5DN6D 1E0KA 3K9NA 4JT2A 2BJVA 3HU2A 1NBMA 4BLOA 3N2IA 2ZJOA 1NP6A 1OE0A 4HZUA 5DO9A 5LBIA 4C0QC 3Q9LA 1K6MA 1N6LA 1RZ3A 4S35A 2ZR7A 4LV5B 3LDAA 4QGHA 1ZM4A 2BMFA 4BZXA 1N6OA 1T91A 2QQEA 3ETLA 4JKIA 4V0MA 3I5XA 2OLKA 1SVOA 3GLIE 2YHSA 3U2QA 2QPAA 4IXMA 3IKJA 3OIVA 3TQCA 4DRZA 1J7KA 1R5BA 3RS7A 3TGPA 2GJKA 4M8NE 4HATA 2EFHB 2J0VA 2NZJA 3B9QA 3GJXC 3D3QA 4JLAA 3RS2A 1BOFA 2OLJA 4LV6A 1ZM7A 5CB6A 5CIQA 5KDDA 2QTVB 2DWOA 5FUWA 4KO8A 4OQXA 2IHYA 4Q1FA 4DDTA 2NMVA 3A1WA 3H4MA 2VQSA 3QJYA 1W36D 3ZGXA 3AUYA 5AJZA 2EYQA 4HYYA 2JLRA 1JPNA 1S3SA 3OEEA 1DBSA 3GMTA 1BYUA 1ZYUA 5J4HA 1GNPA 2W00A 4AKHA 2XNSA 3CX7A 3VR3A 5IDVA 2YOGA 1Q3HA 1ZNYA 3U7EB 2ORWA 2FFQA 1OFTA 1S2MA 3EWAA 3L0PA 4ZKEA 1KI4A 4JSTA 5SZHB 4CEJA 2B8TA 2DPXA 2G0NA 3H1TA 2BEKA 2IYUA 2ZS9A 1YZKA 4Q4HA 4WZ6A 1XEFA 4BZPA 5EE0A 1SXJC 3CB4A 4M1TA 4YXWD 1R2QA 4OI1A 3A4NA 2PJRA 2P6UA 1GOTA 2WPDD 1W0JA 2QAGA 4D4MA 4DCTA 4L16A 4B33A 2HXSA 5EE3A 2J41A 1K8RA 2ZE7A 4PZLA 3V4RA 3AKCA 1Q1BA 3ZS9A 1N6IA 1XMJA 1WBDA 3EG5A 1IXZA 1QRAA 5DHAA 1Z0DA 4OHVA 4OQLA 5EP2A 1OB2A 4Q00A 4W5JA 1VG1A 4WZAE 2O8FA 1S8FA 1HH4A 1U90A 4KODA 4JJZA 4QJ3A 2HYIC 5CM9C 2W0SA 4URYR 4DIDA 1U94A 4TTPA 3BS4A 2R6GA 3IUYA 3E70C 5ELXA 2O8FB 3B7GA 4LRWA 4DLRA 3AVYA 4U7DA 3AVXA 1T0HB 4D6PA 5KNBA 3HJNA 2WJVA 4A9AA 5UKDA 1E2HA 2PT5A 3I62A 1ZU4A 3C5HA 1E2QA 1FX0A 1DE0A 4HUQA 4BFXA 2CHQA 3T12A 1DO0A 1R5OA 2MSDB 4MKHA 4MDFA 4XWOA 1KSJA 4A82A 3AP1A 1WB9A 2B21A 2OEPA 3AGQA 1KK2A 5HZHA 4TYPA 5F2EA 2R2AA 4TMWA 1KDRA 2WKQA 3EPLA 2O8DB 4M9QA 4TLDA 4QG7A 3KQNA 2QMHA 1P4SA 4DLWA 5D3MA 3B13B 4LBZA 2WWGA 3NEJA 2NO6A 3W34A 3VKWA 4BLQA 1EG7A 1W2HA 4ILEA 4EPVA 2CL0X 1OSNA 1BO6A 1Q0UA 4OI0A 2OFWA 4HB4A 4QNMA 2R44A 1KNQA 1RRGA 2GXSA 3GFOA 2OZEA 1JJVA 2ASEA 1JR3D 2GJAA 1SVSA 1LF5A 4BWYA 3ZQJA 4LHYA 4ZV4A 4JBXA 1N3BA 2IC5A 4R2HA 1KO5A 3B5JA 1U81A 2X2EA 2ZSEA 4ZKDA 1G21E 2QT0A 1E6CA 2AR7A 2YWHA 1T8UA 1SXJE 4TMXA 2W2TA 1IOZA 5C18A 3QG1A 5H68A 4DSUA 3PR1A 2ERXA 4L8GA 2GEDA 3QKSA 4M2LA 1HTWA 1IONA 1E4VA 2J3EA 3QKRA 2VA8A 4MH0R 1XX6A 1C9KA 3Q85A 4HLDA 2VSOA 5JMTA 4DLYA 2WIBA 1SVLA 4M9ZA 3DOFA 5J40A 2VPPA 3IO5A 3HR8A 2FGKA 1KI2A 4I1VA 1M7GA 1J2JA 1P7CA 4DEXA 3UANA 1A7JA 1HV8A 3PFIA 1ODFA 1GVNB 2ZJ8A 2LKDA 3QVVA 2VTKA 3FKSD 4FWIB 4N3NA 1D5CA 3ZH9B 5KUTA 2XITA 4A0RA 1NMYA 2X77A 2F43B 2XSZA 2BBWA 2BOVA 3H2YA 4MQBA 3U3MA 1AS3A 4B2IA 3HP1A 1KGDA 3AB3A 2ORVA 2A78A 1OV4A 2ZJBA 4MRNA 1OH5A 4MRRA 4B3XA 4Q1AA 3BE4A 4K46A 3Q3JB 3NDPA 1YJ5A 3A1SA 2ZUCA 3LXXA 4TMVA 2GXQA 2HCJB 5AUQA 4DSOA 4JLMA 3EIEA 1W46A 3GLGE 3CR8A 4RFSA 3F3YA 4JLNA 3NBYC 1PLLA 2DWPA 3AVOA 2BBSA 3A1VA 1SZPA 1W0KA 3B85A 4JLOA 2FA9A 2YOHA 4A92A 4WA7A 5C46F 3T61A 4Q66C 3A1UA 3S1AA 3BB3A 2LKCA 2FZLA 3DHWC 2HEIA 4JL6A 1GFIA 5CJPA 3GLHB 4ZCIA 2QP9X 1US8B 1Z28A 4LCBA 5JWOA 4NZYA 1R5NA 4QGAA 2BV3A 5FOUA 2H1LA 2RMKA 2V54A 3W5IA 3K9GA 4XD7D 2J5XA 2JJ1D 3CR7A 3C4JA 4IVQA 3V4FA 4IVRA 1DADA 3RRYA 4D4KA 3U60B 4PC3A 1NVVQ 2RB4A 3WXMA 3ZQ6A 1R6BX 1B0UA 1NKTA 3GLGB 3BH6A 2C9YA 2QAGC 1P62B 4II7A 5LB2A 2HF9A 2J1LA 4LYHA 4C7OA 4M21A 3VR6A 4Q9JA 2A5DA 1MT0A 4LHXA 1D8TA 3DZDA 