1AJOA

Circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-127
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
GHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSNQTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and properties of de novo circularly permuted 1,3-1,4-beta-glucanases.
pubmed doi rcsb
source organism Paenibacillus macerans
molecule tags Hydrolase
molecule keywords CIRCULARLY PERMUTED (1-3,1-4)-BETA-D-GLUCAN 4-GLUCANOHYDROLA
total genus 49
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1997-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ajoA00
4PBOA 4LBOA 1TEIA 2GN3A 1D0HA 4UW4A 1PZ7A 1MR5A 1SLBA 2WQZC 4GWMA 4YZ3A 1W6PB 4P9WA 1Z78A 2VW1A 1ULCA 4XJ8A 1MS8A 2DVDA 4RL7A 1SLCA 4K1ZA 4XOGA 5IUQA 3WOGA 3D5OA 5H9QA 2GALA 5H9PA 3AP7A 1UL9A 3JU9A 4XE9A 2UWBA 4M01A 5GZDA 2EALA 4YW3A 4Y1VA 5GLWA 1LOBA 4YM3A 3LCPA 1AXYA 2DV9A 4YW1A 3WCRA 1CPMA 1JBCA 5E88A 4YGEA 3WDVA 2GNBA 3PMEA 3FLPA 4AGVA 3R05A 5GJ6A 4XIKA 4FQ4A 1FAYA 3N35A 5H9SA 2CY6A 1QF3A 1DQ5A 2ZACA 2ZMNA 4BPZA 1KDMA 1A78A 3VKNA 3WDTA 2A6VA 4Y24A 1AX0A 1UZZA 1Q8VA 3M1HA 4M00A 2AR6A 4UW6A 2ZZJA 4XJZA 1YO8A 4BM8A 3ZSKA 1URXA 1G9FA 2DWRA 3OPZA 1I1EA 4WV8A 1V6IA 4P9YA 1LESA 1QOTA 1N3PA 1SLAA 3AYDA 4FPJA 1LULA 1I3HA 4P9XA 1BZWA 2ARBA 2WKKA 2GMPA 3MW4A 5E89A 3AZZA 4C1XA 3ILNA 1W6QB 5T5PA 2DUPA 1YYNA 2JJ6A 4P14A 4Y22B 1FNZA 1LOFA 2GMMA 3WG3A 4Q1PA 3N7JA 1GANA 2DTYA 2OUJA 2WLQA 3FUOA 5DZGA 3HR9A 4XIOA 1O4ZA 5FREA 1HKDA 1DQ6A 3ILRA 4CZSA 1N1VA 5CB7A 1LHVA 3B69A 4XXAA 4DQAA 5AVAA 2VW2A 3B3QE 4XJUA 3SITA 1HDKA 3R4UA 4Y20B 1UZYA 5EWSA 4GKYA 2DVFA 1N47A 1DQ0A 3AP4A 2A6XA 3RG0A 4M3CF 5GLUA 2DVGA 1N1SA 1AVBA 5JOWA 1KITA 2A3XA 3SISA 1Y7BA 2UWAA 1UPSA 1MVQA 3T2TA 2CWMA 1ONAA 2SLIA 2C5DA 4R9DA 2CWSA 3WVJA 5CBLA 2VUAA 2Z42A 3MPPG 1W6OA 4XILA 3PVNA 3AYCA 3NV4A 5HCFA 5KXEA 1YRZA 2LTNA 2A6WA 3UL2A 1F31A 1ULEA 2R0HA 4FOVA 5IK4A 1S0FA 5DXDA 1GYKA 2PHFA 3RMYA 2D6KA 1LHNA 4YM1A 1GV9A 4RA0A 3AFKA 4XBQA 4Y1YA 5DZFA 5GALA 1GKBA 4FPEA 3V65A 4BLJA 2DTWA 1CVNA 5HCAA 2D3RA 4BLIA 5T52A 1C4RA 3O0XA 1LJ7A 2ZHLA 1CONA 3A0NA 3FFZA 2AENA 2ZGNA 4DPNA 3M3EA 4FPCA 3BODA 2B7YA 5BYNA 3AJYA 2A6ZA 1CJPA 4XJWA 1KDKA 2JE7A 2FMDA 4YFWA 1Q56A 4FOQA 3ZVXA 5SV8A 1DYKA 4PQ9A 1CN1A 4XHBA 4FPLA 4Y1ZA 5T50A 3M3OA 2EXKA 4L8QA 4YW5A 3AJZA 5IT6A 3UJQA 4H55A 1F9KA 2JD4A 5T54A 3FBYA 1FV2A 1GZ9A 1LU1A 4Q8LA 1N3OA 5GZEA 3WHTA 1DQ2A 2YMZA 3MEPA 1V6LA 3V0AB 1A8DA 1ENRA 4AVSA 2E51A 4AVVA 1W6MB 3MW2A 3IM0A 4R9BA 3MW3A 4W65A 3WNXA 1S0EA 4HL0A 1DZQA 5HCBA 3ASIA 1HLCA 3M3QA 4XYXA 4I30A 2AGSA 2DURA 1GZWB 1UMZA 2WSUA 1KRIA 1LENA 1KQRA 1IS5A 1QGLA 3IPVA 1GZCA 1KJRA 1PZ8A 1QNWA 2W52A 2D6LX 4GA9A 2VY0A 3HMYA 4K1YA 1G8WA 5IK7A 5GLZA 1Q8QA 2EIGA 3NV2A 2R0FA 1GNZA 2DVBA 3SH5A 3GALA 3WG4A 1ENQA 1AX1A 1W0PA 4DRRA 1JW6A 5CAZA 4Q26A 2ZGUA 3RMXA 5GLVA 4FP3A 3N3HA 3OGGA 1LHWA 2D6PA 3A0KA 1VALA 3USUB 1BJQA 3OYWB 3KQRA 1LGNA 1F5FA 2CNAA 4AGGA 1WD4A 2WNEA 1WCSA 2ERFA 3ZSMA 1OKQA 2A71A 3LSDA 2D43A 4LBQB 4OZXA 5DUUA 3AP5A 1AF9A 4M3CB 2ZMKA 4AWDA 3ZYRA 1WW4A 2D6NA 4Y22A 2NN8A 3SH3A 1FV3A 3HN1A 3LSEA 4BOWA 1G9AA 1S0CA 4FOYA 1LEMA 3IN9A 4LBJA 4JRAA 4XZPA 3VKFC 1MS1A 1LGBA 1ZM1A 3POYA 3APBA 4JC1A 2A3WA 5DG2A 1IOAA 1LOAA 2ZGPA 4ZKTB 1CPNA 1G9CA 3WDXA 1JYIA 5DZEA 1LGCA 2AREA 1UN1A 3WV6A 3ZSJA 1HQWA 1W6PA 2V5YA 1LOCA 3NWKA 1Z0HA 4LBQD 3TB0A 2R1DA 1S1AA 1S0JA 1UX6A 3PJQA 4Q27A 3D6EA 4WVWA 3RQ0A 3AXDA 4MYEA 2XG3A 3B01A 3C2UA 4M3CE 1ULFA 5LK5A 1LHUA 5L73A 2P3IA 2A75A 2PHXA 4DFSA 2JE9A 5GZFA 2ES3A 1GICA 3WDUA 2ZHNA 4NO4A 1H9PA 3T1MA 1XQNA 1ZA4A 1CIWA 1N1YA 2D3PA 1QU0A 4F83A 2EXIA 5JLVA 2CTVA 5JVVA 4LBMA 1AXZA 2VH9A 1X50A 3O5SA 3ZXKA 3SH4A 5DG1A 3RRDA 3ZXJA 3IKWA 2BQPA 3AK0A 4FQZA 4ISQA 2CL2A 4YZ2A 4XMIA 5EXOA 2E7QA 2PHRA 4YG0A 4YFZA 1UKGA 2DU0A 2E7TA 2VW0A 1S0GA 3VKLA 3INAA 4ISRA 4YGCA 1WW6A 1JHNA 5GLTA 1J1TA 3W59A 3I8TA 2AYHA 2DVAA 4YZ5A 5KXDA 1DQ4A 5F9TA 1MS5A 2Q5TA 5KXCA 1FATA 2JDZA 4TZDA 4WVVA 2XB6C 3FLRA 5DUVA 1WLCA 4XBNA 2V73A 1Q8PA 4YGDA 1VAVA 1KJLA 2A70A 1DQ1A 1Q8SA 1W6NB 3H0OA 1FX5A 2UURA 2ZGQA 2DU1A 1BKZA 1MS9A 1LOGA 1QDCA 2GNMA 2ZKNA 2RHPA 4KBBA 4YM2A 1EPWA 3WDWA 1AZDA 2ENRA 1JYCA 4UW3A 1Q8OA 2GMEA 4DRVA 2UU8A 2R16A 3RSJA 2A3YA 3WG1A 1SBEA 4JCKA 2SBAA 2ZGOA 3OY8B 1H30A 4C1WA 3V0AA 1MS4A 1D2SA 2DUQA 1W6MA 5GM0A 2ZHMA 1MACA 3WG2A 2DYCA 2C9AA 4K21A 1V6OA 1RINA 1ULGA 2E53A 3BOPA 4FPKA 4HANA 3SNMA 5CA6A 3ZXFA 5DUWA 4YLZA 3N7MA 5GZCA 1HQLA 3L2YA 4XJ9A 4XTPA 4LBNA 5T55A 1JOJA 3GNEA 1B09A 2ZMLA 3POSA 2YZ4A 4YM0A 4CRQA 1BYHA 1C1FA 1GNHA 1R1ZA 3DGTA 4FPYA 1QDOA 2ZGRA 4XJAA 2NP0A 3IMNA 2CYFA 2NMNA 1WBFA 4YZ1A 1AJOA 2WSVA 4YGBA 2W39A 3OYWA 1QOOA 3OJBA 3T1LA 5T5LA 1H9WA 5JMCA 3QCWA 4LBLA 4FPGA 4AYUA 1G9BA 2WJSA 4LBKA 3Q9OA 4LBQA 1FNYA 4ATEA 1MZ6A 3AP6A 4BQ1A 2PELA 4PF5A 3M3CA 2WT1A 4Z8BA 5GZGA 1VAMA 1CESA 1LEDA 2OUHA 2P34A 2GN7A 4NOTA 3ZSLA 2W68A 1LHOA 2OVUA 3W58A 2YROA 4ASMB 1PZ9A 1JXNA 5T5JA 3AZVA 3O12A 1MS3A 4Q2FA 1WBLA 4GALA 3WHUA 2DUOA 2WT2A 1SLTA 1W6QA 2ZABA 1VLNA 1IS6A 1YXWA 2EAKA 3NV1A 2JKBA 2ZGSA 3FUQA 1G7YA 4ATFA 1G86A 4XDQA 1DGLA 2P37A 3VKOA 