1AK2A

Adenylate kinase isoenzyme-2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE ISOENZYME-2
total genus 75
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ak2A00
2YWEA 2JJ2A 1FQKA 2CE2X 2DFKB 3OEEA 1X1SA 2GK7A 1ETUA 4F4JA 3ONWA 3MJHA 3RRMA 3QNUA 3QG1A 4YMSA 3NXSA 4B3DA 1Z07A 5FFMA 1KZ7B 4US2R 2ZR9A 5J40A 1E2JA 1GOTA 1G16A 3KTAA 1N0VC 1UBFA 2OCAA 3EZ9A 2D2FA 3LNCA 1T3HA 4Q1DA 3V4RA 2C9YA 1HA3A 2GJKA 1E2GA 1A4RA 4PAMA 5EZ5A 1T0JB 1HH4A 2FSIA 5B57C 3LO5A 1SVWA 1G7RA 4XD7D 3RSLA 3TW8B 2YHSA 3Q7QA 2IYTA 4B2LA 3QXSA 1UEIA 4KFRA 4PC2A 4DLYA 4HZIA 1G7SA 1FFHA 2O8CB 3K53A 4TYPA 1G3QA 1CR0A 4LJ6A 1OPXA 2IWHA 3A4NA 5J47A 3NC1C 2JJ1A 2WM9B 4A8JC 4KVGA 2R65A 2MSEB 2V4ZA 3I3SR 1ZP6A 4JLKA 1N6LA 2GESA 3SBDA 3BWDD 3GJ4A 4ZDKA 5J4KA 4R7ZA 1WP9A 3GLFB 2JIZD 3RS3A 4QGHA 2IHYA 4F92B 3AKYA 3KQHA 3K70D 4C0SA 4IDOA 4LC1A 2AHOA 1OKKD 3H1TA 2EFEB 4Q03A 4RKEA 3HR7A 1ZC3A 5DHAA 4X8LA 4DCSA 2ZUCA 3DMDA 4MKHA 4D4LA 3MLEA 4IVQA 3GJ6A 3VR3A 1NBME 2RKOA 4GT1A 4D26A 1AKYA 1UPTA 5EXPA 1NRJB 1E9EA 1E1RA 2RGCA 2WAYA 4IW3B 3PVSA 2OBNA 2MMGA 4DJTA 4NU0A 4C0BA 1U98A 1US8B 2ORVA 3VKGA 1IBRA 2NPIA 3PXGA 3VR2A 4D0GA 4JLVA 5JHGB 4OQNA 3TLXA 3GEHA 1O3YA 4ZV4A 5DYGA 3OIYA 2BC9A 2CDNA 2ZI6A 5DE3A 5AWFC 4LHVA 1SKYB 5SZJA 1R8SA 2O0JA 1C9KA 4JVMA 4G5QA 2ZRMA 1SVMA 2QAGB 2VSFA 2Z4SA 3KB1A 3QBVA 4KFSA 5DGXA 1ZCBA 2N42A 1X8LA 2PX0A 3K0CA 5FUYA 3BB1A 4LBVA 3OIVA 4Q4LA 4L15A 3QXHA 5IDVA 1NN1A 1VG9B 4DC9A 5FI0B 3UIEA 2OLKA 4A1FA 3RAPR 3WYGA 4DIEA 1SKYE 2AN9A 3QF4B 4PHHA 4YONB 2ZANA 1JPJA 2Q6TA 2ODBA 2HXYA 1E2EA 4JT4A 1KSFX 3JVVA 1XB2A 3AVOA 2JJ8A 1C1YA 1S3GA 1FQJA 1G3IA 2OBMA 4QBIA 4QHSA 4N0EA 2OUKA 3AGPA 1VECA 2ZE8A 5EUQB 4YLGA 3VHLB 4JBWA 1W1WA 2CBZA 3I4LA 4DDTA 1AZSC 1Z6XA 4HYYA 3OHMA 1ZIOA 4N1AA 1FUUA 2HF8A 3NH6A 4JLPA 3EPJA 2IEYA 2TMKA 2YV5A 3UWOA 4JVSB 4HUTA 1KAOA 4UXHA 4NHOA 5E3HA 1OXUA 1KI8A 1Z2CA 5E7JA 1IAQA 1OSNA 5EXXA 4TLCA 1P62B 3P32A 3QEOA 3ECCA 1ZJ6A 3FHCB 4RD4A 4QRHA 3AVXA 1G8GA 2PLFA 3G82C 1I4DD 1DVRA 4LHYA 4M1KA 1S0UA 2PT7A 3BORA 2ONKA 2QGZA 3UKDA 2JLUA 1OV4A 3VHXA 1EFRA 1PZNA 4LX0A 2D74A 3W3ZB 1CP2A 2ASEA 5EE3A 2FG5A 2IX3A 1GP2A 2W6JD 2QM8A 2QL6A 1U0JA 2YVUA 5JWHA 4MGZR 4R9UC 3U3RA 2AWNA 4DCNA 1CJUC 1F2TB 1DBSA 1DTSA 4I4LA 5FUVA 3RHFA 1OIXA 2OFOA 4G0NA 3U6KA 4M9QA 4C0JA 1R0YA 2CNWD 1R5NA 4Q4JB 4PC1A 2P6UA 5JFGA 3GPLA 1MO5A 3DMNA 1JB1A 1L8QA 2WVJA 2RH5A 2AWOA 1XEXB 1TNDA 2WZQA 1G7TA 4BEBA 1IHUA 4F93B 1WBBA 4LPSA 2LKCA 3D7MA 4CF7A 3W3AA 4LK2A 3L43A 3PEWA 3AVVA 3SFZA 1JAIA 3MWKA 2ZSFA 5DN6A 1AS2A 2G83A 1HY3A 1GM5A 4BFYA 2CMKA 2EYUA 4IOLA 2AKAB 4QJ4A 1YZUA 5FOWA 2OG2A 1KI6A 4Q1CA 3VU9B 4E03A 4HSEA 3PJRA 1RZ3A 2DYKA 1II9A 3X1DA 3B1WA 1IY1A 1BS1A 1CS4C 1U90A 4G3XA 3ZVRA 1E2DA 1XWIA 3EZ6A 3SZRA 3W90A 4HDQB 4GI7A 1I2DA 221PA 3VR5A 1B23P 4JLNA 2ZRPA 3LVQE 5AK0A 1Z0AA 4RSGA 4QFMA 4EAQA 1YE8A 1AQYA 1DEKA 4QG7A 3FHOA 4JLMA 4YDHB 4QBHA 4PANA 2X77A 5FI1B 3GMTA 3WNCA 3TSWA 3ZLJA 3L8YA 1Z08A 4R71A 2EFHB 4BPBA 4FCTA 4WZBE 5KPDA 5FBRB 1KKMA 5FOSA 1NIPA 2HCJB 3MWLA 4LDJA 1NG1A 5FOVA 1C4OA 2E87A 2VP6A 4TYQA 5GJVC 4FXPA 1GILA 3KJEA 2QT1A 3K0AA 2QT0A 3QJYA 3PUWA 3WBKA 1XCGB 1S9HA 1OLOA 1Q3HA 3MFYA 3BS4A 3SEAA 3OESA 1HE8B 4URYR 4U7DA 2AK2A 2V7QD 4WBSA 1K5GA 2P6NA 3A1UA 3C8UA 3QKTA 1XXHE 2J0VA 3LD9A 4MGYR 3ADDA 1BIFA 4DLRA 2GXUA 5JSZA 3GLGB 3RS4A 4XVUA 1ZM2A 5KU1A 4YDSA 5IF9A 1MO4A 2YINC 2A5FA 2IYLD 1IXZA 2GJAA 2P5TB 2FFBA 4JL6A 4D82A 1G21E 2BCJQ 5F9HA 4AURA 3KKQA 4TMZA 1TF2A 2ZJAA 4NKRA 2GF9A 4FMDF 3DKPA 2OBLA 4UNPA 2GJSA 1TTTA 5DSZA 1E1QD 1OH8A 3NVAA 4M1SA 2DR3A 1XZPA 1J90A 2ANCA 4GP6A 1G3UA 1OFHA 5KPJA 3K0FB 4P33A 1EESA 3I5XA 3FKQA 3IEUA 4V0KA 2QE7A 3TIFA 4TWZA 4UKDA 4HI0E 1YR8A 3TK1A 1PUIA 3QXJA 3W6PA 2Q9BA 3DDCA 3RRZA 3ZD6A 1G6OA 2UZIR 2XJ9A 4DB2A 3EPKA 4Q21A 5JLJA 2ZS7A 4PC6A 1KI7A 8OHMA 3R8CA 2ZI3A 2IF0A 3W8NA 3THXA 2XB4A 1MO6A 3FFAA 4RD3A 2JLZA 4S2EA 3W5JA 2XZPA 4NCNA 4B6FA 4LZZA 1E2KA 2G1JA 3H0KA 2IL1A 3K9NA 3RDPA 3GLFA 3ZZUA 4BFZA 1QF9A 1AIPA 3Q8XB 3THOA 4US1R 3B1YA 3BRWD 3AGQA 2OO7A 1U2RA 1W2GA 3R7WA 2G88A 1KK1A 1XBTA 2ORWA 4B47A 4LYJA 3JZAA 1ZINA 4EPRA 4AG6A 3AUXA 4OHXA 1RRPA 4B43A 2KJQA 2B6HA 1U9IC 5J4LA 1M74A 2ORIA 3EZ2A 1GKIA 2ODEA 2IUTA 2GK6A 3NBYC 4XTRA 5DI3A 4OI0A 1ONBA 2XNSA 4TMXA 3HR8A 5KSZA 1XEWX 1Q0UA 1XP8A 2VA8A 4MRPA 3EC1A 3IBGA 1T5IA 2VQSA 1D5CA 1DE0A 1DG3A 4QBFA 5TARA 1DO0A 1DPFA 2NMVA 3Q5DA 4HATA 2ZSBA 4MRSA 1EXMA 1S2MA 1E9FA 2G9NA 5KNDA 2VP2A 4Z1MA 5C4MA 1M7GA 1Y63A 2WWWA 2QU8A 2QNRA 2WKRA 4BFTA 5AUPB 3LQQA 2PZGA 4AK9A 1NN0A 2AL7A 2VRWA 4PHGA 3O47A 3A58B 1G8PA 5G3ZA 3UANA 1GRRA 4AYTA 4A6XA 2J41A 3K9GA 1UBEA 5SZKB 4C0QC 2ZRHA 3K8YA 2R6AA 3CPJB 3S1AB 1Q44A 4BASA 4ZCIA 1E2LA 5FOXA 4KAXA 3AH8A 1NVUQ 3B13B 4MYUA 5CDFE 3MG9A 4TL8A 5L3SB 3U7HB 1RYHA 2VYFA 2O8CA 4KJZA 4D25A 4Q5IA 1G64A 2CCKA 5K8UA 2GEUA 1SXJC 4V0MA 3KQUA 2NTYC 1KI2A 4FWIB 2UKDA 2NZ8A 3P1JA 4M1WA 1T0HB 2JCSA 1D8TA 5GADl 3WMGA 4M9SA 3Q3JB 3NHAA 4GRAA 3OF5A 2IXGA 2XITA 4HDOB 4DCVA 2ZRNA 3GQBA 1HQCA 4G1UC 1CXZA 3ASZA 3MGCA 4JYCA 2C78A 4W7SA 3GEIA 