1AJOA

Circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-127
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
GHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSNQTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIRCULARLY PERMUTED (1-3,1-4)-BETA-D-GLUCAN 4-GLUCANOHYDROLA
publication title Crystal structures and properties of de novo circularly permuted 1,3-1,4-beta-glucanases.
pubmed doi rcsb
source organism Paenibacillus macerans
molecule tags Hydrolase
total genus 49
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1997-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ajoA00
2R0FA 2VW0A 3B9CA 5L73A 5LK5A 1D2SA 4YGCA 1W6QA 1DGLA 2WT1A 3A0KA 3FLRA 4FPHA 5JOXA 2PHFA 4K20A 2DVGA 3USUB 2ZA9A 4FQZA 1S0GA 1KJRA 4XZPA 1LOFA 1A3KA 1LEMA 2DU0A 1JBCA 4HANA 4YM3A 1IKPA 3AJYA 2H0BA 1KJLA 5GLUA 5JOWA 1V6IA 4XOGA 1LHOA 1RITA 2TEPA 4M01A 4Y26A 5KXDA 1H9PA 2OUHA 3KM5A 2P2KA 3H0OA 4ITCA 1W6OB 1MS0A 5T5LA 3BODA 4XBQA 1DIWA 2SLIA 2ZHMA 3VKLA 5CAZA 4Y20A 3ZPYA 2DUPA 4K1YA 3ZXFA 4XJ9A 4XIOA 1LU1A 2A3YA 2E51A 1OFSA 3B01A 3OPZA 3WNXA 2ZMKA 2ZHLA 1DYPA 4YZ1A 4TYSA 1WLWA 3N36A 1KRIA 1Z0HA 3VUOA 2ES3A 1N1VA 3AP6A 1LHNA 1AVBA 1Q8QA 1OQ1A 1LTEA 1VLNA 3AYEA 2GNTA 1VAVA 4I30A 3JUUA 1O4YA 1MZ5A 3R4SA 1SCRA 3WDUA 4YGEA 3M1HA 3I8TA 2A6XA 1DFQA 4Q1PA 2VW1A 1GZWB 4YW4A 1Y7BA 3O0VA 4PF5A 2UWAA 2R1DA 1IS4A 3SITA 1S1AA 4UW6A 5E88A 2YV8A 3WG2A 4FOYA 4YM1A 1DQ2A 1AX1A 2A6YA 1FV3A 4DRRA 3GNEA 2PHUA 4M00A 1DQ0A 4YZ3A 4DS0A 1H30A 2D43A 5T5JA 3OY8B 1BZWA 4GWMA 3NV2A 3RS6A 1CPMA 1G9AA 2GMMA 1G8WA 4PBPA 4XXAA 1MS4A 2RHPA 3C2UA 1UZZA 1FATA 5IK5A 5GZFA 3D4KA 3WHUA 5DUXA 1DQ5A 1Q8OA 2JJ6A 3PMEA 2VXRA 1WD3A 5JMCA 2UURA 1UAIA 3HMYA 4XTPA 2D6OX 3IM0A 4TZDA 4M3CE 3WCRA 1FX5A 2GMPA 4XXPA 3NV4A 4XBNA 3D6EA 4XJAA 1BQPA 1LU2A 3M3QA 3MEPA 2YXSA 4Y1UA 4XJ8A 1V6MA 2WSUA 1N3PA 1AXYA 1WCSA 2CWMA 2WQZC 4YM0A 2VW2A 2YZ4A 3RSJA 3BOPA 4M3CA 1CR7A 1V6KA 2YY1A 3AX4A 2WNEA 1SLBA 1V6OA 2D6LX 2JD4A 1FYUA 3B3QE 2JE9A 4MYEA 2YROA 5H9SA 4XJWA 4ZXKA 1LOFC 5JOYA 3WLUA 4ASMB 3T2TA 2WJSA 4M3CF 3SLIA 3ZXEA 4Y1VA 5DUVA 4CTEA 2WSVA 1W6MA 4GWNA 3UK9A 5GZGA 1AXZA 1WLCA 3B69A 4WVVA 1I3HA 2ZGKA 4ATEA 2UU8A 4PCRA 3WUDA 4YG6A 4P9WA 4XDQA 5JDBA 1G9CA 1WW6A 5IUQA 2WT2A 1W6OA 4XTMA 1WW5A 3JU9A 3M2MA 1TEIA 3T1LA 3ZXLA 1GNHA 3WDTA 1UL9A 2ZABA 4IQPA 2D6NA 2JE7A 2A6VA 1FAYA 3AP9A 1LGCA 1DQ1A 2JDZA 1AZDA 1LCLA 4LBQD 1DHKB 3AZYA 4YW3A 2YMZA 2FHRA 4ATFA 3IMNA 1S0BA 1GLHA 1URXA 1SLAA 5FRAA 3ILNA 1WLDA 3AZZA 2JKBA 3SH5A 4AVVA 5KXBA 3ILFA 1QGLA 1LHWA 3Q9OA 4Q2FA 3AFKA 3IPVA 1C1FA 3INAA 3O12A 1UN1A 3OBRA 4NOTA 4BM8A 1GZCA 4H55A 3L2YA 1G86A 2EXIA 1G9DA 4R9CA 3FUOA 3AXDA 3POWA 1CN1A 1GZ9A 5CBLA 3AP4A 5CA6A 5GLWA 3V0BA 1AXKA 2HYKA 2D6MA 5CB7A 4R9AA 3VV1A 3WG1A 1DLLA 2UWCA 4LBQB 1JXNA 4FP3A 3V64A 2P3KA 4AGVA 1CJPA 1JYCA 1LODA 3WUCA 1QOOA 4WV8A 3ZXJA 1W6NA 3IN9A 3M3OA 4HL0A 4Y24A 3OYWB 3WDYA 1LHVA 2DVBA 2NYYA 4YG0A 4AYUA 1LGBA 4GA9A 5IK4A 1R1ZA 3V65A 1APNA 1X50A 2CTVA 5H9PA 3ILRA 1IKQA 2CNAA 2ZGRA 4OZXA 3UJQA 3B00A 4FOQA 4Q1RA 4Q8LA 1RIRA 2CWSA 5GLTA 4RA0A 4BLIA 4PBOA 1LGNA 1HDKA 1HLCA 2DTYA 1LULA 3OJBA 2GMEA 3N7LA 1SBDA 5AVAA 5JLVA 1AJKA 1ULEA 4BPZA 1G9BA 2PHWA 5GZEA 4RL7A 1SLIA 1GNZA 1MS5A 3WDXA 3LSDA 2D6PA 4DRVA 1BJQA 1NXD1 2GALA 1PZ9A 1IS5A 4ISQA 3LCPA 1LESA 2A5ZA 1W6PB 4XILA 4Y22B 4L8QA 3ZSMA 1Q8SA 5KXEA 3RQ0A 1QOSA 1OKQA 1LEDA 2W08A 3WVJA 2ENRA 1CVNA 4BLJA 4BOWA 2EAKA 5E89A 2XB6C 5JOZA 2D3SA 2D44A 1GKBA 1ENQA 2PHTA 1S0EA 3N3HA 2AUYA 1SFYA 3TB0A 1W0PA 4YLZA 1YIFA 3UJOA 4XMIA 1WBLA 1SACA 1CPNA 1HQLA 3M3EA 2ZGMA 1MR5A 1JW6A 5DG2A 1GICA 1XQNA 1VALA 2WT0A 3QLQA 2AENA 1ENSA 2C5DA 1YI7A 3ZSLA 4UW5A 3WOGA 1ULDA 3OBTA 3APBA 2OUJA 4YW1A 1YYNA 2ZACA 1CONA 3DGTA 1BKZA 3SISA 4K21A 1ULFA 4Z8BA 1QNYA 4ZKTB 1ENRA 1PZ7A 2R1BA 2EXJA 3WV6A 5EYXA 2ZGQA 2AR6A 5GLVA 5DZFA 1MVEA 5SV8A 1S0DA 1A8DA 5DXDA 3NV3A 1WD4A 2GDFA 3R05A 3SNMA 2DUQA 3O0WA 1MVQA 5T55A 1AX0A 3ZYPA 1KITA 3M3CA 4FVVA 4XHXA 4YM2A 5IT6A 4YW5A 1SBEA 2WKKA 2VY0A 1PZ8A 5CNAA 4GXLA 2XG3A 5EYYA 4YZ5A 2E7QA 1N47A 5E8AA 2JECA 3T1MA 2A70A 1QOTA 1IS3A 1S0JA 2OVUA 1YO8A 3USUA 5T50A 3MW3A 4P9XA 5GZDA 3D5OA 1IS6A 3AK0A 1LOBA 3AYCA 1IOAA 2ZMLA 1GANA 2ZGNA 2A71A 4YGDA 2A3WA 5GLZA 1BXHA 2LTNA 3BIWE 5JVVA 5GJ6A 2PHRA 1G9FA 2EF6A 1AJOA 2V73A 2D6KA 4XE9A 4LBQA 4Y1ZA 1LOAA 1UMZA 2VUAA 3ATGA 4CZSA 1SLLA 3HN1A 2ZZJA 2ZGUA 4FPGA 4FP2A 1HKDA 1DQ6A 4KBBA 3ZVXA 3ENRA 1DYKA 3OYWA 1WUVA 2DVAA 3OGGA 4XYXA 2ZHNA 2A3XA 4XBLA 2ZGSA 1GSLA 2FMDA 1GYKA 3PVEA 2DU1A 5HCAA 2W68A 2E6VA 3O5SA 5IK8A 1YXWA 1HQWA 1MACA 4R9BA 5DZEA 1Q56A 1VAMA 3FFZA 2GNBA 3RMYA 3TAYA 2DV9A 4YZ4A 1FV2A 1QKQA 1C57A 3ZXKA 4UW3A 3BTAA 5T52A 1MS3A 4BMBA 2DVFA 3O0XA 1JUIA 2ZGOA 4YG3A 3ZSKA 2D3RA 1WW4A 1LHUA 1KDKA 1WBFA 2AGSA 1F31A 4GALA 3V0AB 1W6PA 4DFSA 1JOJA 5FREA 4M3CB 1GZWA 4YZ2A 1C1LA 1YRZA 2EALA 2OW4A 5GALA 3MW2A 2V5YA 5BYNA 3VKNA 3AP5A 4XJZA 1LJ7A 3QCWA 1ZM1A 4XMAA 4P9YA 1F5FA 2DURA 5F5QA 3FUQA 3A0NA 3OY8A 1W6MB 4WZFA 1SLCA 2ZMNA 3AJZA 1MS9A 3RMXA 1JN2P 1WW7A 1MZ6A 1MS1A 1QF3A 4FPFA 2D7FA 2EIGA 1N1YA 4XIKA 4XHBA 2AH2A 2CYFA 