1AK2A

Adenylate kinase isoenzyme-2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
220
Chain Sequence
b'PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE ISOENZYME-2
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
molecule tags Phosphotransferase
total genus 75
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ak2A00
4FMDB 3LD9A 4BFWA 4OBEA 4PQRA 1W47A 2DY1A 5FI1B 4GPTA 3THWA 2QBYA 1AM4D 1QBKC 1VCNA 1II9A 1NN3A 4TMZA 2ODWA 1MV5A 3RNLA 3NDBB 4W5JA 4HZIA 2J59A 4JSTA 5FUVA 5IHPA 1H8HA 4AKIA 1DTSA 1VIYA 4A92A 4NYJR 3DOEA 3A4MA 5AJYA 2PX0A 2QPTA 2VHQA 4NYIR 2JIZD 2QQEA 4QGFA 4RD1A 3RRZA 4BECA 1E2IA 4JLBA 1GTVA 4KYIB 3ICEA 1TEVA 3BRWD 3EA0A 1W4BA 3UMFA 3ZVRA 4IOLA 2IHBA 2CK3A 4Z8XA 3K70B 4TTPA 5FL7A 5JRZA 1US8B 4UXIA 2IUSA 3QENA 4M8NE 4M1YA 1IY1A 1CR1A 3L0IB 2GCNA 4JBWA 4YXWA 1E9BA 1NN5A 1NKTA 3KKMA 5HZKA 3F0TA 5CLQA 3FOZA 1N6NA 2V1UA 3I8XA 4JIMA 1HE1C 4BGDA 2Z43A 4KHZA 1ZD9A 2GA8A 4DEYA 1KYIA 2QA5A 2JLXA 1Z29A 3LBHA 3WMEA 5GADl 4DC9A 4S35A 4UXJA 1XWIA 3EPKA 1GSIA 1IQPA 2ZRGA 4IDOA 1EFHA 2YOFA 5EZ5A 1N6LA 3WYGA 3E5HA 4G5QA 4D4KA 3U44B 4LHXA 3EXAA 2QEQA 2ZSDA 4B6EA 4TL6A 4B47A 2ONJA 1P2UA 4B2LA 1W0KD 3THYB 1FNMA 1LS6A 3DL0A 2PMKA 5HCIA 5HE9A 1NVVR 2WV9A 3OIUA 3FHTA 3A1TA 2ZRJA 4UNSA 1UFQA 2DBYA 2G77B 2ZRHA 2FEMA 3TGPA 4DDUA 1YJ5A 1R8SA 4JLNA 2D7DA 3AVQA 4OQNA 4AIIA 3RANA 2DWPA 2ZRIA 3BOSA 1MO3A 5CM8B 2XTMA 2YHSA 4MITA 1F2TB 2ZI9A 3HYTA 1CS4C 5G3ZA 5GVSA 4BEBA 3SR0A 3MWJA 2W6JD 2C9OA 3CBQA 2ZI4A 2VF8A 1Z22A 1KK0A 1ZIPA 2YWHA 2F43B 3IQWA 4P4UA 3R9IA 4C0BA 1OHHA 2VA8A 1LV7A 1PLLA 2CHQA 1QHIA 2HT6A 3FHOA 2WWYA 1JEDA 2X2EA 3UG7A 3D31A 1MH1A 1XEWY 4QM6A 2VHCA 2Y8EA 3SYNA 3Q3JB 2FEOA 4PZZA 4BFTA 2ONKA 1Z08A 1ESMA 1XMVA 2Z0MA 1DADA 2XZPA 3GFOA 4PX9A 1ZU5A 3A1VA 2ATXA 1Q12A 2YC4C 2QP9X 4C4PA 4US0R 5IK2D 1SVSA 2ZAMA 3ZVLA 1T6NA 3DO6A 3I92A 2ZITA 3FHCB 4QHSA 4XSHA 4LJYA 3T61A 2QP3A 1T3LA 2PZFA 4W9MC 1ANKA 2IXEA 3VR1A 1X6VA 3B1WA 4Q21A 3KQHA 2R62A 3PCRB 3ZGXA 3ZVMA 3V9PA 1NIJA 3EAQA 1XTKA 1E1QA 4D4LA 2J41A 2QI9C 1G41A 4IJMA 3TRFA 4K81B 1FFHA 3CM0A 1CR0A 1G8GA 4IRUB 4B2IA 3IPYA 1R5BA 3RS5A 3GLFB 3BFXA 3B8HA 3THXA 1CXZA 2JLZA 1Z6GA 1XXHB 3IIJA 3SHFA 5JMTA 2L0XA 3LVRE 4HZUB 3KDSE 3QKSB 3SN6A 1EESA 2PL3A 1TUEA 1FMLA 1GDDA 1TF7A 4WVFA 4IFBA 2X8AA 1VDZA 2WBLC 4BZQA 2F55A 1ZBDA 1IN5A 1YZLA 3TKLA 1P9RA 2P6UA 2HV8A 3EZ9A 4Z8YA 5SZJA 3CLVA 1KI7A 3H86A 3ADKA 4ILEA 4PPNA 5KPDA 3R9WA 3KJIA 1HV8A 1JR3A 4GOKA 3TUZC 2GHIA 3PR1A 1E2NA 1R5OA 2R8RA 2ZSAA 3Q7QA 2JJ8A 1YZGA 3P4YA 5DYGA 3M1IA 3EZ6A 3K70C 4JVLA 4MKGA 2IW3A 1X8LA 2UVQA 4FN5A 2BMJA 1I4DD 2J3EA 3U3RA 1XPOA 1XF9A 4AURA 3QPWA 1XEXA 5LD2B 5CLLA 3T1OA 2ZJAA 5J47A 1JQLB 2QUZA 3HU2A 2WOJA 1NMXA 2A78A 4DCVA 4DCNA 4URXR 1D9XA 3WY9A 5IT5A 3KXLA 2BM0A 2ZR9A 3ETLA 2EFDB 4QJ3A 1N6HA 3AKDA 1P4SA 4CEJA 2J0UA 3B1YA 2GWHA 3R7WA 3EWSA 1CBUA 2J7PA 1CJMA 3A36A 3QQ5A 3UMSA 3PIRA 3RHFA 2HLDA 2MMCA 2CLSA 3D3QA 3EG5A 3ONWA 4OHXA 3X1ZA 1RE0A 4NBSA 2C98A 4OI1A 2CHVA 1XMJA 3U3KA 2VSXA 2PH1A 2YOGA 1VPLA 3SS8A 1M7HA 1XXHE 5C1BA 1Z0KA 2NZ8A 4LC0A 2B6HA 2RGNC 3B85A 4ZDIA 1DAKA 2RHMA 4B3XA 3CRQA 3UATA 1R5NA 4TL9A 3U6KA 4A4DA 3GQBA 1CF4A 5HCNA 2CDNA 4IEIA 1KDRA 1ZUHA 3U61B 3BORA 4OQLA 2WZQA 3BB1A 3QUSA 