4KITB 1QDEA 4IDHA 4TLBA 4TL6A 2LKDA 1X1RA 1UAAA 4LBWA 1P7CA 1LV7A 3KKOA 5EP2A 1RRFA 1UJ2A 5L3QB 1F2TA 2ZUBA 1Z0DA 5JWRA 2P6RA 4V02A 3MSXA 2HJVA 1NP6A 2OHFA 3CPEA 1KOFA 3VX4A 1JJ7A 3P4XA 1LB1B 3A1TA 4QC2A 4W9MC 1G1MA 2GVDC 3QKRA 3WXMA 1CJMA 1VHLA 2FOLA 2RHMA 1AQUA 5G40A 1NIJA 2QAJA 4GOKA 3NKVA 1T4GA 1J2JA 2Z0MA 2W2VA 4AKGA 2OFWA 1NN3A 2CL6X 4US0R 4FMCB 3W6NA 1Q12A 2DFNA 3ZDQA 1TQ6A 4BZXA 3KTAB 4Q9KA 4L9WA 2GBLC 4KU4A 1E9DA 1Z28A 4Q4JA 1F2UB 4KSCA 3BERA 1KO8A 1W4CA 1YHNA 2H5EA 4GZMA 2F9MA 1NF3A 4C3ZA 3LV8A 1UBGA 4JL5A 4B6EA 2GAAA 5FPYA 3EARA 2YOHA 3CNLA 3T06B 2EYQA 1HUQA 3T35A 1XTKA 4B73A 4YXWD 3W9YA 2AFHE 3U7GA 3B85A 4YMWA 1E2QA 1GWNA 2DBYA 1QHSA 2J7PA 4I1SA 3ZH9B 1Z6YA 1VYUA 3JVUA 1SXJD 4UXIA 1IN7A 5AJYA 2AK3A 4OI1A 1LVGA 1IN8A 3A1SA 4B2IA 5IT5A 3M0EA 1E1QA 1ZCAA 3C5CA 1DOAA 4Q01A 4V0OA 2FDCA 2OXRA 2BM1A 2QMUA 3O8CA 3VKHA 1OXXK 3ZVNA 3ND9A 1IONA 4Q4HB 2BMEA 2QQEA 4LSGA 3Q9LA 1E2PA 1FNNA 2AX4A 2J46A 4JMPA 4YXWA 1VPLA 4C0KA 1M7HA 4CDGA 1KNXA 4RD1A 3P26A 4P4SB 2VP4A 4ZDWA 3NEJA 1MKYA 3ETLA 2BBWA 3HWSA 4EPVA 3A4LA 1T9HA 1II8A 1U8ZA 2V6JA 1WXQA 4NYMQ 1TMKA 2F3RA 3RS5A 3MWYW 3V9PA 3SC3A 4M9ZA 1A5TA 1YZTA 1Z0IA 4UJ5A 3GLGA 2AXNA 4LOAA 4QGGA 3A1WA 3N70A 1G8HA 2SHKA 4E07A 1KSJA 5IRCD 1BH2A 2BBSA 3MUFA 4ARZA 1COWD 5A4JA 1FTNA 3GD7A 3ICQB 2C9CA 1AS0A 2GBLA 2XZOA 1AK2A 2YZ2A 2J9RA 4BLPA 4AD8A 2MSDB 2JLYA 4MQBA 4A0HA 4QGFA 1N6KA 3FMPB 1F6BA 4R2IA 2XSZA 5AUQA 4HLUC 2GHIA 1IQPA 3W34A 3MWJA 1Q1ZA 3IIJA 3VX3A 2IYUA 1Q20A 3K0FA 3H4MA 1QG4A 1Z6GA 2BOVA 2EW1A 3AP1A 4O25A 3TQCA 4CEJB 1E32A 3VR1A 2IYWA 1Z3IX 2QBYA 1WBDA 4OJKA 1N5JA 3QXCA 2F1IA 2YNMA 1U8AA 5FTKA 3ZVLA 3O8BA 4PQYA 2G0TA 2QTVB 2FWRA 1VG8A 3BGWA 1XCPA 5HCIA 2G0NA 2WWXA 1E79A 5KSPA 2XSZD 4O0MA 1UBCA 5CJ2A 1CRQA 3THWB 4F4IA 2ZQ5A 4QOSA 2EWWA 3IHLA 5JMTA 1KDRA 3SDZA 3BD9A 3IEVA 2CL0X 1KO4A 1UF9A 4RZXA 1VIAA 4ZCLA 1IJFA 1SVSA 4A92A 3R8FA 1XJ0A 2V7QA 2P0EA 4Y0VA 4KYUA 4XTCS 3AEZA 4EFMA 5JJIA 2HLDA 4BECA 1ZNYA 4BFWA 3AVUA 1E9AA 3RANA 4NPHA 1J8MF 3U61B 4JVNA 4BUJA 3SHWA 1GRQA 5JECA 3CRMA 3GLIA 3EX7C 3FMOB 3E2IA 3C7KA 2W2XA 1IM2A 1GTVA 4OYHA 1DELA 4U00A 5KSYA 3CB4A 4BWYA 2BV3A 2WJGA 2WBLC 4CYMA 4M1TA 4GDFA 2J5XA 3CLVA 2D7CA 3R20A 2F6RA 2ZYVX 2QN6A 3GLIB 3SQWA 3F0TA 2BHRA 4PAOA 1OH6A 4PO8A 2ZS8A 3QXXA 2FGKA 2CL7X 4C0LA 4R98A 2F55A 2ZEJA 5B30A 1K6MA 3L0SA 3F5FA 4G5SA 2JLVA 2QMHA 4IDQA 5AJWA 2I1QA 2QTHA 3PQCA 4LCBA 4NL4H 4ZPXA 5JEEA 5F9FA 2D06A 1NVVR 3RS2A 1Z06A 5KO2A 3M4YA 3HDTA 3H2YA 4EIWA 2JLRA 2DB3A 1N2CE 3BK7A 1G20E 4MGKR 3NIBA 2OCYC 3QI2A 4IFBA 2DWPA 1XMSA 3WNDA 4M1MA 2YKGA 1AS3A 3EW9A 2XXAA 1FP6A 2W2TA 3LQRA 1XNJA 2FEMA 5EE5B 4B33A 5DH9A 1LS6A 2QENA 2WV9A 1D2MA 4E5UA 1KTVA 2J0SA 3RWMB 3U4QB 3B78A 3KL4A 4F7WA 2BJVA 4E09A 3U6BA 1S9DA 2HDNB 4DSNA 5FR2A 3WYFA 2ZS9A 3U3MA 3ZS8A 1MV5A 2CVFA 1US8A 2FFHA 2ZJ8A 4F4CA 2FZLA 4C0AC 5JS8A 4CEJA 2CLCX 2VHUA 1KIMA 1IY0A 1F3OA 3FDIA 1P4SA 4GOXA 1FMJA 3AVWA 1SHZA 4LYHA 4TMTA 4GOJA 2R6FA 2J87A 2XNDD 3MAAC 2XX3A 1KHTA 2A5JA 5DO9A 2YC4C 2CE7A 4HUQA 1W0JA 3SBEA 1GNQA 5B2ZA 1TQ4A 1M7BA 1KSGA 3GLHE 2AD5A 2YWHA 1E2NA 2OCBA 2QTFA 4PO1A 4V0LA 5HKKD 4HB4A 1ZVQA 4GSYA 4N3NA 1FZQA 1W4RA 2YJTD 1OYYA 3LY5A 4V0NA 3TR0A 5DI9A 3KJHA 4H1VA 1T8UA 1NLYA 1GKYA 4WXRA 4D80A 3KKNA 2ZJBA 2OZEA 2JIZA 1KI1A 1VYTA 1TX4B 1HTWA 2WIBA 4JZKA 1CF4A 2DFLA 1R2QA 2O8EA 1TQ2A 1E4VA 1SXJA 2ZI4A 1R5BA 3CWZA 3PV0A 5FBQB 2FPMA 3GFPA 2WOOA 1T3LA 4EUNA 2WIAA 2ZI9A 2BKUA 5ANRB 1Z83A 4DLUA 3K0SA 2CCJA 1ZNXA 2OE2A 4M0LA 5JJKA 2W0SA 1E9RA 1R4AA 4GMXA 2CCGA 4MDFA 2F7SA 1BKDR 3LFUA 3NDBB 4CVNA 2J0QA 2VF7A 1Z47A 3X2SA 2BM0A 2QROA 1JXOA 1KYIA 1NL3A 1Y3AA 1OHHA 2IYZA 4LJ7A 4DZZA 4DB4A 5CB6A 2ZE6A 4ZDIA 2QGNA 3D8BA 3LBHA 2GNOA 4KFTA 3KDSE 3GFOA 3QG5A 3B82A 4URZR 1GNPA 5DNYB 3B9QA 1M8PA 2C99A 3DOFA 1BO6A 3D3QA 4MKFA 2ZSAA 3BXZA 1P6XA 2OAQ1 5FL7D 5D3QA 2QAGC 5G53C 2BEJA 5E7MA 1EFCA 3BC1A 3AKDA 2IT1A 3K09A 3EZ7A 4IFEA 4UNRA 5IK2D 4Q66C 2F9LA 3TSOA 1ZRHA 4B3FX 4DWJA 3W8RA 5H8WA 2WWHA 4IOJA 4TT3D 4ZIRA 3HYTA 3M1IA 5DIFA 3X1XA 4OJQA 4LJ5A 4ZO4A 1W7AA 1L4YA 3IKJA 2C03A 1E98A 1NVXQ 2X2FA 4NBSA 4CW7A 1J8YF 1H65A 1K8RA 1KO5A 2VBCA 4PR0A 1EG7A 3SJAA 3QENA 2RGGA 3C41J 4NYJQ 4YMUA 2XOKA 2WAXA 4RFSA 2GZAA 2O8DA 1VKJA 1Z2AA 1SVKA 2H92A 4B35A 2QP3A 2A5DA 4FMDB 1N6NA 1XXHB 3VQTA 2W6ID 2KE5A 3ZJYA 4IRUB 4QHYA 1VCIA 2VLIA 2JA1A 1G18A 4Q4AA 3NWJA 2OXCA 2XTMA 2WJVA 5FBLB 1TADA 2CHVA 2L0XA 1KDPA 3ZVMA 3CONA 2X8AA 4GNKA 4RY2A 3RC8A 1CJTC 1OB2A 4LHXA 3PUVA 4DHEA 3U3KA 1OIWA 2GJ8A 1IN5A 3BH7A 1ODFA 3FKSD 4BRWA 5IHPA 3R9XA 2NO0A 3IDQA 5D3MA 3CBQA 4CEHA 2EU8A 3L2OB 5KHOC 5LPNA 3K0EA 3WHLA 4KLNA 5H70A 4Q47A 1ZD1A 3EA5A 5CIQA 3LLUA 3QKRB 1WE2A 5CJPA 1R0WA 4BLOA 3BH0A 2WWFA 1XTJA 3CZQA 3LXRA 2KB0A 5D3MB 3TUIC 3PUXA 3AF1A 4M4SA 2PZFA 2XZLA 3B5JA 3T1OA 4OK3A 1G8YA 1I4TD 1ZW6A 2RGEA 4PPQA 3OE7D 4GL2A 3I61A 1CRPA 3G5UA 1Z8FA 1SXJE 1YZQA 5KNCA 1KY3A 3BE4A 3O8RA 1NVWQ 4B32A 3RRNA 1E1RD 3DZ8A 4IJMA 1RVDA 4P31A 3SJBA 1NSFA 2IXFA 2PT5A 3FPAA 1TUIA 1XPRA 1ZU4A 2O0KA 2ZJOA 1AN0A 2CNWA 1EFUA 3EZFA 1W36B 1YJ5A 