5F5QA 5EYXA 2D3SA 1V00A 1SFYA 3V0BB 1QOSA 3FLTA 2A6YA 3AYEA 2PHUA 1WUVA 4Y20A 1GSLA 1BXHA 3OBTA 1JN2P 1QNYA 4Y1UA 3WUDA 4WZFA 4Q8KA 2VU9A 3UJOA 1V6KA 1JUIA 1SACA 4FPOB 4YW2A 5IK5A 1N1TA 1WLDA 4ZXKA 2ZGKA 1ULDA 5CNAA 3V64A 2D6MA 1GZWA 3VKMA 2AH2A 3A4UA 1OQ1A 4R9AA 1IS4A 3VV1A 1LCLA 3VUOA 4U2AA 1U0AA 2GDFA 1YI7A 3ILFA 2FHRA 2P2KA 1DFQA 1UAIA 4XMAA 4AVTA 2LALA 2ZHKA 1SLIA 2TEPA 2W08A 4UW5A 2R49A 3B9CA 3USUA 3AX4A 3AXEA 5JOZA 5JOXA 1LTEA 1W0OA 3D4KA 4XTMA 5KXBA 1AXKA 4Q1RA 1C1LA 4XHXA 4XBLA 2PHWA 4TYSA 2ZBJA 1GLHA 2ZA9A 5FRAA 4M3CA 1DBNA 4GWNA 3AYAA 2AUYA 3O0WA 1S0DA 2EXHA 2KM2A 2NMOA 2NM1A 2ZGTA 2OW4A 3B00A 4DS0A 1SLLA 2ARXA 2UWCA 1APNA 2YV8A 1WW5A 3AP9A 2VXRA 1LOFC 1VIWB 3WCSA 3RS6A 3ZXEA 5IK8A 3ZYPA 1CQ9A 1G9DA 3U4XA 4GXLA 3WZ1A 3OY8A 3AZWA 1YIFA 1MZ5A 1DIWA 1S0IA 2PHTA 1IKPA 1NXD1 3ENRA 2D6OX 3ATGA 1GBGA 1RITA 3N7LA 1V6JA 2I2SA 3ZXLA 1AX2A 3UK9A 2A5ZA 1SBFA 1WD3A 2EF6A 3NV3A 4BMEA 1SBDA 1ENSA 5JDBA 5EYYA 3DUIA 4AGRA 3M2MA 3CNAA 4ITCA 2P3KA 1OFSA 3BIWE 1LU2A 4PBPA 1SCRA 2D44A 2YXSA 4YG6A 2YY1A 1IS3A 4FOWA 2ZGMA 3OBRA 3QLQA 4U36A 1S0BA 2D7FA 1QKQA 3I4IA 4D69A 1LOEA 2A7AA 1MS0A 1SCSA 1CR7A 2P3JA 3N36A 1FYUA 1QMJA 3PVEA 5H9RA 2GNTA 3WDYA 3POWA 3IPVB 3WUCA 4FPHA 2NYYA 3BTAA 1A3KA 2EXJA 4FP2A 1BQPA 3ZPYA 1RIRA 2WT0A 1WLWA 1W6OB 5DUXA 3AZYA 5T5OA 2G4IA 1AJKA 1DHKB 3R4SA 1DLLA 2JECA 4GKXA 3N7KA 3PVOA 5JOYA 4K20A 4R9CA 4YG3A 1V6NA 1LODA 1DYPA 4IQPA 3WLUA 2R1BA 1NLSA 4YZ4A 3KM5A 2ZGLA 3AZXA 4XXPA 3TAYA 1O4YA 2ZAAA 4Y26A 4SLIA 4CTEA 2H0BA 4BMBA 1WW7A 4FPFA 4Y1XA 2GNDA 1W6NA 4FVVA 3O0VA 1LECA 1V6MA 1IKQA 2NZ9A 3JUUA 1C57A 2HYKA 4YW4A 5E8AA 2E6VA 1MVEA 1N3QA 3SLIA 4PCRA 3V0BA
chains in the Genus database with same CATH superfamily
3VBFA 1TEIA 2VXJA 3VHPA 3NMBA 1D0HA 4UW4A 3I3EA 2ZCWA 3CEWA 1CAWA 1C3HA 1SLBA 4RD7A 4QQHA 1W6PB 5BUVA 4B7EA 1QH6A 2GSYA 5FYSA 3IIAA 2DVDA 2O8QA 3HNBM 4RL7A 4V1PA 3WOGA 4DB5A 3MV11 3SEEA 2CAVA 5GLWA 2J1VA 1W8ZA 3K4DA 2XBO2 3WP6A 4YW1A 3VBUC 2RR13 2GNBA 3BB6A 4GIQA 4XF4A 4JQTA 4IERA 2WIIB 3FLPA 3RJRA 5J37A 3ST7A 1RUD1 4HG6B 1OVSA 5GJ6A 4NWWA 4LMFA 3J26N 2WZR1 2Y6HA 3N35A 2BTVC 4FFGA 4WM7B 2ZMNA 1Y4WA 3H1YA 1A78A 1RGSA 3VKNA 4TSVA 1W9WA 5A7QA 5FAXA 2ZZJA 5FY5A 2VNRA 2YGLA 2BJSA 3A7QA 3GHNA 4LA2A 4BM8A 5FY4A 4FTBA 1RJ8A 1WCQA 1XNKA 3RYPA 3ZDVA 2XJVA 1V6IA 4P9YA 3NAPA 1NE6A 1SLAA 4FPJA 3KMHA 3RZGA 1QJZA 4QB6A 4NWVA 3PTRB 3OCPA 2RVAA 1EV11 2MEV3 2ARBA 3ORJA 4LORA 4AXOA 5E89A 2Z4FA 2WAOA 1FOD2 3AZZA 5L7OC 3VD9A 4C1XA 3P6BA 4A3XA 5L36A 1YYNA 4QPIA 2VQAA 3AVSA 2OUJA 1C28A 1RUG3 3PUIA 2WWUA 5A7WB 1LB2A 1DQ6A 4GB33 5E1RA 5FLHA 4IL7A 1D4M1 5AVAA 2JB4A 3B3QE 1W0NA 3DEMA 3E5XA 3RZZA 3JBG2 4CCOA 1TVGA 1W8UA 4J25A 3R4UA 3ZXAC 1QJX2 1ZZCA 4Q0VA 1QWRA 1BBT1 2BPA2 3CMGA 4GKYA 2X5IA 2Q30A 3BOWA 3KVBA 2DVFA 4GJYA 1N47A 1DQ0A 1WKYA 1VBC3 5FZLA 5GLUA 4NMIA 4AQTA 1WMXA 1AVBA 5JOWA 2A3XA 2QJVA 4NAMA 2IUWA 4XDPA 5FJHA 2JG8B 3AKQA 4IV1A 1X8EA 2IFWA 4P9GA 3LQCA 2CWSA 5FV3A 1OOPA 1C8NA 2RDSA 2E32A 3HNMA 5FZIA 2Z42A 3MPPG 4CXYA 4ARXA 5FZAA 1DGRN 4XFGA 3CZUA 1QHDA 2BERA 2A6WA 4XF1A 1FMD1 4CEYB 1J1LA 1F31A 4E4SA 1FPN2 5IK4A 1QJX3 3PU8A 3ZXGA 1BHGA 4DXZA 3MIEA 5CEHA 4IV3A 2PHFA 1PX3A 4YM1A 5DN2A 5FXZA 5GALA 4FPEA 4QPGA 4AAXA 1W9FA 4E4HA 5FYMA 3QACA 2D3RA 3UV9A 2BVVA 2PTMA 3VDAA 4MX3A 4D6QA 1LJ7A 1RTVA 2VOXA 2AENA 1QXPA 2W5FA 2JG9A 2RDNA 5DDJ3 2WQ4A 3JB8A 1TNRA 3ZSEA 4GULA 5FLIA 3AJYA 4E4DX 4PLMA 1YQ5A 2XWJB 2JE7A 4CP9B 3IB3A 3PNAA 1Q56A 3N9OA 1M4WA 3ZFEC 5BY5A 4QM8A 5FO9B 1OF4A 1Z7S1 4CA9A 4XHBA 4PIZA 3B02A 1FPN3 1BVVA 4Y1ZA 5LW9A 3B7MA 3LE0A 2EXKA 4UF0A 1JZ8A 5IT6A 3UJQA 2R072 1ZVFA 4TLFA 1VBC1 2VCBA 3FBYA 5FPUA 3LF7A 3WHTA 3A23A 1DQ2A 2IC1A 4LUMA 4CCDA 1A8DA 2XOMA 4XF0A 4AVSA 1S2EA 4BH9A 3C7OA 2OYZA 4CEWA 3U75A 4Q0UA 2XJSA 3RI8A 4W65A 2EIEA 1HX6A 1VB4A 4HZFA 1HXS1 4HL0A 3ZFGB 3OUIA 5I8YA 1HLCA 1HRI3 1AYM3 3M3QA 4I30A 2H6BA 1OT5A 4HVRA 4FAHA 1IS5A 4DO0A 1QNWA 1VBA2 2X8KA 3VL8A 2XWBB 1I9RA 3S6PA 3T1LA 2W94A 2DVBA 1UF2C 4Y5TA 4CDUB 2WZEA 2BUKA 5GLVA 1RXFA 1QQP3 1RUI2 1LHWA 1SMVA 4R4XA 3VZKA 4Q0SA 2EICA 3I2GA 1LGNA 2BGOA 1L7RA 1UY2A 4L0PA 3OPTA 4W4ZA 4HOOA 2HEWF 2A71A 2BBAA 1EUUA 2D43A 3LSDA 4LE3A 4W6YA 4CCEA 1VBD2 1OQDA 3SH3A 2NN8A 1HB4A 1FV3A 3KVAA 3LSEA 5A3TA 2VZOA 1L7QA 2I45A 3HPNA 2HWB3 4A42A 2Z2SB 5F37A 4IEUA 3CJIB 4LBJA 3QBQA 3POYA 1RUD2 4XDOA 3T0DA 2CU5A 1W9YA 1LOAA 3OGVA 4LKFA 4ZKTB 1CPNA 3WF3A 1G9CA 3AMQA 4COVA 1LGCA 1ULPA 3VBHA 1JI6A 4TLGA 3ZSJA 4K6BA 1W6PA 4OHZA 2QDNA 1Z0HA 4XQWA 1VBD3 1TQ5A 1S0JA 1ZBA3 1PO21 2GH8A 2W1SA 4ZS3A 3D6EA 4QXKA 4P5HA 5CKMA 3UETA 4QX7A 3AXDA 3NNFA 2PFWA 3C2UA 3GYDA 4M3CE 5CVRA 5LK5A 1LHUA 2JKXA 3N4MA 4JGYA 1JMUB 2JE9A 1GICA 2YU2A 4XQDA 5FZFA 3WNMA 3AKTA 3MDPA 2WBKA 4QM9A 1XQNA 2HWB2 2JDAA 3ZO0B 4IE7A 1N1YA 2PAEA 3WEZA 4F83A 3H1MA 2IWGB 4LBMA 4LK7A 4IGOA 2VH9A 5JZGA 1I6XA 3O5SA 3H3UA 1Q3EA 1UO9A 2VG9A 3I2IA 3MGUA 2VPVA 4JZRA 4ISQA 3WP4A 3ZXJA 3PHMA 4AI2A 3J7NA 5BNNA 2WYFA 4YG0A 1NUKA 2VOWA 1JOBA 2WLPA 2WNVB 4EROA 3MF6A 3MUY1 3I2HA 4UFJA 3VZOA 3NAPB 1PGW2 5GLTA 3O1RA 4I0AA 4CXWA 2VVDA 1W8HA 3I8TA 3W59A 4BA6A 2YBSA 2FDGA 4WVMA 