1E0KA 1R4AA 2B92A 2BOVA 3WBJA 1GNQA 4Q1EA 1OFUX 1GOTA 1UBFA 4NU0A 1XJCA 1E6CA 2VQSA 2QMOA 2VSOA 2XZLA 1G64A 1E2PA 3GLHA 4Q03A 5IF9A 2Q0HA 3NIBA 3UXMA 2WWWA 1XTQA 2XITA 5KYKA 4P4SB 4DBLC 1CJKC 1ZNXA 3BE4A 5K8UA 1F2UB 1ZUNB 4Z1MA 4TSFA 5L3SA 2OAP1 3M0EA 2Q9CA 5CYOA 2NG1A 1SULA 2K5UA 4JLMA 1GUAA 5FL3A 1XCPA 1VCMA 2CEAA 2AKYA 4TWZA 3HJNA 5HKKA 2OFXA 1SXJA 4H9GA 1NJFA 4KI0A 1J7KA 2GK6A 2GK7A 2OG2A 4GOJA 1U98A 1SKYB 5BN4A 3QEOA 3TW4A 3AF2A 5SZIA 4DUGA 1GKUB 5L3VA 3T1QA 1W4CA 4M1TA 3EARA 2UZIR 3KKNA 4WZ6A 2YYZA 2Z6VA 4RD3A 4PO1A 1S4QA 4URZR 2G0NA 1YZUA 2BKUA 2O8FB 5GJCA 1G20E 1NBMD 2IWRA 1YE8A 2XSZD 2XOKD 1S1MA 4R2HA 2BJVA 2FZ4A 3AVPA 3GLGB 1WF3A 5FI0B 3CPJB 3TW8B 1OB5A 4L8GA 3SQXA 2VP6A 2BMFA 4ACAA 1E9RA 4UKDA 4P31A 5EE0A 4BE7B 1ZW6A 2VBCA 1Y63A 2Q3MA 1R0ZA 3BJIC 3CIOA 3H2YA 4JVNA 1E98A 1AGRA 2D06A 3AEZA 1TF2A 1Z07A 2XJ4A 4TMXA 1CLUA 4R2IA 2BBTA 1NLFA 1KO5A 1E2DA 2QMUA 3B6EA 3C5CA 4YMSA 2GCOB 3K8YA 1OSNA 3EX7C 2WWGA 2DCUA 1UKEA 4I99A 4KFUA 2O0JA 3RAPR 1G8PA 1LF5A 4R98A 1YU9A 2A5DA 3DMDA 4OK6A 4NYMR 4XVUA 1FTNA 3OE7D 3QF4B 3W9YA 5TB5A 1E3MA 5JJKA 1GRNA 5FPSA 1N6KA 1UBEA 1VKJA 1ZD1A 3IQXA 3LQRA 5EE3A 1W5SA 3RRYA 2WTUA 2ZAOA 1H8ED 1AS0A 2FX3A 1JXMA 3BH0A 2FA9A 3E2IA 1QF9A 4DDVA 4DKXA 1S3SA 4TQUS 2JCSA 3TQFA 4TLAA 4MDEA 1JJ7A 2DWQA 2GTPA 1SZPA 5LD2C 1KI6A 1SKYE 3OEEA 4HB0A 2GCPA 3CNLA 4M4SA 3C8UA 1OKKD 3FMFA 5KNBA 4TYQA 2LKDA 3QJYA 3U5ZB 3NDPA 1XFAA 3IIMA 4KAXA 4EKDA 1G7RA 1UJ2A 1P6XA 3OF5A 3TNFA 2B8TA 2E87A 4AK9A 1MABA 3VTKA 3BAFA 4ARZA 3Q7PA 1GFIA 5CJ2A 1NI3A 1Q1QA 2CCJA 4A2PA 1GRQA 3L0SA 3ZH9B 4AG5A 2OSBA 4G01B 1VHTA 3NTUA 4EPRA 1PVOA 3OFNA 1U90A 3DZDA 3Q5EA 4Q1DA 1XB2A 1Z0IA 3HU1A 4OI0A 4CEIA 5A0FA 2ZR0A 1RJ9A 2EW1A 2YOHA 4L4UA 4E03A 4HLQB 2ZI5A 1O87A 3DHWC 4LCBA 4RCYA 3U60B 1EX7A 2WSSD 2XNSA 4HLUC 3VR4A 1EWRA 3AP2A 2C78A 3K9HA 3RS2A 1AZSC 4JLVA 2FSHA 2JLSA 4JLJA 5BW8A 1CJVC 4C0JA 4Q4JA 1L8QA 4B3DA 4BUJA 2HT1A 1NN0A 3KTAA 2H18A 3GJ6A 1QHYA 3QXHA 4D81A 1ZM7A 1XTRA 4ZKDA 4RD0A 2WM9B 1XU4A 4RJLA 1G21E 1NL3A 3TMKA 5JJIA 1M34E 1ELOA 2BCGY 1YQTA 2REXB 2IEZA 4EPTA 2D3WA 1KGDA 4KFSA 4QHYA 4A6PA 2QAJA 3KJEA 4NYJQ 2ZRFA 2WWHA 5CIWA 3IKJA 2YWGA 3A1UA 1WBBA 1SGWA 3KKOA 4FCVA 2ZYTX 1P62B 3JVUA 3QXJA 4J0QA 1EFRD 5DI3A 1G5PA 2QNRA 1G4AE 2GXUA 4B3GA 4L5BA 5DN6A 2YNMA 1XZQA 4BLRA 1XJ0A 3B13B 4GMXA 1RZ3A 2FPMA 2O0KA 4MUAA 1XTJA 3PG5A 4EQ6A 4MA4A 2XTZA 3W5JA 3THWB 3W90A 4TLEA 2QBYB 1R10A 1OIXA 4IOKA 4BRWA 1EWQA 5J4LA 1QHHA 1WB9A 4L9SA 2ZE6A 1KSGA 5AJZA 2IYVA 2PT7A 4B73A 1RPZA 2KBFA 4P4TA 2Q3FA 2GZDA 3MRSA 1ZCBA 4ZIRA 1NJGA 3WRYC 2P2LA 1T5LA 1DAIA 1DG1G 3L8ZA 3QPVA 2ZSBA 1HUQA 1XEWX 2HXYA 3CKLA 2OLJA 1E79D 1DO0A 2R6DA 2WWFA 4PHTA 3QKUA 4O2LA 5EJEA 4BFVA 1WQ1R 4XVQA 3QXSA 1QHNA 4DCUA 1P7CA 3S1AA 1RC8A 1N6PA 5KTYA 4JLPA 3LWNA 5KNCA 2O8DA 5D3MB 2FPKA 1COWA 1NVVQ 4OYHA 1CJUC 5FR2A 4A8JC 1KK1A 1S8FA 3A37A 1RFLA 3NBYC 2IHYA 2BKEA 4C7OA 1P73A 1E0SA 4LPKA 3MMPA 1OYWA 1XBTA 5JHHB 4DZZA 4MYTA 2FMXA 1J70A 1T0JB 4JLOA 3ZS9A 4WIAA 4F93B 1DAHA 1G5RA 4D25A 3CRVA 3W5IA 2D62A 1OV4A 5FTKA 3WMFA 4C0QC 4XIGS 3RC3A 2RCNA 3G82C 1J8YF 1WBDA 2WJGA 3U4QA 4P32A 2CK3D 1MRSA 5FL7D 4Y0AA 1BOFA 2H8KA 3MG9A 1IXSB 2WSMA 4YXWD 1SHZA 1SVLA 1CU1A 3MWLA 5TDHA 3QG5A 4XTRA 