1QU0A 1ULCA 1S0FA 5HCFA 3W59A 1V6JA 5DUUA 2E7TA 1DQ4A 3LSEA 3R4UA 5GZCA 2DVDA 2A7AA 2W52A 1SCSA 4C1XA 4FQ4A 1UKGA 3AP7A 1LOGA 4FPEA 5F9TA 2ZKNA 5DG1A 2R49A 3A4UA 1SBFA 2R16A 4U36A 2P3IA 4FPOB 1J1TA 5T54A 1W6QB 4SLIA 1KQRA 5T5PA 2EXKA 3POSA 4ISRA 3MW4A 5H9QA 3SH3A 3NWKA 2A6ZA 2CL2A 2ZGTA 2ZHKA 1Q8PA 3IPVB 2AREA 2P37A 1V00A 4PQ9A 5T5OA 4JCKA 4FOWA 4LBMA 3AYDA 1V6NA 3FLPA 4AWDA 4LBNA 3N7KA 1BYHA 1LECA 3V0BB 4LBJA 4Q8KA 1Z78A 3POYA 4FPLA 1F9KA 2SBAA 1N1TA 1S0IA 1ULGA 2DTWA 2ZBJA 2P3JA 3MPPG 4FPYA 4FPKA 1UZYA 2Z42A 4F83A 1O4ZA 1AF9A 1D0HA 1FNZA 2VH9A 1W6NB 5GM0A 2CY6A 4Q26A 4AGRA 1QDCA 2DUOA 4Y20B 3VKFC 3GALA 4YGBA 2VU9A 1Q8VA 4FOVA 2C9AA 4GKYA 2R0HA 4UW4A 1S0CA 3FBYA 1CESA 3NV1A 2ERFA 5DZGA 5EXOA 3ZYRA 2BQPA 1GBGA 4GKXA 4AGGA 1SLTA 4NO4A 3AZXA 2WLQA 4LBKA 4W65A 1U0AA 2Q5TA 4WVWA 1N3OA 2NZ9A 4YFWA 4AVSA 4K1ZA 1VIWB 1NLSA 1I1EA 4Q27A 4AVTA 4D69A 4YFZA 4C1WA 1A78A 1JHNA 2D3PA 3VKMA 2ZGLA 4CRQA 4DQAA 3RG0A 5KXCA 2A6WA 3WG3A 2ARBA 3HR9A 1ONAA 4FPJA 4YW2A 2G4IA 3AYAA 5H9RA 4FPCA 3WDWA 1G7YA 2DYCA 2EXHA 3WG4A 4XJUA 3V0AA 1EPWA 2KM2A 2GN7A 3AZWA 3PVNA 5DUWA 4BMEA 5IK7A 1LOEA 1JYIA 1DZQA 2ZAAA 2E53A 1KDMA 3VKOA 4Y1XA 1QMJA 3N7JA 1W0OA 2NMNA 2DWRA 1GV9A 1FNYA 1UX6A 3N7MA 3PVOA 2GNMA 2P34A 3FLTA 2LALA 3KQRA 3W58A 1AX2A 4Y1YA 1UPSA 1RINA 4JC1A 3SH4A 2PELA 1DBNA 1N1SA 1LOCA 1C4RA 3AZVA 3WHTA 4LBLA 3AXEA 2PHXA 1H9WA 3U4XA 3RRDA 1CIWA 3WCSA 2I2SA 5EWSA 1CQ9A 3WZ1A 1MS8A 2B7YA 2W39A 1ZA4A 2ARXA 3WDVA 2ZGPA 4DPNA 3I4IA 2GNDA 3N35A 2NM1A 1QNWA 4LBOA 1B09A 2A75A 3PJQA 2NP0A 3UL2A 2NN8A 1N3QA 3ASIA 1QDOA 2AYHA 3IKWA 4BQ1A 2GN3A 4JRAA 4R9DA 4U2AA 4Y22A 1V6LA 2NMOA 2UWBA 1LENA 3CNAA 3DUIA 5HCBA 4P14A 3ZSJA
chains in the Genus database with same CATH superfamily
3KF5A 3H42B 2VW0A 2UY8A 4KWKA 5LK5A 2XJUA 4AHYA 3Q8BA 3J8F2 3NJYA 4PDWA 1DGLA 3A0KA 3GHNA 3ZN4A 1VBD1 2VZVA 5JOXA 1U5ZA 2PHFA 4ASKA 1KGYA 2VNVA 4PT6A 2ZA9A 1S0GA 4XZPA 1Y4WA 2MNGA 4QX1A 4UFJA 1RL3A 4JGZC 4XCBA 1JBCA 1R091 4OLLA 5CFDC 1NY71 4LITA 2X09A 5C33A 5IVCA 1KJLA 3TEWA 3O7OA 3RZLA 4XOGA 4CCLA 5LK7B 1H9PA 1WCUA 2OUHA 3ECQA 4WM7C 3SQOA 1NCQC 3VBSB 1MS0A 5T5LA 1QJX1 2I07B 2ZPXA 3BODA 3BPSA 3BVCA 4JDNA 3KVBA 1DIWA 4ZPIA 3ZM8A 4BWOA 2SLIA 2ZHMA 1RUC3 2IC1A 3EO6A 2Y0OA 3VB9A 3U4SA 3A7QA 3ZPYA 3M3IA 5JI7A 3ZKUA 4QAWA 2ZTNA 4V1PA 5LY2A 2KA3A 4XFGA 2CGNA 2E51A 3WNNA 5A7WA 4YVSB 2XUMA 4XCAA 4CDQC 2ZHLA 2Q8CA 1WLWA 2WINB 1Z0HA 3AP6A 2PN5A 1AVBA 1OQ1A 1A6CA 3AYEA 2GNTA 3UGGA 2P4EA 3CL1A 4Q4Y1 1U5YA 1WCQA 1A34A 4EE2A 4YGEA 3ZFEB 4QXKA 3M1HA 3SMHA 3TWIA 3R0RA 3H9AA 4L11A 5FZMA 5JZGC 4P5HA 1DFQA 3LB9A 5JXGA 4J6GA 4Q4X3 2VW1A 1JZ8A 3FX3A 2RM22 2JG8A 4XQDA 4YW4A 4BQWA 2QKDA 3N9MA 1U12A 4PF5A 2R1DA 3EMRA 2BBVA 3UNPA 2ARAA 2YV8A 5LWBA 4FOYA 4B4QA 1HRV1 1DQ2A 1R083 1AX1A 1W3XA 3M7AA 2A6YA 4D6RA 1JYXA 1K42A 5IAVA 5FMOL 1YQCA 2FBEA 3H3UA 4OUMA 4A7YA 4XUTA 2WAOA 3WINE 4Q4V1 4O7XA 2ADDA 1EYBA 5FZ1A 3C7OA 5BXXA 1VBE3 4XXAA 4QKNA 2IXHA 2BYVE 1W8ZA 3HNMA 3HJRA 3HAGA 4Q4W1 5A3UA 1Y43B 5I91A 1FATA 4HSLA 3VBUA 5D8AA 2LRPA 5GZFA 2WQ8A 4BQYA 1ASJ3 1DQ5A 1UY2A 2WDBA 1AL0G 2ET1A 3IIIA 4MGQA 5JUVA 5C71A 3CJIC 5CKMA 3WF2A 1VBD2 4FO9A 5FOBB 2D6OX 4MO3M 4AQTA 4BQ3A 4M3CE 3TBDA 4MGZE 2JB4A 3OBAA 2RDQA 4XXPA 4CE8A 4XJAA 2TBVA 5I0UA 1V6MA 5FPUA 2BGPA 1WCSA 1R092 1MPXA 4MSVA 4YM0A 2GU9A 5FZEA 1CR7A 2YY1A 3FHAA 4CU6A 3AX4A 5LA1A 2AEYA 1SQ4A 1PIV1 3S30A 4M4RA 3AKPA 2HWD1 4OI4A 5FV3A 1GOGA 4ZXKA 4LTAA 1QJZA 3IBMA 1NLRA 4QX3A 1IGOA 3CHXA 3OPWA 1B35C 5LBEA 3JD72 4Z07A 5DUVA 2RDSA 2BUKA 2Q8DA 2JE8A 4BU2A 2BV4A 2VM9A 3VL9A 2UU8A 4CEWB 4C0BA 2QZ3A 2IVJA 4YG6A 5FWJA 5FYUA 1AR93 4XDQA 2VOWA 5LRRA 4HKOA 5CFCA 3NNMA 1WW6A 3MBWA 4NROA 1W6OA 3NNJA 4OI1A 2ET7A 2VVFA 4UOJA 3I3MA 5FZBA 3OBZA 3JU9A 3H7YA 4I01A 2QE3A 2QQJA 1I6XA 3WDTA 5F1RA 4HLTA 1RVF1 1GR3A 4IQPA 1CAUB 3H8XA 2IFWA 2GH8A 2A6VA 3U0ZA 2VD7A 1AZDA 1K5JA 1UOBA 2HBTA 3GHMA 5FJHA 1A8MA 4LBQD 3WQ7A 1DHKB 4YW3A 2WIIB 2YMZA 4QXHA 5C3RA 1QQP1 1URXA 2WUHA 5KXBA 2JKBA 4CEYA 4NHXA 4FAHA 3H1WA 3Q9OA 3KWVA 1BBT1 3IPVA 4Q2FA 1C1FA 3H3ZA 1GP5A 3INAA 4FFFA 1NCRC 4H55A 3L2YA 1G9DA 1X8EA 2WL1A 3WP6A 3AXDA 3POWA 1CN1A 1GZ9A 5CBLA 2WN3A 1UY4A 3V0BA 3K51A 4LO5B 4CDXA 3DPRA 1E5SA 3WG1A 2VZQA 4WZCA 5HCBA 2IZWA 2G9GA 1ZA7A 4AGVA 1LODA 1JYCA 3OUIA 3WUCA 4FTBA 2GH2A 3ZXJA 4QB6A 2ARCA 5FTTC 4D94A 3OG2A 4GH4A 3WDYA 4HL0A 4E8DA 5FXZA 1LHVA 5F5CA 1F5JA 3GBGA 4YG0A 3BUCA 1LGBA 1TVGA 4Y3OA 1VPHA 3D3AA 4OUSA 4N53B 3VGIA 4ZHNA 3KGZA 1H8TA 1X50A 2CTVA 4ZS3A 3ILRA 1IKQA 2CNAA 5H9PA 3VDDC 4Q1RA 1WCDJ 3PIJA 1RIRA 2CWSA 4Q8LA 1DLCA 2YC2A 2ZX2A 4RA0A 3RI9A 1HDKA 4CCDA 3OTFA 3OJBA 5AVAA 3U78A 1AJKA 1JUHA 3Q8AA 2FQPA 1US3A 2HKXA 1EY2A 4NAMA 5GKAC 4EN9B 1PGL1 3RI8A 2BW8A 2PAEA 2D6PA 1AYM3 2UY9A 4DY5A 3EHKA 5HI0A 1W90A 2A5ZA 1W6PB 4CXXA 3B94A 4QWNA 4YYOA 5JMOA 1UO9A 5KXEA 2W08A 1LEDA 1VP6A 2BNNA 2ENRA 1ZZ8A 5LW9A 1GQHA 2EAKA 2RJ2A 2XB6C 1FOD1 5JOZA 4PIZA 2HLEA 4UXAA 4BQ4A 2K46A 3UYJA 2XDVA 3N3HA 3OEBA 2XXZA 5C7GA 4YLZA 5ABJA 1YIFA 2VPVA 4P9IA 4RQPA 2RM23 2J1VA 1CPNA 1MR5A 1QJU3 4JZRA 1OH4A 5IVYA 4O65A 4L99A 3TNPB 2UYAA 2ZEYA 2JG9C 3OUJA 5C3QA 5LCWL 