1ZNZA 3H86A 1RJ9B 3LQQA 3KKQA 2ZM5A 5JHGB 1W47A 4QHYA 3P32A 2WPDA 4TWZA 2VHQA 1GL7A 5TVKA 2Q3HA 4G3XA 4A8JA 2J7PD 3K0AB 5K8IA 3I4LA 4FCWA 4KAXA 1AZSC 1FQKA 1KKLA 3MLEA 3LH5A 1R0YA 4X8LA 5JCZA 4RY2A 3SFZA 4YMSA 2D06A 1R0XA 4A1FA 1G7CA 2QENA 1MV5A 2CJWB 2GBLC 3REGA 4I1SA 2PT7A 4LZZA 4GL2A 3AUXA 2DHRA 4ASUA 3FYHA 2YWFA 3EXAA 1W49A 2CVFA 4PX9A 3RLFA 2RKOA 1KI9A 1KHTA 4P3YA 2CE7A 1UADA 3B6EA 4BZQA 2VO1A 1TEXA 1WP9A 4D82A 4DDVA 2ZSAA 1BYIA 1E9EA 2IXFA 3QXJA 2V55B 3JVUA 4Q7KA 3SBDA 1TUIA 3UMFA 1TEVA 1RIFA 3SQXA 1V5WA 1PLKA 1ZD1A 2AD1A 4JJKA 3SYNA 1U8ZA 3TSOA 2JLUA 1X1RA 2BMEA 3C14C 4NCHA 1MH1A 1VG8A 3D7MA 4KLZA 1AQUA 3P26A 4HDCA 1SHKA 4NYJQ 2QGZA 2IUUA 3QQ5A 4LV8B 4WOPA 3FMPB 2C96A 2J7KA 3GQBA 4AI6A 5JJKA 1JB1A 2XOKD 3K0CA 4LY6A 4YDSA 1AGRA 1T8TA 3KJGA 3E1SA 1AKEA 1ZW6A 3CRQA 3WRXC 3RWOA 3X1WA 1OXUA 5BN4A 1NF3A 1NSFA 2VHJA 4DLVA 3VNVA 1KZGB 2VHTA 1OB5A 3GEIA 4DXAA 3THWA 5HZKA 3U44B 1A2BA 1NJFA 3ASYA 3MSXA 3O47A 1C1YA 4X8MA 5JRZA 2HUPA 3THWB 1SXJB 1GL9B 3UMRA 2EW1A 3LW7A 1Z6YA 3SJZA 3NXSA 3HU3A 3IPYA 5EE5B 2Z4RA 3ZVLA 4C0JA 2VP9A 3A8TA 3CF2A 4HB0A 4EFLA 5AUOB 3TKLA 1DVRA 3UWKA 4DLZA 5JI2E 4A2PA 1JR6A 1OFHA 2ORIA 3HYRA 2JLQA 2G0TA 2AKAB 2A5YB 2IYWA 3EZFA 2YVUA 3W5JA 1S96A 2CHGA 1VYUA 5EUQB 5DNYB 3B1YA 4M0LA 3TJZA 2CCGA 4JLDA 3ZDQA 3KX2A 4DLSA 3IDQA 4OK5A 4XOIA 1MO3A 1E2GA 3THYA 2AX4A 2R6AA 2QBYA 4FWTA 1ZP6A 4HLQB 4UXJA 3G5UA 3AEZA 3TVTA 5JWRA 1MR3F 5JCPA 1QF9A 5AR1A 4RVCA 3TR0A 1XPRA 5B2ZA 4MUAA 1RC8A 1WDTA 2C95A 4GT1A 5TARA 4MA4A 1C4OA 4I99A 4YQFA 3G0HA 3QPWA 4V02A 2O8CB 1EXMA 4PO8A 1GDDA 1Q44A 4AD8A 1EWQA 5AUPB 5EE1A 5FTJA 1KI6A 2WJYA 1OH8A 1G8FA 1Z47A 5E7MA 3THOA 3KQHA 2GK6A 1HEIA 1G8GA 2BEJA 4EAQA 5JRJA 2Y8EA 5EZ5A 2RAPA 2PX0A 1QVRA 4OKSA 4Q4JB 2DFTA 1T5IA 1DAEA 4BE7B 2Q9CA 4BLRA 2ZJ5A 3MFYA 1OHHD 4NCNA 5DHFA 4TLBA 4IKEA 4RD0A 5B64A 4CEJB 1W0KD 5DSZA 1AN0A 2Q9AA 5IT5A 2ATVA 3BB4A 4FIDA 2Z4SA 2ZRCA 3QSYA 1Z6GA 4A15A 4TZ6A 2R8RA 2ZQ5A 2WOOA 2IYRA 5EP1A 2ZSDA 5AJXA 1CJMA 2NG1A 5FR1A 4Q21A 4QRHA 3MUFA 1E9RA 2IUSA 3VMFA 4OK6A 5ANRB 1DG3A 4FMBB 4Q47A 3QIAA 4PXAA 4KFTA 2OAP1 4CIDA 4GZMA 3QNUA 2AK2A 3CRW1 2CVHA 1R7RA 1MOZA 4QNRA 1N5KA 4KITB 2ZI3A 2B6HA 3T1QA 1N5IA 2FFHA 2BKEA 2WSMA 4Z8XA 1NRJB 1E79D 1EFHA 2QAJA 1GRRA 3LQRA 3W3ZB 4FINA 1AS0A 1UKYA 2YWGA 4BECA 3TH5A 2LWIA 4OHZA 1XTRA 1A1VA 2BM1A 4F4JA 1XDBA 2YJTD 4XWKA 3SI7A 1TQ4A 4Q5IA 2PLFA 3L8ZA 1GTVA 3QXSA 3AVUA 4TZ0A 5JS8A 2V4ZA 5SZKB 3RRZA 4C0LA 2EWWA 4DCUA 5JECA 1IN8A 2A9KA 4IDQA 1PUIA 2JDID 1QHGA 1BH2A 4MKIA 5CDFE 1F2UA 5DIFA 3IPXA 5K8LA 2QP3A 4QBIA 4C2TA 2C8VA 2ZI6A 1XD2A 721PA 2OBLA 3ZVRA 1QHHB 1XPOA 3N70A 4WVFA 3NBZC 3W6PA 2J0UB 3SZRA 1EGAA 4H9GA 4HEJA 5HKKD 5EQTA 2ONKA 1G17A 2ZJZA 4PAOA 1G18A 3AF0A 2DY1A 1FTSA 3FHTA 2D74A 5BN5A 2ZYTX 3DKVA 2V9PA 2ZIAA 4PPFA 3QPVA 3DDCA 2QM8A 3BC1A 3IQWA 5E7IA 2WAYA 4UJ3A 3WBKA 3SQWA 2F3TA 5FBRB 4NYIR 1FNMA 1X86B 2CE2X 2Z0MA 4GPTA 4Q02A 4A6XA 2ODBA 3ND9A 4G0NA 4KFUA 1TPZA 2ZU6A 2ZS7A 5E3HA 1VYVA 4I81A 1VKJA 4U5XA 1YKSA 1YR6A 3NG1A 3OAAA 3OE7A 2XTMA 1QHYA 3FKQA 4IEEA 1L4UA 5DN6A 3L0OA 3RSLA 3VNUA 3L0IB 3B78A 