4URUR 4DIDA 2OXCA 2IC5A 1E1RA 1R0XA 5CB8A 1L4UA 1N3BA 1NLYA 1ZD8A 2H17A 5CDFE 1IN6A 4IXNA 2FSFA 1CKEA 1E99A 1RVDA 1G19A 1JPNA 4LJ6A 4YMUA 5JWRA 3FMIA 1KMHB 2QRNA 4URVR 1W4RA 4JS0A 4Q7MB 5KNDA 2V3CC 5B57C 2V6JA 1I2MA 1OT3A 5F9FA 5KSOA 3LO5A 4KFTA 1FQJA 2QTHA 2ZI3A 2C04A 4KVGA 3UKDA 2NO1A 3FGNA 2Q3HA 4PTLA 2B7BA 2CCKA 5H8WA 3GP8A 1KY3A 3AUYA 4FCWA 1VECA 1Z47A 1K8RA 2QAGA 5E7MA 4HYYA 4Q5IA 5CK5A 1OJLA 1N6IA 3GCGA 1BH2A 2IS1A 4U00A 1JEEA 4DHEA 4A2QA 1UF9A 2AXPA 2QG6A 2CJWA 2WHXA 3MJRA 4HAVA 5AR1A 2XTNA 3SZRA 2ZSFA 1DAGA 4XD7D 3ZDQA 1U0HC 2I4IA 5FOXA 3VMFA 1U9IA 1DE0A 1BIFA 2PEZA 4MKHA 4F4IA 1R0WA 3TVDA 3K9GA 5CM9C 2ORWA 3KFXA 3SJBA 4PFSA 1BYUA 1Z0AA 2FWRA 2GBLC 1ZVQA 4LHVA 5HZHA 1Z83A 5DH9A 1KNXA 3DKVA 4HAWA 4V0OA 2ZROA 3VAAA 5JECA 4DLTA 3CO5A 2ZRLA 3SEAA 3LY5A 2G9NA 3CZPA 1NVXQ 2PZGA 3AV0B 4FCTA 3CWQA 2R6GA 2AKAB 1CTQA 4U02A 3THXB 2ZRKA 3O47A 4D0NA 3K9LA 5FUYA 4Q7LA 4MQBA 5TVKA 1YZKA 1EK0A 4AWXA 1Z6XA 2V7QA 2AK2A 2VP2A 3EC1A 2BVNA 1XRJA 2CLCX 1TMKA 3TIFA 4Q66C 1ZNWA 3B1XA 2DYKA 4V0KA 3HR7A 2C95A 2CHGA 1V5WA 4FD2A 1MR3F 4GL2A 4ESVA 4MGKR 5KPJA 2GJ8A 2WKPA 2DR3A 4OI4A 5FOUA 1FQKA 1E1QD 1G4UR 3GFTA 1CRQA 1E2JA 1OF1A 1GRRA 3SDZA 3SC3A 4Q1FA 1J99A 4V0MA 4A0HA 4B76A 3WBKA 3AF1A 5DISB 4D0GA 2QQ0A 2OBNA 2ZJOA 2ZS9A 4JYCA 1OYYA 4DSNA 3MGCA 4E07A 4HATA 2REBA 2QSZA 4M1WA 4PSAA 1XEXB 3FFAA 3CF6R 2JLVA 4WXPA 3PEWA 1NSTA 4WZAE 2HJGA 3AVVA 2ZYUX 4EAQA 3ZVNA 3SFZA 2J87A 3BB4A 4PO8A 2GJKA 2HYIC 2ZSEA 1W44A 1T8TA 2AD5A 3OEHA 1KNQA 5J40A 3UWKA 4CEJB 4Q02A 3RSLA 1IN7A 1JR3D 2ZRDA 2JJ1A 3GLIA 1ZU4A 4EPVA 3WYAA 1K5DA 2IYUA 3AVOA 1BYIA 1AIPA 1AGPA 4HAYA 2ZUCA 3OIWA 2FU5C 2R9VA 3D6TB 1G7SA 5EE9A 4AY2A 3WHLA 4HDQB 1OXUA 5KDDA 2KWIA 2G1JA 5JBQA 2AXNA 3KX2A 1WMSA 3OAAA 3B7GA 2JASA 3L2OB 3I73A 5E7IA 1ZNZA 4CT4B 4DCSA 1NN1A 1Q22A 4HB2A 5EXSA 4V02A 1ZINA 1ZUIA 2ZANA 3AGPA 2NPFA 3N70A 5DGXA 5FBQB 5AUNB 1G8YA 2BHRA 2CLDX 4GP6A 5AWFC 4HAUA 3SYLA 2JAQA 2RGGA 2J7PD 1Z5ZA 3BC1A 3VNVA 3AB3A 3KB2A 3KQKA 2HLDD 3LAWA 2W2XA 2EFGA 4GSYA 1T5IA 5KDLA 1NKSA 3DMNA 4JJKA 5JZVA 4IOMA 1IY2A 3KZ1E 4NKRA 3QI2A 1JQJC 2C96A 3DOFA 1X3SA 1GNRA 1Q3HA 5KSZA 2GF9A 4LHYA 3T34A 2KE5A 3W6PA 1FPMA 1GZSA 1KO4A 4RD6A 2YWEA 1VHLA 3A6PC 3LLMA 4LV5B 4XWAA 2QY9A 3EZ2A 1DO2A 2OILA 2O8EA 3C5HA 5B58C 3RVBA 1E94E 1SXJB 2HEIA 5FOSA 3WNDA 5DIFA 3MJHA 3R20A 3TQCA 3PEYA 2PLRA 3K0FB 2ZRPA 3L0PA 4YC7A 1A1VA 4DLXA 1VYTA 5KSPA 1Q0UA 2A30A 3LQQA 5AUQA 5LDDC 1WA5A 5JEEA 2WKRA 3VNUA 4GMDA 2O8CA 2KB0A 4NYMQ 4C0KA 2ORVA 2QTFA 3CONA 2C77A 3NKVA 2IYYA 2QP4A 2QZ4A 4TSFD 4Z1MD 2BMDA 3KXIA 3I32A 3EIHA 4XD7A 1P9WA 3K0AA 1IHUA 2EYQA 2VSFA 3FYHA 5C4GB 3AVYA 1P3JA 4TMKA 4YMVA 4JMPA 2IUUA 3VKGA 3LX8A 3U7EB 3L43A 4KXFB 5F2EA 5E3HA 5DO9A 3REGA 1SXJD 5HKKD 3ZD7A 4FINA 2YZ2A 1OFTA 4LC1A 1TEXA 1WDTA 4OHYA 4IVQA 2QU8A 1L4YA 2GVZC 2J46A 4DUGD 1E0AA 2ANBA 1F60A 1L2TA 2QN6A 4LYFA 1TX4B 1VTKA 1BS1A 1CP2A 5DSZA 1T8UA 2IA5A 1QHSA 2MSDB 2IYSA 1ZNYA 1JAIA 3GEEA 4XTCS 2FSIA 2F9MA 4URWR 3C14C 3L0OA 5BQ5A 1U8ZA 3KJGA 3I72A 1KK2A 4WA7A 2GF0A 2LCFA 1NY5A 3G0HA 1HH4A 2BEKA 2FG5A 4Q9JA 3VKHA 1E96A 4OHZA 1G6HA 1X8KA 4NMMA 4B71A 2ERXA 2A5YB 2JA1A 1NG1A 2P5SA 3LBIA 4RZUA 2HF9A 1AK2A 3MLEA 2ZVQX 5UKDA 3M4YA 4EFNA 1B0UA 3BBPA 4GZLA 3I3SR 