4DS0A 1QJY1 5F5AA 5HXMA 4YW1A 2W2IA 4IGPA 1YYNA 2QQPA 2ZACA 2EIBA 1CONA 4Y4YA 4AVBA 3VD4A 1BKZA 1E5HA 3BI3A 1W8NA 1YQ5A 2WS91 1QQP2 4Z8BA 4ZKTB 1K5MC 2R1BA 5KHKA 5EYXA 3VD7A 2P17A 3VBFA 1BHGA 4H3WA 4CDWA 1BBT2 1W2OA 2CDPA 1BMV2 1OH3A 2FDKA 3T08A 2JDPA 5SV8A 1A8DA 5FQ0A 3R05A 2GDFA 2RS52 4RHV2 5A7WB 1FT9A 2E9QA 4ZS2A 4CCMA 3PU3A 4YW5A 4AVAA 3ZO0B 2WKKA 4LO6B 4WM8C 1PZ8A 2GSYA 5FYSA 2VTFA 4GQ7A 2R32A 1PMHX 1K12A 2BJSA 2VTXA 4DXZA 1Q3EA 2A70A 3GJBA 3VHNA 1QOTA 1DGWX 2VNGA 1YHFA 2BBAA 1UOGA 3USUA 3MW3A 3WF0A 4HN0A 3GBFA 3AK0A 3BCWA 1LOBA 3J7NA 1IPJA 2ZMLA 1GANA 2ZGNA 3CJXA 4YGDA 1VRH3 1RUG1 3ACGA 2VMGA 3MIDA 3BIWE 5JIAA 5GJ6A 2R062 3MUZ1 2B39A 4NMIA 5FP9A 1OPMA 1OF3A 4XE9A 5FIXA 4JV4A 3JD73 3I59A 3CEWA 4XPVA 4AF9A 5K9YA 4XF9A 5G04L 4S2HA 1F4HA 4KG0A 2PTMA 2RR12 1J3PA 1DQ6A 2XKPA 2B4KA 5FPZA 4DZGA 2QQIA 4LT5A 2Y6HA 4N8MA 2FCTA 1GSLA 3KVAA 3KLSA 4RGAA 4JKKA 1HB4A 4IW3A 4Q5OA 5D8AB 5EJ3A 4YNIA 3U07A 3VBUB 1YXWA 1FOD2 1HQWA 1KEXA 4RSUA 4ES8A 1VAMA 1T6BX 2IFRA 3FFZA 1UQXA 2BTVC 2DV9A 1FV2A 1O6UA 4YZ4A 1COV2 3RWKX 4UW3A 2HEVF 2WBKA 5FZAA 4BMBA 2DVFA 1VRBA 3FBMA 3O0XA 4RS5C 3JBG1 3ZFGA 1WW4A 2AGSA 4EWEA 4HZFA 4D6SA 4HPKA 1GZWA 5FCCA 4B29A 1OT5A 1W0NA 2JEMA 4P9LA 1C1LA 4AI8A 5GALA 2EAAA 4V2VA 2ZOEB 2WS92 3RZMA 2HWF3 2V5YA 4I3GA 3NSTA 3RYRA 4ZU4A 5BNPA 1NA1A 4W6YA 3D82A 3KCYA 3NQHA 1O3SA 3ZFFC 1GWKA 1S2EA 1QXJA 4CP2A 5J1XA 2PHLA 5C8CC 2ZMNA 5KHJA 2ZCWA 1QXRA 2HWC3 4NPMA 2YB7A 5C5TA 2R7EB 1WW7A 3D8CA 5L7OA 4KWLA 1J3RA 1QF3A 3ITQA 1C8M1 4N9IA 1VBB1 4NIAA 5DMYA 4UBHA 3OB8A 4XHBA 3OEAA 2HWB2 2X10A 3FWEA 1IG0A 1POV3 4EWAA 5HCFA 5FZDA 3W59A 4BK5A 4DXRA 4NIHA 4BH9A 2E7TA 1IZ3A 5L19A 3P6BA 4N43A 4RGGA 2DVDA 3GGLA 2FZ2A 1SCSA 4HKWA 4TWTA 5ANQA 5F9TA 1RUG2 1TMF3 4FPEA 3TEYA 2W92A 2R49A 2ZKLA 3A4UA 1SBFA 1RUF1 3HOBA 2P3IA 4FPOB 4K9SA 2W3JA 3VBOC 4B4RA 4MH0E 4SLIA 5LA0A 3K3OA 2Q0AA 3PURA 4CEYB 2BWCA 4NHYA 5FYTA 5T5PA 3MW4A 3SH3A 2JB8A 3NWKA 4NHKA 4AQSA 1IPSA 3IPVB 1DGWA 1Q8PA 1WGPA 4PQ9A 4UFHA 1ZBA3 1ND2B 1UCXA 1WMFA 2J1RA 2OXBA 3AYDA 4LBNA 3HNYM 3N7KA 1TME2 2OA2A 5LASA 3AL5A 1H8VA 4TLGA 4CDXB 4EROA 3V0BB 3DPRB 3CZJA 4FPLA 5ACA1 1NXMA 4LK7A 1N1TA 1MQTB 2DTWA 2VL4A 4FPYA 4MX3A 1O4ZA 1FNZA 5IVBA 4IEWA 4WM7A 3RYPA 1NCQA 4Y20B 4YGBA 3THCA 1JYNA 4UFKA 3E6DA 2VQUA 4OVEA 5JPNB 4LE3A 2X05A 5BNOC 3MF6A 1H8TB 4GKYA 2R0HA 4UW4A 4AFAA 1CESA 3NV1A 2ERFA 5DZGA 3NKGA 1GBGA 2VCBA 1RUJ2 2WLQA 1OLRA 3C7EA 4CDQA 2YBSA 5F6KA 3QH6A 4WVWA 4FAGA 4HVQA 1JOBA 5BNNC 5CISA 4IDZA 1NLSA 3ZYFA 4Q27A 4AVTA 1I1EA 2FD8A 1RC6A 4I0WB 2D3PA 4AW7A 1V9U3 1AL23 5FLHA 2XVGA 1VB4A 4CRQA 1BK1A 2VCMA 4GMP1 3WG3A 2CDOA 4LPLA 4JVAA 1WA6X 2VZRA 4FPCA 4XDPA 3QACA 4KG8A 2EXHA 1SDDB 3ZMOA 2FCVA 3KSCA 3NJXA 4CCNA 5JZGA 1PGSA 3V0AA 4GJZA 4GMP0 1C8M2 3NAPC 1J1LA 1D4M3 1DZQA 2PLV2 4P5YA 2E53A 1ZBE1 5I0DA 2AZ5A 4Y1XA 1U5XA 1W0OA 1W28A 5ABJB 4RQPB 4PLMA 3N7MA 1X9PA 2Y60A 3GDBA 2G1MA 2WWUA 2LALA 3KQRA 4PJYA 2R063 4OZOA 3SH4A 3Q8CA 1DBNA 1LOCA 2WO7A 1H2LA 2RV9A 4XC9A 3S7EA 1KS4A 1O4TA 5FZ0A 4E4HA 5KC6A 4LBLA 2PHXA 1H9WA 1RMU1 1W8OA 4XUPA 2RR13 4IE4A 1CQ9A 4QPWA 2G19A 1TG7A 2ZGPA 3O1MA 1RUE1 3E5UA 5FPVA 2VG9A 4CDWB 2I74A 4DPNA 4CP9B 4NN0A 4FBFA 4P9GA 1ZRFA 2R30A 1BCXA 3CJIA 4LBOA 3ZYHA 5HBAA 2VC9A 3PJQA 4W6XA 5B4NA 1QDOA 1ZZBA 3ETQA 4H7MA 4QQHA 4BQ1A 1R1A3 2MEV2 3CU7A 2ZS6B 4U2AA 3CNAA 3DUIA 4B7KA 5IVJA 3O1VA 2EICA 1NKGA 4H7LA 4AI3A 3LDBA 1FMD3 5L73A 5APAA 3TEZA 1OSGA 2PQSA 3FLRA 4N7UA 2VULA 1I5ZA 4BISA 4GIQA 2YGMA 5LEJA 1UY3A 4XF3A 4OHYA 3T09A 4TSVA 3FN9A 2QDNA 4C8DA 1PM4A 3USUB 2RG4A 1VJ2A 1VR3A 5LB6A 1W8FA 2QVSB 4GB31 4KMQA 1KJRA 1W2TA 3LA3A 3UETA 3ZYBA 1LEMA 2DU0A 5FP3A 3SEEA 3HQUA 4YM3A 3MFAA 3O1TA 1B35A 2HBUA 4D7SA 3UGFA 5JOWA 4JGYC 1RITA 5KXDA 3WF4A 2XHKA 3T4HB 2WRAA 1EAH3 4YVWB 2W95A 4M0HA 1OXCA 3W21A 1TNRA 3I59B 4KNCA 3CIHA 5F2SA 4G3YC 4AR2A 4B3NA 4G9SB 2ZEWA 3NW4A 4IXLA 4WVZA 1ZVFA 2JICA 1PO11 2JDUA 2E33A 2QQMA 4XJ9A 4XIOA 1AR71 1XNDA 2XJQA 1UXZA 1UNBA 2ZMKA 1BEV3 3KGLA 3Q8EA 4H14A 4N90A 1RUI2 5I8YA 3E6CC 1KRIA 3TNQA 2A1XA 3VUOA 2KD7A 1TE1B 4PLOA 1REFA 1Q8QA 1UF2C 2WZ8A 3IDEA 1XNKA 2DF7A 4NHLA 5FZGA 1LRHA 1VAVA 3TYJA 3WQBA 1QH7A 1RUH1 5FKCA 1IHMA 3W20A 5JSPA 1VMHA 2PA7A 3ZFGB 4AXOA 2E63A 4MV2A 2A6XA 1DGRA 4LIUA 3WQ0A 1O8SA 1EUTA 1NZCA 4EN7B 1NCRA 1GZWB 5HV0A 1Y7BA 1VBA1 3O0VA 3CF6E 4IUGA 2C26A 5FMDA 3U10A 1RMU2 4NPLA 1S1AA 3IB3A 1SG3A 5E88A 2WFPA 4PIXA 3ZYIB 1ZYBA 3J4UH 3DECA 5BNPB 4P08A 3RJRA 1NA1B 1TME3 3P1IA 4M0NA 4YW7A 1FV3A 2XUEA 3GNEA 2VMDA 4YZ3A 1OC1A 3GXUA 4QX5A 4X6QB 2WLPA 5T5JA 3RYKA 1BZWA 2VVEA 1PK6C 2YHJA 3NV2A 3AMHA 1CPMA 4LUMA 3C7FA 2Y6FA 1G8WA 2WNUC 2O1QA 1K3IA 5A7PA 5L7OB 1QIQA 2RHPA 5EQUA 4QX7A 5D1IA 4MUVA 4I3PA 4IEQA 3VHOA 3VLBB 4XDOA 3BN6A 4IV3A 2JXAA 1W9SA 2VXRA 5F37A 3P3NA 3TN91 3HMYA 2YGLA 3N9QA 2YPJA 3NMBA 5IJRA 2VMFA 5C6CA 3GZAA 4FCAA 5F32A 5A70A 5CYYA 1RHI3 2JWPA 4N43B 3D6EA 1RUJ3 4GB32 1LU2A 4BE3A 3S57A 5JXIA 3KT1A 4QXCA 2WQZC 3RSJA 4GULA 3LE0A 5FLIA 5J37A 4OMCA 1JTZX 5F6LB 4FTSA 4TLFA 4XAEA 5DDJ2 2JD4A 2FDGA 4CSWA 1MEC1 5T3NA 4RFRB 2QFEA 3WR0A 5H9SA 2IXCA 3M70A 1LOFC 1W2AX 4ASMB 1F4AA 