1ZIPA 2C8VA 4UJ3A 1ESNA 1KDOA 3KXIA 2RGNA 3VKWA 3NDPA 2ATXA 721PA 5JRJA 4QJ3A 2NO1A 2P65A 1P2VA 3BB4A 3E1SA 1U99A 3FTQA 2FFQA 1KY2A 2BMFA 2O52A 3B6EA 3GLHA 3IILA 5GJCA 1GDDA 5HR5A 4C9BA 2J3EA 2VP9A 4LJ9A 4D81A 5SZHB 1LF5A 3T5GA 1E69A 1NLZA 1NKTA 3VNUA 2WHXA 5GJWC 3KKMA 3K1JA 3LLMA 1OFUX 3NEYA 1P2UA 2FSFA 3KB2A 1Z0JA 2NOAA 4NE2A 3GJ5A 5TDHA 4TMVA 4Z1MD 2QQ0A 4HZUA 5EXTA 2HXSA 2GDJA 5CYOA 2QPOA 3V00A 3FFBA 1YQTA 1L4UA 1W44A 4MGIR 2GXAA 1R8QA 2I4IA 3F8TA 2P5SA 4RVCA 1QG2A 4RD0A 5SZIA 5KDLA 1ZUIA 1KK3A 4NP6A 4P32A 4HAXA 3C15C 1P9NA 4V03A 5KOYA 3GEEA 2WOJA 4EPYA 1TF7A 4BGDA 4PSAA 4TSFD 3GLGE 2GTPA 1LNZA 2ERXA 1QHYA 2KBFA 4AIIA 1QZXA 4H1UA 4XOIA 4MRVA 1II0A 2V6IA 1E2HA 1XMVA 2V1XA 4DBLC 3EIEA 3KFVA 1KMHB 4FMBB 2ZRCA 2ZAOA 3CM0A 3VAAA 2O8BB 5L3SA 2CXXA 1I4LD 1VMAA 2BKEA 3CX7A 3OEHA 1A1VA 2F1JA 4XIGS 1A2BA 1Z22A 3BFVA 3DOEA 4MKGA 5P21A 2PEZA 4RZ3A 2XXAB 1KGDA 2FN4A 2OV2A 3CH4B 2XB2A 1WA5A 3A37A 2GF0A 1XEXA 4PPFA 1GUAA 2GXQA 1HYQA 4JVLA 2QY9A 3A36A 4IEEA 4G5OA 1B0UA 5BXQC 2IS2A 2ZI5A 1NNEA 5H68A 4R2HA 1TF5A 4M1OA 3I32A 3AKEA 3ZD7A 2O8FA 1KJYA 1YZLA 1W5TA 3TVTA 3EA0A 4LGMA 1MRSA 1W4AA 2W6JA 4D0LB 1FNMA 2VSOA 3IO5A 4IEIA 4AC9A 2ZRAA 2WTUA 4JBYA 2ZITA 4DLZA 2J59A 2R2AA 4NYIQ 1IOZA 1KI9A 5F98A 2Q9CA 3RNLA 4W5WA 1N5LA 4A9AA 3I62A 3RVBA 1Q22A 4B74A 4HB2A 3Q5EA 1YR9A 2OM2A 1XPOA 4QBGB 2J7PD 1PLJA 1W0KA 4YQFA 1FTSA 1G8FA 3CRQA 5IK2A 2C9OA 4CZ2A 5CDFA 3R9IA 3IIKA 5BYKA 2PH1A 3D6TB 2Q0HA 4D6PA 2A30A 1RIFA 1S3SA 4WOPA 3KJGA 5TXGA 5FR1A 3EXAA 4OHWA 1ZD8A 2FSGA 1GVNB 3B1ZA 3LXXA 1KZGB 3SYLA 2O5VA 1WDTA 2RCNA 2DCUA 1DAGA 3SN6A 4HZUB 2IA5A 2IYYA 1ZUHA 3T1VA 3QPUA 1QBKC 2JJ1D 3U44A 2V1UA 4ARZB 3BJIC 3L0IB 2CLSA 5JI3E 5C2JB 4BLRA 4FCWA 621PA 3CF0A 3OIUA 2KWIA 1AKEA 5FUXA 1P72A 5FPHA 1E99A 3AUYA 5C4GB 2ZSEA 2ZIAA 2OSBA 3A6PC 1JALA 1KJWA 1XCMA 2ZU0C 3N2EA 3K0CC 3BBPA 3QSYA 1OKKA 4Q1FA 4JT2A 1I2MA 5HKKA 1RJ9A 2G77B 3GJ7A 3RC3A 4JLDA 2ZAMA 4KV9A 2ZRGA 2J7KA 1Z6TA 2NIPA 3CRRA 2V9PA 2MMCA 4AKEA 1QHNA 1VG1A 3PFIA 3CF2A 4I1VA 3HU3A 3P20A 4LHZA 2DWQA 2QG6A 3TBKA 3THXB 2YYZA 1L7VC 2C5LA 1X86B 4RFVA 1S96A 2PMKA 2D4HA 5AJZA 1LTQA 1U9IA 3BOSA 1RW4A 3BFXA 3QVVA 1Z0FA 3SS8A 2H18A 2HYIC 4FINA 5GJBA 3KJIA 5CM8B 1LW7A 1G7CA 4TL9A 2Z4RA 4X8OA 2J1LA 1SQ5A 1CIPA 4DCUA 5C46F 3OAAD 1G41A 2A78A 4NTZA 5L3QA 1JPNA 2NQ2C 1NBMD 5CK5A 3TSZA 1JJVA 3IQWA 4LC0A 1BOFA 4GPTA 1YZNA 4NCKA 1HURA 4DT1B 2YOFA 4IHQA 4B44A 1VHTA 4MDEA 2I3BA 3U4QA 2C95A 1E0AA 4N0DA 1TAGA 2GJ9A 4AKIA 3GCGA 3LA6A 3N2IA 3RSOA 3SE0A 3OIWA 2JLSA 4BEJA 4BE7B 1SVOA 3TJZA 4UNNA 1XTSA 4EPWA 5ELXA 4JIMA 4MUBA 1OW3B 5EP1A 4KYIB 2WWYA 1W36D 1NBMA 1BMFA 3CWQA 3AVTA 5TMPA 3DO6A 1L2TA 5JS7A 1EFTA 1ELOA 2F43B 1W2HA 4A8JA 1DO2A 1XPUA 4OQFA 1BYIA 1OE0A 4URXR 4CGZA 2CJWA 1N0UA 3ZZTA 5BQ5A 821PA 3LRPA 1FP7A 1CBUA 1GFIA 1AGPA 5J4YA 3SR0A 4L5BA 1T8TA 1SZPA 3TR5A 4JLAA 5JZVA 2FSHA 4BFUA 1G3MA 1G291 4WAUA 1R5OA 2BDTA 3WMEA 2PJZA 4CEIA 4C2UA 3KXLA 3QQ5A 3EASA 3MJRA 3NBFA 4BQSA 4MA4A 2WWIA 3IPXA 4RJLA 2GCOB 4FWTA 2DPXA 3FOZA 2O8EB 3TRFA 2G1KA 2QMEA 4JKIA 4XWKA 3QBTA 5HE8A 3ADCA 4DLXA 1KO1A 3K09C 4O2LA 5E7IA 5BN5A 4YMTA 3S1AA 3QUSA 1SVLA 2FPKA 4PZZA 5AR1A 5HCNA 1DAKA 4DDWA 1JQJC 3FGNA 2IYRA 1JEEA 3QF7A 4OI4A 3QE0A 5KYKA 3X1WA 3M6AA 4IVRA 2D3WA 2D2EA 1OJLA 3LAWA 3THYA 3WHKA 2B21A 4Q9JA 2QM7A 5E4FA 1TEXA 4RKFA 3EC2A 3C16C 5FTJA 3CX8A 1UKEA 3WRXC 1EK0A 3L0PA 3U5ZB 2GVZC 2ZRKA 2YOGA 3N5CA 4M2LA 4Z8YA 2RGAA 2XNDA 1NY6A 4DKXA 4WW0A 3QF4A 1ZD9A 3I1FA 2FGJA 3TQFA 4A4DA 1RPZA 4M1YA 4S35A 1UEJA 2CHGA 1OH7A 2W0MA 3WNBA 2GCPA 3GJ8A 4AYWA 1UKYA 1XMJA 4LI0A 1TU4A 5L3VA 2XAUA 4FIDA 4Q19A 4OQMA 2PJRA 3DM5A 4CT4B 1CTQA 3REGA 4M9XA 2HEIA 2P2LA 4LYAA 5FPTA 1V43A 5JRZA 3NBXX 1SXJB 3CIOA 2OILA 2OFXA 4A2WA 4QGAA 2ANBA 4Q9HA 1Q57A 2WJIA 1YR6A 2C04A 2DY1A 4I99A 3ZYCA 5B58C 2Q3HA 3CRVA 1IN4A 2RAPA 3AV0B 2ZVQX 3I92A 5HZKA 2B8WA 3L0OA 4M22A 1JR3D 3FHTA 3I72A 2NO6A 1UKVY 4IDPA 4EJSA 4TQAA 3U44B 1WB9A 4NCHA 2AD1A 4JKYA 4FW9A 5DHFA 3KQLA 1COWA 1M2OB 1E2MA 1H8HD 2FFAA 4FI3C 4PFSA 4DCTA 4Z54A 3KUCA 5HE9A 1UDWA 1U81A 5CM9C 1N6PA 2IWRA 4TQ9A 4RZ2A 2GKSA 2Q9AA 5EZ6B 4D4JA 4DLTA 1CJKC 1W4BA 5JCPA 4BZPA 5FBVB 1CR1A 4Q4HA 1XEWY 4CRWB 4CIDA 1JR3A 2QPTA 4NZYA 2VHJA 3CNNA 4YMVA 4A15A 3H84A 4NYIR 4EQ6A 1G17A 3A1VA 4OQXA 5F2EA 4DT1A 2VEDA 3PUZA 4LBYA 5J4HA 2D7DA 1H8HA 3KQNA 3CH5A 4NMMA 1A82A 4LPKA 4A0RA 3NG1A 2J45A 1TEVA 4G5GA 4Q7MB 2GAOA 3RLFA 1E79D 3NC0C 3KXKA 1R10A 3TE6A 4NH0A 2NO9A 3P27A 4TT3A 2UZ3A 1N6RA 4MUAA 1KJZA 1NLFA 2ECKA 3ICEA 2PLRA 2HJGA 1GITA 3BB3A 3GJ0A 4PTLA 4CEHB 2HV8A 3U7EB 3KX2A 3A8TA 3UG7A 1W49A 2WPDD 4EJSC 2OAP1 1S4QA 4TLEA 2J0UA 2ZRDA 4NDZA 2FJUA 2IF2A 2GXSA 3QPVA 4POAA 3CF6R 4A36A 4TZ0A 3SU8A 5L3RA 2QE7D 4PPGA 4DSOA 2FA9A 2OEPA 4OK5A 1S1CA 3C14C 4UXJA 4ZKDA 2G6BA 2GZDA 1NMYA 1X8JA 1DAHA 1NMZA 1OIVA 1XEFA 4Q18A 1OXTA 2QRNA 5K8LA 3RYTC 2QUZA 1KNQA 1ZMXA 3FMFA 4JLBA 4BZQA 1UADA 2PX3A 1FW6A 2JLQA 3RWOA 2IUUA 1XFAA 2RGBA 2DWOA 4EPTA 5EE0A 1YKSA 3X1ZA 3I8SA 4HB3A 2IYVA 4L8GA 4LV6A 2CK3D 2WSSD 1ZNWA 1AJEA 3B7GA 1CULC 4URWR 