4CT5A 1CIPA 3FMOB 1GKIA 1OXXK 1KI9A 3B78A 4NCHA 3ADDA 1QZXA 2C8VA 4E09A 4BFZA 1P2SA 2JLYA 3BXZA 4LBWA 1Z2AA 1MABB 1CRPA 4RY2A 4ARZB 3HDTA 2AWNA 4WAUA 4EIWA 4PZYA 2D74A 1E4YA 4M21A 3GEIA 4Q19A 4MGZR 2LKCA 1D6JA 5J4VA 1E2EA 1R7RA 2ZR7A 2ZEJA 5EUMA 5TMPA 4MH0R 2EYUA 2GILA 3HWSA 4LI0A 4M2LA 4Q9LA 2KSQA 2CNWA 3E70C 3IO3A 4M9ZA 4A15A 3K09C 3DPUA 4PAMA 5FPYA 4CEIB 1C1YA 3OEED 2P3SA 1E2QA 1E32A 1RJ9B 2FFAA 5HR5A 2VP5A 1SVIA 2ZS8A 3MWKA 3LVQE 3E1SA 1PV4A 3DKPA 1A7JA 3ECCA 4DLUA 3WYFA 4H1UA 4GNKA 4WOPA 5EP2A 2ASEA 5ELXA 1E2MA 3LXXA 1L7VC 5AJVB 1C4OA 2P6NA 3SJZA 2CXXA 4QBGB 5E4FA 5H70A 3IO5A 3W8RA 2W6IA 4Q4JB 3TLXA 4ZCIA 2NO9A 1M7BA 3KTAB 4PAOA 3AGQA 1G5TA 5DHAA 3TR0A 5JWOA 3OFND 4RD2A 4TYNA 2R6FA 3W6NA 3K0CC 4ZDKA 4XSGA 1S0UA 5K8IA 2QGNA 1PLKA 2Q6TA 4NL4H 2D2EA 2OCAA 4JL6A 4BEJA 2ATVA 1YRBA 3HP1A 3EPHA 1A5TA 1A82A 4JZKA 3GLFE 5TY0A 3LA6A 3EASA 3CX7A 5IRCD 2GJSA 1W5TA 4ACBA 1TU3A 3TUIC 1YR7A 2D2FA 4G3XA 4QNMA 2ZI7A 4EDHA 4OKSA 1ZC3A 4MYCA 1KZ7B 4UJ3A 2E9SA 3D7MA 3OESA 2VHJA 1KDTA 4Q00A 4D6PA 1BMFA 1IXRC 1Z0JA 1QHHB 5LPNA 4LJ4A 2ZE8A 4PHHA 2EFCB 3SBDA 2AD1A 1G3UA 3DM5A 1K6MA 2CMKA 4P3YA 4HLCA 1W0JD 1VCIA 4FWIB 2QE7A 4ZIRB 1KDOA 1N5IA 2VL7A 2RGXA 2ZUDA 4LSGA 2G0TA 4ERNA 5FUXA 5DNYB 1JXOA 2JDIA 2YV5A 2J0SA 4B48A 4M0LA 1KSFX 3QKRB 2QRZA 5G41A 1GNPA 1Z3IX 3NEJA 5DN6D 1OW3B 1W7AA 2GAAA 2Z4SA 2J5XA 3I62A 4QBHA 1ZM2A 2GDJA 2GXSA 3OIVA 4GFDA 4TTQA 3V00A 3F5FA 3VR2A 4US2R 3W3ZB 2QPAA 3S1AB 2QROA 1AQYA 4LWZA 1A4RA 5K8TA 1EG7A 4FMBB 1KI4A 2O8DB 4G5OA 4CGZA 3T1TA 2PCJA 1KY2A 2CCGA 4I1UA 5TARA 2ZU0C 2O52A 2ZS7A 2ZTSA 4K46A 4C7OB 4TZ6A 2ZRMA 4B35A 5C4MA 2OAQ1 3NH9A 3PENA 2FFBA 3RRNA 4MGYR 2WJVA 3GD7A 4LJ8A 4V0LA 1QVRA 1U94A 5FOWA 2QORA 2IYZA 3FVQA 4GBMA 5J4KA 2VF7A 4NE2A 2GXQA 5FOVA 4BFYA 1CR2A 4X8LA 2AN9A 1I4TD 4HB4A 1RYFA 3PUXA 1P5ZB 2ZXUA 1KO8A 1U81A 2OXRA 2RGNA 4QHTA 1ZMXA 2UKDA 4RZ3A 1COWD 4TYWA 3QPUA 5J4YA 4O3MA 5HPYB 3RWMB 1DAEA 2VTKA 3C41J 2PJZA 1SVKA 1CEEA 5G3YA 3CRRA 4EJSA 2IXGA 4KV9A 1AQUA 2MSEB 5G53C 3LNCA 3TK1A 2RGCA 1DG3A 3MSXA 2ZPTX 2WWIA 1JI0A 1NVUQ 2AHOA 3RDPA 5AUPB 2A5FA 4NTZA 1F2TA 2AX4A 1NBME 3VKWA 3CRMA 5BYJA 4U5XA 2ODEA 3TVTA 4D4MA 1UDXA 2JGNA 4DSTA 4MRPA 1GIAA 4MDFA 3PEVA 3FMPB 2FDCA 4AKHA 1ZAKA 2NMVA 2JJ2A 3KB1A 4IEEA 4KCGA 1U0LA 4G1UC 4N3NA 3U3JA 4KODA 4GP7A 4UXHA 4W5HA 4TN1A 3RRMA 2GEDA 2QAGB 2Z4RA 1Z2CA 3MAAC 1C9KA 1E1RD 3PUWA 2R65A 2GNOA 4OJQA 4OI2A 4V0NA 1T9HA 2CJWB 1OXSC 1QHGA 1U8YA 3R8CA 5L3QB 4DT1A 4TL7A 4PHGA 4BQSA 4LJ9A 1EFCA 1II0A 3NBXX 4ITRC 4OK5A 3VQTA 3KJHA 3ZQ6A 3T5GA 2B21A 3WP0A 4A36A 4NCKA 3DZ8A 3GLGE 2A7QA 2CE7A 1H65A 4EFMA 2FJUA 1VG0B 4GDFA 2A9KA 5CK4A 2DB3A 3CPHA 1W49A 4HSEA 1U2RA 1PLJA 221PA 3LW8A 4C2TA 4URYR 4B44A 4GZMA 2FSGA 2WAXA 3Q5DA 2DFTA 4II7A 4DDWA 1LVGA 1XP8A 4M1MA 4OQMA 4A1FA 3MD0A 1XXHA 2P65A 5G40A 1HA3A 1CJTC 1N0VC 4Q4AA 1MRNA 2OE2A 2XB2A 1VYVA 3O8DA 4OQXA 1IONA 3ADBA 1KAOA 3AH8A 1GM5A 4DB4A 4HEJA 3ZYCA 2IF2A 3PUYA 2IYQA 3ASZA 1SVWA 4LBZA 3WHKA 3GEHA 2DFKB 4ON9A 1X86B 2QM8A 1DELA 4HUTA 5GJWC 3BK7A 2H5EA 421PA 4DLYA 2WPDA 2GKSA 3KKPA 1D2MA 1M74A 1W0JA 3F3YA 2XEXA 5JCPA 2GRJA 4OJKA 2RGEA 2FGKA 3TJZA 4ZDWA 1HT1E 5BXQC 4NYIQ 1KZGB 1G9XA 1FUUA 1XEFA 3HPQA 4IVPA 4IKEA 2V7QD 3IIKA 4MRRA 