3ZR6A 4Z2AA 3ZXEA 1PO12 3EXUA 2WSVA 5GZGA 4QKFA 3UK9A 3D0SA 2QNKA 2Y33A 4ATEA 1I3HA 2XR4A 5I0RA 1CIYA 2HWE1 2JG9A 1IPKA 1VMJA 1QEXA 3FFQA 4WM7B 2OZ6A 4HFSA 1RUH2 4XF0A 4META 5G05L 3AKTA 3HIFA 3KT7A 5LATA 1FAYA 2VMIA 1LGCA 1DQ1A 3U14A 5FP4A 1WMXA 5LA9A 4I2OA 1LCLA 1S2KA 4CDQB 3AZYA 4BZ4A 4BHPA 3IMNA 4QPGC 4AEDC 1GMMA 1S0BA 1GLHA 4AVVA 4CUAA 2O8OA 1QWRA 4Z2WA 3ILFA 5A3WA 1QGLA 4AFBA 2MEV3 4DUXA 3AFKA 4BM8A 3KCXA 2IXKA 3O12A 3OBRA 3O1UA 1CX4A 1GZCA 2VO5A 4LORA 2VOTA 1G86A 2EXIA 2IXJA 4XFBA 4R9CA 4FFHA 2XWJB 1W9YA 1GOFA 2RMU3 5JZGB 1H1IA 2D6MA 4QU2A 5A1LA 4ES9A 1DLLA 3HVDA 4LBQB 1JXNA 1OFNA 1VBC1 3FL7A 4QX0A 4DEVA 3WNKA 2JDHA 2J1SA 1O91A 1CJPA 1FPN3 2UYBA 2DCTA 2R073 1QOOA 2VXJA 1F35A 3ELNA 3GM8A 5FZFA 3TN92 5K0UC 5FZHA 3T2PA 5AC92 2VQ0A 3CO2A 3MIGA 4Y24A 3OYWB 2VMCA 3IMMA 4PI0A 1ACCA 2A73B 2NYYA 4AYUA 3HT2A 3SCGA 5IK4A 5J98B 1R1ZA 2H6CA 3POIA 4QX2A 3CDZB 4S2GA 4W50A 5FK7A 5FZKA 3SCFA 3V65A 3ZR5A 4I0AA 4OZXA 1Z7S1 5TSWA 4A3ZA 5FJKA 3ES4A 4ARYA 2W94A 3WW2A 1LGNA 1HN0A 2BVVA 5FYHA 2GMEA 1NLQA 1VRH1 2JKXA 2WZR1 2WN2A 1G9BA 1SLIA 5L9BA 1HIXA 4QDQA 3BIEA 3VZJA 1PX4A 1XNTA 1NXD1 3WT3A 1RUI3 2R043 2BFUS 3AMNA 5D21A 3THTA 1OOPC 1W9WA 2CAUA 5EZWA 3RQ0A 5FXXA 4RS5A 3R6SA 4J1XA 4BOWA 4XZUG 5E89A 2HWE2 1RUD1 3PJYA 2D44A 2QQVA 2BVBA 2PHTA 1MZFA 2WYFA 1JI6A 2QQWA 3OGVA 3AVRA 3NJVA 2XBO3 1HQLA 4Q0QA 2WFF1 2WWSA 1GICA 1XQNA 3N4MA 1VALA 2WT0A 2FCUA 1W8UA 1YI7A 3OSDA 4AZZA 1B35B 4EZ4A 3APBA 4NWVA 5C8CA 1HJGA 3PUIA 3DGTA 2LS6A 4GWIA 1UMIA 3SISA 4K21A 4RYDA 1ULFA 2VMEA 4E2SA 2X5IC 5IVEA 1ENRA 1PZ7A 2EXJA 1ALYA 3JXSA 4LLFA 1DP0A 1D0GA 3OOXA 5DZFA 4CUGA 4JKLA 4YVSC 1LNSA 3AC0A 3LOIA 3SNMA 2HWF1 3O0WA 2MHFA 1AX0A 1NY72 4MADA 4FVVA 3ZYPA 4XHXA 3K75B 5EP9A 3URFA 3PIGA 1XYNA 1CX1A 1PGW1 3HT1A 2VY0A 2WAAA 2XG3A 2QUOA 1QJX2 1CGPA 2WNOA 4KU7A 5LBFA 4MGYE 5DAPA 1S0JA 2WR9A 2Y0IA 1YO8A 3HBKA 1P8JA 5GZDA 1SEFA 4P9XA 3D5OA 1IS6A 3AYCA 1IOAA 3GZUC 1NCRB 1HXS1 2ZX1A 1POV1 5GLZA 5JXJA 3SC7X 3VZMA 2XWBB 4A3XA 1Z7S2 1NX9A 2PHRA 5KHHA 2WZPP 4Y5SA 1AJOA 2I45A 2V73A 2D6KA 4DEQA 2VCCA 3ROUA 2CU5A 5LRSA 3ATGA 2GC0A 1CAXA 2J1EA 4JAAA 4QGMA 4Q4Y2 1MZEA 2ZXQA 2RS11 1BK0A 1Y3TA 4FPGA 1UU5A 1RTVA 3EBRA 3NKTA 4OI0A 1CZVA 5DN2A 3ENRA 3VZKA 4AEMA 4XYXA 5JR7B 2ZHNA 4HBNA 5A80A 1AR63 3O1OA 3ZLIA 2FMDA 1XSQA 5FYYA 1JMUB 1NAEA 3S0MA 2XLFA 5FOJB 2AC1A 2YDEA 3PVEA 4NE9A 2W68A 3O5SA 5BNOA 3MF9A 4HT1T 4Y5Z0 5HCAA 5IK8A 1MACA 1AYN3 4R9BA 4IV3B 3WD5A 1Q56A 4EWDA 3AMMA 5C3PA 5EHDA 5KR7A 1Q43A 1QKQA 4GWJA 1HRV2 5FYVA 3J26N 5HV4A 3ZXKA 2YG0A 1H2MA 2Q30A 1JU4A 3QOPA 3A22A 5T52A 2V5DA 5BNNA 4FXKB 4JTOA 5FPAA 2WFF2 4Q4V2 1LHUA 3H1MA 3J8F3 1WBFA 4OUEA 5FLJA 1F31A 4GALA 4DFSA 2O0OA 3M8LA 3PDQA 2WYSA 1XE8A 3M4FA 4Q4W2 4R52A 3ZXDA 2GC1A 1RUOA 2JDMA 4YARA 1VB2A 2OW4A 3ON7A 5JPMB 3BYWA 2V4AA 3MW2A 2GAUA 1ODNA 2ZX0A 3WF3A 3NAPA 1TNFA 4XMAA 4DNYA 5I8TA 2VAUA 4J1WA 5F5QA 1KS5A 3A0NA 3RZHA 2EA7A 3OY8A 1CD3G 3RDIA 4CEWC 3SXWA 3NNLA 2B45X 1AL21 4A6OA 3VBHB 5AC93 1OLMA 1PIV2 2RJLA 4LKFA 2Y26A 1N1YA 5CIRA 3HQXA 5J3UA 3B02A 2CYFA 4QQPA 2HWD2 2ZJCA 2BOIA 4LEJA 3BTZA 5FY9A 5C4WC 1S0FA 4HSJA 3WY6A 2W1SA 3SKVA 5FBZA 1V6JA 4IE0A 5DUUA 3LSEA 3SCHA 5GZCA 2Q1MA 2A7AA 4CU8A 4AHXA 3RJ2X 1WMEA 3AP7A 1HXS2 2Q8EA 5A33B 3RFRA 5DG1A 1VAKA 2RE9A 4KH9A 4PDWB 4EQVA 2BRTA 5EIYB 1XU1A 4UI9L 3POSA 3PUHA 3I2FA 1XE0A 3K4AA 1ZX5A 2RS12 2ZHKA 2P37A 5T5OA 3VBRA 3OCPA 1NUKA 4LBMA 1D7PM 1RVF2 4AWDA 3FLPA 5J09A 1LECA 3WXPA 5JSOA 4AVCA 3T4VA 4LBJA 3ZN6A 4IV1C 2XVLA 3S7IA 1WLTA 1ULGA 4HVOA 1UD1A 2P3JA 1ZZ7A 4QQLA 2JENA 4FI9A 4CCCA 1NT0A 1FXZA 5GM0A 4QGLA 3I54A 4AGRA 2PXJA 4MGSA 2VR4A 2IVIB 3G6JB 1SMVA 2VU9A 5FYMA 5A6ZA 2DBNA 4IEVA 4XFAA 4DMIA 1CZTA 1VBD3 2BQPA 4AGGA 1SLTA 3ABZA 3AZXA 3CMGA 4QQ2A 3DCQA 4F3JA 1PX3A 2NZ9A 1CAWA 2ZX3A 4HMZA 4S2DA 4AFMA 4AVSA 5FP8A 3MLKA 2FDJA 4D69A 3VDBA 2RJKA 1A78A 1JHNA 1R093 4K8RB 2FDFA 1O5LA 1REDA 2GC3A 1X9TA 4DIQA 3PL0A 3RWNA 1ONAA 3C7GA 4FPJA 5A32A 1PNGA 4EN8B 1YFWA 2JG8B 3AYAA 4OHXA 1W03A 1BLZA 3ZN5A 4DB5A 3B93A 1EPWA 2GN7A 2PMWB 3ZXGA 3WQ1A 1OF4A 2PHDA 3PVNA 4BMEA 3ZPOA 1LOEA 3ACHA 2RS31 1JZ7A 5C5UA 2NMNA 2DWRA 4Q0VA 2VTXJ 1PGL2 2XLAA 1OLQA 4K7JA 4QX8A 3FLTA 2D5FA 4H2AA 5C9AA 1REEA 2XGXA 4JC1A 2NQYA 3MYXA 4IEOA 4RR3C 4JHTA 2AACA 4COWA 5C8CB 3AXEA 1E57A 3L2HA 3CZUA 4Q4Y3 4UBGA 3J7MA 3RRDA 1CIWA 3WCSA 4CYDA 2WNUA 2I2SA 1NE4A 2B7YA 3KCCA 5CZKA 1SFPA 3QD6A 1XYOA 5L9RA 2WO1A 1LR5A 2GNDA 1PVC1 4Q29A 1ND3C 3UL2A 1N3QA 3K3NA 2GN3A 4JRAA 3RGBA 1QJY2 2NMOA 4IEPA 4NJ4A 5CVRA 3POFA 1LENA 4A42A 5LBCA 2R0FA 4LQRA 2OQ7A 3MLJA 4YGCA 4JDMA 1W6QA 3FJSA 2WT1A 4FPHA 3TRSB 3DXTA 1GP4A 2YUEA 4K20A 4KBZA 2DVGA 2PYTA 1YWKA 3MLLA 2VOXA 4LLOA 5K8SA 2OQ6A 4Q4W3 4D7TA 4HXCA 3U37A 1LOFA 1PNFA 4LKSA 4WBBA 5AVPA 2YC0A 1IKPA 1UY0A 5D2AA 5GLUA 5JR2A 2QQUA 2W0XA 4UF0A 4Y26A 1LHOA 1RHI1 4M01A 1DDLA 5CFCB 1C28A 1UPIA 2P2KA 3H0OA 4ITCA 1JOPA 1W6OB 2ATFA 1OD5A 1OA3A 1OUXA 3GCXA 2VZTA 3VDCA 4LHNA 2XMLA 5ISLA 1YQ2A 3KHCA 2IXIA 3E5QA 1NZIA 3WX5A 4K1YA 1EV11 4IEXA 3ZXFA 4QPIC 3OPZA 1OFSA 2FDIA 5AFBA 3OGJA 1DYPA 2HWD3 4TYSA 5IW0A 1H2NA 5BNOB 3N36A 5FMCA 1SPPA 3BKZA 