2QBYB 2QP9X 3NH9A 1DAMA 1SULA 2RGNC 3K70B 4HUQB 1O87A 4NCJA 4M53A 2RGDA 4MITA 5KTYA 3CPHA 1XD8A 3LH5A 4B3XA 3ZS9A 4DEYA 4ZI3A 4LJAA 1KK0A 1U94A 1CJVC 4M8NE 2IS4A 2W6IA 1E3MA 2OCPA 4PC3A 5KNBA 4RFSB 1RYFA 4LYFA 4Q7JB 4GFDA 1Q1EA 4L9SA 5GVRA 5H1YA 2IXEA 2IYQA 2QPAA 3I8XA 2FNAA 1KKLA 1KSHA 1X6VA 2WKPA 4GP7A 2IHBA 4C0HA 1NN5A 3ADBA 4WA7A 1T6NA 1MH1A 4IOMA 1TU3A 3EPLA 3NBZC 3AF2A 2ODNA 1ZUNB 4PAQA 1CR4A 1PJRA 2HT6A 2KBEA 3WRYC 2WWGA 2D62A 1EWQA 3G0HA 2O8BA 3ZZ0A 1R0ZA 2ZVPX 3GJXC 1CEEA 4XVQA 2VHQA 1SGWA 1Q1BA 3LBIA 4MYTA 3IGFA 4MRNA 4A2PA 1QHXA 3PENA 4Y0AA 1XMIA 4KI0A 2C77A 1PVOA 4L4UA 3E70C 1G5TA 5DLQC 4GMDA 1CR2A 4A6PA 3U60B 2A3RA 2ZYTX 1NY5A 2RHDA 2ZROA 3L8ZA 3ND8A 3BFKA 1S1MA 3TW4A 3WP1B 3CKLA 4HLQB 1VTKA 4CEIB 3PEVA 5G3YA 4OHZA 1WRBA 1P5ZB 1N6HA 4C7OB 3TH5A 3QY0A 1G3RA 1J7KA 4PXAA 2J0UB 4BFSA 5LBIA 3CO5A 3NHBA 4O3MA 2C2HA 3EAQA 5AJVB 1E0KA 1DAIA 2ZYWX 4ACAA 3B9PA 1XXHA 3AF3A 1TL7C 1JR3E 1XU4A 4I1OA 5AUNB 2YWFA 2IK8A 4LJ4A 3GLFE 2WJYA 3HPQA 2GZHA 4PSKA 1FUKA 5EE1A 4A0GA 2FV8A 5JBQA 1E6CA 2JATA 1E9CA 4LRWA 4B71A 1OHHD 1MABA 3DEFA 4JSYA 2GILA 3THYB 5JSZB 2GEVA 4Q02A 1KO7A 1Z29A 3PEUA 1P61B 2GCOA 1MRNA 4FCVA 4Q7KA 2FF7A 1ZU5A 2REBA 2GRJA 1QVAA 2BMDA 3C5HA 1AM4D 1JQLB 2ZETA 4NYMR 4EDHA 4II7A 4OL0A 1GSIA 3Q7PA 5DN6D 1PV4A 2W83A 1T5LA 4KBGA 2FZ4A 4JBXA 2JDID 4DLWA 4HAWA 5L8VA 1ZC4A 1KI4A 3AVYA 3AQ4A 5CLLA 2MSCB 5J5CA 3ZGXA 1N0WA 1X8KA 2B7BA 2PCLA 4P0TA 1WQ1R 5HPYB 4TMWA 2Y8EA 1TPZA 4BLSA 1VIYA 1KAGA 4W5JA 5KDDA 1HT1E 3IO3A 4OI2A 4Q9LA 4OQLA 3QKSA 4FN5A 4Z51A 1DG1G 3CNOA 2QMOA 1D6JA 2PMDA 5LD2B 2FE4A 4ACBA 4L16A 3GFTA 4TQUS 4WVFA 4Q1BA 1UFQA 3AM1A 4TYYA 3A4MA 3U2QA 1NJGA 2LCFA 4H9GA 2XOKD 4ILEA 4K8OA 2EWVA 4PSVA 4TYWA 1G4UR 3UWKA 2ZU6A 4ON9A 3SJCA 1R0XA 3LX8A 4MYCA 1RFLA 2BVNA 2ZRIA 1MT0A 1E4YA 2IEZA 1ZM3A 2E1RA 2F43A 3VFDA 1V5WA 3AKCA 1E0SA 2QSZA 3W5IA 3T1TA 2JJ2D 3IHWA 3FMIA 3WBJA 2QRZA 3H86A 4DSUA 4ESVA 4PZYA 1YVDA 4XH9B 1SHKA 4I1UA 4RD6A 5CLQA 4EKDA 4C7OA 2CLDX 3VMFA 1G5RA 2R44A 1QRAA 4LV8B 1W46A 3FYHA 4KSBA 3UMFA 4Q1AA 5JWOA 5KDOA 2BCGY 5C18A 5EP3A 3Q72A 2JEOA 1QHIA 2FPLA 2EVWX 4EFNA 3P4YA 2ZR7A 4ZKEA 4PZLA 1WF3A 5AUOB 5J4VA 4C4PA 3BAFA 2GCNA 1D9XA 4B75A 2I1VB 3SOPA 4B34A 1DADA 5B64A 3MRSA 3DM9B 1GAJA 2ZUDA 2WKQA 1Z63A 3T15A 1U0HC 3OE7A 1PLKA 4LHWA 1X3SA 5FOUA 4EQ6B 1W47A 2NG1A 2W00A 2ZPTX 4KBFA 2Z6VA 5BN3A 1XF9A 2JASA 2A7QA 3UG6A 3FE2A 2ODWA 4PHFA 2VP5A 4TTPA 2V55B 1A2KC 2BMJA 3LBNA 1N5IA 1VG0B 4KO8A 2PL3A 3CZPA 4IDNA 3VNVA 3GJ3A 1DAEA 3OAAA 2WJHA 3TAUA 4LV5B 4PO9A 1VCOA 2VPPA 2QI9C 4KODA 2WMOB 1OF1A 2HYDA 3HPRA 4IVPA 3T12A 5FH9A 3B60A 3QKSB 5CITA 1R6BX 1HQYE 1RE0A 2IC5A 2JLXA 2FMXA 3AB3A 1GL6A 2N1BA 4PQFA 1KMHA 4AG5A 1EFHA 1PLLA 3GP8A 4ESHA 3OFND 2V8OA 4A8JB 1RJ9B 5UKDA 4IKEA 5EJEA 3AP3A 3QVUA 4NONA 4DSTA 5BN4A 1JBKA 3PCRB 1VDZA 4U02A 5DISB 5FPKA 3ASYA 1VYVA 3B1VA 4IOKA 4WZ6A 4HLCA 2A9KA 1Z6AA 4JSTA 2RB4A 2QEQA 2FH5B 3U3JA 1H8ED 2ZI7A 4QHTA 1N6IA 5HZHA 2A5GA 4DRZA 4ZI2A 2X2EA 1P75A 3KFXA 4J0QA 3SHFA 4PPNA 4PX9A 2AR7A 3JZMA 3B8HA 1ESMA 2WJJA 4K81B 3PUYA 2IBMA 3OFNA 2WICA 3KKPA 4KFUA 5CB8A 3GLHB 5JI2E 4KXFB 1P2TA 2H7VA 5BYJA 1OFIA 3IIMA 1G6HA 3DKVA 4WIAA 3LWNA 1OFTA 1IN6A 4HAYA 4LY6A 2JGNA 4OBEA 4LWZA 2H1LA 1EWRA 4PHTA 5LD2C 2E9SA 3UXMA 3DZDA 1SKQA 1JEDA 1XDBA 1FX0B 1G19A 4U5XA 2HCBA 2ZE5A 1EGAA 3F3YA 1T3SA 2REOA 2VSXA 4XWAA 5K8TA 2JAQA 2XGJA 1QHHB 5DI3B 3X1YA 3SNHA 2ZRFA 5F3WB 1AGRA 5JEDA 1XTRA 1U0LA 4V0ME 2V3CC 1U8YA 2GEDA 3T61A 4HAVA 3KUDA 5LDDC 3RRYA 2CJWB 2HLDD 1E96A 4OHYA 1OXVA 3MD0A 5A0FA 2H8KA 3K9HA 4TMKA 3TKLA 2C98A 1XD2B 3QEJA 4OK6A 1IXSB 1F5NA 2IS6A 2C96A 1LS1A 2R62A 3K0AB 4KHZA 1KI3A 4AI6A 1ZBDA 4B3BA 2LWIA 2A2ZA 1NG9A 2G3YA 4ASUA 4EPXA 4D4KA 4AY2A 2EFDB 4NCIA 1W0KD 3UPUA 3SQXA 4HB0A 4ITRC 3DPUA 3FB4A 4A0FA 1NI3A 3KZ1E 1EFRD 5HTKA 5JJLA 1NJFA 1LY1A 5JCZA 1ZM4A 4RCZA 2B7CA 2QSYA 3MCAA 3EWAA 4HDCA 1QVRA 4QKQA 2XTNA 4P4SA 3HU2A 1XRJA 2GWHA 2VP0A 3WYAA 3ZQ6A 1UDXA 5FOTA 2OESA 2H17A 3IPYA 1PUJA 1FOEB 4XSGA 1K5DA 3CX6A 3ZIAA 1CKEA 1ZYUA 1W48A 3KQKA 1N3BA 4BFVA 4NYJR 2Z43A 3FWYA 3ZQJA 1ZNZA 1E9SA 1LFDB 1P3JA 1FMLA 4UNQA 4O2RA 2JLWA 2PBRA 2PZEA 2EQBA 1T91A 3I5YA 1Z0KA 2RGXA 4B3GA 2IUSA 2ZJ2A 3B1XA 4MH0R 4DDUA 3IQXA 4DLVA 2ZJYA 3ZIAD 1SVIA 4BFXA 1RRCA 1OYWA 4QL3A 1OXSC 2XEXA 3HU1A 5TV2A 4XVRA 4TSFA 1G9XA 4LJ8A 1XD9A 2AXPA 1RRGA 4Q9IA 1ZM9A 1HE1C 1ANKA 4JJZA 1CLUA 4JJKA 1YRAA 1E9BA 2IYXA 3RABA 1W0JD 2ZR0A 2ZRBA 1YZKA 4BLTA 5M04A 2VL7A 4D2IA 1D2EA 4AYXA 1Z5ZA 4BRUA 5GVSA 4G5RA 1JECA 2BIFA 4KLZA 4Z8XA 2H57A 3IBYA 3QIAA 3GLIE 4B2PA 4RCYA 1WMSA 3QOFA 3B2EA 521PA 2ZXUA 5FL7A 4JLJA 4TN1A 3W6OA 4ERNA 3TUJC 2ATVA 4QNMA 2Q3FA 3SI7A 1BYUA 3WP0A 3LDAA 2O8DB 4MKIA 1CU1A 3LVRE 1KK2A 2QORA 1HEIA 2WPDA 1KMQA 2AKYA 4TTRA 3VR6A 1JR6A 1FX0A 2RMKA 3PEYA 5EUMA 1NVVQ 2R6CA 2DFTA 3VU9A 3R9WA 1BMFD 2BWJA 1GZSA 3T5DA 4OKSA 4M21A 4TTQA 4WXPA 2Q21A 3WY9A 4TLAA 3TUZC 5KUTA 4QM7A 1D9ZA 1UM8A 1NKSA 3LW7A 1XTQA 3PG5A 2F1HA 4P3YA 1A7JA 5EQTA 1GRNA 2FU5C 3RS0A 3D31A 2ZTSA 1TQDA 1JNYA 4Q00A 3NTUA 1VCNA 4A82A 1XX6A 