2QAGB 3EPHA 3CH5A 1LVGA 3WYAA 4QJ4A 2R6CA 3LLMA 3SJAA 3AVWA 4TLAA 3PEYA 2ERYA 5FUYA 4LJ5A 4OYHA 1SKYB 2ZRJA 5FUXA 2YV5A 2EFDB 1RYFA 1XTSA 1NMZA 2OSBA 3L43A 3MCAA 3I92A 1E0SA 2QBYB 3WY9A 2O0JA 2VRWA 2XB2A 1RW4A 4N1AA 1GRQA 5FBWB 3B82A 5HR5A 4D26A 2XZOA 3Q72A 1E96A 4GI7A 1E0JA 5B58C 3BIFA 5KU1A 1QG4A 2GJ8A 2GVZC 2H7VA 2W83A 2QORA 3KKPA 1YR9A 3P27A 5FI1B 2IL1A 821PA 2ZI9A 4YONB 3EPJA 1KDOA 2OUKA 1IN7A 3TNFA 3EZ7A 2GXUA 3PCRB 5LD2B 5JEDA 2ZRKA 3TK1A 1RPZA 4K81B 1FNNA 2FWRA 3GLIA 1Z0JA 1D2MA 2H8KA 4TLCA 1GUAA 2GESA 6Q21A 3T1TA 2G77B 1NVVR 1HUQA 2V1XA 4FI3C 4LSGA 4EJSB 1CF4A 2VYFA 1EX6A 3BGWA 3CF6R 1JEDA 5KNCA 4QL3A 2AFIE 1S1CA 2H17A 1MO4A 4LJ9A 4MRPA 4US0R 5HCIA 4LBYA 1M7BA 1X3SA 2GXAA 2B7BA 4B2LA 4EQ6A 2F9MA
chains in the Genus database with same CATH superfamily
1SK8A 1HFWA 2JATA 2NPIA 2FZEA 4N4AA 3RCBA 3B38A 3CXUA 4BMNA 4CKEB 4FBMA 2V7PA 3C3WA 2D2XA 2D62A 1C3OB 2BFCA 4K3UA 4L3WA 4RVFA 4UBJA 5LZ7A 3ZIDA 4EPRA 5B1SA 4G5OA 4EOGA 4CEIA 2IZ0A 3DDZX 1UKEA 4L8VA 4URFA 4YAGA 1T1RA 3EC2A 1WMEA 4PC1A 5KB3A 3UT5A 1WW8A 2WK1A 1VMIA 3AYXB 3T3MB 4JI0B 1FUKA 4MGKR 4ZANA 4ZYVA 4Q48A 3K9BA 4IIDA 4KV7A 3ROPA 3N2KA 2FEWB 4CN9A 3DP9A 1NDUA 3OFKA 3SHVA 1DRWA 4V0OA 1HOXA 3F47A 1N7JA 3SR4A 3GLQA 5HTOA 4MR7B 3CEMA 5AKEA 4FZ3A 5KQGA 4GW3A 2ZIZA 3JARB 2C83A 1KE1A 1ENPA 4DKXA 1Y6FA 3JR7A 1OKKD 1BZYA 3H5IA 4KQ9A 2J9ZB 4HMQA 1KRWA 2NAFA 3ICWA 1G7SA 2HLDD 1FTQA 3MM4A 4Y2JA 1KO4A 2OLEA 4CM8B 4CV3A 1ATIA 1HSOA 3BD8A 1KVRA 3IEXA 3D8RA 1EJBA 1Y1PA 3LUJA 3BBLA 3AETA 4IDBA 3BILA 4JFRA 4AURA 2ZAOA 3KC2A 1XP5A 4J0IA 4YP1A 4G2TA 4YJ2B 4KXMA 3PB3A 1YA6A 2WYOA 1TD9A 4QOEA 4WADA 2PGAA 2KI5A 1NW4A 3F7MA 4TROA 5BSRA 1IXYA 1YB1A 3GJ3A 4ZXPA 1DO2A 4K8RB 5L3SA 1KQOA 1J00A 1JT9A 3K8YA 3EDCA 3LUKA 4RF3A 5FTMA 4LZJA 3NH9A 2DPGA 2D4HA 1E2DA 1MJNA 3V5NA 5B12A 3Q7IA 3N39C 4MQ6A 1QUFA 3K1AB 5K3FB 1F4PA 4C2AA 4CIWA 3MJFA 4QASA 4UZEA 4Q82A 1O6FA 1A8HA 4MW0A 3PHLA 1IIBA 2EARA 1Z45A 4X8OA 1U2SA 3VSBA 1VB5A 1KQ3A 4LXXA 3F2VA 4RJTA 2R1TA 3TTVA 4ZI2A 1Q7EA 3BREA 4R71A 3TW4A 4D8VA 3FYUB 4UBNA 5E95A 1GTRA 2G1KA 1WZEA 2WIGA 5F77A 4KR3A 3F49S 4BNUA 1ZH8A 4CCYB 2V0NA 3C3KA 2AOVA 2CFTA 1JXOA 2HPHA 2UUPA 3E3NA 4JBIA 1JKFA 4FNGA 4UUOA 4XLTA 5AHOA 4X44A 3FSGD 5K3SA 1IQ0A 5LC1A 5AYVA 1IZ9A 2W37A 3DC2A 2C5AA 1P5JA 1T4BA 2M2IA 3GFRA 4N6GA 3ZZMA 4D9GA 3DHNA 4WZAB 3G2QA 1ZRSA 1ONSA 1N3IA 4B44A 3WK7A 3ZU2A 2JLYA 1S4QA 1UBKS 2IUEA 4KLNA 3LPMA 2W2KB 2ZAGA 3VVBA 3MHTA 3RBVA 2O48X 4PYKA 3GCGA 4LZOA 4FT4A 2NADA 1RXSA 2W9XA 2FX3A 3RWBA 4KQEA 3FW1A 2WTAA 2PGJA 4OHOA 4AZVA 3WLRA 2ZS8A 4FN5A 4N5LA 3UHPA 2JLXA 2ID4A 3J7TA 1TB4A 1ADYA 4JI3B 1NY5A 5DKFA 3RFUA 2ENWA 5JE8A 2BJHA 3E7PA 3OM8A 4JJIA 4FDUA 3REFA 4E21A 4P86A 1DIAA 3ECCA 3PTZA 3PUVA 1T1IA 4IJUA 2JEZA 1N7GA 1M2HA 4CF4A 1LV8A 5LYYA 4M1YA 3DMRA 1T0UA 2EZ9A 4BN5A 1R0CA 5BOSB 5JZVA 3OEED 5I9TA 2W2LD 3I2YX 1L5KA 1C9NA 1CUEA 4KDCA 4FYVA 1LWNA 3R23A 3BXPA 4GF5A 4YB8A 5TMEA 3R9WA 3JVVA 3GJ8A 2ZT6A 3DE3X 1SR8A 5DP1A 1E2LA 2CK3D 3TUJC 5JMOA 3KDPA 3QUTA 2XCTB 2HYDA 3KJNA 1M5UA 2PWPA 3GJQA 5KHOC 1KHHA 2EP8A 2GBPA 2QRJA 4MDEA 