1MO4A 3QBVA 4CYMA 1LFDB 1TQDA 2YINC 3ZZUA 1VIAA 1KHTA 3V4RA 4RZXA 4AYTA 2QMEA 5FBRB 2JATA 1KKLA 1A2KC 3NH6A 4HUQA 2IWHA 1N6RA 1RYHA 3KXKA 3QIAA 4I1SA 1KK3A 1R6BX 4Q7JB 1R8QA 1UDWA 1G18A 2B8WA 4NCNA 5EUQB 1KO1A 4JVMA 2GJAA 4QC2A 3T5DA 3GLIB 1JR6A 4LHWA 5A5GA 3KQUA 1YVDA 3NEYA 5B30A 2ZE7A 3T15A 1W4AA 5FOTA 4BLPA 4L9WA 4Q01A 3P4XA 3G5UA 1S3GA 2CL6X 4QNRA 4U7DA 2ORIA 4JT4A 5CJPA 4I1VA 2Q9BA 2PJRA 3K9NA 1ZC4A 3K0EA 2TMKA 3SE0A 4G0NA 3A4NA 4EPYA 2A5GA 4HLUA 4BWYA 1FOEB 3TSOA 1Y3AA 1N0WA 5KSYA 1HE8B 2XJ9A 3QEJA 4N1AA 3OEHD 1A2BA 1OXVA 2N46A 1P2VA 2OCPA 4B75A 1S9DA 1G291 1D9ZA 1S2MA 2IL1A 4FMCF 1TQ6A 2JJ1D 4M1KA 3VFDA 1W36B 2OO7A 3MUFA 2F3RA 3ADCA 3U3MA 1Z0FA 2BBOA 3EIQA 4LBYA 1AN0A 1KI2A 4V0ME 2QT0A 1D2EA 2W00A 5FTLA 2OCBA 2IYRA 2H57A 2HJVA 1XD2A 4TT3A 4ABYA 3BFVA 4M1SA 4X8OA 1WCV1 2C5LA 5E95A 1G8HA 2RGDA 1X8JA 2I1VB 2FNAA 3WRXC 4GRAA 3OAAD 5JHGB 3JVVA 3SFVA 4EUNA 3J81k 1E4VA 3D8BA 4OHVA 4QGAA 4NONA 4US1R 3X2SA 2KI5A 1AKYA 1ONBA 2C03A 3PUVA 2O8EB 3VR3A 1Q20A 3QF7A 1R0YA 4XVRA 2W2VA 1YR9A 1P61B 1Q1EA 4O2RA 2WIBA 1Z8FA 4TYPA 4AD8A 1N5KA 1PUIA 3HYRA 4JYBA 1W36D 5SZHB 2UZ3A 2KBEA 2OLKA 3IBYA 2NO6A 3P20A 4TYYA 2PCLA 5F3WB 1E2FA 2C9CA 2W0SA 4BRUA 1TTTA 4WW0A 3B5JA 3EC2A 2O8CB 2C9YA 4IDHA 3RS0A 1T3SA 4MKIA 1NSFA 3NBFA 3DVLA 3ND9A 2ZJ8A 2DWOA 4R9UC 5LB4A 5FH9A 1OH7A 3K0AB 4YDHB 5AJWA 4LK2A 4PSKA 4DSOA 2ZM5A 2AWOA 4FXPA 1RRCA 3NC0C 3JZMA 3WNBA 1AA9A 4EJSB 2FGJA 3C4JA 5JJLA 3SQWA 1OIWA 4JT2A 4Z51A 1LB1B 1TUIA 3ZIAA 1LW7A 2FH5B 4M9XA 3R9XA 4AI6A 5K8LA 3QSYA 2ZQ5A 2XNDA 3I5YA 4LX0A 4HDCA 2PZEA 1S1CA 2OZEA 3KFVA 2IUTA 4ZO4A 1F5NA 4A8JA 3CWZA 4TQ9A 2A3RA 5KOYA 4Q9IA 2X2FA 2DFNA 3QF4A 3EA5A 4O0MA 2G3YA 4Q18A 3L82B 3HU3A 4B2PA 4TZ0A 4Q4HA 3GJ7A 3RS3A 1HQYE 3PFIA 2IBMA 2H1LA 2Z5FA 1G17A 1GILA 3B1ZA 2IYTA 4QKQA 6Q21A 1KJZA 4DXAA 4CIDA 2G6BA 4UQOA 2J0QA 4G5GA 2OHFA 1IN4A 3C7KA 2DPXA 3CR8A 1JB1A 4M1OA 2JLUA 2JLRA 4OK3A 1TL7C 5FTNA 5FTMA 3A1SA 1T4GA 3WMGA 1KSJA 2W0MA 1G7CA 2VRWA 1KAGA 3FB4A 1LS1A 2PMDA 5FPTA 2KJQA 2WVJA 4DIEA 3THOA 3LXRA 4JLKA 4XJXA 3VHXA 1IXZA 3GJ0A 4BLOA 4F7WA 1E9AA 2ZJ5A 4DEXA 5CB6A 4F92B 2OFWA 1AS2A 3C16C 2XXAA 4PZLA 1VMAA 1XX6A 1Z0DA 4PC3A 4B43A 5JRJA 3CX8A 5ANRB 3NXSA 2ZREA 1GITA 2P6RA 2HDNB 1UAAA 5AUOB 3TH5A 2X19A 1IAQA 2V1XA 2ZE5A 2W83A 3RSOA 2FF7A 4B33A 3KUCA 4QBFA 2WICA 5F98A 5EXXA 3VX4A 1N6OA 3HPRA 1MOZA 3C15C 2VHUA 1KJWA 2JLWA 1AJEA 4LY6A 4XH9B 2GJ9A 2XX3A 3CZQA 2CNWD 3EPJA 4NCIA 3FDIA 5HE8A 2J0UB 3UWOA 3R7WB 3B9QA 5LBIA 1F48A 5JSZA 4LGMA 1WP9A 4KITB 1Z6AA 3H0KA 3GPLA 2GBLA 3NG1A 4N0EA 3AVXA 1HY3A 2V8OA 4PQYA 3WP1B 1P60A 4ZV4A 4XOIA 3T12A 3QXCA 4D0LB 1FTSA 4Q1BA 1ZM3A 1SVOA 1NLZA 1Q1ZA 1T91A 2W6ID 1OIVA 4Z54A 2HCBA 3N2IA 5JCZA 1UKZA 2VEDA 1G8FA 4NDZA 4PSVA 1IOZA 4DRZA 4KFRA 4IOJA 1E69A 5FBLB 1E9SA 1G3QA 4QM7A 1KTVA 1NRJB 3AVTA 1TQ4A 3OHMA 1JR3E 3SJCA 5CDFA 1MKYA 2EU8A 1UM8A 3GLHB 2WKQA 1NMZA 3LX5A 4PPQA 2F6RA 4C0SA 2PLFA 4EJSC 4Q9KA 3GFPA 4OL0A 1D5CA 4LRWA 3CNOA 1P9NA 4WBSA 4B3FX 3IHLA 4PPFA 5L3SB 3U2QA 5JLJA 5EP3A 1QRAA 3EZ7A 5EP1A 3ZZTA 4ASUA 1Z06A 2F1IA 1QG4A 2ZYWX 4JSYA 5D3MA 1TF5A 1FL9A 1HT2E 1M8PA 3X1WA 4YMTA 1XDBA 3NHAA 5SZKB 1BMFD 3L8YA 4MRVA 1E9CA 4KBFA 4TL8A 1WRBA 3CRW1 4NHOA 3AM1A 4FMCB 4RFVA 4MKFA 