3RZJA 4A7YA 1MS5A 4QHOA 3OBZA 4ZU4A 5FYVA 4Q29A 2P5BA 4BZ4A 1Q8PA 3I59B 2VBPA 1J3PA 1KJLA 2A70A 2Z79A 1BKZA 4UOJA 1QDCA 1IG0A 2RJKA 4Q4Y2 1J83A 4HN1A 5FYHA 2QQOA 3GM8A 5IVYA 4DRVA 2JIJA 3KV9A 4Q4V3 2UU8A 2JDYA 3NJXA 4JDOA 2WA3A 3RSJA 4H3WA 3WG1A 2G9FA 1F8VA 1W8OA 3OY8B 4C1WA 3VD7A 1UY0A 4CDQA 4NJ4A 4QAWA 5HPOA 1D2SA 5CFCA 2GC2A 2HWF3 2ZHMA 1MACA 5J96B 3U07A 3IIIA 2O0OA 2DFBA 1QJY1 2AEZA 4HANA 4JGYC 4UFHA 5LA2A 4N53A 5DUWA 4CEYC 1VBB3 1WWYA 4Q4W3 5ISLA 4YLZA 5FZEA 1YFWA 2EA7A 5EJ3A 2FQPA 4L9BA 1WCDJ 4QX8A 3KD4A 2V4VA 2WZPP 3T08A 3WXPA 3FX3A 3OSDA 2AZ5A 1GOGA 1JS9A 1CWPA 1B09A 2ZMLA 5FDBA 1WCKA 1BYHA 3THCA 3T0BA 2Y6FA 4AW7A 3DXUA 5C3RA 1DGRA 3I54A 2ZGRA 1RUE2 2BEOA 3HQUA 3IMNA 3K4ZA 2RMU1 1TME1 1WBFA 2WA4A 2WSVA 3P3PA 4YGBA 5F3EA 4CCKA 2W39A 4E2QA 2VAUA 1QOOA 3KGZA 4LBLA 4AYUA 2C0ZA 4LBKA 3ZYIB 1FNYA 2JDPA 1C8M1 3B9IA 4YW6A 2QNKA 3R4DB 4HVOA 3EHKA 4DMIA 2IXHA 2BVBA 1R091 2R042 2Y34A 1DZRA 2Y0IA 2YROA 4ASMB 5C8CA 1HXS2 4FCAA 1NCRC 2VUJA 1CIYA 1PO11 5C3SA 1NZIA 1PVC2 4NHYA 3ZFEA 3WHUA 3MFAA 2DUOA 1BK0A 1W6QA 1VLNA 1IS6A 4CP9A 3J7MA 1H8TC 1UY3A 1CZTA 2JKBA 4ATFA 4RFRB 1OPOA 3ON7A 1EYBA 1DGLA 3VKOA 1W90A 3OF1A 4JGZC 4MGKE 2D3SA 3HT2A 1SZBA 1QOSA 2A1XA 1M06G 2A6YA 1O8PA 1XBFA 4EN7B 5KHGA 1GSLA 3TNQA 1AR71 1AR63 1VRH3 3OBTA 1L3JA 4LLFA 2ZPXA 4MUVA 3JQXA 4QDRA 1JH5A 4Y1UA 5E16A 5FYZA 3WNLA 1GWLA 3LD8A 4Q8KA 5C6CA 1SACA 2Y6JA 2YU1A 4W8JA 1WLDA 1RUH3 3R0RA 4ZXKA 1ASJ2 2XL9A 2ZS6B 4AZZA 2D6MA 1GZWA 2ZEZA 1CJDA 4RN5A 4CE8A 2JE8A 1OD3A 3A4UA 1UMIA 5LEJA 1UYXA 3W9AA 1MEC2 3M70A 4U2AA 4OCTA 3ILFA 5FZBA 3IDCB 2BRTA 1UAIA 4AVTA 5F32A 5JSOA 3O1PA 2LROA 1RUJ2 2ZHKA 3H8XA 3WT3A 1VRH2 4AI3A 1HN0A 4HONA 4N7IA 3USUA 1YHFA 3AX4A 1NA1A 4BIOA 1ZRIA 3DYMA 1UPIA 1C1LA 2DCYA 2VTXA 4C91A 2ORZA 1GLHA 1GOHA 1UY1A 4RGKA 4E27A 2J1SA 5BNOC 5JUVA 4GWNA 4MGYE 5JI7A 3E1F1 1W2AX 5A3LA 1F4HA 3B5LB 3O0WA 3THTA 2KM2A 2NMOA 2NM1A 2OW4A 1APNA 4A6SA 1WW5A 1PK6A 3AP9A 2VXRA 2XHKA 4G9SB 3WNKA 1UWWA 5I0SA 3WCSA 4LUKA 3ZXEA 3VBHC 5IK8A 3ZIWA 1CQ9A 3WF2A 1VAKA 4Q0QA 3CQOA 3E5UA 5ACA2 2IXLA 3OGJA 4GXLA 5DAPA 1MZ5A 5HXMA 3USSA 2XONA 1NXD1 4JGZA 2MEV1 4Q4X2 2Q8DA 4KWLA 3BTZA 5FOJB 2HKXA 4XEZA 4AFMA 3D0JA 3LOBA 3M2MA 3H3ZA 3URFA 4ITCA 2P3KA 4AVAA 3GZAA 4HVQA 4PBPA 1IQDC 1LU2A 5BNPB 3WR0A 3UGFA 1SPPA 2X5IB 4JTOA 1IPSA 1E5RA 1W3XA 2ZGMA 3CKHA 2UYBA 3KSCA 1FMD2 3O14A 4LR4A 3PURA 1LOEA 1LNSA 2DCTA 2OPWA 4TN7A 2VUDA 2R073 2VMHA 2Q0AA 2FBEA 1GZTA 3LB9A 3WDYA 1YWKA 2WR9A 3C3VA 3THPA 2JG8A 4IV1B 3AL6A 4P9IA 3H50A 1IPKA 1X9PA 4FPHA 1V9U1 3N9PA 5FYBA 4CUAA 4AEJA 4DUXA 4XQ4A 4FP2A 2EXJA 4LHLA 1BQPA 3ZPYA 3ZR5A 2QCSB 5JI9A 1WLWA 2VZSA 5DUXA 2XKPA 5FZCA 5FZKA 1UU6A 5F39A 4AHWA 3ZOIA 1SQ4A 1C8M2 4OVEA 4E8DA 3EXUA 5JZGC 1UQXA 5A3PA 1DLLA 2JECA 4ES8A 2CDOA 4S2FA 3SHRA 5BNOA 1MZFA 4YG3A 1Y9MA 1V6NA 1CX4A 1DYPA 4XC9A 3WLUA 2BW8A 2D93A 1K12A 2ADEA 5A3UA 5DMYA 4QU2A 2R1BA 1AR82 5KWRA 1NLRA 1XYPA 4QHZA 5FZHA 2RS32 4Y26A 2CGNA 1R64A 2K9ZA 2IXIA 2H0BA 2ZAAA 4SLIA 2FZ1A 4XFFA 3T30A 1RYYA 1PVC1 4PI0A 5FK7A 3GBFA 2J1AA 5FYUA 5CISA 4NPRA 4EE2A 1MVEA 3RFRA 1N3QA 4CDWA 3SLIA 1SHWB 1H6XA 1PM4A 1VBE3 3UKTA 2PN5A 2GN3A 3TEYA 2C6SA 1YIPA 1ND2C 3FZ3A 5DPNA 4YVWA 3LOIA 5CFCB 2JXAA 3GJBA 2UY8A 5HCHA 1RMU1 3BU0A 4IEYA 3THDA 3VD5A 1Z78A 1EP0A 2VW1A 4XJ8A 5IUQA 1SLCA 4K1ZA 4ZPIA 3HNYM 3D5OA 1E57A 4EZHA 1QJX1 2E7AA 3HT1A 4XE9A 1GQPA 4Y1VA 4UYBA 4R4ZA 1LOBA 5A7OA 3O1OA 5FZ6A 5DQ0A 2BGPA 5K0UC 4C90A 1FT9A 4OQ8A 1JBCA 1NCRB 4R8HA 5E88A 2ZOEB 4CEWB 2G19A 2P1BA 4GAZA 4PIYA 4C8DA 2TUNA 4COWA 1YQ2A 2VE1A 4EV0A 4CDWC 3ZFGA 2NLRA 1X33A 1KD7A 1OH4A 3SC7X 2VZPA 4EN0A 5F7UA 3DF0A 1OA4A 2WYSA 1FAYA 4CCNA 4YVWC 5AFBA 4L2NA 2VVEA 1GR3A 4LEJA 1AR73 1VRH1 2Q4SA 4NIGA 2A6VA 4TXWA 2YPJA 3NSTA 4M00A 5FCCA 4FTEA 3LWCA 4XJZA 1K45A 1ZZ9A 2YFZA 3OPZA 5LBBA 1W05A 4WV8A 2HJIA 4BHPA 2W46A 3DPRC 1YLLA 1I3HA 1KGYA 4P9XA 1K5MA 1BZWA 4ASKA 5EZWA 2WKKA 1H1MA 1G6NA 2O1QA 1H1IA 3ZFEB 3SQOA 2R062 3T2PA 5T5PA 4EN6B 5EFUA 2DUPA 3VD3A 4AL9A 4Y22B 4O9EA 1VBE1 3KQ4B 4Q1PA 1GANA 2DTYA 2JB8A 2WLQA 3FUOA 3N9NA 2W47A 1HKDA 1ND2A 1ZYBA 4XW3A 1W9TA 5CB7A 3CJIA 1FI2A 2HBTA 1RUJ1 3NQHA 1KXGA 3OPWA 4XJUA 4ASLA 1LAJA 4YARA 1UYPA 2YC2A 3G7DA 4EWAA 4NIDA 4QGNA 3EBRA 5F6LB 2Y6LA 5FO8B 4I2OA 1JYNA 1H8TA 1KS5A 3GJAA 5JIAA 4O65A 2XLGA 4QX3A 4H14A 1N1SA 1XB9A 1O3SA 3M3IA 2UWAA 5FQ0B 1UPSA 3T2TA 1W39A 1XU2A 4GWIA 1NYWA 1ONAA 2ZKLA 3ZN5A 4XVHA 4R9DA 4BXFA 5FBJA 3WVJA 5CBLA 4HN0A 2WABA 4WBBA 2PAKA 2V72A 1W2OA 3ABZA 1UZ0A 2WO3A 3UL2A 4OHXA 1A34A 2Y33A 1S0FA 2F17A 4UFKA 5JR2A 3RWNA 1OLQA 3FN9A 3RYKA 3TBDA 3TEZA 1LHNA 5JXGA 1H0BA 1GV9A 1OXCA 4RA0A 1UOFA 3QH7A 3DPRA 4WM7C 4XBQA 4Y1YA 5CZKA 5DZFA 1PGL2 4AI0A 4FFHA 4XF3A 5DABA 1CVNA 4XAAA 5JMOA 2RS31 2XQXA 1C4RA 3O0XA 5FMOL 5CFDA 1CONA 5E6HA 1QQP1 3A0NA 5BPXA 4BYYA 4WVMB 2ZGNA 3B94A 3M3EA 4YPJA 4DPNA 5BYNA 5FFOC 1IG3A 4AG4A 1FOD3 4PIXA 4S2HA 1CJPA 3ME2A 4B1LA 1HRI2 3AMNA 4HK8A 4YFWA 2XJTA 4FOQA 3ZVXA 4QX1A 4WVZA 1W2NA 2PHDA 5SV8A 1DYKA 4AHZA 3OGRA 1TMF3 4YW5A 1RMU2 3AJZA 5FPAA 2CGPA 1UX7A 5AVPA 5JXIA 1XNDA 1OBNA 1FV2A 1GZ9A 1XE8A 5A6XA 3RI9A 3T2QA 