4P4TA 2VHTA 3VTKA 4Q1EA 2ZJZA 4Q48A 4B76A 5C1BA 2ZM5A 2ERYA 2NZJA 2REXB 3CR7A 3MMPA 2R6GA 3HYRA 2OLJA 4Q4AB 4QNRA 1GIAA 4MYHA 4LJYA 3RS7A 2O8FB 5BWMA 4UQOA 4JL8A 4URUR 4B48A 3OZXA 4F38A 4X8HA 4XJXA 1NMXA 1M6NA 5FL3A 4QM6A 4W5HA 1D2NA 5KSOA 1LF0A 4OHVA 1DAFA 3V4FA 3I73A 2ZRLA 4DLSA 4DXAA 1E94E 4FMCF 1OH5A 2EFCB 1HT2E 1OT3A 4DIDA 2F1RA 4PQRA 3LW8A 4XD7A 3REFA 5A5GA 4X8MA 4BLQA 5EE9A 3QKUA 3FVQA 1DS6A 1YZGA 5TY0A 1N5KA 4XSHA 4DUGA 1P9RA 1MABB 1QHGA 5TB5A 4JS0A 3PITA 1P2SA 4TZ6A 4LBZA 1II8B 2VHCA 4G01B 2XJ4A 2BBTA 4IXMA 4I81A 4PC7A 2IS1A 4DVGA 1EX6A 4C2TA 1DARA 1M34E 5E95A 1JI0A 2ZYUX 3DVLA 1AA9A 1RKBA 5CIWA 1MO3A 3LX5A 3TGPA 3AF0A 3EWSA 4DUGD 2FX3A 3AP2A 3C4JA 1N6OA 1XZQA 2P67A 4RZUA 4MRRA 3FKSA 5FUWA 4HAUA 1GG2A 1TUEA 1P9WA 3U3OA 1KDTA 4E22A 5FTMA 1GL7A 3HJNA 3TVDA 1AZTA 2PEYA 3ADKA 5FTNA 2QZ4A 1Q3TA 4ASUD 2BEKA 2ZREA 3EG5A 2PCJA 4ZCMA 1GNRA 4HEJA 1E2IA 2V54A 2HT1A 2IYSA 1E2FA 1W5SA 3BIFA 1Q1QA 1YRBA 4YC7A 5BW8A 3HP1A 1N25A 2Z5FA 4XWOA 3SJZA 4CT5A 1XTIA 1YR7A 4D4MA 4UNSA 1GKUB 1OB5A 1XJQA 2IW3A 1FPMA 3TNFA 6Q21A 2VF8A 4RD2A 3SYNA 2W58A 3J81k 2A5YB 1QHHA 3UATA 4Q7LA 1G4AE 4HAZA 2Q3MA 1J99A 1GL9B 5FBWB 1HV8A 2ONJA 1IJEA 1R7RA 4EFLA 2ZE7A 3E5HA 5CYPA 1XD2A 4GBMA 2CEAA 2YC2C 3EIHA 4A2QA 3U7FB 3CR8A 2BJWA 3BH6A 3T34A 3L82B 3UMRA 2N46A 1E0JA 3THWA 2AFIE 4K46A 5LB4A 4D0NA 4KVAA 421PA 2HF9A 2JDIA 1H8EA 2VIIA 2YWGA 2NPFA 5EP4A 3SYKA 2ZRJA 2ZJ5A 3Q85A 3CW2A 1NSTA 4B3CA 4DEXA 1IXRC 1WCV1 2NGRA 2NO7A 2GETA 4KCGA 2VH5R 4QXAA 1JXMA 1F2UA 5AJXA 4EJSB 2VTKA 3IUYA 2R9VA 1J70A 4AKHA 4LUCA 2X19A 4TL7A 3UMSA 2CHQA 2HUPA 5G41A 3T1QA 3K9LA 2X1VA 3PR1A 1F60A 4IXNA 4JYBA 2KI5A 1M1YE 1JAHA 1G5PA 4ZDJA 2QP4A 4C30A 2H16A 2QA5A 3TAHA 3WMFA 5TVKA 2R6DA 121PA 2B8TA 2FEOA 2Z83A 1W36C 5DYIA 3CUEF 1F48A 4TLDA 4QJ5A 3SFVA 1P60A 1IY2A 3CRW1 3K70C 1MR3F 2WSMA 2DHRA 4WZAE 5EXSA 2XTZA 1UKZA 2O0HA 3R7WB 4URVR 1P73A 1FL9A 5CK4A 3EPHA 2F3TA 2BBOA 2R8RA 3OEHD 1KI6B 3PIRA 2UVQA 4HLDA 1Q21A 2K5UA 5JHHB 3AVPA 4GZLA 2VO1A 2CK3A 2WSSA 3OEED 2B92A 2P3SA 3AVQA 2OT3B 4ZIRB 2KSQA 3AF4A 2WMNB 5FPSA 4F91B 2GA8A 1MOZA 1VCMA 3QPWA 1EX7A 1XJCA 1RC8A 3UK6A 5FTLA 3O8DA 2CVHA 4DDVA 3DHWC 4P4UA 2ZSDA 3VR4A 1YU9A 4ABYA 4TYNA 3DL0A 3EIQA 5LB2A 2QAGA 4AWXA 1S8FA 4JLOA 1ZM7A 4FD2A 3TMKA 5K8IA 2EFGA 1ZAKA 4HLUA
chains in the Genus database with same CATH superfamily
3N58A 4BP1A 5C8DA 2VDRB 1X1SA 2VYVA 1NZJA 3WLOA 1YS4A 4F4JA 3DVQX 3MJHA 2PH5A 3QNUA 3QG1A 4PSDA 2WSLA 2BRUA 5FFMA 4R84A 3AXSA 1T34A 1E5TA 4HSGA 4XIIA 4CLRA 4NK4A 1GOTA 3MQ2A 3MT0A 1D7AA 1N0VC 1UBFA 3P0EA 4KQWA 4MWBA 4DXAA 4ZI7F 4OJNA 3WGZA 3G17A 1EZ1A 1T3HA 1GU0A 4YS6A 2VAWA 1VE7A 3DT8A 4CW7A 1HA3A 1A4RA 4RPKA 1W35A 3WGUA 2RI0A 1EVYA 1OZ0A 1A77A 1P1JA 1SVWA 1GJRA 2QYHA 1H2AS 3MQ4A 3NOVA 1DX4A 2I6UA 1TKCA 1WXEA 1DJMA 1QTIA 1OWNA 1EGMB 3WL7A 1UEIA 2AA3A 4KFRA 4HZIA 4MS1A 4LJLA 3S40A 3ZE1B 1FFHA 4J2TA 1X38A 2VHEA 3ZX5A 1V6AA 3A4NA 3Q3EA 1NPDA 4K05A 4B79A 2JJ1A 4YUXA 3Q6MA 5JJBA 2NADA 4FDMA 2IUEA 5JMPA 4A8JC 2Q50A 1CY4A 1GNSA 2R65A 1THGA 2V4ZA 3H83A 3I3SR 3PHHA 4CL3A 5K0EA 2JK0A 4JLKA 2ZUTA 3SBDA 1RBZA 3NAQA 3DL4A 4DCPA 3I1JA 1WP9A 3QLVA 5IVHA 3GT4A 2JBAB 2PV0A 4OGLA 1JKFA 3PNBA 4Z9AA 2QRHA 2JVKA 3KQHA 3QPBA 3WKDA 4C05A 4C0SA 4IDOA 2AHOA 1OKKD 3H1TA 3HXKA 3IA2A 4LOHA 3L77A 4L4RA 1NLUA 1M2WA 3GVCA 3VPCA 2HN9A 4EH1A 4OMDA 3VO9A 3PGLA 5IZ4A 4BMSA 2XI4A 3CUYA 4Q9IA 5JCJD 1GPH1 4D4LA 3L4EA 2Q4OA 5HDBB 1XU9A 2V6BA 3OIFA 3VR3A 3ILXA 4AROA 4G8BA 1N1DA 2JIMA 4KYTA 5IMBA 3MHTA 4WEQA 5CLHA 1J33A 2ZBDA 1MAAA 2OBNA 1DIAA 3ZYZA 1R4NB 1L3IA 1HRKA 1Y3BE 1UKAA 1G38A 4NU0A 2PA3A 5DW0A 3PDIB 5I6DA 4L5IA 1VJGA 2RK6A 1US8B 3QV2A 1DMRA 4HRAA 3PX3A 2EC5A 3WKAA 2JH9A 5AHRA 2NPIA 3PXGA 1R8JA 4EHAA 4JLVA 3H18A 2X23A 5CCEA 1USWA 5IPFA 3GEHA 2YRWA 1I4OA 2WV7A 3C4VA 4F3CA 1WD5A 4P36A 5DYGA 2OMKA 4ZV4A 3OIYA 2CDNA 5D1HA 1R8YA 1TCBA 4PX2A 3D2BA 4TWBA 2YVKA 1TVKA 2NU9A 1SKYB 2NTJA 1YA8A 2Z8XA 3H2ZA 4I9NA 5FXMA 1JHUA 2BZ0A 3NBUA 3OPYI 1W2WB 5IUKC 3V8PA 1SVMA 2VSFA 4HUJA 5IJ9B 3QBVA 4RVGA 1DV1A 3LBAA 1SQFA 1X8LA 3ENZA 3II6X 4AJ1A 1Y8CA 3NCTA 1K6XA 3I6QA 5FUYA 4YQYA 1ZZEA 4YB8A 1IUOA 2O4UX 3DAFA 3GNTA 3OIVA 3OQ6A 5E38A 1R18A 1RXWA 2QGFA 3NM6B 4UU1A 1NQOA 4MO9A 1NN1A 2YIVX 5FI0B 3ZR4B 2FHPA 3UIEA 4ZVTA 1B73A 4ZGGA 5A9RA 1GU1A 4A1FA 4F21A 1HL3A 3RAPR 3WYGA 1L7PA 5CEFA 1UFRA 1WAMA 2AN9A 2F00A 4UAUA 1WR8A 1ZLYA 3OO1A 4YONB 2JZNA 2ODBA 1XDUA 1P7WA 3LWZA 4JT4A 1TJNA 4UQPA 3VH1A 1E9VA 2FW0A 4GWGA 1XB2A 3CXRA 1J5PA 4ZAFA 2IH4A 5SYMA 2G25A 3G9QA 2JJ8A 4RJ2A 1S3GA 1A8HA 2AIRA 1W1IA 3N8KA 4UTZA 2NZWA 1GA6A 4RK4A 2WUGA 1V3UA 1X80B 5AIAA 4YAGA 1VECA 4ILKA 1TT5A 2J3IA 4PGAA 4HFJA 1BMTA 1UP4A 1WSWA 1Z6XA 2UDPA 2XNJA 4B6JA 2BPOA 3OHMA 1ADFA 2PWYA 1ZUD1 2HF8A 3KR9A 4NOMA 3NH6A 1W581 5T64A 5LQNA 3ILVA 3QUCA 2IPAB 3V7NA 2IEYA 4H0NA 2GDZA 2TMKA 1C4KA 2HV9A 2YV5A 3UWOA 1ATIA 3HWRA 5CD9A 5BSTA 3IUSA 3FDXA 1KI8A 1RADA 2X40A 1F7VA 3AMVA 3VNRA 3COJA 4ZZ2A 3OZTA 1CPYA 1IAQA 1JS1X 1OSNA 2HB6A 2PK3A 3G2JA 3HVIA 4OUDB 3UK7A 2GS9A 5G4KA 5CFRA 4OFXA 5EXXA 4HDKB 