2F1JA 3GJ3A 3PJRA 5J4HA 2IS2A 1YR8A 2QE7D 1FX0A 2H92A 2FOLA 2VPPA 1ZP6A 3IEUA 3REFA 4B6FA 4DSUA 4HB3A 2JDID 1G3MA 4HAZA 1LNZA 4BLQA 1KSHA 4KBGA 3AF0A 4QXAA 1TADA 1U99A 3KKQA 5FBWB 1OB2A 3VU9A 2DHRA 3SHWA 1FP7A 1I4LD 3LLUA 2V9PA 3W3AA 3K70D 1Q57A 5FBVB 1KMQA 5EZ6B 4B34A 3X1DA 1OH8A 3WXMA 1ZIOA 3RLFA 3K1JA 3F8TA 3CNNA 5KUTA 1HURA 4FI3C 4HLDA 3W8NA 1QDEA 2OBMA 4KJZA 2P5TB 5JFGA 3T1VA 1DVRA 4CW7A 1DS6A 1KO7A 5BN5A 3GLHE 2Z83A 2AK3A 3BB3A 3BIFA 4EPXA 1W2HA 5EE1A 1KMHA 3K0SA 4TTRA 1E2LA 4FW9A 2WWXA 1EGAA 2ZJ2A 3IUYA 2QTVB 1SKQA 5GJBA 1E2KA 4CEHA 4WZBE 4IDNA 3LH5A 5DYIA 1VCOA 3ZS8A 2RGAA 1JNYA 3BH6A 2MSCB 4IDPA 4RKEA 4JL5A 4CVNA 5AK0A 3ASYA 2YKGA 4LV6A 4CDGA 1P75A 2NQ2C 4YMWA 5LB2A 2CL7X 1SXJE 4KLNA 4LYHA 1J90A 1G1MA 4Q1CA 2PT5A 3AVWA 2HYDA 4A6XA 2ZIAA 4BLSA 3PQCA 1GL7A 1E9FA 1KI6B 2F7SA 2OV2A 1J2JA 4RFSA 5EP4A 4DDTA 1AKEA 4H1VA 4E5UA 2QMHA 4DLSA 1AS3A 1NF3A 4DT1B 4C30A 3A8TA 4L16A 3AKEA 3NHBA 1E9DA 1DPFA 2RHDA 2RH5A 3SNHA 5JI3E 2NTYC 1Z63A 2O8BA 3IBGA 1UKYA 4PO9A 5F9HA 3Q8XB 3O8RA 4B3CA 2J7KA 2C2HA 4AKGA 2JJ2D 2CL0X 1N5LA 2WMOB 4A0FA 3BS4A 2VLIA 2R44A 1DOAA 2D7CA 2WOOA 1ZJ6A 2PX3A 4AYXA 3KQLA 3P1JA 4PPGA 1UBCA 1E9EA 2VHTA 1M6NA 3AKCA 5JI2E 3RC8A 3UIEA 5FR1A 1SQ5A 4DLRA 4KYUA 1B23P 2NO7A 4PR0A 2H16A 1NP6A 3LBNA 5JEDA 4Q4AB 3EW9A 3DM9B 2N1BA 3B60A 4KLZA 1Z6TA 2XGJA 1XTIA 4MRNA 3BFKA 2GETA 2ANCA 2FFHA 4PC2A 4Y0VA 4AYWA 1VG1A 1X1RA 3W34A 3EPLA 3AQ4A 2WJHA 1II8A 1NVWQ 1KI8A 1G7TA 1XTSA 1UEIA 2X1VA 1GAJA 4LBVA 4MGIR 4Q47A 4RVCA 5GVRA 4B3BA 1DAFA 2BDTA 3FPAA 2WIAA 2R2AA 1M1YE 2ZU6A 4AC9A 2AR7A 2NO0A 4Q4LA 4S2EA 8OHMA 5JS8A 1XD8A 4IXMA 1P2TA 4EPWA 2PBRA 2JIZA 2EFEB 721PA 2E1RA 1SXJC 5EQTA 3LW7A 5DI3B 3QKTA 1J8MF 1SHKA 1Z28A 5L3RA 4JKYA 4IW3B 1P72A 1ZM9A 2SHKA 4MRSA 1YR6A 4EQ6B 1VYUA 2ZJYA 4PC7A 3A58B 4PXAA 3RABA 4HUQB 1NIPA 2WPDD 5DHFA 1OH6A 1E2GA 4NH0A 2J9RA 3TBKA 4QG7A 4P33A 4I1OA 4C3ZA 4ZI3A 4WXRA 3SJAA 4Q7KA 3VHLB 4X8MA 3ZLJA 1HYQA 3K09A 3ZQJA 5KU1A 1DAMA 3VR5A 1Q3TA 4NP6A 1YZTA 4CF7A 1MO5A 1GP2A 1N5JA 1BO6A 4K8OA 4XWKA 4DLZA 3AP3A 3SBEA 1US8A 1ZYUA 2Q9AA 2XB4A 1GWNA 1W0KA 3ZD6A 3TUJC 2OUKA 1OLOA 3U6BA 4JJZA 4L15A 5J5CA 2N42A 2W58A 1AZTA 2V6IA 2CE2X 2ECKA 5HTKA 3CF0A 4C0AC 1XCGB 4QRHA 5M04A 1NY6A 4BZPA 3K0CA 1EX6A 4TLBA 4C9BA 5L8VA 4TLDA 4D26A 3KQNA 1XD2B 5JS7A 3RWOA 1EFTA 3N2EA 4TQAA 5DE3A 4B74A 2G83A 5H1YA 2F3TA 5FPKA 3I4LA 1PUJA 3AP1A 4YONB 1YHNA 2R6AA 2W6JA 4PQFA 3U44A 4PC6A 3NBZC 3U4QB 3IEVA 3THYA 3W6OA 4JBXA 1X1SA 2OESA 2BMEA 3PEUA 3K0FA 3MCAA 2VP0A 1OH5A 1Z6YA 2VH5R 4TMWA 3FKSD 3QG1A 2HF8A 2G1KA 5IDVA 2C99A 1V43A 2GESA 2NIPA 3B82A 2VO1A 4AKEA 4G5SA 2GEVA 4LOAA 4TT3D 4Q9HA 1RKBA 2I3BA 3AF4A 1R2QA 4O25A 3PXGA 3WNCA 3H84A 2W2TA 5IK2A 1KIMA 1N25A 4Q48A 1JALA 1WXQA 2NOAA 5KHOC 3AKYA 2BM1A 1OXTA 3B2EA 3BWDD 4YQFA 1JPJA 1ZM4A 2V4ZA 4GI7A 4F4CA 2F43A 4BPBA 4M9SA 1M2OB 3JZAA 3FTQA 4PAQA 2CVFA 4KO8A 1JAHA 3X1YA 2FZLA 1ETUA 4FIDA 2IS6A 2VP4A 4LYAA 1KKMA 2FPLA 3CW2A 2AFIE 2BCJQ 4A8JB 3K53A 1FUKA 4FWTA 1RRGA 1GVNB 1WE2A 3M6AA 1JJVA 5FTJA 4EFLA 2JEOA 2BC9A 1IY0A 4QBIA 1UKVY 4ZI2A 2GEUA 1LF0A 5EXTA 3AUXA 621PA 1DEKA 121PA 5DI9A 1KI3A 4IFEA 4DCTA 1F3OA 4Q4HB 1TQ2A 4JLAA 2EFHB 1N2CE 2ZVPX 2RB4A 1U8AA 3RS7A 2YWFA 1Q44A 2CVHA 2FE4A 3ZIAD 