5A6YA 5GZEA 4LO5B 5F3GA 3MEPA 2VMIA 5BNPA 3V0AB 2GC0A 4GWJA 1SPPB 2E51A 4AVVA 2K0GA 1GP4A 3AB0A 1GFF2 4AEDC 4QX5A 1CZVA 1AYM2 3LA3A 1S0EA 4HPKB 4N7UA 1DZQA 4O9GA 4AEMA 5A33A 4RGGA 3ZKYA 2WN3A 3LIGA 2HWC3 4QDQA 2WC2A 2VOTA 4D0QA 1W04A 1UMZA 2LS6A 2WSUA 5FZOA 1JZ5A 4CU7A 3WW1A 1GWMA 5AC91 1X7NA 4GA9A 2OKXA 3HMYA 5GLZA 2EIGA 2R0FA 1GNZA 1DG6A 3WINE 4QX2A 3GALA 4DRRA 5CAZA 1W0PA 4KG8A 2MHFA 2VO5A 2Y26A 1XOYA 3LFMA 3OGSA 2GZWA 1PO12 3PIJA 2D6PA 3A0KA 3ZN4A 3KV4A 4N9HA 1WLTA 3MHZA 3F2ZA 2CNAA 2WNEA 3O1MA 2WFF1 1T6GC 2QKDA 4I02A 3RZLA 5DUUA 2VZUA 5FPBA 4FT8A 2QQUA 1AF9A 2P3YA 4M3CB 1PX4A 2ZMKA 3VBSB 1RUC2 2OS2A 1PGW1 4AWDA 5K0UB 2XUEA 4BOWA 3BKZA 4LO8A 4AVBA 2BNNA 4FO9A 5A7WA 2C26A 1LEMA 2VTFA 4K8RB 2B4KA 1T6BX 1VR3A 4QPWA 5D8AA 3ZLIA 4XZPA 2W95A 1ZM1A 5DG2A 4UBHA 2R6QA 1D4M3 2ZGPA 3S30A 3TRSB 4BQ5A 1TMF1 3WDXA 4F8AA 3WF0A 2AREA 3WV6A 4KBZA 1HQWA 1PO13 1H2LA 4OLLA 2V5YA 1LOCA 4LBQD 3K3OA 1WMDA 1XNBA 4Q0PA 2R1DA 3DCQA 3MV01 4S2GA 1UX6A 3PJQA 4M0NA 4DZGA 1ZZ8A 3TEXA 4XUQA 1OLME 3B01A 1ULFA 3GZUC 2BU9A 2P3IA 2YG0A 1POV3 2ES3A 5ABJB 3WNPA 2ZHNA 4NO4A 3OD4A 3T1MA 4OUSA 4UT5A 3H1WA 2HWF1 3ZYHA 1QU0A 5LWBA 1NCQA 1VBE2 1GUIA 4AI8A 2WS92 5L9RA 3J4UH 3ZXKA 2ZX4A 5DG1A 2D5HA 2G9ZA 4GD4A 5CADA 2IVJA 3I2DA 1JTZX 3PU3A 4XMIA 2E7QA 4HT1T 4YFZA 3U1XA 1RUE1 5JAXA 2FDIA 1HB3A 4GH4A 1S0GA 4L92A 5M0TA 3CZJA 4KQ7A 1VB2A 2LW8A 2W9XA 5K9YA 2VMFA 5AFEA 4GJZA 1E5SA 4MGQA 1ZZBA 1VPHA 2FDJA 1JHNA 1YEWA 5FWJA 2FDKA 5CKNA 5C71A 4Y4YA 4UFIA 1NT0A 4Q4X1 1WGPA 3LEGA 4WVVA 5FR3A 3VDBA 2XB6C 3FLRA 4YGDA 2V73A 4QMAA 5B2GB 3LDBA 4KGQA 4HSJA 4DUVA 1W6NB 3ZYGA 2VZTA 4Q4W1 2UURA 2DU1A 2DCJA 5ANQA 2RHPA 4OFGA 5C3PA 4EN8B 4YM2A 1EPWA 4KU7A 2WNUB 4QXHA 1AZDA 1RUD3 3VLBB 2GU9A 2ENRA 4UW3A 2QQNA 1Q8OA 4L97A 2YPDA 1SFNA 1RUOA 5C70A 3ACGA 2QQLA 2P6CA 1MPXA 1EUTA 1R083 2C9KA 4JCKA 4CUGA 3C7HA 1H30A 1MS4A 2WUHA 3QH6A 2DUQA 5FMDA 1AYN2 1OA2A 4JGZB 5FMBA 2KD7A 1JYVA 2PAMA 2BZDA 1JZ7A 2XXZA 3BOPA 4IEOA 1ZZ7A 4IDZA 4FPKA 4KG0A 5CA6A 5F5AA 3ZXFA 5FZ9A 4X6RB 2Q8OA 1XPWA 5FQ0A 1IQAA 1HQLA 1AYM1 1KFUL 3RDIA 5GKAC 5T55A 3OBAA 2P17A 3AMHA 3C8XA 4LIUA 2H0VA 5JIUA 5JPNB 1JYTA 2K46A 1JOJA 1HJGA 1R092 2HWD2 3RZHA 5L9VA 4ZS2A 2R043 3T09A 4QU1A 1W9SA 3JCIA 4OQ9A 1C1FA 2ORXA 5FP3A 1R1ZA 3DKQA 4MH0E 1QDOA 4PLNA 4XJAA 4F3JA 4XZUG 4RQPC 3UYJA 3OJBA 4GZ9A 4WM7A 3WW4A 2OZJA 1O5LA 3MUZ1 2XJUA 3QCWA 2F4LA 4FBFA 5JMCA 2D5FA 4LBQA 5G05L 4ZU7A 5J09A 2J7MA 3FJSA 3TN91 2ADDA 1MZ6A 4PF5A 2WT1A 3PIGA 5T3NA 2VQ0A 1BBT2 1CESA 2OUHA 3IAQA 4MOAA 5LBEA 2VD7A 3UT0A 5CFCC 4JX0A 1LHOA 1CAVA 5T5JA 3FHAA 1AR72 5KHKA 1P8JA 1NKGA 1AR62 5JXJA 3F95A 1H2NA 4Q2FA 1WBLA 4GALA 4OI1A 2Q1MA 2HH9A 3HBKA 2WT2A 2CDPA 4COUA 3KB5A 3HQXA 5I0TA 2RS52 2X10A 5IYYA 1G7YA 3LGRA 4HSLA 2P37A 4PI2A 1BBT3 2QTWB 1UXZA 5EYXA 5F5QA 4NIAA 1V00A 2ZEWA 3WP5A 1ZRDA 1ZRFA 4YSFA 3AYEA 3WP3A 2PHUA 3IBMA 2I74A 2B9UA 4M0HA 4AEDA 2VGDA 4B4PA 2RJ2A 3J8F1 2HLEA 3I7DA 3O7OA 3VDDC 2VU9A 3UJOA 3MI8A 3CO2A 4FPOB 4YRDA 1RUC1 5A33B 3K75B 3CL1A 1OSGA 5F1RA 2E33A 5FZOB 2QE3A 4MSVA 5JPMB 2XH6A 3I97A 3NJYA 1NCRA 4SBVA 2I07B 4K7JA 1O4TA 3VUOA 4RFT0 3B93A 1NLQA 2WNVA 2FHRA 3DL3A 4XMAA 4OMDA 2OA2A 4OYUA 4BISA 1W8NA 3B9CA 3POGA 3PVBB 3E97A 5JOZA 4I01A 5F5IA 1W0OA 4Q1RA 4Y5Z0 3ETQA 4XBLA 4COZA 5FY8A 3RVHA 4TYSA 3T4HB 2WZR3 1VBC2 4CP0A 4BQ4A 5LY2A 1DBNA 3VBSA 3AYAA 4BQ2A 4D6RA 4OHVA 1S0DA 2EXHA 3MLLA 4D7TA 4NVPA 3NKTA 4LQRA 2UWCA 1HXS3 1W8FA 4E4ZA 1LOFC 2PHLA 3GCWA 4IV3C 3GZEA 5ANNA 3PTYA 1XXNA 3JQWA 1G9DA 3U4XA 4META 3AZWA 2DCZA 4AHYA 4PT6A 3ZPOA 1DIWA 1VBA1 2E26A 4RS5C 1IKPA 1XNCA 4H7MA 3FWEA 5SV5A 4QGMA 3AFGA 4QKFA 3ATGA 3SMHA 2PLV3 3VHOA 4KL1A 3WW2A 1I5PA 3ZXLA 2Y38A 2ILMA 1ODNA 4ET7A 1WD3A 3NV3A 1SFPA 1OMIA 1KFXL 4QWNA 4W6XA 5EYYA 4EZ4A 4I3GA 5A3OA 1OKOA 2YFUA 3CNAA 3VBOB 2Z5WA 4Z92B 1OFSA 4MXVA 3KF5A 4WM8B 3SEPA 1U5YA 2D44A 1RVF3 1IS3A 2FDFA 3QLQA 1H8TB 1KEXA 2E31A 2D7FA 2WZR2 3UNPA 4MVTA 3I4IA 2A7AA 2BBVA 2JG9C 1CR7A 2B46X 3HIFA 3MIHA 2JIGA 3VN4A 4BK4A 1W28A 1C5IA 1AR92 4BK5A 1VP6A 2D40A 1WMEA 3JBG3 4DXRA 3E6DA 1QJFA 1VMHA 4ZU5A 5LBFA 4ARYA 4CUBA 4Q4Y3 4KH9A 1HRV2 3PJYA 2NYYA 4QPGC 4CEWC 3BTAA 3Q8BA 4LA3A 4GH4B 1YFXA 2B9VA 4LO6B 1C8M3 1SDDB 5FXXA 3V56A 1RUC3 5A3MA 2XBO1 1WA6X 4H2AA 3HWJA 2FZ2A 4Y3OA 4GKXA 4F7ZA 2K2SA 4Z82A 4K20A 4JKMA 4QXCA 5IAXA 4IQPA 1RMU3 2QVSB 4YZ4A 4XXPA 5F3IA 5C9AA 4BQWA 4CTEA 3KT1A 5EHDA 4BMBA 1WW7A 2OPKA 1CAXA 4AQ6A 1OLMA 1W6NA 2JD9A 3NRUA 3VZNA 1IKQA 2NZ9A 4FAGA 1AL22 2QBXA 2WNUA 3VZMA 2QZ3A 2XQRA 1O3QA 2VBDA 3VKFC 4COYA 4LIVA 4HBNA 4PDWA 5A32B 4PBOA 1UIKA 2VMDA 1ASJ3 3S7EA 2X09A 4EJRA 2GP3A 1E5IA 2HWC2 2W92A 2Y64A 3CBNA 3IZOA 1NY71 3WX5A 3PUHA 3POIA 1MR5A 4W6WA 3ACIA 4GWMA 1UW8A 1TG7A 1UXXX 2VMCA 2YUEA 1ULCA 4XOGA 2JDHA 4BJ0A 2VOVA 1WZXA 4NHLA 5H9QA 5H9PA 1RUG1 3JU9A 4LITA 2UWBA 5GZDA 1R082 4N90A 2EALA 2XLAA 4MGZE 4GMP0 1ZBE3 4AQSA 4JGYB 3LCPA 1AXYA 1PK6C 2DV9A 1COV1 1H2MA 2RV9A 2V09A 3POBA 1CPMA 4PF1A 4QB2A 3WCRA 2XDVA 5FWEA 3NO8A 2PQSA 3PMEA 3VGIA 4AGVA 4FFFA 3R05A 4RR3B 4A7KA 5LRRA 5FZ1A 2WRAA 5C3OA 5JZGB 4LE4A 3AMMA 1GU3A 1NA1B 4FQ4A 2CY6A 1DQ5A 2ZACA 3W5NA 