2ES3A 1N1VA 2C24A 2ORZA 4PI2A 4PHZA 4RD7A 1LHNA 1JYVA 2OPWA 2XKOA 3NNFA 3ZKYA 1RGSA 1W2NA 4ZU7A 4L92A 3QBQA 2K0GA 3JUUA 4QPGA 1O4YA 2E31A 3R4SA 1SCRA 2DCYA 2ZZQA 3PNAA 3DEMA 3UT0A 3WDUA 5BNNB 1ZRDA 4MVTA 1AR81 3I8TA 3SEPA 1W9FA 2B46X 1PO21 1YQ8A 4LO7A 4KGQA 2XHNA 4Q1PA 4XFHA 5I93A 5CU1A 3OF1A 3I49A 4JGZA 5CEHA 3LEKA 5FYIA 5CFDA 3SITA 3VZLA 5FZOA 1HRI1 2J1TA 3NAPB 1AUYA 2D40A 4GH4B 4DRRA 4XF1A 4MGKE 1YEWA 4KGGA 1GQPA 1H30A 1PVC2 4JQTA 5K0UA 2D43A 4JX0A 3ZOIA 1OUSA 3OY8B 4AI9A 3K77A 3JBG2 4GWMA 3RS6A 1G9AA 2GMMA 2F6BA 1QQP3 1J3QA 3LZZA 4PBPA 5F3IA 3DYMA 3C2UA 3KF3A 1OURA 1WCKA 4QKDA 1UZZA 4BQXA 3JB8A 4DXTA 1UXXX 2V09A 5JWPA 5IK5A 1BBT3 1C5IA 3D4KA 3NNGA 2FDHA 5DUXA 2GZWA 2JJ6A 3WNOA 3OGRA 2W9XA 3ZYJB 2RS53 4RHV3 3S5QA 2X29A 4YW6A 2Z79A 3KV4A 4QB1A 3CKHA 5IFPA 4SBVA 1Y9GA 3WCRA 2VBPA 3NV4A 4QGNA 1XU2A 1ZZ9A 3M3QA 2YXSA 1RB8G 1GFF2 1XYPA 2WSUA 1N3PA 4A2UA 5IFTA 4QDSA 1RUC1 1YQ6A 1QJFA 2YZ4A 1YLLA 2OS2A 1E5IA 3BOPA 4KL1A 1OOPA 1V6KA 4KI5M 1SLBA 1V6OA 1VBB2 2TUNA 2YU2A 2CV6A 1YNAA 4CEYC 4D3WA 5CADA 3B3QE 1US2A 3JQXA 1AHSA 1HX6A 2YROA 4XJWA 2Q1ZB 1ND2C 5JOYA 1UZVA 5KBFA 3K46A 3T2TA 3TOJA 4QMAA 3LKJA 3ACLA 1OBNA 3VBRB 3SLIA 1W8HA 3O1RA 4Z1VA 4CDXC 2FMYA 3DPRC 4QDRA 3B69A 1OPOA 4WVVA 2ZGKA 2WWJA 3ZN6B 1MQTC 4PCRA 3AB0A 4KU8A 1RUF2 2R041 3PLQA 4D6QA 3I3QA 4CU9A 2ORXA 4Q4X1 3F2ZA 4W8JA 2VZPA 4XTMA 3VBFB 1WW5A 5FPLA 2JIJA 1XE7A 2W1UA 1RXFA 1TEIA 1WA4A 2BGOA 2X5IA 2XH6A 2Y6LA 3M2MA 1GNHA 5FQ0B 3T1LA 3ZXLA 1H8TC 5JIUA 1FOD3 2BFUL 2D6NA 3OGSA 1R081 4AL9A 1OKOA 3MI8A 4MGTA 5L9VA 1COV3 3PUAA 4B1MA 3VD9A 3P5BA 5ACA2 2XBO1 1XXNA 3LDKA 4EN6B 1RJ8A 1JU3A 2FHRA 2Q1FA 1ZNPA 2YFZA 5HXVA 5I0TA 5B4XA 1VBE1 3ILNA 1WLDA 3U1XA 2QQKA 1HRI2 2VZUA 3I97A 3ZSEA 2J1AA 3KV9A 1S4CA 1ODMA 1LHWA 1QJY3 1S2BA 2WQ4A 2XL9A 5FPXA 2VBBA 3RZJA 3DYPA 1ASJ1 1QJEA 4NUBA 5E16A 5A32B 4R4XA 4WVMA 2TNFA 3PVBB 2ZAHA 2WS93 5FZLA 1STMA 1AXKA 1I5PA 2HYKA 3VV1A 4R9AA 5BY5A 2CGPA 2UWCA 1IQAA 3V64A 4FP3A 4AG4A 2L9LA 1J83A 2DDUA 5A7NA 5FY1A 3NRUA 4E27A 3RZGA 4OI2A 5I0SA 1ZREA 3IN9A 3M3OA 4HKLA 4XFFA 1T2XA 5C9AB 3HPNA 1UZ0A 3AKQA 4GA9A 3B5LB 5J36A 2D97A 1KD7A 4F8AA 1XNCA 1APNA 3DL3A 2HWB3 1RUC2 2ZGRA 3B00A 4OHWA 5FK8A 4ET7A 5GLTA 4BLIA 2C9KA 1HB2A 1HLCA 1EPZA 2BPA2 5LZ6A 3N7LA 5JLVA 1ZBE2 1ULEA 4LXLA 4BPZA 4CDWC 5GZEA 1XNAA 4RL7A 1AR91 1L7LA 1MS5A 3VHRA 3BU7A 1RUG3 3LSDA 4AHWA 5EPAA 1UOFA 3K4ZA 1BJQA 4L2NA 4DRVA 2GALA 4XEZA 3T2OA 1HV1A 4HN1A 5LY1A 4ZZ8A 3BTYA 3GCWA 1LESA 1O5UA 2QCSB 3TEXA 4HPKB 3ZSMA 4OFGA 4NR1A 4Y4RA 4NVPA 1QOSA 1OKQA 3ACIA 1CVNA 2W91A 3FHQA 2YPDA 1GKBA 2YBPA 3I3BA 1ENQA 2PFWA 1S0EA 2WNVC 4Q4X2 1W06A 3UV9A 1RUE2 3TB0A 2JX9A 3UJOA 3ZXAC 3BU0A 3BALA 1ULOA 3GF6A 3LOBA 3EB7A 4PQQA 2ZGMA 3WEZA 1JW6A 4LOTA 1TZOA 4IE7A 3LEIA 3QLQA 4UW5A 3T0DA 5FWEA 1ULDA 1YFUA 4LUKA 2OUJA 2Z5WA 1X7NA 4YVWC 5F5IA 2CAVA 3VDDA 2BNMA 2ZEZA 3J8F1 4AFCA 3IAQA 4NRMA 1QNYA 3JBG3 3LA7A 3WV6A 1Q5OA 4CXYA 2AR6A 2DFBA 4UFMA 5GLVA 1MVEA 1OA2A 3T0AA 2YFUA 5DXDA 5C4WA 1WD4A 3LFMA 3LFIA 3IT8A 5A3OA 5T55A 2WABA 2EIEA 1M06G 1KITA 1SZBA 2IUWA 4JDOA 5ERLA 5IT6A 1UOJA 1SBEA 1SPPB 1GU3A 3WW3A 5CNAA 4HOOA 5CG8A 3GBWA 3EQEA 4AFDA 1N47A 3LAGA 1W8TA 4XVHA 4I0BA 2OVUA 1IS3A 4FFGA 5HPOA 3ZFGC 2OX0A 5T50A 4FXGB 1XNBA 4ASLA 2QQLA 2HYXA 3UKNA 2Y6KA 1C8M3 2QDRA 1JS9A 1AR72 1VBB3 2A71A 2PLV3 2YBKA 1UKRA 3A23A 3B9IA 1IQDC 1AYM1 4JGZB 4JQRA 3K48A 5EFUA 2LTNA 3K2OA 5CFDB 2F4PA 5DAQA 3ACFA 3KV6A 5FZOB 3Q8FA 1LOAA 4IV1A 5EJ1B 1J58A 5A3LA 3HBZA 3DYOA 4CZSA 1O3QA 2Y38A 3HN1A 2JDNA 1NCQB 3WP4A 2ZGUA 5J48A 5JCTA 2QZ2A 2BDRA 1K5MA 4KBBA 4Y33A 1DYKA 1OA4A 5A33A 5FUNA 4B4PA 2J42A 2BZDA 2IXLA 4XBLA 5IAXA 5L7OC 1F2NA 4M4PA 2RM21 4RGKA 1VBA2 4NIDA 1GYKA 1QJU1 3JQWA 2Y6GA 2DU1A 3CBNA 4BXSV 4XFIA 4QD2A 3OPTA 1KFUL 4G4FA 3RMYA 4WM8A 3TAYA 3FE5A 1XBFA 2H6BA 3AKSA 1C57A 5BPXA 5FZ4A 4MGIE 2HEWF 2XJPA 4URTA 5FUPA 3RZKA 1S55A 4Q0PA 1JUIA 1XOYA 2ZGOA 3E1F1 3H50A 3ZSKA 1KDKA 4ZU5A 2KR2A 4IERA 4PF1A 2KXLA 3V0AB 1W6PA 1JOJA 5FBJA 5FREA 4LNVA 4CPBA 4BJ0A 4YPJA 5KC5A 1JZ2A 1OVSA 1ZRIA 4D7YA 2DFCA 3KZ4C 3ZIXA 1GUIA 1UWWA 1CJDA 3V56A 2W1QA 2OYZA 2Z2SB 2XJTA 3H8RA 4IESA 4A45A 1YI9A 1WKYA 2OKXA 4QQOA 1W3VA 3VKNA 4XJZA 2VBDA 3QCWA 4P9YA 5EJZB 3RPQA 1NG0A 3I3DA 4AAXA 1OLME 2DURA 3FUQA 4OHVA 4CXWA 4C91A 5CG9A 4WZFA 4CDUC 1SLCA 3AJZA 1MS9A 2O14A 3DF0A 1JN2P 3MICA 3RZZA 4RR3A 3J9SA 4B1LA 3N9LA 2RDRA 4FPFA 1OD3A 2BGCA 2EIGA 4GMP3 4QXBA 1MEC2 3PMSA 4MG2A 3GZTB 3ZDSA 3CJIB 2X5IB 2CSGA 2LW8A 2B8MA 1DQ4A 3UESA 1DZRA 3R4UA 4K8FA 3JD71 4LKDA 3KV5A 1ND3A 4C1XA 4FQ4A 1ZBE3 3E6BA 4BB3A 4IEZA 2K2SA 1AYM2 5FMBA 3T3YA 4AQ2A 2ZKNA 3ZYGA 2VOVA 1J1TA 2ZX4A 5DQ0A 4TN7A 4QHOA 1XJAA 4UAPA 2EXKA 4QB2A 5A3PA 5LEKA 2ETEA 2A6ZA 5FZ6A 4YSFA 5FYCA 2ZGTA 3MV01 5JI9A 5JXHA 1V00A 3WNMA 3BPZA 1RMU3 4WVMB 1RUNA 2XVKA 1V6NA 3ZFFA 3FHIB 4L97A 3VZNA 1YJLA 3HEIA 4Q8KA 3WW1A 1W8WA 3POYA 4MHUA 1RUE3 1F9KA 3VBSC 1QJU2 1S0IA 2B9VA 2ZBJA 3KQ4B 5C3SA 2VZSA 3MFCA 1D4VB 5LBBA 2VH9A 3VL8A 3HWJA 4OCTA 4XQ4A 5E1RA 5FO7B 2CY6A 4Q26A 4AI0A 4UWDA 1QDCA 4DY3A 2DUOA 3LIHA 4CP0A 1Q8VA 4QT6A 2C9AA 3MO4A 2O8QA 1S0CA 3FBYA 5KHGA 2CGOA 