2AL7A 4I81A 5E7JA 3QE0A 2HUPA 5A4JA 2BJWA 4PANA 4UJ5A 4ZDJA 1XCMA 2XNDD 2ZUBA 3FWYA 3IDQA 3BGWA 3GLFA 3GJ5A 5CIQA 3OIYA 2VYFA 2QT1A 2IEYA 3UK6A 4JVSB 2IXFA 4BFUA 4OHWA 4HZUA 1KI1A 3QKSA 3KL4A 2ZJBA 1CR4A 2RKOA 5BWMA 3GJXC 1W48A 5C46F 3NWJA 3IHWA 3LDAA 3Q85A 2ZETA 4JL8A 1XD9A 2ODNA 2XXAB 2V55B 1PZNA 2WJJA 4D2IA 2V54A 1KJYA 1G6OA 1RW4A 3CH4B 2GVDC 3I5XA 2VP9A 5FFMA 5H68A 2EVWX 3CPEA 2A5JA 3V4FA 2QSYA 2IX3A 2MMGA 4M22A 4ZCMA 4UNNA 3U3OA 2QL6A 2IF0A 3NC1C 4YLGA 4ZKEA 3Q72A 4XWOA 4BLTA 1FNNA 2BEJA 1U0JA 1GL9B 3O8CA 1FZQA 5BN3A 3PV0A 3PVSA 3U7HB 3LFUA 1MO6A 4MYUA 4LV8B 1FP6A 4FMDF 2OM2A 3QBTA 4JLDA 1KDPA 1YZNA 2QENA 4CRWB 5CITA 2ZRNA 2PEYA 3FFBA 5FUWA 3I1FA 2JLQA 1GKYA 1XMIA 4Q1AA 2REOA 3UG6A 3I61A 4P0TA 4LDJA 1GL6A 2IYXA 4UNPA 3H4MA 2NGRA 4JKIA 3MFYA 3CF2A 4GOXA 1LY1A 5JSZB 4D4JA 3Q9LA 4A0GA 2RAPA 3KUDA 3I8SA 1O3YA 3SYKA 1NMYA 4QFMA 5EXPA 2BBSA 2J45A 1JBKA 2WMNB 2ZJZA 2NPIA 4POAA 3CH5A 4LUCA 4W7SA 1VG8A 3B9PA 2O0HA 4LJ7A 3IGFA 2BV3A 4D80A 2ZRCA 5JWHA 3TSWA 4NCJA 3TAUA 2ZI6A 4RD4A 2OT3B 2P0EA 4IHQA 5AJXA 1MT0A 4R7ZA 2P67A 4BFSA 2G88A 4MYHA 3P27A 4C0LA 2GXAA 4DB2A 1K5GA 4A2WA 4LHZA 4F91B 2ZRAA 3ND8A 3AVUA 2IT1A 4BASA 4BZXA 3T35A 5CYPA 3B1VA 2WJIA 4RCZA 4OQFA 4P4SA 3FKSA 1ZRHA 4F38A 2RGBA 1JECA 1RRPA 3QKRA 1XPRA 1F2UA 4QL3A 2YVUA 1NBMA 2EWVA 2XSZA 1HTWA 2XOKA 5D3QA 2QGZA 2FV8A 1YRAA 3FE2A 5KO2A 1XMSA 4KU4A 2QAGC 2J0VA 1E0JA 1OFIA 1EXMA 3QXXA 4JBYA 2YC2C 5DLQC 4A0RA 1G16A 4HI0E 5B64A 5KDOA 2IS4A 1EFUA 1QHXA 1SVMA 5TV2A 4C0HA 2J1LA 3CX6A 2EWWA 2EQBA 3CB4A 4KSCA 3ICQB 1TNDA 4DLVA 1H8HD 4YDSA 3VR6A 3TR5A 1T3HA 3GLIE 1FX0B 1RRFA 3OZXA 5TXGA 1QG2A 2ZRBA 3U7FB 2CBZA 1U9IC 1ODFA 4CZ2A 4B32A 2O8FA 3LRPA 1ZCAA 3OE7A 4LYJA 4UNQA 3VU9B 3GLGA 3A1WA 2IYLD 1XNJA 2QM7A 4ASUD 3SI7A 1UPTA 2X77A 4BFXA 1DARA 1H8EA 2OEPA 1IJFA 1G3RA 1S9HA 3A4LA 3UPUA 1BKDR 1TAGA 2F9LA 3QNUA 4RZ2A 1NNEA 2IK8A 4LJ5A 4GT1A 2BIFA 3PITA 4QJ5A 4QJ4A 4E22A 4N0DA 1PJRA 1M7GA 1W2GA 2OCYC 3BERA 1OKKA 4DJTA 1G3IA 2DFLA 4ESHA 2GCOA 2Q21A 1LTQA 1T0HB 1XZPA 5EE5B 3GJ4A 3N5CA 3TAHA 1GG2A 3FKQA 3UMRA 5BYKA 5C2JB 1OPXA 2ERYA 1I2DA 2H7VA 1NG9A 4CEHB 2R6CA 1HQCA 2F1HA 3UANA 1OFHA 4RKFA 3GJ8A 1D2NA 4RSGA 3R8FA 1FMJA 4QGGA 3MWYW 1TU4A 2B7CA 1F6BA 2WJYA 1OE0A 2LWIA 1KOFA 4LPSA 4I4LA 4ZPXA 3O8BA 1TPZA 4TMTA 3IPXA 4RFSB 1HEIA 3QVUA 3H1TA 5L3QA 4HDOB 2WSSA 2GZAA 3QY0A 3CR7A 1XPUA 1IN8A 2O5VA 4QOSA 5FPHA 2XAUA 4DLWA 4LJAA 2O8BB 4NPHA 4A82A 4NZYA 4TLCA 2ODBA 3EIEA 4V03A 3T06B 3EZFA 2BBWA 3SOPA 4AG6A 3TSZA 1OHHD 1D8TA 1W1WA 2RMKA 3DDCA 2GZHA 3IILA 1RIFA 4X8HA 3ZZ0A 4DWJA 2XZOA 5GJVC 3RS4A 2YJTD 1IM2A 1QVAA 2IYWA 2I1QA 2GAOA 3AF3A 2QPOA 3VX3A 1S96A 2AFHE 2ZYVX 4M53A 1EFRA 1YZQA 2BWJA 4M9QA 2F1RA 4LZZA 4R71A 1UADA 3QVVA 3BH7A 4G5RA 2D4HA 3EWAA 5P21A 4D82A 3SU8A 3P32A 4QGHA 2HXSA 521PA 2A2ZA 1W36C 2WAYA 4PHFA 3U7GA 4KSBA 1Q1BA 4PC1A 2FFQA 1VG9B 1ESNA 3P26A 3ZJYA 1II8B 1FW6A 4W5WA 5C18A 1XJQA 3X1XA 1UEJA 4A9AA 4IVRA 2NZJA 1IBRA 1UBGA 1N0UA 3PUZA 2OFOA 4ZCLA 4DVGA 3CUEF 821PA 5B2ZA 2HCJB 2OBLA 4C2UA 2VIIA 1E2HA 3GMTA 3RYTC 4HAXA 3TE6A 1DBSA 4UNRA 1E79A 4F4JA 4IDQA 1IJEA 1CULC 4TMVA 2FN4A 3DEFA 3QOFA 1W46A 3HR8A 3LV8A 1Q21A 3BD9A 4KVAA 3NVAA 4MUBA 1YKSA
chains in the Genus database with same CATH superfamily