1AYN3 4AFDA 5F5CA 2Y60A 1MQTC 1AX0A 1OH3A 1UZZA 3OEBA 4JDNA 5FPLA 1ZBA1 1QY4A 3ZSKA 5A6QA 1I1EA 3O1VA 1RVF2 4IEZA 5BXXA 4HXCA 5IJRA 5FY1A 1LESA 5FY7A 5C7GA 3AYDA 3GBGA 1CAVB 2XVLA 1NX9A 3K48A 5EJ1B 1PM7A 3E6BA 3MW4A 2GMPA 3KT7A 2BGCA 1PHMA 5LEKA 1R1A3 2X29A 1HV0A 4QKNA 1TE1B 4AFCA 5F3CA 2JJ6A 5K0UA 1Y9QA 2DDUA 2GMMA 1A8MA 4OZOA 3N7JA 3PUQA 4MZUA 4BE3A 2KR2A 3BVCA 4XIOA 3O1UA 1O4ZA 5FREA 4BQ3A 3ILRA 5D8AB 3T2OA 4Z2AA 3B69A 4XXAA 2Z69A 3SITA 1O8SA 3AKSA 2YYOA 1D4VB 4IEVA 3VHRA 2RM22 5AC93 4DNYA 1US3A 3AP4A 4I3PA 3WY6A 1PMIA 1QEXA 4M3CF 1F4AA 1RC6A 3U14A 4MADA 3UKNA 2DVGA 2VCMA 3MZHA 1UYYA 4LHKA 3MIFA 1UZVA 1LRHA 5DAXA 1Y7BA 2EIBA 4YYOA 1MVQA 3QD6A 2R041 3P3NA 1HW5A 2SLIA 3HJRA 4O61A 1YI9A 2PLV2 2F4PA 3POJA 2VUAA 3LDRA 3RGBA 2RMU3 5A1LA 2W1UA 2RS11 4XFAA 4B1MA 3PVNA 3ZFFB 5HCFA 1YRZA 1ND3B 4CDXA 1KS4A 4INDA 4Y4RA 1W2TA 4UWDA 2R0HA 5EJZB 3KCYA 4AF9A 2RM23 1HIXA 5DXDA 4IEXA 1GYKA 3VBSC 1EV13 4RYDA 2D6KA 3RMYA 4PQQA 1S4CA 4ZZ8A 4V2VA 2QQIA 1OOPC 2QQMA 3AFKA 1H1AA 5J98B 3V65A 1D4M2 5A7PA 2J1EA 4BLJA 2VCCA 1PGSA 3JBG1 3EO6A 2IXCA 2CSGA 2ZHLA 4AR2A 1TZOA 4C0HA 3C7FA 4UFMA 4X8NA 5K7PA 3BODA 2WWSA 3AVRA 4CP2A 1S2BA 1JOPA 4XJWA 3NNLA 5K8SA 1W8TA 1YQ6A 1YQCA 5HI0A 3GGLA 1EV12 1VE0A 1CX1A 5LRSA 1CN1A 3GF6A 4FPLA 4I0WB 5T50A 2IXJA 4L8QA 1GNYA 5FP8A 2HWD1 3POFA 2JD4A 1F9KA 3HD8B 5T54A 1LU1A 4Q8LA 3CJIC 1N3OA 5EIYB 5FZ0A 5TSWA 2YMZA 3TOJA 1NOVA 4BU2A 2CV6A 1ENRA 5BV6A 5L9BA 1ULOA 1F5JA 3MW2A 1GWKA 3S7IA 3IM0A 3WNXA 5ABJC 4OI0A 1COV2 4GH4C 4YNIA 3EJKA 5KHJA 4XF9A 2GC1A 1H4GA 2XVGA 1GZWB 2WN2A 5J48A 1KRIA 1AL21 1KJRA 2W52A 2ATFA 2JENA 2HWF2 2VY0A 4XFHA 1G8WA 1PO22 2J22A 5D2AA 3OOXA 1POV1 5FLJA 3R6SA 3T3YA 2YB7A 4CUCA 3VBFC 1ENQA 1AX1A 2ZAHA 1T2XA 4Q26A 3RMXA 3ES1A 4FP3A 3VBRC 5IAVA 2ZZQA 1ODMA 2MEV2 1VALA 3USUB 1BJQA 1JZ3A 1NCQC 1OQEA 2P4EA 3KQRA 2HWB1 1F5FA 3S5AA 4AGGA 1WD4A 1WCSA 3S0MA 1Z7S2 3ZSMA 1OKQA 3PDQA 4LBQB 5C5UA 3AP5A 3K77A 4C0BA 4LT5A 3ZMOA 2D6NA 4Y22A 3D3AA 3HN1A 2B39A 2RS53 2W91A 3GXUA 1S0CA 2VQUA 3CF6E 1OPMA 3LDKA 4FOYA 1PK6B 2Y0OA 5HXVA 5LBCA 2W0XA 4EWDA 2VCAA 4XAEA 4OMCA 5A32A 4AI9A 3APBA 4OI4A 3VBFB 5B4NA 4XABA 5LASA 4LKSA 4LPLA 1VBB1 3SCFA 5FO7B 1CAWB 1JU3A 3UGHA 2YBKA 5FYIA 4RR3C 3NWKA 3I49A 1S1AA 2WNUC 3K3NA 4LJHA 4WVWA 3RQ0A 1PNFA 4MYEA 5C5TA 2XG3A 3HQRA 4P00B 5HV4A 1RXGA 4I09A 5FKBA 1D7PM 2PHXA 3BUCA 4DFSA 3KS7A 1QJU1 5GZFA 4AEDB 3WDUA 2ZX0A 3LEKA 1H9PA 2R071 4DEVA 1TME2 3CDZB 4LLOA 1CIWA 2D3PA 3H3LA 1X8MA 2IVIB 3AM2A 2CTVA 5JVVA 3Q8CA 4MHUA 2JDNA 2RR11 3D82A 3HBZA 3RPQA 1XU1A 3SH4A 4CU9A 4FQZA 3AK0A 1RUH1 5IVFA 4A6OA 4JKLA 3VBRA 4IE0A 4AAPA 2PHRA 5FPZA 2WINB 5L19A 2DU0A 2E7TA 3VKLA 3I2FA 2XMLA 4CYDA 4ZZ5A 3INAA 4ISRA 2ARCA 3X29B 3I3BA 1WW6A 3NJZA 4YGCA 4X8PA 4BDVB 4E2GA 3Q8EA 4O7XA 1J1TA 1MZEA 4YZ5A 5CG9A 4WZCA 1RL3A 4Q5OA 1UY4A 2Q5TA 5KXCA 2ZJCA 1FATA 4QT6A 1O7FA 5DUVA 1ZX5A 1WLCA 3J8F3 3T0AA 1VAVA 1W3VA 2BNMA 4IEPA 1DQ1A 1Q8SA 3H0OA 2LUWA 1FX5A 2ZGQA 1X82A 1VJ2A 3JD73 4DY5A 1MS9A 2WFF3 1LOGA 2GNMA 1RB8G 3BTYA 3DKWA 1VBD1 1GMMA 3GDBA 4J1XA 4N43B 3WDWA 4RHV3 5FPXA 1JYCA 1YJKA 2W1QA 4XFIA 5A7NA 3K51A 2A3YA 1SBEA 3POEA 4D6SA 3V0AA 3FHIB 3WF1A 1B35B 1H2KA 1W6MA 3WG2A 3ZX7A 3Q8FA 2DYCA 2C9AA 4ZONA 4HPKA 1ENXA 1IGOA 3LEIA 2E53A 5FXVA 2VZRA 3SNMA 4NHXA 1C5HA 5FUIA 5C4WA 4LTAA 3C7GA 2BFUL 4JDMA 3N7MA 3UESA 1J84A 2VTXJ 3L2YA 1SG3A 3BPZA 3H9AA 2VMGA 2W1WA 3J8F2 4XTPA 5JXHA 3VD4A 1QH7A 4L11A 3O1TA 2VNGA 1REDA 4MGIE 4CRQA 1O91A 2R32A 4N9IA 3A22A 4TWTA 3ZFFA 1GNHA 2BDRA 3DGTA 3S5QA 3T4VA 1UD1A 4FPYA 4AFBA 1H8VA 1ND3A 5EP9A 2NP0A 4YZ1A 2CYFA 1NG0A 2NMNA 1X9TA 1AJOA 4N53C 3SCHA 4CEYA 5A1FA 3I3MA 3OYWA 1NZCA 4XUPA 1HQNA 4XUNA 5T5LA 1H9WA 2HYXA 1OUSA 1AR93 4IV3B 4FPGA 4NE9A 4CCJA 4JTNA 3Q9OA 3H7YA 1PMJX 4ATEA 3DYPA 1ASJ1 3AP6A 2PELA 5LB6A 3M3CA 3MBWA 4NRQA 3I3DA 4GQ7A 4NRMA 4JQRA 3ACHA 3ZSLA 2GC3A 1K42A 2OQ7A 3W58A 1NY72 2ZX1A 3VDCA 3L9JT 4IESA 3AZVA 3O12A 1D2QA 1SEFA 1MS3A 2TNFA 1SLTA 2VR4A 1EPZA 5FY0A 1US2A 2YBPA 3NV1A 2EAKA 4HLTA 3LZZA 2V5DA 1R081 4MO3M 1G86A 4XDQA 5IVVA 1X36A 4IW3A 4EYUA 1SFYA 3V0BB 1NE4A 3FLTA 3I3QA 4Y20A 1Y9GA 1A6CA 4LOTA 2ZX2A 3K2OA 1Q5OA 5ABJA 3HEIA 3LIHA 1BXHA 4AI1A 4EN9B 4NAOA 1JN2P 4UBGA 1SDWA 3IAPA 4D7YA 1MQTB 4WZFA 3H42B 3MYXA 5ACA1 3J9SA 1JUIA 4YW2A 3KLSA 5IK5A 2ET7A 2WDBA 3ECQA 1NA1C 2ZGKA 5FBZA 3MF9A 5CNAA 3V64A 5IHRA 1EAH3 2VNOA 4HKOA 4NN0A 1EAH2 3WQBA 5DDJ1 4FTSA 4RHV2 3JZVA 1BCXA 1RVF1 4R9AA 2QZ2A 5FKCA 1IS4A 1DP0A 1LCLA 3ZYFA 3U78A 3GBWA 5FZDA 5JR7B 4S2DA 1U0AA 2GDFA 1RHI1 4P9JA 1RUF3 1DFQA 1VBB2 2LALA 3ZMNA 1SLIA 2TEPA 2XGXA 2DBIA 2R49A 1HRV1 4IEWA 1WMFA 2O8OA 1BMV2 1JU4A 5JWPA 1LTEA 1O3TA 1PO23 4KWKA 3KCCA 1VRBA 3PL0A 2ZBJA 2HWE1 2JICA 2RMU2 4LKEA 1ALYA 1JZ2A 3VZLA 1R1A2 5KHHA 5B4XA 4ONUA 5IW0A 1BEV1 4LKDA 4E8CA 5I0DA 3DV8A 3JB4C 1SLLA 2ARXA 2C1FA 2J1RA 2YV8A 5J7MA 1UU4A 4E9KA 4YVSA 5C8WA 3RS6A 2RR12 3ZXDA 5I8SA 4NIIA 3K46A 4QHBA 3KV5A 4KWJA 3WZ1A 1AR91 2WL1A 1YIFA 1PVXA 1ZBE2 3PLQA 1RUH2 3W20A 2OXBA 1S0IA 3HAGA 5AC92 3OUHA 3CJXA 3ENRA 2HWD3 2D6OX 3KZ4C 1H6YA 4GB31 5LATA 1POQA 1RITA 3N7LA 2I2SA 1AR81 3HOBA 1TNFA 