1P62B 3H5WA 2OXFA 3ECCA 3IE0A 2IYFA 4PQEA 5B37A 1RWQA 4KGXA 1G8GA 2EBFX 3GQBB 4DM3A 4DQXA 2PLFA 4JKOA 1VA5A 3G82C 4V24A 1Y7HA 3K8QA 3P71T 2DR2A 1EKXA 1JSXA 3IT3A 5EJGA 2ONKA 5KHLB 3UKDA 2JLUA 1U9YA 3BMCA 1EFRA 3A3NA 2I3DA 1MG0A 1DLJA 1HWYA 2A1UB 2OHXA 2DQSA 4FU0A 4GC5A 4L27A 3RWBA 4YAKA 4HXEB 1GP2A 1KEEB 2QM8A 1H2BA 2ISSD 5H9WA 4MK4A 3W3AD 1OAKA 4KDEA 1F4VA 2OFPA 3KQQA 2P3QA 2Y6UA 2R87A 1F2TB 4X6YA 2ZR8A 4W6QA 2R0QC 4BX2A 1DTSA 5DLEA 5FUVA 3RHFA 1OIXA 2OFOA 4L51A 2P9EA 1ODSA 1Q91A 1BE6A 4JVOA 4LCJA 1UBTS 5FWXA 4D3FA 4BNHA 2EL9A 1R0YA 2I78A 3LL7A 4PC1A 1VKNA 3T0GA 1K5PA 2OYCA 4ZCQA 2CSUA 5ALNA 5JFGA 2XD4A 4WBNA 5HYVA 2ID7A 1KQGA 1L8QA 3JS5A 2AWOA 1TNDA 1G7TA 2XA2A 3HABA 3W3AA 3BJRA 3ZI7A 4CF7A 3PEWA 4O4HF 3AVVA 3MWKA 1OX4A 3LKBA 5JRDS 1T6BY 4AMGA 5JMOA 4YI5A 3TG8A 1AS2A 2P2DA 2GM9A 3R5KA 5D5PA 1RCTE 2X13A 1K0FA 4MEAA 3T9EA 4OX9Y 3CSDA 3UMVA 4UVGA 2AKAB 4JK3A 5FOWA 3T3MB 2FXVA 2PRJA 2VUSA 2C94A 5HBRA 4X3CA 3S2YA 4Q1CA 4RHTA 2AEFA 4E03A 4HGOA 4MI3A 1TGYA 1ZI6A 1II9A 2AGVA 3QI7A 5IVDA 4DR2B 1VMDA 3E35A 3I1YA 1U90A 3T7IA 3UBMA 2P9CA 3IFSA 2WMYA 1FYDA 1MG5A 3O3NB 1XWIA 1YS9A 3W90A 3DEZA 1P5FA 2XLBA 3GLRA 3MJEA 3DFMA 4PIMA 1B74A 1Z82A 1B23P 3PJEA 3RBVA 2O06A 5FULA 3SIRA 1O5TA 1T9GR 3IV9A 4YDHB 4JLMA 1SD2A 4UNIA 5GPBA 3WNCA 5HJ2A 4BPBA 3A6LA 3M3DA 4BNMA 4QQFA 3MWGA 1V6CA 3RUIA 5HXAA 5CDHA 3JATB 5H83A 5KPDA 3AFGA 3KO8A 4C4TA 2QG9A 3IUBA 1RZVA 3MWLA 1NG1A 4MLPA 5FOVA 3VUFA 3I8OA 3OPVA 4I9FA 1T8SA 3PDWA 2QYTA 1AK1A 3D8HA 3VR5D 1GV1A 4ZICA 1U1FA 2L19A 2VSQA 4JA2A 2QT0A 1SMKA 3D1JA 3EXG2 1S9HA 3GNLA 2HPAA 3H5TA 4W5TA 2II6A 2AK2A 1MX1A 4WBSA 1FSZA 2E4ZA 2P6NA 3B6JA 3QKTA 3ZHSA 4CLRB 5B4UA 1BROA 4KE7A 4ISCA 3BGVA 4MGYR 5DEOA 1G8SA 3SSNA 3UQZA 3ZJ4A 4DLRA 3H2IA 3ADDA 1X74A 4TLLB 4XVUA 1T6XA 5CA0F 3GLGB 1GTG1 2YX1A 5IJAA 5IF9A 2YINC 3SHOA 2ZIXA 4P98A 1UC4B 4RVSA 2GJAA 5JH7B 2FFBA 3G68A 4BUCA 2WVGA 4LSZA 3UMJA 5IJWA 3V8VA 4ZU3A 4AURA 5J43A 3IL2A 1QV9A 2HU8A 2C9BA 3NDIA 4OLFA 2BF7A 3RS8A 1RHQA 1TF2A 2YUTA 4FMDF 1QV7A 2YQ5A 3CLKA 3ROEA 5DSZA 2Y05A 1E1QD 2PUFA 3ROTA 5L9AA 1TYAE 3AFIA 5JR3A 3M4ZA 4CMEC 4ENSA 1M8JA 2HK8A 3VBCA 1H3NA 1IHYA 2ANCA 4QZVA 5CVCA 2AN5A 3KPVA 4LRTB 5TQVA 2A9VA 1C0LA 3PUHA 1PZGA 3L05A 2JBAA 4U6NA 1KAMA 2WJ4A 3ZXXA 2I6XA 5IFLA 4AZ0B 3KC2A 4DYDA 4KN9S 1KS2A 4AFNA 1W25A 4L9AA 2AZTA 4V0KA 1GZ7A 3VU3A 1YR8A 5HTOA 2RHOA 4TKMA 1G6OA 2XJ9A 3ORSA 3REOA 2QMYA 4RX1A 4CL2A 5JLJA 4E3ZA 4EY5A 1EUYA 4CCAA 1T9CA 3M6FA 2AW3A 1KI7A 1RPNA 1YB7A 2Q6VA 3JV7A 1EE1A 4BVEA 4YT5A 3W8NA 3THXA 1Q15A 5JSKA 3D02A 3W5JA 1QGZA 5C37A 2YWJA 1OGJA 2ZGVA 1Z12A 1PIWA 3OTQA 1U0OC 1E2KA 1YBFA 2G1JA 3H0KA 3K9NA 4WI1A 1TCUA 5B55A 4O4IB 2W6MA 1QSGA 5BPHA 3PRYA 3IBSA 3Q8XB 2QD3A 3VPXA 3RFUA 1H6BA 3B1YA 3E7PA 3ESAA 1K0UA 1C7ZA 4X97A 1PFYA 1XTZA 4Y98A 3AGQA 1P3Y1 3A1CA 3AR9A 2FMIA 1U2RA 1CLEA 3UQYS 2ORWA 1XBTA 2AOVA 4P7GA 4B47A 3OMLA 4EARA 1L9XA 5K3DA 4CQNA 2DSNA 2CUTA 1C30A 3BMOB 1XC7A 1GGVA 1RRPA 5JJCA 1WF6A 1MZPA 1U9IC 3M6MD 3WICA 2ORIA 3EZ2A 4FHZA 4DSAA 1XRNA 4EP1A 2X14A 4AY4A 5MHTA 3T4UA 4TGLA 4ZEMA 5JZMA 3IJEB 5DI3A 3WLSA 4X7PA 2A86A 4TMXA 2VRCD 5EIEA 5J58A 2BEWA 1LNSA 2P2GA 3AY7A 4HGPA 4JQCA 4F2DA 4G4SO 3H1EA 4RKRA 5ALJA 4PZCA 2O5EA 2QAIA 4BS9A 1HE3A 2XGMA 4L7QA 1DPFA 1UMBA 4LW8A 1P1FA 1H2EA 1PNRA 3KSRA 1GQRA 5AK3A 1VBMA 4FR5A 5C4MA 3OZUA 4X0EA 1M7GA 4GPD1 2WWWA 5LM3A 4Z2YA 3LRTA 1IHXA 2CW5A 2A59A 2W6CX 4MV3A 1XZGA 3E58A 4TXMA 4BFTA 4P80A 1ORDA 5IP5A 5C5IA 1DXHA 2AL7A 5CDYA 1AKQA 3B38A 5F12A 5KQPA 1G8PA 1YA6A 2V5UA 3ZKWB 4AYTA 2WHYA 2J41A 3O0DA 1OFGA 3Q7TA 2XVXA 1CERA 4KNWA 4OHCA 3K8YA 4IEFB 5SZKB 3IESA 3S1AB 1Q44A 1K8ZB 3HB7A 3GAMA 4J3NA 1NLMA 3F74A 5F3DA 1ORVA 1R12A 4ZZ1A 5TPZD 2J4FA 1NVUQ 2F8LA 3Q3IA 1V3QE 5IASA 1Z5GA 5MN6A 2BGNA 1BHJA 1Q50A 4NCBA 4RANA 3AESA 2PV7A 2QR2A 3MG9A 3DF7A 1IBMB 4S3MA 3IHKA 1U5AA 4EKIA 2O8CA 2C2OA 3EOZA 3IURA 4LDPA 4Q5IA 3PRJA 1A7UA 1VJTA 2G8NA 1LQTA 1U31A 2GEUA 2ZCVA 4UVDA 4DZRA 4G65A 2J32A 3B36A 3G1TA 4Y2VA 3DLPX 3JRWA 4FBMA 1T0HB 1TB4A 1ECJA 2I4NA 2QLLA 2EDCA 1D8TA 3LT5A 3QLJA 2E4UA 5GADl 4BFYA 2PGNA 1MCZA 4UM8B 2AQKA 4K1LA 4PZPA 5E8JA 3H9EO 3RF6A 3V1LA 3MUNA 3FI9A 1LD3A 4HDOB 4BC1A 1LJ8A 3GQBA 2BH2A 1OY1A 1P4HA 2B4AA 3CLSC 3ASZA 3MGCA 3MS4A 4JYCA 2R1VB 2PGIA 3BIXA 3DEKA 1CRLA 4KAJA 3VGJA 4CLOA 1TQ8A 1H2YA 1KP3A 2LKDA 1TA4A 1X1RA 2ZYIA 3WB0A 3LTEA 5E1BA 1P7CA 1EFVA 5AXAA 3R3XA 6NULA 1F2TA 3ZVKA 4V02A 1Z3CA 4L2IA 1SKMA 3FN4A 2PUDA 4FBGA 1BCRA 3NMUF 2H07A 1NP6A 5AP9A 1W88B 1U7XA 4YAJA 1JJ7A 4YLYA 1LB1B 3KQWA 3QW4B 4XIFA 4QT4A 3A1TA 1YK0A 2O0MA 3DDOA 5BR8B 3QKRA 3WXMA 4W9MC 2QTTA 7MHTA 3FSJX 2FOLA 1QQTA 5CP8A 2RHMA 3KTOA 3BSYA 3CS3A 4YCCA 5G40A 3D0OA 4QUKA 5AXDA 1H42A 3VNSA 4U1RA 2WU3A 2E55A 3D5QA 5EJ6A 1S4MA 3B53X 1T4GA 4A8HA 4EGSA 3LCVB 2Q3EA 3HXTA 2D8AA 5CHEA 4AKGA 3PKJA 5CVDA 1TFUA 3W5CA 1AT1A 3SYTA 3V5NA 2YJ6A 2ZT8A 5F7JA 4FDTA 4HQKA 2DFNA 2WHPB 3ZDQA 1YFJA 1UXOA 3KTAB 2NXJA 5KJ1A 1T15A 4RJIA 1MVLA 4KSCA 2QRGA 3BERA 1KO8A 3HA5A 4GZMA 3HGTA 3OLYA 3AU8A 3DT6A 3OQJA 3LCMA 4JB0A 5B4VA 