4WDQA 3BZWA 2AF4C 1NNI1 4D8YA 1DC3A 3UMSA 1NG9A 1GG2A 2JRCA 4GMKA 3B1VA 4ZO7A 3RRFA 3KG2A 1SBCA 1XJ5A 3GJRA 5EUCA 3ZD7A 2ZDHA 2M6LA 3SKYA 4INAA 4ZEXA 4WZZA 4B2PA 1EHYA 3I09A 4AMZA 3C1AA 1E2MA 3OE5A 1UKAA 3WKDA 1CFZA 1PDWA 2DBRA 2HQOA 3UG6A 2J3MA 3IP3A 3ZBUA 4DG8A 5LUAA 4DIMA 2BCJQ 2P4HX 2Z6QA 1WU7A 1E5VA 1W76A 4LPSA 4B34A 4DLAA 4RTQA 3IV7A 3L01A 4Y9UA 3AF4A 3FXAA 1GDTA 3CN7A 4RU1A 2ZROA 4HNGA 5LKAA 4DCNA 3UFBA 3EBPA 2J32A 2Q45A 2XZTA 4J4HA 3GLUA 4RCZA 4ITVA 2EQ5A 1ISIA 3AOGA 4G8CA 4YR9A 2C7RA 4K6OA 2VP3A 5GY7A 4NYJR 5A03A 5JZOA 5DCUA 3V7YA 1VLLA 2QYSA 3B9BA 4O3MA 3FD8A 4J16C 4ZVNA 3BSYA 3MWGA 3NYQA 4YRSA 1J70A 1ESNA 1G20A 4UD6A 4IM7A 3JQCA 1H2BA 4Y8VA 4BQEA 3PUHA 1E2IA 1B8OA 3OCWA 2R48A 4I8XA 2NACA 1G1MA 5HHTA 3JATB 1HE2A 5G3ZA 2R6R1 2L0XA 3EUFA 3V1MA 4PC7A 4NNJA 1RCTE 2ZI7A 3BA6A 2JIZD 1IHPA 1QV6A 4ZAZA 3WGYA 4CTNA 4PANA 3D0OA 3EE6A 3PJEA 5HDQA 1XB2A 4KW7A 5DNEA 3OPVA 5EY5B 2XADA 1ZNWA 2VKTA 4QEZA 2H1SA 3VU0A 2P27A 2IQ5A 3AR8A 3KOWA 1MPTA 4KMRA 4PCAA 4QJ5A 5KVCA 1VCNA 3A4MA 2P62A 1TVCA 1EFTA 3L6CA 2LP4Y 1YZGA 2OGZA 1MXFA 1NI3A 1R88A 4KN6A 1A69A 3IRVA 4CUJA 1BOOA 2EJTA 2WJWA 2HTEA 2OP0A 4GMXA 4GRAA 5HRAA 5IZ4A 5JXIA 4M7WA 2WINI 1Y5MA 4I55A 4QEDA 2YXLA 1YQWA 2RGEA 1NXOA 3ILXA 1CJKC 2H57A 2W71A 5TRTA 1IK6A 3ZW7A 1G21B 2VDRB 1T3HA 4HK4A 4KU4A 1ZH6A 3SSAA 3TX6A 2IXEA 3Q8LA 2XT6A 5BWOA 1WPRA 4ID9A 3BK7A 3HRIA 1VJ5A 1WV0A 3BB1A 4FK8A 2I78A 4PRKA 1NVUQ 1AD2A 4HOYA 4UTXA 1I7NA 5D7BA 1HM5A 4LTNA 3FROA 3H04A 4IJ5A 5DLDA 3WDKA 1R3UA 1J42A 3ZLUA 5HYVA 3KUKA 2X8WA 3DPUA 4YRQA 3BL5A 1LS6A 2H11A 5BWMA 4EG4A 5GVSA 4H7EA 3VA7A 1DAHA 3VR4H 4AJ4A 4GLLA 4ZU3A 3RFXA 3W5UA 2PLNA 4LC1A 4BGEA 1AG9A 4ZO4A 1VI5A 1AGYA 1X7YA 4C6TA 5C4MA 3HB9A 2C5FA 2I4OA 4TS9A 3RKSA 3IX7A 3NTOA 1NJ8A 1G5TA 2FMUA 2P75A 3LY5A 5CLQA 3I9V6 4REQA 2C3YA 4WCFC 3I32A 4JCCA 3ZJ4A 4A0HA 5C1DA 4OIFA 4YECA 4O4IF 1BD3A 4MWDA 4Q05A 1HXHA 4UUAA 1EQAA 1FDVA 2F3RA 5H5JA 3TTTA 3U9LA 1AUQA 2UXCB 2X9LA 1CJBA 3QLJA 3PWZA 4Q16A 2NV2B 1X42A 2OPBA 2QUBA 2WUWE 3V8PA 2HV9A 4HDMB 4LK3A 2GDJA 4KQMA 2X8AA 4PSUA 3SLRA 3P9IA 5AK0A 4BOYA 5U9CA 2RSLA 4NU8X 3GDWA 4UPVA 3LQKA 2AZDA 4UM7A 4XWAA 3VBEA 4M0KA 2P2SA 5E9WA 1QKJA 5HS4A 1OBFO 2PZBA 1ZCFA 2YV3A 5BW5A 4QWMA 1NWCA 5KU7A 1DTWA 5A6SA 1CZNA 3L02A 1BE8A 3QF4A 2O3UA 3IJ5A 4KTTE 3ESYA 5BNFA 3BQNB 2G7MC 3Q7TA 3UMVA 1TJ3A 2RIPA 3CFYA 4M7PA 3RBAA 2HMYB 1AC5A 4G41A 4CPDA 3A6PC 3KPUA 4M0CA 3E7WA 4JP3A 4E4TA 2CV2A 1UK8A 1SC9A 1FDTA 2ZYAA 3AHGA 5C8XA 4KWCA 4KK4A 3EDYA 2G04A 4AKGA 4M8SA 3TSZA 1IM2A 2FN3A 2K4MA 2VJPA 5GM1A 1AA6A 3EZLA 3VX3A 4TYNA 4LGYA 2C03A 1H8HD 1N9GA 1LNZA 1S2GA 2WF9A 4RF5A 2NUTA 3STUA 3VSDA 3WL4A 2IITA 4G8BA 1GSHA 5CFRA 4BEWA 4IOKA 2K2QB 5LXTF 2QN6A 5CJ2A 3EARA 5BWNA 5IUJC 1JIIA 5CIYA 3QFTA 2F8TA 1ES9A 3OT4A 2NXWA 4IDDA 5LCXA 2H2FA 3ZK9A 4C03A 4G1VA 2DULA 2BI4A 1TIKA 3N7AA 4UASA 8GPBA 5KMGA 1N1GA 4QZVA 2Q29A 4HG2A 5IXSA 2UXDB 1SU7A 3OEHD 4QAJA 3QHPA 5JSZB 1GQFA 1Z8FA 4TL7A 2L82A 2R4TA 3A06A 1K7XB 2FE4A 2J87A 4KGXA 2QY9A 3GGSA 3W6NA 4A0GA 1OZ0A 3DBLB 1E66A 1KY3A 1RABA 4HVAA 4I2VA 5I01A 2OVFA 5LOVB 1IPFA 