1RUF2 1NQDA 2RJLA 1Z7S3 2EF6A 4D94A 1SBDA 1ENSA 4OHWA 3SKJE 2RDRA 5IVJA 5JDBA 1MEC3 4AGRA 5IWFA 3LEMA 4OI2A 2YDEA 3BIWE 4YG6A 1BK1A 3D8CA 5A7SA 3EYPA 1ZRRA 2N7GA 3OBRA 4YWAA 2B8MA 1S0BA 5FP4A 3NJVA 1QKQA 3PMSA 3NNJA 4H7LA 2VM9A 2YC4A 4D69A 2W2IA 3N36A 2P3JA 5FUNA 1FYUA 3VDDA 5FZ3A 1QXRA 1WA4A 1QMJA 3PVEA 3I2OA 2VJXA 2GNTA 5FK8A 3GCXA 3POWA 4K9SA 1OHFA 3FHQA 1DF0A 2XR4A 4D3WA 3IPVB 3MLKA 4MV2A 3WUCA 5FUPA 4BQXA 1AUYA 2X05A 5BNNB 3U0ZA 1BLZA 1OOPB 1UYZA 1YJLA 1ACCA 5FXWA 5DAVA 1A3KA 1COV3 1O3RA 1RIRA 3CHXA 1UU5A 5G04L 4LXLA 1F15A 5T5OA 2R063 2G4IA 1AJKA 2VULA 5FIXA 5F2WA 4A45A 2ARAA 4EWEA 2BV4A 5ACA3 2VVFA 3RYRA 3R4SA 1PIV1 2VNVA 4XFBA 5A80A 2EVXA 2LM3A 2WNOA 1PMHX 5I0RA 3LKJA 3ZR6A 4Q4V2 4B8EA 3KM5A 2ZGLA 3AZXA 3TAYA 1O4YA 2VUCA 3LPGA 2D97A 5FPVA 3OTFA 4FPFA 5KC6A 4KGGA 1HB2A 2FCTA 4FVVA 1LECA 3OD0A 1NAEA 3HVDA 1V6MA 4G4FA 3JUUA 4N43A 1C57A 2HYKA 2NPIA 1O59A 1UKRA 1VBA3 3LPFA 4YW4A 4MGSA 4URAA 4PCRA 1XYNA 3AKPA 5FZGA 4LBOA 1REFA 4YW7A 3ZDSA 1UOJA 4JRLA 4KMQA 5I0UA 1PZ7A 3U11A 4OUMA 4A2UA 1B35A 2WQZC 3ETPA 4XCBA 1VMFA 4YZ3A 1XYOA 4P9WA 3ZFGC 1QXJA 4R52A 4NPLA 4XPVA 1MS8A 2Y6KA 1OURA 5D8AC 2GALA 4UAPA 3AP7A 1UL9A 2RM21 3KF3A 4MHRA 4M01A 2OX0A 3TNPB 4YW3A 4CCLA 5L7OA 4YM3A 2XPJA 2X53S 4QPIC 5EPAA 4BIFA 1ST8A 2RE9A 1JUHA 2BWAA 4YGEA 3WDVA 1K3IA 2OZ6A 4MG2A 4Q4Y1 5FZ4A 3FFQA 4XACA 3N9QA 1XSRA 1NCQB 2QQWA 5FY9A 3EB7A 4XIKA 1PNGA 2G1MA 2MNGA 2PYTA 1QF3A 2VC9A 4L99A 5H9SA 1F35A 4BPZA 4LO4B 4CCMA 2WNVC 1KDMA 5ERLA 3WDTA 5CIRA 2J42A 1NQJA 2XLFA 4Y24A 1Q8VA 1Y3TA 3M1HA 2AR6A 4UW6A 1RUNA 1CAUB 4AEKA 1YO8A 4IE6A 1ZZ6A 3IDAA 4QQ2A 1URXA 1G9FA 2DWRA 3LFIA 3KT4A 4NUBA 5I93A 3ROUA 4CU6A 4HKLA 3AC0A 3J7HA 4M4RA 3RZMA 5IATA 1W03A 1QOTA 1N3PA 2JDMA 1LULA 4DUWA 1UZWA 1U12A 1BEV2 2RG4A 2XL7A 3MICA 4KNCA 2XVKA 4URTA 1E5HA 1GQGA 3UKVA 4JAAA 5A70A 3UGGA 3ILNA 1W6QB 4NRPA 4P14A 4RHV1 3WG3A 1FNZA 1LOFA 5JCTA 2E9QA 4J1WA 2QQJA 1RJ7A 5DZGA 3HR9A 3NW4A 1RHI2 2WO7A 4CZSA 4OHYA 1N1VA 2PLV1 2GH2A 1LHVA 3N9LA 3ZM8A 4DQAA 5C3QA 1B35C 1ZA7A 2VW2A 4GB32 2W3JA 4XCAA 2RS12 1HDKA 1RUE3 1UIJA 1K5MC 4PLOA 4QPYA 2IXKA 3IDBB 2Q1FA 3LAGA 1UZYA 4Y20B 3U37A 2XHNA 1UCXA 2VECA 5EWSA 1UMHA 2YHJA 2J1TA 3W21A 1QQP2 1RUI3 3GZTB 4QQLA 4QGLA 1MQTA 2A6XA 3RG0A 2UYAA 4E2SA 5C9AC 1OUXA 4LULA 3CIHA 5A1AA 1KITA 2VMEA 2H6CA 3SISA 3RWKX 3DECA 2TBVA 5APAA 2CWMA 2JDUA 2C5DA 3NNMA 1LR5A 4MLOA 3E6CC 4MXWB 1AR83 4HETA 2QDRA 4DINB 1Q43A 1W6OA 1IHMA 4XILA 3VBUB 4FXKB 4BCUA 3BU7A 5A3NA 2VBBA 3AYCA 3NV4A 4JV4A 5DAWA 5LCWL 1JHJA 3FBMA 2LTNA 5KXEA 2R061 1XE7A 3C7EA 2XBO3 1OI6A 1REEA 1ULEA 4FOVA 1AL23 5BNQA 1U5ZA 5KR7A 3BPSA 4AK3A 1K5JA 2RS13 3VBRB 1OFNA 4BXSV 4KWUA 2DF7A 5C33A 4A44A 1GKBA 5I91A 1CAXB 2DTWA 5HCAA 2A73B 4HK9A 4BLIA 3MFCA 5T52A 3W5MA 1GP5A 4BQYA 3TWIA 3MLJA 3FFZA 1R093 2GP5A 4I0BA 4D7SA 4FPCA 5IVBA 1JZ4A 2B7YA 3ACFA 4M4PA 3WSOA 5BNPC 3FE5A 1LKNA 2A6ZA 2OT7A 2X5IC 1KDKA 3Q8AA 2QFEA 2FMDA 5FYCA 1OC1A 2ZTNA 2ET1A 5FMOS 4PQ9A 3VHNA 5LY1A 2ZEYA 3SCGA 5BNNC 3M3OA 2VOKA 4AVCA 5CFDC 4P5YA 2CAUA 4H55A 4NHMA 2B45X 5I8TA 3MIDA 4DXTA 4ZXEA 3G6JB 4CDQB 1V6LA 5FZMA 2BP6A 1W6MB 3M7AA 1GQHA 4R9BA 3MW3A 5IFPA 3BALA 3KCXA 5FMCA 4RR3A 2BFUS 5HCBA 3ASIA 3VDDB 4XYXA 4B3NA 3P1IA 4RQPA 4N53B 1QJU2 2AGSA 1DZTA 1PVC3 1PGL1 2DURA 2MPFA 3K4AA 1IZ3A 1LENA 1KQRA 1QGLA 1RHI3 2HEYF 3IPVA 1GZCA 1PZ8A 4K1YA 3AL5A 2D6LX 5IK7A 1D0GA 1Q8QA 2JG8C 3NV2A 1AHSA 3SH5A 3WG4A 2FCUA 1JW6A 2ZGUA 5F8PA 3L2HA 2ID4A 3N3HA 1JODA 3P5BA 3OGGA 5CKQA 1I5ZA 5CYYA 4RGAA 5D1IA 1UOGA 1XJAA 4CDQC 1QIQA 3JD72 3OYWB 4QDSA 4XUOA 2VZQA 2QUOA 5A6ZA 2ERFA 4OZXA 5C8CC 3H8UA 4FFIA 4JKKA 3ZN6A 3ZYRA 1HJFA 1WW4A 1W06A 2BYVE 4QPIB 1J59A 5IVEA 2XJRA 2PA7A 4JHTA 1G9AA 4LHSA 4V2WA 3KGLA 1FMD3 4G3YC 4UXAA 3IN9A 4B4QA 2WO2A 1V9U2 4JRAA 1JYWA 1MS1A 1LGBA 4JC1A 1V9U3 2A3WA 2WO1A 1IOAA 4IEQA 1BVP1 3ES4A 4P08A 4YVWB 5JSRA 2YC0A 5DZEA 3ZYBA 5FOBB 1JYIA 1UN1A 2AEYA 1JZ6A 2BOJA 3TB0A 3H8OA 5DDJ2 4Q27A 4IUGA 4FSJA 4X6QB 2HEVF 1OF3A 2XKOA 3VB9A 3IDEA 4DY3A 3KHCA 4Q4W2 3VBOA 4QQOA 5L73A 2A75A 3OUJA 4WM8A 2UY9A 3AKRA 1ZNPA 2DBNA 2PXJA 4QD2A 4DEQA 2QQKA 3WQ7A 3J7LA 1ZA4A 5FYTA 2HWE3 4IE5A 4CPBD 2FCVA 5LA9A 3VZJA 1YUDA 4AHXA 1OA3A 1DU3D 1GOFA 3WF4A 5JLVA 2EXIA 4GMP3 3NKGA 1AXZA 4CDXB 2DFCA 2VZVA 4A41A 1X50A 2AC1A 1AYN1 2JEMA 3EQEA 2IFRA 3RRDA 4HMZA 1XE0A 4K3UA 2F6BA 2BQPA 3IKWA 1S55A 1RUI1 1YC61 2CL2A 4RS5A 5FTTC 4A4AA 4YZ2A 5EXOA 2JWPA 2VZ3A 3RJ2X 1CAUA 4A3ZA 1UKGA 4JVAA 1XSQA 2HWC1 4QPGB 2VW0A 4IXLA 1VMJA 1XRUA 1DYOA 3ZFFC 3VBOC 4CDUC 2Y8KA 2NQYA 2AYHA 2DVAA 1ZBE1 5DAQA 5KXDA 1K5MB 2QQVA 1EY2A 2JG9B 1DQ4A 4OUEA 2EAAA 2RS51 4KU8A 1DGWA 5FP9A 5F9TA 2JDZA 4TZDA 4OULA 4DOUA 2PMWB 5C9AB 2HBUA 4LNVA 4XBNA 4W50A 1YNAA 3DN7A 5K4LA 3MIBA 2JX9A 5IFTA 2WFF2 4P02B 1OVPA 1S2KA 4AQ2A 1OD5A 2ZKNA 2Q1ZB 1YCIA 3S57A 4KBBA 2L9LA 1V70A 5FZ8A 3LA7A 4YVSB 2Q8CA 2GMEA 4PDWB 4AFAA 2R16A 1H4HA 3N9MA 3LA2A 2SBAA 2ZGOA 3U4SA 3WQ0A 3TYJA 1DGWX 2RDQA 5GM0A 5LK7B 4IETA 1W2UA 4K21A 1TMF2 1V6OA 3BGAA 1RINA 1ULGA 1XC6A 3RZKA 3ELNA 1POV0 3NVCA 5D21A 4ZY9A 5GZCA 2KA3A 4ES9A 1STMA 4XJ9A 4D8MA 4LBNA 2OQ6A 3MIGA 4CCCA 4QKDA 