3LV8A 2JFNA 4B6EA 4IIXA 1DC7A 3ABZA 3CNLA 4JR1A 5DYNA 3VZPA 5K8CA 2C8LA 1VJ5A 3T35A 3ESXA 1YUNA 1XG5A 4AJIA 1S2GA 4YXWD 1ZHFA 1SH7A 3NCHA 3Q5GA 3RYHA 2AC4A 3IMCA 4BV2A 3U7GA 3NHSA 2NSHA 1QHSA 2J7PA 3LYHA 4I1SA 1MJ5A 4UXIA 1SXJD 3ZWPA 2JARA 4PF1A 4MP6A 1LVGA 3LKDA 4R3WA 3A3OA 3PZRA 4Y1FA 4B2IA 1E1QA 5IT5A 1DOAA 2OXRA 2OZKA 1KH1A 1EJ0A 2QMUA 1M34A 3P2YA 5HIMA 4LVNA 4YUVA 3H5OA 4Z4GA 3M3PA 4OHFA 1C41A 3OECA 1ZCFA 4G1FA 1AQIA 1Y89A 2JH8A 4LSGA 5AK5A 4ZVKA 1YB1A 2ZB3A 2J3QA 3FWZA 3LHKA 4WMLA 4C0KA 4MQFB 2IEBA 2I6TA 1TA0A 4ZOLA 1M7HA 3Q0EA 3GJTA 2J9XB 9LDBA 2VJYA 4P4SB 1T6ZA 3GZ4A 3THSA 1LTKA 1Z15A 2BBWA 3BA6A 3WAJA 2FF5A 1JHVA 3RSQA 4BU1A 1SAYA 2V6JA 3HCEA 4NYMQ 2DP4E 3RAGA 5LKRA 3SC3A 5HX7A 4H77A 1EVLA 3CW8X 2B9EA 1J1ZA 1KAQA 3E2PA 3GDGA 2AXNA 4BNNA 4LOAA 3A1WA 3RFTA 3UWPA 1I5OA 4EUHA 1RCFA 3MUFA 4ARZA 5A1TA 1COWD 4UZFA 3X0DA 3FETA 5A4JA 2C9CA 2GBLA 1AK2A 4S1OA 1N9ZA 4QASA 2XHEA 4ZOLF 1RACA 4R41A 4EB8A 4AD8A 1FP1D 2MSDB 5HOEA 3CO0S 2W2KB 4QGFA 1N6KA 4RXUA 1DGQA 4EBFA 4XKJA 3TTVA 1R27A 3UV6A 1QAQA 2DF8A 2JGAA 1Q14A 2XSZA 2GHIA 4QUDA 2L2QA 4R2IA 4Y9SA 3SMVA 1MQAA 4ZAVA 1Q1ZA 3EFEA 2IYUA 4TKUA 2Q41A 1Q20A 4RVFA 5DTEA 3A04A 5KVQA 2P4QA 5I9IA 5DN9A 1QG4A 1SN7A 2Q6LA 3AP1A 1QIKA 4FSHA 2DBQA 3UJAA 1E32A 2G9QA 2IYWA 2B7LA 3FXAA 4HFNA 4MLZA 1NJ5A 2HFJA 4PYMA 1UDAA 4OJKA 3VC7A 4BJ3A 5CFPA 1EYZA 4BZWA 1U8AA 3O9ZA 4ZO6A 3R6DA 4E2YA 5F7XA 1DPGA 3UVEA 2XECA 3I1IA 3ZVLA 2BELA 2DFVA 3O8BA 4XXHA 2QTVB 1A98A 1ZWKA 2FWRA 3WL4A 3ITEA 2YYSA 3S4YA 1E79A 1I2ZA 5KSPA 3F4BA 4F2PA 1YFLA 2XSZD 5K0TA 1Y6JA 4B3JA 1L7XA 5CJ2A 4OXQA 1CRQA 1FF9A 2DUWA 2GLUA 3DDUA 3E03A 1J24A 4IDDA 4MVXA 3M4JA 4F4IA 2E4AA 2ZQ5A 1U8UA 5L51A 1KDRA 1V9CA 2O05A 3A26A 4X7RA 5FEUA 2IODA 1XAGA 1PFVA 4RF2A 2FLWA 4CKCB 1VIAA 3OM1A 3BZBA 1TD9A 2P5UA 5DK6A 1UT6A 4F5DA 1JA1A 1NXOA 1GYQA 1ENOA 4Y0VA 2XE7A 3AL2A 1HBJA 4XTCS 4EFMA 3R5FA 3W0LB 5K4GA 4UVEA 4F46A 1O95A 4BFWA 1A8PA 3ETDA 1PTJC 3BDAA 2V4UA 4YDQA 3BGSA 5EWMA 1OASA 1QWSA 1N1MA 2BFPA 2Y0BA 3DO8A 3E8SA 5ECGC 3PTAA 4A91A 3EX7C 4MWGA 4IF6A 1Y5RA 1IM2A 2CDBA 3UHFA 1NFQA 4TRJA 2BV3A 3BILA 3T4EA 1NBEA 4GECA 1N77A 3QX3A 4GDFA 2RHLA 5HMLA 4MI6A 1QPGA 3CLVA 1D8AA 3EGWA 3R20A 4YAUA 1VP3A 2QN6A 2HU5A 1QZUA 4GMKA 4J6FA 5EXDA 4C7JA 3NHWA 5J1SB 1ST2A 2FSPA 4R1SA 1HFEL 2ZS8A 2J6CA 4ZVOA 1NW6A 1VYHA 1J0DA 3B9BA 1K6MA 1E62A 4G5SA 1WW8A 1OQAA 4D45A 4RWEA 3UC5A 2I1QA 2ENUA 4LCBA 4P93A 2JAWA 1E20A 4L5YA 3OUZA 3DQPA 3PVZA 1MDBA 1PT5A 3CE9A 4X1IA 1MO2A 1NVVR 3SAJA 3SXJA 1GGNA 3DUWA 3H2YA 3EYWA 3HDTA 6AT1A 2PH3A 3DVSX 5JAPA 3RT7A 4JEUA 2Q49A 3FDJA 1WZCA 1ZJ5A 3LY9A 1TKBA 1YIOA 1HDRA 4ID3A 4IFBA 1UPFA 5BWMA 5ALFA 1ZXXA 2W2OA 4OO3A 1XMSA 1J9GA 2DBVO 2VJAA 1ABEA 3B6KA 3BZUA 3EW9A 2XUDA 2XXAA 3STXA 5EWJA 1T2UA 5EE5B 4B33A 5DH9A 4C43A 1LS6A 2GAIA 2G82A 3W5UA 1KTVA 5TR9A 2WT8A 3U4QB 3CNHA 4F7WA 3U6BA 1P4GA 4MV5A 1IZ7A 3T0FA 1YS1X 1UFKA 3WYFA 4S2UA 2CVFA 3KU1A 2FFHA 2PM8A 2YIJA 2XQKA 2PJDA 3BJMA 3DZCA 5AM2A 4EKGA 4CEJA 3UW3A 4IG9A 4TV9B 2CLCX 3CVJA 3WQRA 4KNYA 1EXDA 1KIMA 3FPHA 5JASA 1FRQA 1F3OA 3FDIA 4IMRA 2BI8A 1MEOA 4TMTA 5YASA 5KYWA 4RIFA 3FSEA 5CFQA 1R15A 5D5HA 3C6YA 4D6XA 3T3EA 1OFUA 5C1IA 3DCYA 1THZA 2PRYA 5JQGB 4ZU1X 1TZBA 4AF8A 2C2BA 5GV7A 4KYVA 1BN7A 4ZQFA 4PO1A 4HTFB 2OCBA 4V0LA 2QTFA 3JPYA 4HB4A 1ZVQA 4GSYA 2I66A 4IAOA 1W4RA 2F17A 3FWNA 2PKCA 1CRZA 1OYYA 3LY5A 3OCWA 1T5HX 3TR0A 2DJ5A 2ZYSA 1Y8QA 2DR0A 5DI9A 2BGLA 2CLMB 1SZCA 1PNOA 2ZIZA 3NKLA 2PZAA 4HDSA 1GKYA 2PX8A 2YW2A 3LCCA 3P2KA 4DXHA 3ESQA 4V1CA 1RD4A 2JIZA 3FCEA 1HTWA 2QUBA 3CH7A 4M49A 1JYFA 2DFLA 2Z95A 3TSCA 3NIDB 1C0KA 1E4VA 1SXJA 2ZI4A 4MCIA 5IAJA 1RLOA 1I7SB 2JA2A 2WOOA 1EWKA 1X7XB 4R01A 4YRKA 4N5DA 3PGXA 3WK5A 2WHRA 4CMGA 4WVLA 5KB3A 2C2WA 3A6DA 4AUNA 2JEZA 1FE8A 4DLUA 1GTRA 1B3RA 3KYIB 4IGKA 5JJKA 2W0SA 3GFSA 4IHAA 1HYBA 3WWDA 2GX6A 5KS2A 3RAFC 4WA8A 1QIMA 4MDFA 1XZLA 3I12A 2F7SA 2ONCA 2NVOA 2B35A 3IUMA 5ALGA 4CVNA 2VF7A 3X2SA 4C4ZA 3LO8A 5LBTA 5JAZA 2X2PA 3BIJA 1KYIA 8AT1A 5E2AA 1OHHA 4TWIA 3K71B 3TZHA 5A03A 2J9FA 3ETGA 3M3HA 4BMZA 4UEJA 3IQDB 1KFCB 1OUMA 2VKQA 3D8BA 1U5BB 2I2AA 4UCFA 1H2ZA 3P0RA 3VJKA 4URZR 2PAAA 4FGSA 2NU6B 3D4OA 4WOCA 1K8QA 4HXGA 2GSWA 2VXOA 2CDCA 3D3QA 2FKNA 4QQKA 1W5FA 4K86A 1AE1A 1GZ4A 4PYIA 4YP6A 3EBOA 1GRCA 2O54A 1JG7A 2OAQ1 4KXMA 4RK1A 2A9RA 1RPAA 3FVVA 3EHEA 3ML1A 2E5WA 2O3UA 5JYDA 4J9VA 4Y2XA 3TIVA 2O20A 4BBAA 4N49A 1Y9ZA 1JYEA 4EGQA 2QPLA 1OJ7A 2B36A 4CMCA 3ZXYA 4Q66C 1PGOA 2F9LA 1L4FA 3C7CB 2EX0A 2C3UA 5H8WA 4IOJA 1U0BB 4NZMA 5DIFA 4EJMA 1E5XA 3IQHX 1W7AA 4U2GA 3ZWCA 3DUFB 1SM4A 1Z4MA 1ESEA 2JD0A 5EHGA 5KSWB 3ROXA 3DBHA 1N2SA 1J8YF 5K0GA 4AICA 9GPBA 1JHQA 3NJ4A 2BDEA 1KO5A 3NHZA 3STHA 1UK8A 1Y8AA 2WU4A 3L84A 3F8WA 2FW6A 3C41J 3VTFA 3GHYA 5ALXA 2XOKA 2WAXA 3WKBA 5LP6F 4L4YA 1NC1A 4UOQA 1JIQA 1SCUB 2ORYA 1RHRA 3W8FA 2FSVC 4WZAB 3C85A 2M9MA 3WLEA 4NXNB 3NRBA 1TK3A 2QP3A 2A5DA 1C7RA 3VQTA 3LPDA 4FSXA 4IRUB 1BXZA 1H5NA 1NW9B 2JA1A 1K4YA 3O0TA 2CNDA 4MX8A 2XDQB 4G5YA 4NE7A 4DWVA 4WJLA 4QEZA 2PUHA 4I50A 4IF4A 1ODCA 1TCCA 4ZHQB 