3BTVA 3D6NB 2ESRA 1ZK3A 3AIOA 3OBBA 3OM1A 4UDYX 5TJ9A 4E5UA 1JWBB 5FCDA 2BFMA 2AG8A 2F8LA 4KO3S 5CW1A 4FMDF 2XLCA 3U26A 1NMXA 3TTYA 3M83A 1QHXA 4MJ7A 1JMKC 1J2TA 3CH6A 4E2XA 4GI3A 5BN4B 4XDZA 2XWJI 3HMKA 4Z6KA 2VP6A 4GP6A 1HF3A 1ZUNB 4HNTA 1N4DA 3ZOKA 1JXMA 2IX3A 1Q1QA 5DI9A 3W9YA 1IM5A 1RP7A 1CULC 1D3AA 3GRYA 1QH9A 4TSRA 3P0RA 4MR7A 4ZT2A 4CIXA 4KKVA 2WU0A 5LU9A 3ZDCA 4RQAA 3BYZA 4RZSA 1OFUX 3RT7A 3G7SA 5E6SA 3WA7A 3VJMA 2IXGA 4ZFNA 3VTKA 3BG5A 1PJRA 1K4KA 2J9XB 5B4TA 1YF3A 1EEXB 1V8PA 1SMKA 4L2IA 3SXUB 2FFBA 5K6RA 4JP1A 2TECE 4ZJZA 4GKKB 1T9DA 3HY6A 3H75A 3PVSA 4UUBA 1U5CA 2IZ6A 2W4IA 1QX3A 2DFPA 3EVGA 1QIJA 4ZCSA 2IY9A 3KPYA 5JNLA 1FBNA 3CO0S 5FTLA 5JDIA 4WESB 1ZHFA 5JROA 2QQFA 1X7XA 5DGXA 4AS1A 4DDWA 2A5LA 2WD8A 4A8JB 1BKYA 1QFXA 4KXVA 4F92B 1PJAA 4Q4AB 2H63A 3L0SA 3WGLA 1OXXK 1M34A 1U0JA 3I9V1 4KCGA 1U7HA 3FYSA 1JBKA 3LNCA 4HUQB 5G0UA 3SSOA 3FPKA 3CH4B 2GCPA 3ZIAD 2HLHA 1J5XA 1BVYF 2PSJA 3GLFE 1I7SB 1JR3E 2SBTA 3OSZA 4OQNA 3VMMA 4GOJA 2GF0A 3FOBA 3OLXA 3OCUA 4LZWA 4NJMB 4MVJP 5G2OA 4EHIA 4UVDA 4E12A 4EUHA 4EUEA 1KSFX 4YMLA 5COAA 4BCCA 3WMFA 2BEUA 4J0DA 1A5TA 4UZFA 1WBJB 2R1VA 2BL4A 1F60A 5JLJA 1JNYA 3AI3A 3F6RA 3PX3A 4C05A 1QOQB 4UKDA 4D8XA 3KAQA 2FUKA 4YRKA 1LI7A 3ESDA 4CMIB 4TYWA 3F97A 1CR2A 2P1ZA 2GAAA 1IATA 2GM5A 1OOEA 4NK4A 3VU3A 1XCMA 4MVJD 4KWHA 3R7DA 2RHLA 4F4HA 1CQWA 5FOQA 5BSFA 4D9BA 2WMNB 2AC4A 5JANA 3L3BA 4PONA 3I30X 3SD7A 5KYNA 2CYCA 1GITA 1Q0RA 3DKRA 1S8AA 3SQLA 4BIIA 3P5BA 1AF7A 3FJ1A 4RMIA 1WXIA 5CP8A 3PNPA 4CR6A 2V0GA 5ED0A 2PRIA 3FCXA 4MKRA 3WQHA 3PHBE 4RFLA 1SHZA 1U5BB 2ID7A 2OFXA 1LVUA 1Y1LA 4JDUA 3MBIA 3KKNA 3TF5A 1VI2A 3AVQA 2IPLA 2XGGA 4FYJA 4BAGA 4C01A 1JR3A 1YMUA 2CLKB 3AW9A 4HGYA 2DTDA 1U5BA 3UJPA 3O8CA 4GDMA 2XQJA 5PNTA 3VDNB 5AHXA 4UBLA 1TK3A 3OLYA 1X19A 5EWMA 2AZ4A 4A8HA 2RAFA 2P9BA 3RC8A 3IT2A 3WRYC 5BVHB 2FAXA 4XD7A 1I51A 2PGDA 1WIWA 3OIYA 3OU7A 1SXHA 2FSUA 1YR3A 3UC9A 2OCAA 5JMWA 1UIMA 1Z6TA 3GZNA 3LVBA 3A26A 3QFCA 3VYTB 4Z4EA 4LOIA 3DFKA 1DLIA 2A1TR 2XECA 3JSXA 1LRLA 4OMDA 4M0UA 4BFUA 2EF0A 1MHTA 4X62B 3P9YA 3L7AA 4BBZA 5H02A 2TYSB 2C9CA 4KN8A 1GKUB 3ENKA 5F21A 4RZIA 3W79A 3KJIA 3O2NA 2A3NA 3JQEA 3KR0A 5F1KA 4NENB 1K5HA 2FPLA 3PEUA 5DTRA 4DYHA 4O4JF 1F8UA 1WE2A 4D97A 3RV3A 5HK9A 2NO5A 1QPZA 4EGQA 3VR2A 5CR9A 3CCBA 1GPWB 2HPAA 1RU3A 1E2BA 2II6A 3DMFA 4XW2A 1JE0A 4P7KA 5LL6P 2AL7A 2C4TA 2QD5A 4IG9A 4C4PA 1JFVA 3A9CA 4GQBA 1BWQA 3AXSA 3GPIA 1O6BA 4Z0HO 1PV4A 4LAFA 4L15A 2G6TA 2E4XA 3PBKA 4MV5A 3KO8A 2HHCA 1D2CA 3NHLA 3LYUA 4KJZA 3GDGA 1E2JA 4RLQA 1DDGA 3R0ZA 1Y0BA 1URPA 2YJ6A 3ON5A 2JLZA 2C3UA 2PUGA 3F73A 4M9RA 1VHTA 3HCDA 4TS4A 4N76A 2ZPUA 5DMHA 1VGVA 1RD4A 3OCZA 3AP3A 2HCTA 2Q6TA 1Y63A 3S1AB 4UBIA 3GL9A 5ALOA 2ZXUA 3CNBA 1ZJZA 2QE7A 2NZYA 2PY6A 4L76A 3ZXYA 1XDWA 2XKKA 4CKZA 4JR0A 3ZD6A 4QYIA 1Z5NA 3TKYA 3WLMA 3PHIA 1C8BA 4QICA 1I7LA 4GDFA 3AUTA 4KUEA 2H4WA 2XGMA 4OJYA 4RZUA 2HMVA 1H1TA 4GC9A 4IIUA 4PFQA 1ZUNA 1V1MB 1A27A 4MW5A 4MICA 1QG0A 2CF6A 2V45A 3R41A 4HQRA 1M1NA 2PLRA 2JLWA 3GVPA 2X9GA 3CNOA 1RXYA 3G8DA 4M0EA 2PKQP 3DNPA 2QLLA 2FPRA 2H1HA 4IFTA 