2B5HA 2OIIA 3A21A 3ITQA 3GNEA 4FI9A 5F6KA 3POSA 2YZ4A 4YM0A 3IWZA 4IE4A 1U5XA 3VBUA 4Z1VA 2XUMA 5LA0A 2XJQA 4HFSA 1RUJ3 3NAPC 3BN6A 2D98A 2VQTA 2WQ8A 3CLPA 4K40A 3ACLA 4LO7A 2ETEA 1IPJA 2WZ8A 3H7JA 5FP7A 5A3WA 4Q4X3 4KI5M 1G9BA 2WJSA 2WS91 4XURA 1YFUA 4NR1A 4QQPA 4AOCA 4BQ1A 4NIHA 1YQ8A 4Z07A 4Z8BA 1BMV1 2WWJA 3NL1A 1VAMA 5GZGA 1NXMA 2P34A 1LEDA 3JXSA 4IGPA 2GN7A 4NOTA 3O1SA 3BTXA 2W68A 2OVUA 4A7ZA 4B7KA 4PDWC 2YGMA 5CFDB 2HWE2 1PZ9A 1JXNA 5BNOB 3AMPA 4P9LA 3PUSA 5J3UA 2FMYA 4Y5SA 2R7EB 4XETA 1CD3G 3E5QA 4N8MA 3VBHB 2ZABA 4LK6A 2Y6GA 2CGOA 1YXWA 2ZGSA 3FUQA 4DIQA 1EAH1 4CSWA 2XJPA 1O5UA 2WFPA 5F2SA 1L7LA 4UFLA 2V4AA 4CDWB 2E63A 2GAUA 3OB8A 1QJEA 1QJY2 3JD71 1WUVA 3OG2A 1XNTA 2AACA 3VL9A 1HRV3 3FL7A 1QNYA 2PQQA 3WUDA 1F2NA 4LOSA 1FXZA 1V6KA 4Z2WA 4IGQA 1N1TA 2W87A 3DYOA 4RQPB 3ALQA 4JHZA 3MO4A 1ULDA 4NHKA 5FJKA 2VZ1A 1R1A1 3WW3A 5IVCA 5L7OB 3KWVA 4NPMA 1FOD1 3VKMA 5FYYA 1AL0G 2AH2A 5C4WC 4MGTA 1HRI1 1OQ1A 5LZ6A 1BEV3 3VV1A 2VL4A 4IV1C 1WCUA 2P6HA 3TN93 1YI7A 4J6GA 3M8LA 2P2KA 3QOPA 1OLRA 3WQ1A 3OEAA 2W08A 4QXBA 4UW5A 4ORFA 3D0SA 1YFYA 3AXEA 4WM8C 4TTGA 5JOXA 4XTMA 5KXBA 3D4KA 3I2KA 1AXKA 5J36A 3CU7A 5EV7A 3KV6A 1J3RA 2PHWA 4NROA 4XHXA 3IMMA 5HV0A 5LA1A 2R30A 2ZA9A 1RUF1 1DLCA 5FRAA 3SKVA 4B4RA 4M3CA 4CXXA 3I59A 3ZN6B 2CHHA 2AUYA 2G9GA 1XNAA 1QJU3 2J1UA 2ZGTA 1ZREA 1Y43B 4LHNA 4DS0A 3B00A 2FD8A 4CP1A 3TN92 1TME3 2QQPA 4QB1A 1JYXA 1O6UA 2B42B 1VIWB 2JDKA 5FZ7A 3ZYPA 1CZSA 1ND3C 2WS93 1V0AA 2BOIA 2FDHA 3OY8A 4K8FA 4CDXC 2PHTA 1DCSA 4CU8A 1AR61 4XFCA 5KHIA 1GBGA 3IT8A 4PJYA 1V6JA 3SXWA 1FPN1 1HB1A 2WAAA 3U10A 4CVUA 1ND2B 1AX2A 2ZEXA 2A5ZA 1SBFA 2ZXQA 4UF0B 4QKBA 3UK9A 4N43C 4BMEA 4CPBA 5C4WB 3DUIA 1DDLA 5HBAA 2C4XA 2DCKA 3WNOA 1J58A 1SCRA 2YXSA 3FC0A 2YY1A 3DXTA 4PHZA 3BIEA 2KXLA 1PIV2 4FOWA 1UNBA 3GHMA 4U36A 4XUTA 3BI3A 1PIV3 4GMP1 1ZRCA 2ZX3A 1MS0A 1SCSA 1W8WA 2O14A 4Q4V1 4DXSA 2BWCA 4AE2A 1MEC1 5H9RA 4EQVA 5CU1A 3WNNA 4RS5B 4B29A 3EMRA 5JSPA 4QX0A 4ZHNA 3BYWA 2IZWA 3NNGA 4YVSC 3RNSA 1RUG2 3FMGA 4MXWA 3M4FA 5EQUA 2Q8EA 1QJY3 2WT0A 4CDUA 1W6OB 5CG8A 1HN1A 3AZYA 3ZKUA 5KC5A 1CGPA 4RSUA 1U5IA 3H8RA 1DHKB 3HN3A 2C24A 4UI9L 2LRPA 3I2JA 4FXGB 1GP6A 3N7KA 3PVOA 1UOBA 4BWOA 5C8CB 4R9CA 5JOYA 4HKWA 1LODA 5J1XA 3TEWA 3WD5A 4BB3A 1NLSA 1HV1A 3KHBA 4Y33A 5KBFA 3DPRB 3ZIXA 3ZYJB 2RS33 4Y1XA 2GNDA 3MPBA 3O0VA 3PUAA 3BCWA 5E8AA 1W99A 1ZBA2 1J3QA 2BNOA 2E6VA 2EIDA 3V0BA
chains in the Genus database with same CATH topology
3VBFA 1TEIA 3VHPA 1D0HA 4UW4A 2ZCWA 3CEWA 1CAWA 1C3HA 1SLBA 4RD7A 4QQHA 1W6PB 5BUVA 4B7EA 1QH6A 2GSYA 3IIAA 2DVDA 2O8QA 4RL7A 4V1PA 3WOGA 4DB5A 2CAVA 5GLWA 2XBO2 3WP6A 4YW1A 3VBUC 2RR13 2GNBA 3BB6A 4GIQA 4XF4A 4IERA 2WIIB 3FLPA 3RJRA 5J37A 3ST7A 1RUD1 5GJ6A 4NWWA 3J26N 2WZR1 3N35A 2BTVC 4WM7B 2ZMNA 3H1YA 1A78A 1RGSA 3VKNA 4TSVA 5FAXA 2ZZJA 2VNRA 2YGLA 3GHNA 4LA2A 4BM8A 4FTBA 1RJ8A 1XNKA 3RYPA 2XJVA 1V6IA 4P9YA 3NAPA 1NE6A 1SLAA 4FPJA 3KMHA 1QJZA 4NWVA 3OCPA 1EV11 2MEV3 2ARBA 4AXOA 5E89A 5L7OC 1FOD2 3AZZA 4C1XA 4A3XA 5L36A 1YYNA 4QPIA 2VQAA 2OUJA 1C28A 1RUG3 1LB2A 1DQ6A 4GB33 5E1RA 5FLHA 4IL7A 1D4M1 5AVAA 3B3QE 3E5XA 3RZZA 3JBG2 3R4UA 3ZXAC 1QJX2 1ZZCA 4Q0VA 1QWRA 1BBT1 2BPA2 4GKYA 2X5IA 2Q30A 3BOWA 2DVFA 1N47A 1DQ0A 1VBC3 5GLUA 4AQTA 1AVBA 5JOWA 2A3XA 2QJVA 2JG8B 3AKQA 4IV1A 1X8EA 2IFWA 4P9GA 2CWSA 1OOPA 1C8NA 2Z42A 3MPPG 1DGRN 4XFGA 1QHDA 4XF1A 2A6WA 1FMD1 4CEYB 1J1LA 1F31A 4E4SA 1FPN2 5IK4A 1QJX3 3ZXGA 4DXZA 3MIEA 4IV3A 2PHFA 4YM1A 5GALA 4FPEA 4QPGA 3QACA 2D3RA 3UV9A 2BVVA 2PTMA 4MX3A 1LJ7A 1RTVA 2VOXA 2AENA 1QXPA 2JG9A 5DDJ3 2WQ4A 3JB8A 1TNRA 3ZSEA 4GULA 5FLIA 3AJYA 4E4DX 4PLMA 2XWJB 2JE7A 3PNAA 1Q56A 5BY5A 1M4WA 3ZFEC 4QM8A 5FO9B 1Z7S1 4XHBA 4PIZA 3B02A 1FPN3 1BVVA 4Y1ZA 3B7MA 2EXKA 5IT6A 3UJQA 2R072 1ZVFA 4TLFA 1VBC1 3FBYA 3WHTA 1DQ2A 2IC1A 4LUMA 1A8DA 4BH9A 4XF0A 4AVSA 2OYZA 4CEWA 4Q0UA 2XJSA 3RI8A 4W65A 1HX6A 1VB4A 4HZFA 1HXS1 4HL0A 3ZFGB 5I8YA 1HLCA 1HRI3 1AYM3 3M3QA 4I30A 2H6BA 4HVRA 4FAHA 1IS5A 1QNWA 1VBA2 2X8KA 3VL8A 2XWBB 1I9RA 3S6PA 2DVBA 1UF2C 4CDUB 2BUKA 5GLVA 1QQP3 1RUI2 1LHWA 1SMVA 4R4XA 3VZKA 4Q0SA 1LGNA 2HEWF 2A71A 3LSDA 2D43A 4W6YA 4LE3A 1VBD2 1OQDA 3SH3A 2NN8A 1FV3A 3LSEA 2I45A 2HWB3 2Z2SB 4IEUA 3CJIB 4LBJA 3QBQA 3POYA 1RUD2 1LOAA 4ZKTB 1CPNA 1G9CA 3AMQA 4COVA 1LGCA 3VBHA 3ZSJA 4K6BA 1W6PA 4OHZA 2QDNA 1Z0HA 4XQWA 1VBD3 1TQ5A 1S0JA 1ZBA3 1PO21 2GH8A 3D6EA 4QXKA 4P5HA 3AXDA 2PFWA 3C2UA 3GYDA 4M3CE 5CVRA 5LK5A 1LHUA 3N4MA 4JGYA 2JE9A 1GICA 4XQDA 3AKTA 3MDPA 4QM9A 1XQNA 2HWB2 3ZO0B 1N1YA 2PAEA 4F83A 3H1MA 2IWGB 4LBMA 2VH9A 5JZGA 1I6XA 3O5SA 3H3UA 1Q3EA 3MGUA 2VG9A 3ZXJA 3WP4A 2VPVA 4AI2A 4ISQA 3PHMA 5BNNA 4YG0A 2VOWA 2WLPA 2WNVB 4EROA 3MF6A 3VZOA 3NAPB 1PGW2 5GLTA 4I0AA 2VVDA 3W59A 3I8TA 4BA6A 4WVMA 4A7YA 1MS5A 4ZU4A 4Q29A 4BZ4A 1Q8PA 3I59B 1J3PA 1KJLA 2A70A 2Z79A 1BKZA 1QDCA 2RJKA 4Q4Y2 4HN1A 4DRVA 4Q4V3 2UU8A 3RSJA 4JDOA 2WA3A 4H3WA 3WG1A 2G9FA 3OY8B 4C1WA 4CDQA 1D2SA 5CFCA 2GC2A 2HWF3 2ZHMA 1MACA 5J96B 3U07A 2DFBA 2O0OA 1QJY1 4HANA 4JGYC 4N53A 5DUWA 4CEYC 1VBB3 4Q4W3 4YLZA 1YFWA 2EA7A 5EJ3A 2FQPA 4L9BA 1WCDJ 3KD4A 2WZPP 