1T5BA 5FA5A 5BSWA 3IRVA 1SHUX 3PUVA 3C8ZA 4DHEA 1B42A 1BS9A 2PSJA 4FFBB 4WKNA 1FYFA 2HHJA 1A96A 5IHPA 3G2OA 5CT8A 2X9LA 3AUFA 5BSVA 1EX9A 1U0RA 2P77A 4MW1A 4CEHA 2EU8A 2CZCA 1MF7A 3WHLA 3WNVA 4DUPA 1O6ZA 1SIWA 5CIQA 3DDZX 1BQ3A 2ODAA 2WWRA 3LLUA 1R0WA 5T8KC 5CDGA 4WGGA 2WWFA 3AEKB 3LXRA 2VJKA 5B1DA 4MB2A 2IU0A 1BE1A 1NDUA 4OF4A 3ZY4A 2OV8A 3DMPA 4M4SA 3GH1A 2N47A 2QK4A 2WWTA 3DAOA 3GZJA 3K4HA 2XZLA 3JVDA 2QW1A 3P2IA 3T1OA 1G8YA 4OXYA 1F0KA 1VHWA 3C3PA 2BCEA 3IULA 2VWHA 5CUQA 2NTEA 3CEPB 3KWMA 2X9NA 1T3TA 1YZQA 2QN9A 3AEKA 5HK8A 1CK4A 1KY3A 5JBIA 3CJRA 1SU7A 1M76A 1NVWQ 4B32A 1PEDA 3MTEA 4FZJA 4KL8S 4N7RA 4P31A 2WA2A 3RRNA 5C3MA 5JT1A 1X7DA 5LR6A 1JZQA 3E22B 1Z6QA 2ZJOA 3K2EA 1QGDA 3CVYA 4YR9A 2FUG1 4CL0A 1Q0LA 2VHXA 3LDGA 4H31A 3FMGA 1XGKA 1KU0A 3KXIA 2RGNA 3C70A 1IE3A 5G0SA 3UK2A 3VPAA 3NDPA 4L6CA 5JRJA 2IP4A 2IYOA 1DTWB 2HI0A 2Q0QA 2JLBA 1C3VA 1ZSYA 2B6NA 3BB4A 4S05A 4YRGA 2ZBPA 4RPJA 2WD7B 1QZZA 1U1DA 2UYYA 3LYAA 3PNYA 4LJ9A 4P3PA 1PFQA 4W63A 4RETA 2V6MA 3GGJA 4EBBA 3QV1A 1NPYA 4G67A 5EKUA 4E7OA 5FLEX 4FJ1A 4XM1A 4G9EA 4HWSA 2RKBA 3K1JA 3LLMA 4IIGA 1NSYA 1OFUX 2YXPX 3UJ8A 4BNZA 4NG4A 1P2UA 4MQUA 4J3JA 1FJXA 4KMMA 2HSJA 3C3BA 2GPTA 2FPPA 4D8UA 3BKXA 3DNPA 4HX2A 4BDTA 4TMVA 2YIDA 2QQ0A 3PUJA 4HZUA 2XDWA 4QYSA 4YVFA 3TL6A 3UXEA 4JJEA 2GDJA 4O08A 3QJ5A 4A03A 1L4UA 1UBRS 2FPOA 5HIKA 3Q87B 1DJNA 2I4IA 2ET6A 1SWVA 3F8TA 3E23A 1B0PA 4RD0A 5BOVA 1XQYA 1TM2A 4FT4A 4LZLA 1P7YA 1GKKA 1HKHA 3M2TA 1KK3A 4Q6BA 4ZI7A 2FRDC 4NP6A 4P32A 3ZEAA 3C15C 3MTAA 4PW0A 3NB0A 1YVEI 4J7AA 3SBXA 3L9WA 1YVRA 3KEMA 3NV9A 2CLLB 5FQNA 4PSAA 4ERXA 4IQ0A 4NS4A 1O94D 4TSFD 3ZJ5A 2JGMA 2VOJA 1H9AA 2ZDHA 3DEIA 1EB8A 4CFSA 4XOIA 1NJSA 1XVTA 4M7PA 4CDNA 4CM9D 1VGVA 5J59A 1XKLA 1U5CA 5F73A 1XMVA 2V1XA 2E4XA 3DVRX 3FYUA 1W59A 1NQ5A 1NF9A 2I2FA 1OTXA 2XMSA 2YHAA 3CM0A 3W2TA 3QHAA 3C4QA 1Y6QA 1OCEA 1SCQA 3OTIA 5LP6C 1O6CA 3CMMA 3N0VA 4KIJA 1DKUA 2F1JA 1A2BA 2J08A 1ISFA 1Z22A 3K6KA 3LDHA 4JYPA 4IR7A 4RW0A 2OC9A 4RZ3A 2OV2A 3FROA 1KC1A 1C9MA 4TVBA 3CH4B 1IHOA 4I5GA 3WGMA 2IDJA 1WA5A 2PD4A 1HRDA 4L0QA 5JANA 2IOFK 1CUCA 1GUAA 4H18A 4IJKA 2GXQA 1HYQA 1B0UA 4UOEA 3NJRA 3F6EX 2ZB4A 3ANMA 2XBLA 3L49A 2IS2A 3UXHA 5H68A 2FHSA 1TF5A 3R6TA 3V46A 5KWVA 2DUUA 1WQ4A 4BNKA 1W5TA 4OB8A 4LGMA 1MA3A 1ZBQA 1ZJWA 4RDIA 4ZODA 2W6JA 5B6PA 1UOOA 1FNMA 3S29A 1TVEA 2YHUA 4BATA 4AC9A 3DEAA 1LDEA 2ZRAA 2HZ7A 3TLMA 4JBYA 4JUCA 4WCVA 1ISMA 4RLFA 3GW8A 1SBCA 4BN0A 4CMHA 4W5WA 3E84A 3GRZA 3RVBA 4MKRA 5FLKA 3GP3A 4MS3B 4HB2A 2QTAA 1GXSB 2OM2A 4DJFC 3H4TA 4YRRA 4MPDA 3I05A 3SBOA 3F6YA 2BFOA 3CRQA 3RC1A 5IK2A 5DE3A 3RSZA 4ES6A 3WZMA 4EA8A 3IERA 4H35A 4CZ2A 4GG1A 3R9IA 1A97A 1UR5A 2A30A 4HWRA 3KJGA 2PG3A 2PMWB 5HKAA 4GR5A 4JI7B 3TRDA 1MA0A 3LXXA 4Z3OA 3PJDA 3NJ8A 1J4AA 1KZGB 2CLKB 2RCNA 2C97A 2WJPA 1RMTA 5F4BA 1SUWA 4Y2YA 1Y80A 5KWSA 5BSKA 1RXUA 4AXBA 4N41A 5H82A 4K0KB 5JO9A 2VDMB 3QPUA 1QBKC 3G2MA 3JWHA 4N6OA 3KT6A 2NVUB 1QO0D 4OLBA 4MVJE 5K6RA 2CLSA 2I87A 3ZK8A 2ZZMA 1VKOA 1A7AA 5JBNA 5C2JB 2PPVA 1IDN1 5EEGA 1JMKC 4BLRA 1OBFO 2MYUA 1P72A 4J0DA 2ZSEA 1RWBA 4PG7A 3A6HA 1GLNA 2QRMA 3N2EA 5FUBA 3W8EA 4UE3S 5JXGA 3K5HA 3KBOA 1V16B 1RLUA 1E4EB 1XOIA 2IEAA 1RJ9A 3O2JA 4JLWA 3TLCA 1X1TA 1J97A 1MOSA 2J7KA 4AJEA 2RONA 4AKEA 2XT6A 3BD8A 4EJ6A 4ZQIA 1QO0A 2X76A 3I5UA 4F6CA 5IKOA 3T0IA 3LKZA 5JZ9A 2DWQA 4MYRA 1L1QA 3D2LA 4BAUA 2UXDB 1NC3A 1Y34E 4EDFA 3KJXA 5AJZA 4EVQA 1FP4B 5CYGA 3ETEA 1U9IA 1LBHA 1U4SA 3BOSA 4GC9A 2AEJA 4JGIA 4UU7A 4X84A 2GM3A 3ROZA 3JWIA 5ERYA 2HYIC 1FY2A 3EWIA 5CM8B 1LDYA 3OCYA 2XRZA 2Z4RA 4X8OA 3EB9A 1CIJA 2J1LA 1SQ5A 1UEXC 1FFSA 1N78A 5C46F 3RM3A 1R37A 1PV2A 1L7AA 4DRXA 5L3QA 4AP5A 5LQRA 1JPNA 1NBMD 1C1XA 1BDJA 5CK5A 3ZHOA 3IQWA 5JH7F 4HRYA 4LC0A 5LA6B 4NCKA 4DT1B 2OR3A 4BE9A 2RHTA 3BD6A 2YOFA 4IHQA 1R9GA 1AKMA 1M1UA 4QYTA 2EARA 3X1KA 1QCZA 2G6TA 4J0EA 4CL8A 4NQZA 1LBEA 4KRFA 4AKIA 4NOLA 3FYDA 1K8YB 2JFFA 4GVXA 5EWMB 5BUCA 3VA7A 3RSOA 3SE0A 4D79A 3OIWA 3PYLA 4CQLB 1Z4JA 4RUKA 1JZSA 2IQ5A 3K05A 3GCWA 4JIMA 4TVSA 1T10A 4E2XA 5C8VA 4OIFA 3G5AA 4WNIA 1ESCA 3WTBA 2UYHA 2P7HA 1DHRA 1J20A 3T3HA 3DO6A 1L2TA 3PWSA 3UJNA 1JHAA 4PO3X 2H3HA 1DO2A 1JQDA 3UO8B 1MIOB 4OQFA 3KZCA 1UWCA 4IDAA 5TF0A 5LQCA 3KQVA 4MW9A 4NV3A 3VZCA 1Y4SA 4J3FA 5GQSA 5BQ5A 1FLDA 4MPPA 1DMSA 3L1KA 2IELA 2QM0A 2VN8A 3MYYA 4JGBA 3HYCA 4BQRA 5JUWA 4GGMX 4ZEXA 3GA5A 1AGPA 1JSLA 1M1YB 1WL8A 1TTPB 1R1DA 3GMIA 3DT9A 1MQSA 1YT5A 3LZDA 4JLAA 1QCCA 3TTTA 1NFRA 2WYHA 1G3MA 1G291 3JPWA 4DNFA 1R5OA 2BDTA 3AXTA 2IP2A 1EBFA 2BFCB 3WGLA 1UXIA 1Y4ZA 3KXLA 3QQ5A 3EASA 2YV1A 3MJRA 4O3FA 3PQ3A 5IJ0B 4H7EA 3DV0B 1K7SN 2C82A 3TFOA 3G8CA 4FWTA 1ZMOA 2C5AA 5TJHA 1ZSNA 5EIOA 5A3QA 4CIWA 2HL6A 1YUBA 2D59A 3QNWA 2C2ZA 5HE8A 2GH1A 1KO1A 3PHIA 3K09C 3ZUPA 1KOJA 1YGPA 3DMHA 3MSCA 4XARA 5E7IA 2OQVA 3QUSA 3SC6A 4G8JA 3BTOA 5AR1A 4ND7A 1Z62A 5EJ9A 1GPKA 3QHPA 1TZJA 5FO1A 1JQJC 3CT6A 3KM0A 2NXNA 1JEEA 2P3LA 3A7EA 3ACBA 2RBKA 3M6AA 4IVRA 1C9EA 5BN5B 2EKBA 2OVFA 4EK9A 2D3WA 3PQDA 3FCXA 3ICWA 3P9PA 1DJQA 4B5KA 4RNDB 2QX7A 2WTNA