1H0RA 4L4ZA 2FTKE 3PLAE 6ABPA 1OWMA 2PPLA 3TW0A 3CU5A 5FULA 3WYNA 5BN3A 1USVA 2VG8A 3I5MA 1Y3CE 3O8QA 2B2NA 2QGFA 1WF3A 4M88A 3MLAA 3JWIA 4CKCA 4YAWA 3H5VA 2YTZA 6YASA 1SM4A 2FUEA 4MI1A 5L4LA 2D2EA 2XX3A 5BNZA 3NP9A 1N2GA 1PZMA 4PNZA 5LKRA 3AL3A 4PR0A 1A96A 1YC5A 1EVIA 3H05A 3HJCA 3TBKA 4DR4B 4TMZA 3GLTA 1D1SA 2H65A 4QUIA 5MFPA 1SXIA 3Q3CA 1AUOA 1E62A 5ALWA 5IBPA 2O8VA 1JEJA 4GUAA 1KARA 3T7KA 3WIVA 1JRLA 4V2UA 2AN5A 1HLGA 2FEAA 2ZATA 4HJRA 4RK6A 3ZXUB 4ND5A 4WE3A 5AW3A 3CZ4A 1G64A 4GGPA 1Z0IA 4RHXA 4XYMA 1GPMA 1KEPA 1ORDA 2JIOA 3ZGOA 4LNUA 1LK7A 1MAHA 3AKDA 3TIGA 3NAQA 3TQHA 2MT9A 2HWYA 3CO5A 4G4SO 3BSWA 3G9XA 3WADA 1QZXA 2CDRA 1MQSA 1BN6A 1D4FA 3JQ8A 4PVDA 5KQMA 5JAIA 4O4HB 3UKDA 1QLJA 4F5ZA 3A1NA 4TL8A 2ZSIA 4B73A 2IYOA 4E14A 1V4NA 4LDPA 4O5AA 4E5DA 3SYLA 3UXEA 4YYEA 1E3MA 1CD5A 1TJYA 5JADA 4LWPA 5KTRA 2BGGA 4C14A 2UVPA 3ZHYA 1VMAA 3HKEB 1PSWA 3QWAA 2G5GX 4TL9A 1RWWA 5AWFC 4ENWA 2O8CA 5K8TA 4Y2UA 1BFDA 3T35A 2AI1A 5CT4A 1DV1A 3VC1A 5IAGA 3CPHA 4TRMA 1WXXA 1EK2A 4X6XA 4CR7A 1GTL1 1X70A 2PH3A 3KLMX 5E8RA 3AQ4A 1BCRA 1F06A 1P77A 1PWXA 1T29A 3DMTC 3EFOA 3OMXA 3QXHA 4GKBA 4LOAA 3PFHA 3CWCA 1SXJD 1U4OA 4OQQA 2EKPA 5HSGA 4XGKA 1T8RA 3BZUA 1EFVB 1X7WA 4RY8A 3PNKA 2X3UA 4WK2B 5CVDA 5DCWA 3UEOA 2LCIA 4K87A 1FBTA 3ZHXA 2QTCA 1P33A 1HE1C 2VQ3A 1FDUA 1NI4A 4FOTA 2E1PA 4FZRA 3LX4A 2YOFA 1XNGA 3I3OA 4K9KA 3KXKA 5BSGA 1QYXA 4DUZB 2ZYIA 1K3TA 4UNNA 3A4LA 3MJSA 4IYRA 4ZMBA 5HE9A 1K0UA 1E94E 2JFPA 2XE8A 4OXIA 2BMDA 1EP3B 4U7HA 5C31A 4CEIB 4YQEA 4TV9F 4EIWA 2Q1YA 3N0TA 1H8EA 2C7BA 3I9LA 3WYCA 1N2OA 1LB1B 5DI3B 1CEYA 3ZTWA 5FV7A 3KUDA 5T4EA 2Z43A 1IB6A 5TMBA 3W8FA 4OKIA 1IIRA 5C80A 4JLJA 1E5LA 5JQGF 1XHLA 4LQLA 4AW9A 2J5KA 5FOTA 1E64A 3GNQA 3OOEA 5CFPA 2OE2A 3V7NA 1BDIA 1GKYA 2B8NA 3PC8C 2ZJ6A 4MZDA 1KI7A 5C8YB 3R5SA 1ZN7A 3O0TA 5FFFA 3H8SA 5I7SA 4XSVA 1YCGA 4UCWA 3KVOA 3BFJA 4DIUA 5FWNA 3O9MA 5ISMA 1S2OA 1V2GA 2FOXA 3QYFA 5AESA 1VDZA 2C59A 5KWSA 4DR5B 2VPZA 4B80A 5J4VA 2B2CA 3GJYA 2FMXA 5JFOA 2X19A 3AVPA 5AXAA 1QDLB 1Z88A 1Y9EA 1WP4A 3K5HA 1N6PA 3OPYA 3OCJA 4C7BA 2QRNA 1UMDA 2VF8A 1NSYA 1T4CA 1P3JA 1T6NA 4FPXA 2YINC 3EH1A 2B37A 3ZZUA 4Y6QA 3BERA 1C9YA 4LMAA 4BQIA 2B1RA 3C3BA 4P08A 1S9HA 1I7PA 5HFAA 3EIQA 4ADSG 1GPUA 2IXTA 2DERA 2GZRA 1O5TA 2JD1A 2TMKA 4JBWA 2P90A 1KAMA 3R5FA 1XMSA 5EL0A 2IHKA 4LXGA 4MARA 4M83A 2QZ9A 1ZL2A 3CS3A 5I4IA 1DPFA 1O4WA 2I1QA 3HCFA 4NMMA 1GILA 1QRUA 1XZNA 4KXLA 4JI7B 4HLCA 2I91A 5L45A 2COEA 4LISA 2CUTA 4BO4A 3ZCVA 1PJSA 1N7HA 1Z7BA 3G68A 3IP5A 3P4UA 5CEFA 2CNWA 2PTHA 3PQ6A 1S6YA 1Y48E 2Z2XA 4W1PA 4CMEC 1LUAA 4W5TA 1W93A 3DZHA 4MV3A 4PRZA 4PYIA 2CBZA 5EWJA 3ZU6A 2VQEB 3PFWO 3JYNA 2IHBA 3VZSA 3UOWA 5CH3A 1RWQA 1YB7A 2H16A 2YIVX 2OXIA 1E2EA 1HDGO 2I2XB 2YJ4A 3AB8A 4FQ5A 4L9SA 3V4ZA 1R27A 4NI5A 4PX2A 1R8QA 3F96A 3IYLW 4NDAA 1RVDA 5ALYA 1J23A 4DEYA 3FTNA 3KKKA 2REBA 4R9UC 1EESA 4WZBE 3RJ5A 4KKXB 3FB4A 1UZNA 2WZBA 2AIRA 5BMOA 3TLBA 1RKXA 2R3SA 3DZIA 3OOYA 3TSYA 1A50B 2J4DA 4WK6A 1JEYA 4R5MA 1Y4SA 5KSPA 3EODA 3T5PA 5FL7A 4IDPA 1XC7A 1VTKA 4U9HS 3OQOA 4JOCA 2AUTA 1L9XA 1CEXA 3OQ1A 3SVZA 