2DBIA 4YRDA 4QPIA 1VBC2 2XONA 1U0AA 2WA4A 3VBOA 4GB33 5FZIA 1T6GC 2HWC1 2NLRA 4YFWA 4COUA 1Y9QA 3ZFEC 4YFZA 4BCUA 3P3PA 1UW8A 5FZ9A 3RG0A 2A6WA 2VECA 2ARBA 4O61A 3AVSA 4GJYA 5DDJ3 2Y64A 1HN1A 2XPJA 1G7YA 3WG4A 4C0HA 4RFT0 2KM2A 2K9ZA 2V4VA 4GAZA 1BVP1 4MXWA 5A6QA 2MPFA 1JYIA 1C8NA 1VRH2 1KDMA 2WZR2 1PO13 1QMJA 1TMF1 2R6QA 3N7JA 1POV0 4LR4A 4P00B 1AR73 5F2WA 1GV9A 1FNYA 1YUDA 2F4LA 1C5HA 3PVOA 3WP5A 2DCJA 2GNMA 4DO0A 4KWUA 2HEYF 1DCSA 3LQCA 2QTWB 3HQRA 1F15A 3IAPA 3NVCA 4DXSA 1N1SA 3UGHA 1H4HA 1VE0A 4TTGA 1GOHA 1ZBA1 3VDDB 3U4XA 1RUH3 5KHIA 3WNLA 1RUD2 3RNSA 1SHWB 5F8PA 1MS8A 2W39A 3I2JA 3MIFA 2VVDA 3X29B 3U11A 2NM1A 1QNWA 1B09A 1VBA3 2A75A 4ZZ5A 2NP0A 3DXUA 2NN8A 3KHBA 4OYUA 2WC2A 2LM3A 2GC2A 3ASIA 4R4ZA 4CCOA 5C4WB 3HD8B 1X8MA 3DKWA 4Y22A 1V6LA 2UWBA 4MLOA 1UU4A 2NPIA 2FZ1A 4A7KA 2XOMA 4BIOA 1CZSA 4P14A 2VNRA 1CWPA 2C6SA 3B9CA 3I7DA 5DAWA 1ZZ6A 4NIIA 1D2SA 2E26A 4LA3A 2VUJA 2OIIA 5LA2A 4S2FA 5ANNA 5DPNA 2YC4A 3VD3A 4QHZA 4FQZA 1BMV1 3IWZA 5C70A 4HG6B 2D93A 1A3KA 1ND2A 2RS51 4RHV1 4AK3A 2HWF2 4HANA 1V9U1 3AJYA 2WO2A 3ES1A 2H0BA 5EV7A 1DF0A 3TN93 2JG9B 1PGW2 1V6IA 3AMQA 2TEPA 2P6CA 3NJZA 3KM5A 1MQTA 4IV1B 3C8XA 5FY7A 2HWC2 4XBQA 1GWLA 5FO9B 1M4WA 4IETA 1K5MB 2DCKA 3HN3A 3VKLA 5IVFA 3O1SA 5CAZA 1D4M1 4Y20A 5DAVA 4L0PA 4ZY9A 3MZHA 4HVRA 2DUPA 5FY5A 3PUSA 4LOSA 5A1AA 3W5MA 1F8VA 1LU1A 2A3YA 3B01A 3DN7A 1MEC3 3WNXA 1UMHA 4YZ1A 5B2GB 4XF4A 2R061 4IV3C 4ORFA 3IZOA 2VOKA 4IEYA 4WM8B 4GD4A 1H6YA 4Y5TA 1LTEA 1VLNA 1TMF2 1HV0A 2QQOA 4I30A 5FZ3A 1MZ5A 2RR11 3I2GA 2HWE3 1EUUA 1ST8A 1OQDA 1O3TA 5FP7A 3HNBM 1O7FA 2W87A 3BOWA 4NAOA 1HB1A 2Y34A 1ZBA2 2RDNA 2YYOA 5BV6A 2UWAA 4XURA 1IS4A 5M0TA 3LWCA 2Q4SA 4UW6A 1J59A 3C7HA 4JGYA 4E4ZA 1R1A1 3WG2A 5BUVA 4YM1A 1COV1 4INDA 5FZCA 5L36A 3KMHA 1CAVA 2PHUA 2B42B 1DQ0A 1FMD1 3POBA 4M00A 4N53C 4E2GA 3KS7A 3ALQA 3H8OA 4ZONA 4X6RB 5FY0A 5AFEA 3VBHC 1X82A 4CCJA 1MS4A 4RR3B 2VZ3A 1TQ5A 2QQNA 3T2QA 4DUWA 3WHUA 5JSRA 3PMEA 1Q8OA 3JZVA 4UFLA 1H6XA 1WD3A 5JMCA 2UURA 1UAIA 1R64A 4FFIA 4XTPA 3IM0A 2Y8KA 3G7DA 1EAH1 5IWFA 4TZDA 3NL1A 4DOUA 4CP9A 1FX5A 2GMPA 1IG3A 4HONA 4XBNA 5DABA 3VZOA 1BQPA 3MEPA 1VBC3 3BB6A 3E5XA 4K6BA 1ND3B 1QXPA 4XJ8A 4Y1UA 5FY8A 2VZOA 1AXYA 1QH6A 1QJX3 3LGRA 4RS5B 2CWMA 4W4ZA 1V9U2 2VW2A 1AL22 1OHFA 4PDWC 3ZIWA 4M3CA 3OD4A 2Z4FA 3I2HA 4NWWA 1KXGA 1NE6A 2WNEA 4CVUA 4JTNA 2D6LX 4XUOA 1FYUA 4JRLA 2C0ZA 2VZ1A 4BQ2A 1W2UA 2JE9A 2HWB1 1BEV1 3LPGA 4MYEA 4AEJA 3CLPA 2VMHA 3I2OA 2WNVA 3WLUA 3H8UA 2RVAA 3A21A 1Z7S3 2WJSA 1D4M2 4LULA 4M3CF 4Y1VA 3ZFFB 5A7SA 4CTEA 4OQ8A 2CHHA 5FAXA 1W6MA 4GWNA 4QHBA 2B5HA 1AXZA 1WLCA 4Z92B 2WZR3 1JZ5A 1PK6A 3WUDA 4P9WA 5JDBA 2P1BA 1G9CA 4YVWA 4NHMA 5FYZA 2BNOA 5IUQA 2WT2A 1GP6A 1W04A 3T30A 2W46A 5FKBA 5FMOS 3MIHA 1XSRA 3LF7A 1DYOA 5A7OA 1GNYA 1UL9A 2ZABA 4K40A 1RUD3 3GJAA 4MOAA 2JE7A 4PLNA 4BA6A 1TME1 4FTEA 4MZUA 5I8SA 1E5RA 3AP9A 4K3UA 2JDZA 1HRV3 4ARXA 4QPIB 4O9EA 1YIPA 2QBXA 4ATFA 1PHMA 3VBOB 2BERA 2GP5A 3LDRA 1R1A2 1SLAA 2WFF3 4Q4V3 3AZZA 5FRAA 1C3HA 2X8KA 3SH5A 5C3OA 3BTXA 1NYWA 2J1UA 1FMD2 1L3JA 1UN1A 4NOTA 4AE2A 2JG8C 3LPFA 4AHZA 3WP3A 4MXVA 3OUHA 3FUOA 3AP4A 5SV5A 5GLWA 5CA6A 1RXGA 5CB7A 1RUJ1 3EJKA 3PTYA 4MXWB 5FY4A 4L9BA 2P3KA 2VUDA 5FR3A 1CAXB 3GZEA 1RJ7A 1H2KA 3SKJE 4WV8A 1W6NA 4LO8A 5IYYA 4JHZA 4EV0A 1EAH2 1H1AA 3AFGA 2DVBA 4EJRA 1PIV3 4IE6A 4PIYA 4W6WA 1XPWA 3VBUC 5D8AC 3T0BA 4YWAA 1VMFA 3W9AA 4O9GA 4CPBD 1D2QA 1O59A 3UJQA 4FOQA 1UX7A 1UYPA 1UIJA 3J7LA 2P3YA 4PBOA 2DTYA 2Q8OA 1LULA 1SBDA 2PLV1 4A41A 2RS32 4E9KA 2PHWA 2WZEA 1BEV2 4AEDA 4XUNA 1GNZA 1XB9A 1HXS3 3WDXA 3WSOA 5F3CA 2XQXA 1JYTA 3I2IA 2N7GA 1JH5A 5IATA 1PZ9A 4CU7A 1YC61 1IS5A 4ISQA 1HQNA 3LCPA 5FZ7A 4AEKA 4XILA 4Y22B 4L8QA 1Q8SA 3OD0A 4COVA 2P6HA 3ORJA 3MIEA 1Y9MA 2WO3A 3WVJA 4BLJA 1KFXL 5A3TA 2RS13 2D3SA 2D5HA 1RVF3 3BGAA 3USSA 2AUYA 4A4AA 4CA9A 1SFYA 1W0PA 1NQDA 2VUCA 4LE4A 4UYBA 4CUCA 5A1FA 4XMIA 2C4XA 1WBLA 1SACA 3DV8A 3M3EA 5CKNA 2ZEXA 5KWRA 3ST7A 5DG2A 1G6NA 1O8PA 2VGDA 2AENA 1ENSA 2C5DA 3ZSLA 3WOGA 1XRUA 1POQA 2MEV1 3OBTA 2F17A 1ZRCA 3ZX7A 5CFCC 4CDUA 2BU9A 2W47A 4CCKA 4A6SA 3KT4A 4LMFA 3W5NA 3FC0A 2RMU1 1ENXA 4LO4B 2W1WA 5BNQA 1HJFA 3O1PA 2ZGQA 4IGOA 1HB3A 1H1MA 4XFCA 4N7IA 4IEUA 1FPN1 1S0DA 2V72A 4XABA 2R071 3NV3A 5FFOC 3CQOA 5DAXA 2DUQA 2E7AA 1MVQA 4N9HA 5IVVA 3GYDA 3M3CA 4YM2A 3H7JA 4QM8A 3POGA 1RHI2 4GXLA 5EYYA 4YZ5A 2E7QA 5E8AA 2GP3A 2JECA 3WF1A 4EN0A 3N9NA 1QY4A 3T1MA 1BVVA 3IDAA 4BYYA 4E8CA 2E32A 5FXVA 1UYXA 3PHMA 1PVXA 1WWYA 2LROA 2ID4A 4C90A 5J7MA 1EV12 4Z82A 2D98A 3K4DA 2BEOA 2VE1A 2A3WA 4A7ZA 2JDYA 4AI2A 1BXHA 2Y6JA 4IE5A 5A3MA 5JVVA 1RUI1 3MDPA 1NQJA 4ONUA 1G9FA 2EF6A 1RYYA 1LAJA 4JGYB 4LBQA 2DCZA 2G9ZA 2XQRA 3IDCB 1UMZA 2VUAA 4GH4C 4Y1ZA 3VBSA 1SLLA 3VN4A 2ZZJA 1CAVB 1QHDA 1W9TA 3MGUA 4FSJA 4FP2A 1HKDA 3ZVXA 4P9JA 3ZMNA 1GQGA 4AQ6A 4E4DX 1JHJA 4X8PA 1AR82 3OYWA 1WUVA 5FZ8A 4COYA 1PMJX 2DVAA 4E2QA 3OGGA 1PO22 1ZRRA 2A3XA 2H0VA 4ZXEA 2ZGSA 4LK6A 4XACA 1UZWA 2J22A 4HETA 5FXWA 3QH7A 4YVSA 3I2KA 1YFXA 3AL6A 2E6VA 2OZJA 4LKEA 4Q0UA 1CAWB 5DZEA 5FYBA 4EYUA 1U5IA 2GNBA 4AAPA 3AKRA 5K7PA 1EP0A 3R4DB 