3WXPA 3FX3A 2AZ5A 1B09A 2ZMLA 5FDBA 1WCKA 1BYHA 4AW7A 1DGRA 3I54A 2ZGRA 1RUE2 2BEOA 3P3PA 3IMNA 2RMU1 1TME1 1WBFA 2WA4A 2WSVA 4E2QA 4YGBA 2W39A 1QOOA 3KGZA 4LBLA 4AYUA 2C0ZA 4LBKA 3ZYIB 1FNYA 1C8M1 3B9IA 2QNKA 3R4DB 4HVOA 3EHKA 4DMIA 2IXHA 2BVBA 1R091 2R042 1DZRA 2Y0IA 2YROA 4ASMB 5C8CA 1HXS2 4FCAA 1NCRC 2VUJA 1PO11 1PVC2 3ZFEA 3WHUA 3MFAA 2DUOA 1W6QA 1VLNA 1IS6A 1H8TC 2JKBA 4ATFA 1OPOA 1EYBA 1DGLA 3VKOA 3OF1A 4JGZC 4MGKE 2D3SA 3HT2A 1QOSA 1M06G 2A6YA 5KHGA 4EN7B 1GSLA 3TNQA 1AR71 1AR63 1VRH3 3OBTA 1L3JA 4LLFA 2ZPXA 4MUVA 3JQXA 4Y1UA 1JH5A 5E16A 5C6CA 4Q8KA 1SACA 1WLDA 1RUH3 3R0RA 4ZXKA 1ASJ2 2XL9A 2ZS6B 2D6MA 1GZWA 1CJDA 3A4UA 5LEJA 3W9AA 1MEC2 3M70A 4U2AA 3ILFA 3IDCB 4AVTA 1UAIA 5JSOA 2ZHKA 1RUJ2 3WT3A 1VRH2 4AI3A 4N7IA 3USUA 1YHFA 3AX4A 1NA1A 4BIOA 1UPIA 1C1LA 2DCYA 4C91A 1GLHA 4E27A 5BNOC 4GWNA 4MGYE 5JI7A 5A3LA 3B5LB 3O0WA 3THTA 2KM2A 2NMOA 2NM1A 2OW4A 1APNA 1WW5A 1PK6A 3AP9A 2VXRA 2XHKA 4G9SB 5I0SA 3WCSA 4LUKA 3ZXEA 3VBHC 5IK8A 3ZIWA 1CQ9A 5ACA2 1VAKA 4Q0QA 3E5UA 2IXLA 3OGJA 4GXLA 1MZ5A 3USSA 1NXD1 4JGZA 2MEV1 4Q4X2 4KWLA 5FOJB 2HKXA 4XEZA 4AFMA 3D0JA 3LOBA 3M2MA 3H3ZA 3URFA 4ITCA 2P3KA 4AVAA 3GZAA 4HVQA 4PBPA 1LU2A 5BNPB 3WR0A 2X5IB 4JTOA 2ZGMA 2UYBA 3KSCA 1FMD2 3O14A 4LR4A 1LOEA 2DCTA 2R073 2VMHA 2Q0AA 2FBEA 3LB9A 3WDYA 1YWKA 3C3VA 3THPA 2JG8A 4IV1B 4P9IA 3H50A 1IPKA 4FPHA 1V9U1 4AEJA 4XQ4A 4FP2A 2EXJA 4LHLA 1BQPA 3ZPYA 5JI9A 2QCSB 1WLWA 5DUXA 2XKPA 1UU6A 4AHWA 1SQ4A 1C8M2 4OVEA 3EXUA 5JZGC 1DLLA 2JECA 4ES8A 3SHRA 4S2FA 5BNOA 1MZFA 4YG3A 4EWEA 1V6NA 1CX4A 1DYPA 3WLUA 2BW8A 2D93A 4QU2A 2R1BA 1AR82 5KWRA 1NLRA 1XYPA 2RS32 4Y26A 2CGNA 2K9ZA 2ZAAA 2IXIA 2H0BA 4SLIA 4XFFA 2FZ1A 1PVC1 3GBFA 4NPRA 1MVEA 4CDWA 1N3QA 3SLIA 1VBE3 3UKTA 2PN5A 2GN3A 1YIPA 1ND2C 3FZ3A 4YVWA 3LOIA 5CFCB 2JXAA 2UY8A 1RMU1 4IEYA 1Z78A 1EP0A 2VW1A 4XJ8A 5IUQA 1SLCA 4K1ZA 3D5OA 1E57A 1QJX1 2E7AA 3HT1A 4XE9A 4Y1VA 4R4ZA 1LOBA 5K0UC 4C90A 1FT9A 1JBCA 1NCRB 4R8HA 5E88A 2ZOEB 4CEWB 4PIYA 4COWA 2TUNA 4EV0A 4CDWC 3ZFGA 2NLRA 1X33A 1KD7A 4EN0A 3DF0A 1OA4A 1FAYA 4YVWC 5AFBA 4L2NA 2VVEA 1GR3A 4LEJA 1AR73 1VRH1 2Q4SA 2A6VA 2YPJA 3NSTA 4M00A 5FCCA 4FTEA 3LWCA 4XJZA 1ZZ9A 3OPZA 4WV8A 2HJIA 4BHPA 3DPRC 1YLLA 1I3HA 4P9XA 1K5MA 1BZWA 5EZWA 2WKKA 1H1MA 1G6NA 2O1QA 1H1IA 3ZFEB 2R062 5T5PA 4EN6B 5EFUA 2DUPA 4Y22B 4O9EA 1VBE1 4Q1PA 1GANA 2DTYA 2WLQA 3FUOA 4XW3A 1HKDA 1ND2A 1ZYBA 5CB7A 3CJIA 1FI2A 1RUJ1 1KXGA 4XJUA 4ASLA 4YARA 3G7DA 4EWAA 4QGNA 3EBRA 5F6LB 5FO8B 4I2OA 1H8TA 1KS5A 5JIAA 2XLGA 4H14A 1N1SA 1O3SA 3M3IA 2UWAA 5FQ0B 1UPSA 3T2TA 1W39A 1XU2A 1NYWA 1ONAA 2ZKLA 3ZN5A 4R9DA 3WVJA 5CBLA 4HN0A 4WBBA 2PAKA 3UL2A 4OHXA 1S0FA 3RWNA 1OLQA 3RYKA 3TBDA 1LHNA 1H0BA 1GV9A 4RA0A 4WM7C 4XBQA 3QH7A 3DPRA 4Y1YA 5DZFA 5FOBB 1PGL2 4AI0A 4XF3A 1CVNA 2RS31 1C4RA 3O0XA 5FMOL 5CFDA 1CONA 5BPXA 1QQP1 3A0NA 4BYYA 4WVMB 2ZGNA 3B94A 3M3EA 4DPNA 5BYNA 5FFOC 4AG4A 1FOD3 4PIXA 4S2HA 1CJPA 3ME2A 1HRI2 3AMNA 4HK8A 4YFWA 2XJTA 4FOQA 3ZVXA 4WVZA 2PHDA 5SV8A 1DYKA 4AHZA 1TMF3 4YW5A 1RMU2 3AJZA 2CGPA 5AVPA 1XNDA 1FV2A 1GZ9A 1XE8A 3RI9A 5GZEA 4LO5B 5BNPA 3MEPA 2VMIA 3V0AB 2GC0A 2E51A 4AVVA 2K0GA 3AB0A 1GFF2 4AEDC 4QX5A 3LA3A 1AYM2 4HPKB 1S0EA 4N7UA 4O9GA 1DZQA 4AEMA 5A33A 4RGGA 2HWC3 2WC2A 1UMZA 2WSUA 3WW1A 5AC91 1X7NA 4GA9A 3HMYA 5GLZA 2EIGA 2R0FA 1DG6A 1GNZA 3WINE 3GALA 4DRRA 5CAZA 1W0PA 4KG8A 2MHFA 2Y26A 2GZWA 1PO12 2D6PA 3A0KA 3ZN4A 4N9HA 1WLTA 2CNAA 2WNEA 2WFF1 1T6GC 2QKDA 4I02A 5DUUA 4FT8A 1AF9A 4M3CB 2ZMKA 4AWDA 3VBSB 1RUC2 1PGW1 5K0UB 4BOWA 4LO8A 4AVBA 2BNNA 4FO9A 1LEMA 1VR3A 5D8AA 4XZPA 1ZM1A 5DG2A 4UBHA 2R6QA 1D4M3 2ZGPA 3S30A 3TRSB 1TMF1 3WDXA 4F8AA 2AREA 3WV6A 1HQWA 1PO13 1H2LA 4OLLA 2V5YA 1LOCA 4LBQD 1WMDA 1XNBA 4Q0PA 2R1DA 4S2GA 1UX6A 3PJQA 4M0NA 4DZGA 1ZZ8A 3B01A 1ULFA 3GZUC 2P3IA 1POV3 2ES3A 5ABJB 2ZHNA 4NO4A 3OD4A 3T1MA 4OUSA 3H1WA 2HWF1 1QU0A 1NCQA 1VBE2 4AI8A 2WS92 3J4UH 3ZXKA 2ZX4A 5DG1A 2D5HA 5CADA 3I2DA 1JTZX 4XMIA 2E7QA 4HT1T 4YFZA 1RUE1 5JAXA 4GH4A 1S0GA 4L92A 4KQ7A 1VB2A 5K9YA 5AFEA 1ZZBA 1JHNA 4Y4YA 4Q4X1 1WGPA 4WVVA 2XB6C 3FLRA 4YGDA 2V73A 4QMAA 5B2GB 4KGQA 4HSJA 1W6NB 3ZYGA 4Q4W1 2UURA 2DU1A 2DCJA 2RHPA 4OFGA 4EN8B 4YM2A 1EPWA 4KU7A 2WNUB 1AZDA 1RUD3 3VLBB 2GU9A 2ENRA 4UW3A 4L97A 1Q8OA 1RUOA 1SFNA 1R083 4JCKA 1H30A 1MS4A 3QH6A 2DUQA 1AYN2 1OA2A 4JGZB 2PAMA 3BOPA 4IEOA 1ZZ7A 4FPKA 4KG0A 5CA6A 3ZXFA 4X6RB 2Q8OA 5FQ0A 1IQAA 1HQLA 1AYM1 1KFUL 3RDIA 5GKAC 5T55A 2P17A 3AMHA 5JPNB 5JIUA 2H0VA 1JOJA 1R092 2HWD2 2R043 3JCIA 1C1FA 1R1ZA 4MH0E 1QDOA 4PLNA 4XJAA 4F3JA 4RQPC 3OJBA 4WM7A 3WW4A 2OZJA 1O5LA 3QCWA 2XJUA 5JMCA 4FBFA 2D5FA 4LBQA 4ZU7A 3FJSA 3TN91 1MZ6A 4PF5A 2WT1A 5T3NA 2VQ0A 1BBT2 1CESA 2OUHA 5CFCC 1LHOA 1CAVA 5T5JA 5KHKA 1AR72 1AR62 1H2NA 4Q2FA 1WBLA 4GALA 4OI1A 2Q1MA 4COUA 2WT2A 3KB5A 3HQXA 5I0TA 2RS52 1G7YA 3LGRA 4HSLA 2P37A 1BBT3 5F5QA 5EYXA 1ZRDA 1V00A 3WP5A 1ZRFA 4YSFA 3AYEA 3WP3A 2PHUA 3IBMA 2I74A 2B9UA 4M0HA 4AEDA 2VGDA 4B4PA 3J8F1 3VDDC 3I7DA 3O7OA 2VU9A 3UJOA 3MI8A 3CO2A 4FPOB 4YRDA 1RUC1 5A33B 3CL1A 1OSGA 5F1RA 2QE3A 4MSVA 5JPMB 2XH6A 1NCRA 4SBVA 2I07B 4K7JA 1O4TA 3VUOA 4RFT0 3B93A