5CH5A 1U3DA 4R1LA 2XBLA 3C3MA 1UMBB 1BGWA 1XCBA 1R12A 2CNWD 1TQ2A 1WB5A 1IHOA 1TUGA 3JS5A 4YLGA 4Y0AA 4YJ2F 1JU3A 1HZZA 2HB6A 4RE6A 2DG2A 1QCCA 3FZEA 1ZSVA 5MDHA 2GX6A 2C4UA 5HFNA 2GWHA 3R3XA 5FOVA 4ARUA 1LDEA 2C3OA 3RJMA 4AN1A 1TAUA 3NEPX 3WGVA 2K2WA 3DGEC 3VC2A 4S1WA 5DH9A 2PD3A 3NHUA 2M9MA 4ZAWA 1XN4A 2Q5JA 4K9SA 4BMSA 3RIMA 1IUNA 2HBRA 4EUFA 1N0VC 5EMMA 4WUTA 1PEDA 2BUBA 2HMWA 4E33A 5HP4A 5DGIA 4G0YA 2VK8A 2AYYA 4CCAA 2XVZA 2YS7A 1NBMD 5AVJA 3OZEA 2CCJA 2YNMD 3AHCA 4JYCA 4ER0A 2EZUA 4KTVE 5EJEA 2YWEA 1MRSA 2IV3A 1L4LA 1HYBA 2AOUB 4EEXA 3FE2A 4OJMX 4XOUA 4UEJA 3D8UA 1DB3A 2BELA 1JJIA 1QIKA 3IIEA 4NZNA 4EHFA 1Z38A 3A05A 5EA2A 3H65A 4MVJM 4RPCA 4HWTA 2ZQZA 4RHFA 4M54A 1NUSA 3I64A 1PQUA 2AEMA 4BLPA 4YY3B 4G0WA 1I4OA 1L1QA 1LJLA 3BQMB 3NAGA 1XNQB 4EGFA 1IY1A 1IAVA 4YP7A 4EJSA 3MGAA 5DCLA 1SK9A 4G1EB 2AFRA 3U3KA 4B7CA 3BJEA 1FFDA 1PTJA 2FWIA 4FYHA 1CZKA 1GWNA 1TRHA 1WXGA 1XZAA 2IZ7A 3KVVA 1Z8HA 3PKZA 4GU5A 4UNPA 5K3AA 4EQ6B 4YUXA 5K5EA 3H1PA 3PG5A 2P5SA 3DAYA 4DC9A 2H0AA 3PXAA 3IQDB 5CA1F 2C98A 5IWCA 1U0NA 4LXIA 2ZFUA 4GPD1 5TGZA 2ZWOA 3ZLTA 3MMXA 4LGVA 3ZI0A 2ZI4A 1EP9A 1BDJA 1XF1A 1WXWA 2QL9A 3C3CA 2GD1O 1JV2B 3M3HA 3R3YA 4H6VA 4N0DA 4QXRA 4Y2VA 1QOPB 2WTEA 2CNLA 4BP9A 1S9DA 3R44A 3GLGA 3PGLA 1ZN8A 4DB2A 1P1RA 3ZDYB 2EW2A 3Q6IA 1JA9A 1WXEA 2QTBA 5E4FA 1RLTA 2WICA 5EQFA 1WDLA 2GZDA 3FUTA 5LP6C 2Q7DA 1U2ZA 2R00A 1TKCA 3L05A 1CR1A 2GAJA 1QP7A 4RZHA 3ZWBA 3MUNA 1Z5UA 2FEXA 1W88B 4WFKA 3UWPA 2Q8QA 1GCOA 1DIBA 1HC7A 3LDUA 3WGIA 4AWXA 1TCVA 2P4QA 5BVHA 4WECA 3KBBA 3AGPA 3ETEA 3COWA 2PO5A 1VG9B 3HR4A 5ITZA 1JFSA 2VT7A 4L0MA 2OT3B 4C20A 1M74A 2I3ZA 2P4UA 5DRTA 5SY4A 1SA0B 3NHFA 5LZ9A 1PL8A 4E03A 3KTDA 4HZIA 4LBVA 5FNVA 1AMOA 4XPIB 4TKZA 3NM5A 4CL0A 4E22A 2QM7A 3ABZA 3DFIA 3H3FA 3N74A 4DJDC 3QFFA 3G9QA 1ZS9A 3FTDA 2WJ3A 2D5LA 2HUNA 3BMCA 3GLKA 3VPCA 2XHEA 2G9RA 3AUKA 4HP8A 4X1YA 5JAZA 3ZDZB 4BLVA 4RTPA 2XMBA 4NMXB 2F1OA 5DM4A 1NXSA 2NU8A 4HGQA 3CPSA 5JG7A 1ZRNA 2VC2B 3RVKA 2YXPX 3B70A 4CKWB 3KFXA 5LDDC 5CXUA 3RIGA 4EFNA 1QG6A 3GP8A 1WDWB 4TXMA 1Y3IA 3D8BA 4TX1A 4WZBA 1K6IA 2YHUA 2GD0A 1I2ZA 1HKUA 4UNQA 3ZR4B 4CYMA 1UAAA 4ACBA 3OF5A 4NZPA 5DTJA 3VI3B 3W9UA 2WRZA 4WJKB 3ZTYA 1ONOA 3BXXA 5SV2A 2Z8YM 5INTA 2XNHA 3SBXA 2QLTA 3CNNA 4PTLA 2VH1A 2IVFA 1SRRA 2V7UA 3DT9A 3FGPA 5IAOA 1OU0A 5HIJA 2QTMA 4N5MA 2QLFA 3LYHA 3IBSA 1XHEA 2YFKA 1K2WA 4NE2A 4WERA 4IDHA 1CKEA 1E3WA 3KM0A 1IBMB 1WZ2A 3L8MA 1Z0UA 3BJIC 3HKCB 4YAJA 2G9QA 5ES3A 3TUZC 3HJAA 5I3CA 8AT1A 5K0ZA 5IBQA 1QU3A 5KTKA 5EXXA 2CUNA 1IBCA 3L6UA 5GONB 2A4KA 4BS9A 5HGXA 1JAZA 3LDGA 4GM1A 4DN6A 3NDRA 3IE0A 3U6KA 1DBQA 1DC5A 1TMGE 1NJ1A 3AY7A 4PS1A 2PMEA 5K0JA 2CLIB 3NYRA 3UXMA 1VL1A 3ZIUA 1E63A 1OROA 1IVNA 4A4DA 2Q5CA 5I7AA 5TXGA 4OHYA 3LA6A 5LWQA 3MC1A 3NT2A 4JEUA 2K87A 4O2BB 3M1AA 3O9VA 1P5HA 3QJ5A 4DVJA 1HWYA 1M2OB 4XGNA 3L7KA 2IYYA 4KI0A 1PFUA 1QG2A 2OBBA 4N6NA 4YDHB 3M81A 3T7CA 3PEFA 4RKRA 1LLQA 1ND5A 2FSVA 2O05A 2IQIA 3C6ZA 4I1UA 4MYCA 5AKHA 4KOEC 3W9BA 1UEXC 2B4RO 2UZ1B 4XAQA 4V3CA 3BIWA 4CG1A 2WWIA 3EZGA 3QBJA 4G0ZA 2E1RA 3KVRA 4RQUA 1L2TA 2FPGA 