3I2DA 3BTAA 4OMDA 1MS3A 3ZFEA 1LKNA 1DGRN 4YG3A 1UY1A 2D3RA 3I3EA 3J7HA 3EYPA 5FUIA 1J84A 4DINB 5HCHA 2XJSA 4QM9A 2JDAA 4QKBA 4M3CB 5CKQA 4QU1A 3PU8A 4XAAA 4YZ2A 5ABJC 4RQPC 1YRZA 2EALA 2P5BA 3LIGA 3MPBA 4UT5A 2RMU2 3ME2A 4OHZA 2X53S 2BOJA 5A6YA 1DU3D 2BWAA 1WZXA 4QPYA 2ADEA 3VBRC 4B7EA 2WNVB 3AP5A 5BYNA 1LJ7A 1ZM1A 3F95A 1F5FA 1LB2A 1OMIA 3DKQA 3D0JA 1FPN2 3WW4A 4NPRA 1W6MB 1WMDA 2R072 1JZ4A 4OQ9A 4CUBA 4V2WA 1PK6B 4LA2A 3RMXA 1DG6A 2OPKA 4R8HA 1O3RA 1MZ6A 1MS1A 1DZTA 2EIDA 2WNUB 4UFIA 3ETPA 5FO8B 2D7FA 5DDJ1 1JZ6A 3POEA 5IHRA 3VBFC 4XIKA 4A44A 4P02B 4KWJA 2AH2A 4COZA 3SHRA 5FDBA 1QU0A 4AI1A 3S6PA 4I09A 1ULCA 2IWGB 3AM2A 2JIGA 1OVPA 1HW5A 2ILMA 4NIGA 4LHSA 4CCEA 1JZ3A 4I02A 4E4SA 2BP6A 3MIBA 2W52A 2PAMA 4LJHA 4AOCA 2G9FA 1UKGA 2RS33 4EZHA 1LOGA 3H1YA 4OULA 1H0BA 4U36A 2R042 2R16A 3S5AA 5T54A 1W6QB 2VNOA 1KQRA 1AR61 2XJVA 3UKVA 5JAXA 4ISRA 3MV11 5H9QA 3KD4A 2CL2A 5F39A 2AREA 1AYN1 4KQ7A 1JYWA 4JCKA 4FOWA 1I9RA 1R082 3VHPA 5A3NA 1BYHA 3JCIA 3MUY1 1ULPA 4UF0B 4F7ZA 1Z78A 2JD9A 4XW3A 2XBO2 4RN5A 4CEWA 2SBAA 3MPPG 4BXFA 3ZDVA 3WNPA 4FPKA 4F83A 1UZYA 1PVC3 2XLGA 1SFNA 2Z42A 4D8MA 3UKTA 1AF9A 1D0HA 1VBE2 3N9PA 1W6NB 4JKMA 2PAKA 4Q0SA 1YJKA 5C9AC 3NO8A 3VKFC 4TXWA 4BQ5A 1ASJ2 3GALA 3IIAA 3THDA 2VQAA 2B9UA 2XJRA 4HK8A 1W39A 4FOVA 5K4LA 3THPA 1L7RA 1OQEA 1CAUA 4LHKA 3H3LA 1FI2A 5EXOA 2QJVA 2YU1A 4GKXA 3ZYRA 4NO4A 1K45A 3RVHA 1UU6A 4LBKA 3FZ3A 4W65A 1W99A 2Q5TA 4XETA 1N3OA 4BDVB 4K1ZA 1VIWB 3POJA 4QPGB 4AEDB 5FPBA 3VDAA 1GZTA 4C1WA 2OT7A 4HK9A 1YCIA 2ZGLA 3VKMA 1W05A 4DQAA 1PM7A 5AC91 2VQTA 4XQWA 5KXCA 2XL7A 4MHRA 4BIFA 4FT8A 3HR9A 2EVXA 4NRQA 3JB4C 4YW2A 2G4IA 3VD5A 1V70A 4BK4A 4URAA 2W5FA 3PUQA 5H9RA 5A6XA 3WDWA 2DYCA 3IDBB 4XJUA 3AZWA 1SDWA 2WA3A 3LEGA 3KB5A 5DUWA 5BNPC 5IK7A 1OI6A 1NA1C 2ZAAA 3AMPA 4LIVA 2VJXA 3VKOA 2C1FA 3N9OA 1EV13 1YFYA 5C8WA 1AR92 1UX6A 5K0UB 3LA2A 3LEMA 2Z69A 2P34A 4IGQA 1XC6A 1RUF3 3W58A 1AX2A 4Y1YA 4D0QA 1UPSA 1RINA 1L7QA 1NOVA 1ZZCA 2PELA 2LUWA 1GWMA 4J25A 4N53A 2HH9A 1X33A 1C4RA 1UIKA 2HJIA 3U75A 3AZVA 4CDUB 3WHTA 2VCAA 4LHLA 5E6HA 1UYYA 4X8NA 2J7MA 3PTRB 4IL7A 3VBHA 4CP1A 3FMGA 5EWSA 1AR62 3MHZA 1AR83 3WZ1A 4DUVA 1ZA4A 2ARXA 3WDVA 1PO23 3E97A 3B7MA 3LD8A 4N43C 3I4IA 2JDKA 1H4GA 3N35A 2PQQA 5F3GA 1AYN2 5ACA3 4GZ9A 3C3VA 4NRPA 4B8EA 5J96B 2AEZA 5F7UA 3IKWA 2AYHA 1V0AA 1PMIA 1UYZA 1JODA 4R9DA 4XUQA 5F3EA 1HRI3 1OOPB 5A7QA 3O14A 3L9JT 1X36A 3ZSJA
chains in the Genus database with same CATH topology
2VW0A 2UY8A 4KWKA 5LK5A 2XJUA 4AHYA 3J8F2 4PDWA 1DGLA 3A0KA 3GHNA 3ZN4A 1VBD1 5JOXA 1U5ZA 2PHFA 2ZA9A 1S0GA 4XZPA 2MNGA 1RL3A 4JGZC 1JBCA 1R091 4OLLA 5CFDC 1NY71 5C33A 1KJLA 3O7OA 4XOGA 5LK7B 1H9PA 2OUHA 3ECQA 4WM7C 1NCQC 3VBSB 1MS0A 5T5LA 1QJX1 2I07B 2ZPXA 3BODA 4JDNA 1DIWA 4BWOA 2SLIA 2ZHMA 1RUC3 2IC1A 3EO6A 2Y0OA 3ZPYA 3M3IA 5JI7A 2ZTNA 4V1PA 2KA3A 4XFGA 2CGNA 2E51A 4YVSB 2XUMA 4CDQC 2ZHLA 1WLWA 2WINB 1Z0HA 3AP6A 2PN5A 1AVBA 1OQ1A 1A6CA 3AYEA 2GNTA 4Q4Y1 3CL1A 1U5YA 4YGEA 3ZFEB 4QXKA 3M1HA 3SMHA 3TWIA 3R0RA 3H9AA 4L11A 5JZGC 4P5HA 1DFQA 3LB9A 4J6GA 4Q4X3 2VW1A 3FX3A 2RM22 2JG8A 4XQDA 4YW4A 2QKDA 1U12A 4PF5A 2R1DA 2BBVA 2YV8A 4FOYA 4B4QA 1HRV1 1DQ2A 1R083 1AX1A 3M7AA 2A6YA 5FMOL 3H3UA 2FBEA 4A7YA 4OUMA 3WINE 4Q4V1 1EYBA 5BXXA 1VBE3 4XXAA 2IXHA 2BYVE 3HAGA 4Q4W1 1Y43B 5I91A 1FATA 4HSLA 3VBUA 5D8AA 5GZFA 1ASJ3 1DQ5A 1AL0G 2ET1A 3CJIC 1VBD2 4FO9A 5FOBB 2D6OX 4AQTA 4M3CE 3TBDA 4MGZE 4XXPA 4XJAA 2TBVA 5I0UA 1V6MA 1WCSA 1R092 4MSVA 4YM0A 2GU9A 1CR7A 2YY1A 3AX4A 1SQ4A 1PIV1 3S30A 3AKPA 2HWD1 4OI4A 4ZXKA 4LTAA 1QJZA 3IBMA 1NLRA 1IGOA 1B35C 3JD72 4Z07A 5DUVA 2BUKA 3VL9A 2UU8A 4CEWB 4C0BA 2QZ3A 4YG6A 1AR93 4XDQA 2VOWA 5LRRA 4HKOA 5CFCA 1WW6A 1W6OA 4OI1A 2ET7A 2VVFA 3JU9A 3H7YA 4I01A 2QE3A 1I6XA 3WDTA 5F1RA 4HLTA 1RVF1 1GR3A 4IQPA 1CAUB 2IFWA 2GH8A 2A6VA 3U0ZA 1AZDA 3GHMA 1A8MA 4LBQD 3WQ7A 1DHKB 4YW3A 2WIIB 2YMZA 1QQP1 1URXA 5KXBA 2JKBA 4CEYA 4FAHA 3H1WA 3Q9OA 4Q2FA 1BBT1 3IPVA 1C1FA 3H3ZA 3INAA 1NCRC 4H55A 3L2YA 1G9DA 1X8EA 2WL1A 3WP6A 3AXDA 3POWA 1CN1A 1GZ9A 5CBLA 3V0BA 3K51A 4LO5B 4CDXA 3DPRA 3WG1A 4WZCA 5HCBA 2IZWA 2G9GA 4AGVA 1LODA 1JYCA 3WUCA 4FTBA 2GH2A 3ZXJA 5FTTC 4D94A 4GH4A 3WDYA 4HL0A 1LHVA 1F5JA 3GBGA 4YG0A 1LGBA 4OUSA 4N53B 3VGIA 3KGZA 1H8TA 1X50A 2CTVA 5H9PA 3ILRA 1IKQA 2CNAA 3VDDC 4Q1RA 1WCDJ 4Q8LA 1RIRA 2CWSA 3RI9A 2ZX2A 4RA0A 1HDKA 3OTFA 3OJBA 5AVAA 1AJKA 1JUHA 2FQPA 2HKXA 1EY2A 5GKAC 4EN9B 1PGL1 3RI8A 2BW8A 2PAEA 2D6PA 1AYM3 2UY9A 4DY5A 3EHKA 5HI0A 2A5ZA 1W6PB 3B94A 4YYOA 5KXEA 2W08A 1LEDA 1VP6A 2BNNA 2ENRA 1ZZ8A 1GQHA 2EAKA 2XB6C 1FOD1 5JOZA 4PIZA 4UXAA 3N3HA 4YLZA 5ABJA 1YIFA 2VPVA 4P9IA 4RQPA 2RM23 1CPNA 1MR5A 1QJU3 4L99A 3TNPB 2UYAA 2JG9C 1QJY1 4YW1A 1YYNA 2QQPA 2ZACA 4AVBA 1CONA 4Y4YA 1BKZA 2WS91 1QQP2 4Z8BA 4ZKTB 1K5MC 2R1BA 5KHKA 5EYXA 2P17A 3VBFA 4H3WA 4CDWA 1BBT2 1BMV2 5SV8A 1A8DA 5FQ0A 3R05A 2GDFA 2RS52 4RHV2 1FT9A 2E9QA 4YW5A 4AVAA 3ZO0B 2WKKA 4LO6B 4WM8C 1PZ8A 2GSYA 4GQ7A 2R32A 4DXZA 1Q3EA 2A70A 3VHNA 1QOTA 1DGWX 2VNGA 1YHFA 3USUA 3MW3A 4HN0A 3GBFA 3AK0A 3BCWA 1LOBA 1IPJA 2ZMLA 1GANA 2ZGNA 3CJXA 4YGDA 1VRH3 1RUG1 