4B8WA 4NICA 3GGJA 4HB3A 2YNMC 3H6KA 3WL5A 1DFIA 3WMEA 8ATCA 1FP7A 2GFIA 4OHRA 4PGMA 3R4VA 2JKVA 1KH3A 3T7EA 1FRZA 1GZVA 2PH5A 4EPXA 2QT9A 1BRMA 3ROQA 3ONNA 4E11A 5GPBA 1L5OA 3LM8A 1E6EA 3DW1X 3OFNA 1TZCA 1I2MA 3E58A 3M4NA 1RIIA 1OH7A 2AHRA 2FSHA 3I9MA 4LFCB 3VDQA 4C1NA 4QM7A 1XO1A 3ESCA 3OFSA 2NSLA 2PDAA 2AQKA 1IPHA 3R24A 4YROA 3A6HA 5EHIA 5BUCA 1XTZA 1BD4A 1TE2A 2C5GA 5KOHA 3PL5A 1PK8A 2XUZA 2CV0A 3P4YA 3CCCA 1NV9A 5KJ1A 3EVBA 3E9DA 2QTAA 1IXRC 2ZIUB 1Q2UA 1T6YA 4GMHA 3X44A 4B79A 5ALXA 4GXTA 5FKJA 2YY6A 1I1QB 4K2AA 4WBSA 3X1YA 5BMVA 3QBDA 2ORYA 1RAFA 5B58T 3PLNA 1I9GA 4XFKA 1KAEA 1GQYA 2MMCA 1J5EB 3NBKA 2FOLA 3UA3A 1XEWX 3JAKA 3WWYA 2RK6A 3GHYA 3M70A 5FRDA 1G7TA 2ZE8A 3AKYA 1MAWA 2YCLA 3C43A 1KI6B 5F4BA 1E99A 3KR9A 2J0UA 2O2CA 4DC0A 4EF5A 9LDBA 1Q1NA 1KY4A 2RHOA 4LHVA 3E81A 2F7SA 1U9IA 2R4QA 3TD6A 1Y81A 1G8SA 2WIJA 3N1UA 2A0XA 3PUKA 4K9LA 4ARZA 4EH1A 1U0EA 3EIXA 2Q1XA 3I04M 4PLTA 4YMHA 4MV6A 1UDXA 2IVZA 3L5KA 4AUEA 1SXGA 4D81A 4ZMRA 5E38A 4ECAA 3BJRA 4S1PA 2ZVQX 5FD8A 5J23A 5AVQA 3KOMA 2IDZA 4BNKA 3B8HA 3EVFA 5HBRA 1KPGA 3F3MA 2PCJA 5T4HA 1IN6A 2XXAA 4TXNA 1BWRA 1U98A 3G3EA 4MHSA 4RD3A 4XE5A 1G16A 3RBZA 5LQRA 3E48A 1N36B 3NWOA 4LYEA 1WW2A 2F62A 3D4NA 2AEEA 3HGTA 3X1JA 4WWHA 3K7EA 3TE7A 5C37A 1KDPA 4E08A 2FG7C 1ISHA 2CEAA 2IU3A 3RABA 4YV2A 5LPNA 3HFRA 1SHTX 3RTEA 1KJQA 4W5NA 2JGNA 3RBXA 1PG5A 1EFUA 1NVMB 2VSXA 3N8NA 3PQEA 4RPKA 3H1FA 3EPKA 3AINA 3GROA 5I4CA 3OD5A 4FEYA 2XGJA 5T64A 1B0ZA 2O3RA 1GM5A 1UPUA 2PWYA 1HE8B 4HH4A 4U2KA 2ZCUA 5AKYA 3B5IA 2ZBEA 5DBFA 1SOWA 1DJLA 1JHYA 3CV3A 3K0AA 5DI3A 3SE0A 1P0QA 3VM6A 1K7SN 5LXTB 3ZJVA 2C2YA 2C2ZA 2X1VA 3ICQB 1U80A 4XSHA 1A8SA 2VF4X 3GUVA 4KIWA 3TAUA 4B5LA 4D02A 5A4FS 2JFNA 1WXHA 2EKZA 3G1TA 4KGDA 4J2HA 4KLAA 5D00A 5F2OA 3VU8A 1U2EA 2VA9A 3ILHA 2ZVDA 5BUZA 3CJTA 2H4YA 1T6BY 5LQAA 4FDTA 4QAQA 4XKJA 4P38A 4J1TC 2VT6A 1B1AA 3BUSA 1CY2A 4P84A 3AF5A 3TOCA 1G5FA 1LFDB 2W6PA 2ZAIA 4E7PA 1E3TA 4G0UA 2Z1DA 1UDRA 1XTVA 2GM9A 3DLPX 4L73A 1YZFA 5FWXB 3HL4A 4AMGA 1R37A 1B23P 1OZGA 4PZEA 4Q01A 4K8OA 4BEJA 4QTYA 1MMFB 1MDBA 2ECFA 1QHEA 3E2IA 3P9RA 4M87A 3HBNA 5C5EA 4CM3A 4GECA 2EDCA 2H92A 3GD7A 3O8LA 5KMGB 2A9OA 3RTBA 1YUNA 3MWEA 1ZJ4A 4LDRA 1YHNA 1TT7A 4F12A 3R3UA 4I6EA 3TMKA 1PS0A 2CFRA 4ZCLA 2HRBA 5DZSA 1VHLA 3WLOA 4IX1A 1IHXA 3I0ZA 4ZXFA 3BWEA 5BSUA 4INPA 2GKGA 4Q3CA 1HK7A 2HNBA 5AJYA 4IWNA 2AJ8A 3MBOA 4DJTA 1NLUA 1PSDA 1ORIA 1EX9A 4B3HA 1JBEA 5JD3A 4NMLA 2E48A 4GOLD 3DEAA 4E2ZA 5LP1A 4XUEA 5ESWA 3NV9A 4JBLA 1LY1A 3BHNA 1N6RA 4NLLA 3SX0A 4LYDA 3LBFA 4HNUA 1CZUA 2Y77A 2C7VA 3FUCA 2B94A 5A06A 2QRVB 2YMPA 2UZIR 1RQGA 4HX2A 3SK0A 1EDDA 1J09A 1MGPA 1TA4A 1ZOLA 4KMSA 5CM2Z 4YALA 1BHSA 1ZM9A 2VP5A 2BT4A 2C78A 2PNFA 2WDZA 1E7QA 5L3VA 1T3GA 4K9OA 3X1XA 2FZKA 1WMFA 4UU7A 1BHO1 3C4VA 3PTAA 1T34A 1SUSA 4JUCA 4Q03A 2X7HA 3MRXA 4QFBA 4Y9DA 4CR8A 1XG5A 3ELDA 4RJ2A 3NEYA 3G02A 4JKYA 1UXOA 2F43A 2OWEA 2Z09A 3F7TA 2K7FA 3NKLA 1O57A 1XXHE 4W1SA 2WVJA 1BXRA 2HA4A 3OZVA 5G1OA 1UC5B 1ODKA 3HDGA 3QVXA 3LBHA 2H7XA 2VDLB 3K8ZA 3L5OA 2CXXA 3QNWA 5ECDA 1D1TA 3F98A 5IAJA 3WIBA 3KETA