2VMGA 3MIDA 3BIWE 5JIAA 5GJ6A 2R062 2B39A 1OPMA 4XE9A 4JV4A 3JD73 3I59A 3CEWA 4XPVA 4AF9A 5K9YA 4XF9A 4S2HA 4KG0A 2PTMA 2RR12 1J3PA 1DQ6A 2XKPA 5FPZA 4DZGA 4LT5A 1GSLA 3KLSA 4RGAA 3U07A 5D8AB 5EJ3A 4YNIA 3VBUB 1YXWA 1FOD2 1HQWA 4RSUA 4ES8A 1VAMA 3FFZA 2IFRA 2BTVC 2DV9A 1FV2A 4YZ4A 1COV2 4UW3A 2HEVF 4BMBA 2DVFA 3O0XA 3FBMA 4RS5C 3ZFGA 3JBG1 1WW4A 2AGSA 4EWEA 4HZFA 4HPKA 1GZWA 5FCCA 4B29A 2JEMA 4P9LA 1C1LA 4AI8A 5GALA 2EAAA 2ZOEB 2WS92 2HWF3 2V5YA 4I3GA 3NSTA 3RYRA 4ZU4A 5BNPA 1NA1A 4W6YA 3D82A 3KCYA 1O3SA 3ZFFC 1QXJA 4CP2A 2PHLA 5C8CC 2ZMNA 5KHJA 2ZCWA 1QXRA 2HWC3 1WW7A 3D8CA 5L7OA 4KWLA 1J3RA 1QF3A 1C8M1 4N9IA 1VBB1 4UBHA 4XHBA 2HWB2 3FWEA 1POV3 4EWAA 5HCFA 3W59A 4BH9A 2E7TA 1IZ3A 5L19A 4N43A 4RGGA 2DVDA 2FZ2A 1SCSA 4HKWA 4TWTA 5F9TA 1RUG2 1TMF3 4FPEA 2R49A 2ZKLA 3A4UA 1SBFA 1RUF1 4K9SA 2P3IA 4FPOB 3VBOC 4B4RA 4MH0E 4SLIA 2Q0AA 4CEYB 2BWCA 5T5PA 3MW4A 3SH3A 3NWKA 4NHKA 4AQSA 3IPVB 1DGWA 1Q8PA 1WGPA 4PQ9A 1ZBA3 1ND2B 1UCXA 1WMFA 3AYDA 4LBNA 3N7KA 1TME2 2OA2A 4EROA 1H8VA 3V0BB 4CDXB 3DPRB 4FPLA 5ACA1 1NXMA 1N1TA 1MQTB 2DTWA 4FPYA 4MX3A 1O4ZA 1FNZA 4IEWA 4WM7A 3RYPA 1NCQA 4Y20B 4YGBA 3E6DA 4OVEA 5JPNB 4LE3A 5BNOC 3MF6A 1H8TB 4GKYA 2R0HA 4UW4A 4AFAA 1CESA 3NV1A 2ERFA 5DZGA 3NKGA 1GBGA 1RUJ2 2WLQA 1OLRA 4CDQA 5F6KA 3QH6A 4WVWA 4FAGA 4HVQA 5BNNC 1NLSA 1I1EA 4Q27A 4AVTA 1RC6A 4I0WB 2D3PA 4AW7A 1V9U3 1AL23 5FLHA 2XVGA 1VB4A 4CRQA 1BK1A 4GMP1 3WG3A 4JVAA 4FPCA 3QACA 4KG8A 2EXHA 3ZMOA 5JZGA 3KSCA 3V0AA 1PGSA 4GMP0 1C8M2 3NAPC 1J1LA 1D4M3 1DZQA 2PLV2 2E53A 1ZBE1 2AZ5A 4Y1XA 1U5XA 1W0OA 5ABJB 4RQPB 4PLMA 3N7MA 2LALA 3KQRA 4PJYA 2R063 3SH4A 1DBNA 1LOCA 3S7EA 1H2LA 1KS4A 1O4TA 5KC6A 4LBLA 2PHXA 1H9WA 1RMU1 2RR13 1CQ9A 2ZGPA 1RUE1 3E5UA 2VG9A 4CDWB 2I74A 4DPNA 4NN0A 4FBFA 4P9GA 1ZRFA 2R30A 1BCXA 3CJIA 4LBOA 5HBAA 3PJQA 4W6XA 1QDOA 1ZZBA 3ETQA 4H7MA 4QQHA 4BQ1A 1R1A3 2MEV2 3CU7A 2ZS6B 4U2AA 3CNAA 3DUIA 4B7KA 4H7LA 4AI3A 1FMD3 5L73A 1OSGA 3FLRA 4N7UA 2VULA 1I5ZA 4GIQA 2YGMA 5LEJA 4XF3A 4OHYA 4TSVA 2QDNA 3USUB 1VJ2A 1VR3A 2QVSB 4GB31 1KJRA 3LA3A 1LEMA 2DU0A 4YM3A 3MFAA 1B35A 4D7SA 5JOWA 4JGYC 1RITA 5KXDA 2XHKA 1EAH3 4YVWB 4M0HA 1TNRA 3I59B 4KNCA 4G3YC 4B3NA 4G9SB 3NW4A 4IXLA 4WVZA 1ZVFA 2JICA 1PO11 4XJ9A 4XIOA 1AR71 1XNDA 2XJQA 2ZMKA 1BEV3 3KGLA 4H14A 4N90A 5I8YA 1RUI2 3E6CC 1KRIA 3TNQA 3VUOA 1TE1B 4PLOA 1REFA 1Q8QA 1UF2C 3IDEA 1XNKA 2DF7A 4NHLA 3TYJA 1LRHA 1VAVA 1QH7A 1RUH1 1IHMA 5JSPA 2PA7A 3ZFGB 4AXOA 2E63A 4MV2A 2A6XA 1DGRA 3WQ0A 1NZCA 4EN7B 1NCRA 1GZWB 1Y7BA 1VBA1 3O0VA 3CF6E 3U10A 1RMU2 1S1AA 5E88A 2WFPA 4PIXA 3ZYIB 1ZYBA 3J4UH 5BNPB 3RJRA 1NA1B 1TME3 4M0NA 1FV3A 3GNEA 4YZ3A 4QX5A 4X6QB 5T5JA 2WLPA 3RYKA 1BZWA 2VVEA 1PK6C 2YHJA 3NV2A 3AMHA 1CPMA 4LUMA 1G8WA 2WNUC 2O1QA 5L7OB 2RHPA 5D1IA 4MUVA 4I3PA 4IEQA 3VHOA 3VLBB 4IV3A 2JXAA 2VXRA 3P3NA 3TN91 3HMYA 2YGLA 2YPJA 5C6CA 3GZAA 4FCAA 1RHI3 4N43B 3D6EA 1RUJ3 4GB32 1LU2A 4BE3A 3KT1A 2WQZC 3RSJA 4GULA 5FLIA 5J37A 1JTZX 5F6LB 4FTSA 4TLFA 5DDJ2 2JD4A 1MEC1 5T3NA 2QFEA 3WR0A 5H9SA 2IXCA 3M70A 1LOFC 4ASMB 3ZXEA 1PO12 3EXUA 2WSVA 5GZGA 3UK9A 3D0SA 2QNKA 4ATEA 1I3HA 5I0RA 2HWE1 2JG9A 1IPKA 3FFQA 4WM7B 2OZ6A 4HFSA 1RUH2 4XF0A 4META 3AKTA 3HIFA 3KT7A 1FAYA 2VMIA 1LGCA 1DQ1A 4I2OA 1LCLA 1S2KA 4CDQB 3AZYA 4BZ4A 4BHPA 3IMNA 4QPGC 4AEDC 1S0BA 1GLHA 4AVVA 2O8OA 1QWRA 4Z2WA 3ILFA 1QGLA 4AFBA 2MEV3 3AFKA 4BM8A 3KCXA 2IXKA 3O12A 3OBRA 1CX4A 1GZCA 1G86A 2EXIA 2IXJA 4XFBA 4R9CA 2XWJB 2RMU3 5JZGB 1H1IA 2D6MA 4QU2A 4ES9A 1DLLA 4LBQB 1JXNA 1OFNA 1VBC1 1O91A 1CJPA 1FPN3 2UYBA 2DCTA 2R073 1QOOA 3ELNA 3TN92 5K0UC 5AC92 2VQ0A 3CO2A 3MIGA 4Y24A 3OYWB 2A73B 2NYYA 4AYUA 3HT2A 3SCGA 5IK4A 5J98B 1R1ZA 2H6CA 4S2GA 3SCFA 3V65A 4I0AA 4OZXA 1Z7S1 5TSWA 3ES4A 3WW2A 1LGNA 2BVVA 2GMEA 1VRH1 2WZR1 1G9BA 1SLIA 1HIXA 3VZJA 1NXD1 3WT3A 1RUI3 2R043 2BFUS 3AMNA 3THTA 1OOPC 2CAUA 5EZWA 3RQ0A 4RS5A 3R6SA 4J1XA 4BOWA 5E89A 2HWE2 1RUD1 3PJYA 2D44A 2BVBA 2PHTA 1MZFA 2XBO3 1HQLA 4Q0QA 2WFF1 2WWSA 1GICA 1XQNA 3N4MA 1VALA 2WT0A 1YI7A 1B35B 3APBA 4NWVA 5C8CA 3DGTA 3SISA 4K21A 1ULFA 4E2SA 2X5IC 1ENRA 1PZ7A 2EXJA 1ALYA 4LLFA 1D0GA 5DZFA 4YVSC 3LOIA 3SNMA 2HWF1 3O0WA 2MHFA 1AX0A 1NY72 3ZYPA 4FVVA 4XHXA 3URFA 1XYNA 1PGW1 3HT1A 2VY0A 2XG3A 2QUOA 1QJX2 1CGPA 4KU7A 4MGYE 1S0JA 2Y0IA 1YO8A 5GZDA 1SEFA 4P9XA 3D5OA 1IS6A 3AYCA 1IOAA 3GZUC 1NCRB 1HXS1 2ZX1A 1POV1 5GLZA 3VZMA 2XWBB 4A3XA 1Z7S2 2PHRA 5KHHA 2WZPP 1AJOA 2I45A 2V73A 2D6KA 3ROUA 5LRSA 3ATGA 2GC0A 1CAXA 4QGMA 4JAAA 4UBGA 4Q4Y2 1MZEA 3UKTA 2RS11 1Y3TA 4COVA 4FPGA 1UU5A 1RTVA 3EBRA 3NKTA 4OI0A 3ENRA 3VZKA 4AEMA 4XYXA 5JR7B 2ZHNA 4HBNA 1AR63 2FMDA 3S0MA 2XLFA 5FOJB 2YDEA 3PVEA 5BNOA 2W68A 3O5SA 5HCAA 3MF9A 4HT1T 4Y5Z0 5IK8A 1MACA 1AYN3 4R9BA 4IV3B 3WD5A 1Q56A 4EWDA 3AMMA 1Q43A 1QKQA 1HRV2 3J26N 3ZXKA 1H2MA 2Q30A 3QOPA 5T52A 5BNNA 4FXKB 4JTOA 2WFF2 4Q4V2 1LHUA 3H1MA 3J8F3 1WBFA 5FLJA 1F31A 4GALA 4DFSA 2O0OA 3M8LA 1XE8A 3M4FA 4Q4W2 4R52A 3ZXDA 2GC1A 1RUOA 4YARA 1VB2A 2OW4A 5JPMB 3MW2A 2GAUA 2ZX0A 3NAPA 1TNFA 4XMAA 4DNYA 5I8TA 4J1WA 5F5QA 1KS5A 3A0NA 2EA7A 3OY8A 1CD3G 3RDIA 4CEWC 3SXWA 2B45X 1AL21 3VBHB 5AC93 2RJLA 1PIV2