3NM4A 2QK4A 3F4BA 4K2HA 2IPMA 4NOJA 1E1YA 1CG6A 4OBEA 2R84A 4PQRA 1R50A 3K73O 4INAA 1TC2A 2QLLA 1AUVA 4FGWA 4WL0A 4DIOA 3E15A 1X7ZA 3RGWS 5C7IO 1W6UA 2Z09A 1NN3A 3NCHA 3PHGA 3WADA 2ODWA 2QRGA 1QK4A 4EZBA 3RRFA 4EVSA 1GYPA 1K06A 5HRUA 4IZIA 3WAKA 4W5JA 5EOVA 4E7PA 2J59A 4JSTA 4BKPA 3DBHA 1EFDN 1YBMA 3EEOA 1KC3A 3LLVA 1OREA 4NYJR 5HIJA 6AT1A 4CMGA 1LRJA 5KVQA 2PX0A 3LECA 1BC5A 2VHQA 3U17A 5LJLA 3RRZA 1YS4A 3DJFA 3ES9A 3ABIA 1I6KA 2ZIXB 4JLBA 3T9CA 3KR1A 3P9KA 3WLOA 3R9KA 5TT1A 2AG8A 4ZAFA 1CUIA 1RQGA 3BRWD 1W4BA 2XVXA 3DAYA 1BWRA 1M6HA 1XT6A 3KRTA 3P9XA 4X6LA 2CK3A 4XGRA 3T5CA 4CLXA 1KJQA 3AM5A 5JRZA 4H2DA 5CGQB 1US8B 4ZO8A 3RRBA 3QENA 1FRZA 1XA3A 1XXLA 5I45A 1Y80A 4AX8A 3EVGA 3QXGA 4J1SA 1VGVA 1QGAA 1NKTA 1D1QA 4MIEA 3O8OA 5DU2A 1BCRA 5CLQA 4C1NA 1OFUA 3M4NA 3OBIA 2R6HA 3PIIA 4GX1A 3RTBA 1ZSYA 1U3WA 2Y93A 3BXGA 3D8HA 1AZLA 5CGZA 2DOKA 3QUCA 1QIMA 1ZI6A 1L6IA 3AUUA 3M1AA 4L7QA 3W1EA 4CHTA 2JLXA 3LC0A 2WSBA 1W94A 3LBHA 1X2BA 5KREA 1JAZA 1EZZA 1RM5A 2M6LA 3R41A 3DO5A 1U1FA 2JBAB 5F35A 1P4HA 3OLXA 4N5NA 4NX2A 2C0QA 4ZTBA 3VR5D 4E33A 3EPKA 2LNDA 4JFAA 2OK7A 4P5DA 2GM4A 4F2PA 4EKYA 1EFHA 4LXTA 1E7YA 1JLKA 3PC6A 2AEMA 4BBPA 2O59A 4F9TA 1HDRA 3PD1A 3WYGA 3E5HA 4G5QA 5EEHA 5BSVA 1O9GA 4LHXA 3F8SA 2AR0A 1ZMRA 3UOWA 3VDRA 1FX1A 4QU8A 1DKRA 5DX1A 4LA4A 4YASA 3H3JA 1GGMA 4I50A 4LTMA 3DL0A 2PMKA 3QA3E 5AVZA 2R11A 2EC5A 1DCKA 2FR8C 1U5BB 2WV9A 3I01M 2X9GA 2ZRJA 4F45A 2WF6A 2G77B 3UAYA 5C5IA 2ZRHA 1AO0A 2VDPB 1UP4A 4J0DA 3TGPA 1YJ5A 4PVDA 4JLNA 1OZGA 5G4LA 2QTBA 4YRPA 2JS7A 1Y34E 4M0MA 4TTVA 2X40A 3U4DA 1NBEA 4F6CA 2Y2UA 4QOJA 5ESRA 3ECAA 3DVQX 3K94A 4NNJA 1MO3A 4MO2A 1V11B 1A0OA 4AY4A 1QCCA 1NWHA 1CS4C 4O4LB 1K6EA 2DKOA 2C9OA 5AVJA 1V41E 3ZWMA 3JPWA 2NNLD 3K15A 1W1IA 2EL9A 3AHCA 1LV7A 2VRNA 2BFOA 2IYEA 2BI8A 1QHIA 3AINA 3D4LA 3OJWA 2BLLA 4XWGA 4Z0TA 1Y4DE 4WKCA 3AI3A 3JQ9A 4EVIA 2OCXA 1MH1A 1QS0A 4W8GA 4QM6A 2Q0SA 3PTZA 2C2KA 2F8SA 1Z0SA 1U28A 1ZWKA 2FEOA 3Q3JB 3SYNA 5KVVA 3T7DA 2B2NA 2XZPA 3GFOA 1FXWA 2ATEA 1E4EB 1E6KA 2QP9X 3EH2A 3KQSA 1J4AA 4US0R 3UN1A 5IK2D 4LFBB 2W8ZA 2AE1A 3MIIA 5CMLA 1T6NA 1LI4A 5GQSA 2ZITA 3FHCB 2AJDA 1FDOA 1R6UA 4QHSA 5K4GA 3SIWA 1IU9A 1T3LA 4ND6A 1TJPB 3PWKA 4J1TA 4W9MC 3PB3A 1NQXA 1WB5A 2IXEA 5KYUB 2QTLA 3G5LA 4BWVA 3DR3A 3ZVMA 2FEXA 4CKCB 2I6TA 1EUZA 1JE1A 3ZTTA 5LQKA 2J41A 3IUPA 1A04A 1DAOA 1G41A 2OPBA 4NZMA 3TRFA 4K81B 1FFHA 5LOVA 3IPYA 4QEZA 5K3BA 3RS5A 3KB6A 4C4OA 3GLFB 3DEAA 1AGYA 5EXDA 4PV7A 1NURA 5TMDA 3RSGA 1Z6GA 1XXHB 1DQZA 3R6LA 5CBKA 2L0XA 1Q7EA 5JMTA 2PX5A 3AEXA 3NHZA 2NO5A 4UTPA 4M54A 4L5AA 3SN6A 1EESA 4FFOA 4V24A 1TF7A 4GSKA 3IOMA 3ABQB 4BZQA 1VDZA 3FPFA 2OCGA 2M1XA 2P2YA 1BMQA 3MYRA 4UZEA 4XWTA 4JI5B 3JW8A 1WUKS 2P6UA 5HMLA 4IILA 4Z8YA 3M82A 2M6KA 3GY0A 2A1TR 4B1FA 5CNJA 1O6FA 3ADKA 4KXWA 2FP3A 3R9WA 3KJIA 3LDGA 2O5EA 4JJ8A 3UTDA 3BQNB 1R4NB 3S2GA 4IUCS 1Z2OX 1R5OA 3KEGA 4KRYA 3R4CA 4PCUA 2PGNA 4ZV9A 2JJ8A 5ILOA 3M1IA 1P6UA 5LUBA 3WSWA 3TIGA 4E2XA 4MKGA 3K70C 2IW3A 4G0VA 3BD7A 4F9GA 1KZ6A 2UVQA 3O8CA 4FN5A 4RY0A 4P36A 3JYLA 4D9FA 2CDRA 1QIFA 1XZHA 1YJ8A 3T1OA 1PEDA 5BN3B 3VAZA 2ENUA 3GX1A 4DCJA 2D2IA 1EVQA 2G5PA 3PNQA 1N57A 1NMXA 1TXGA 1YHZA 2FZ5A 1Z2NX 1PL8A 1Q7BA 4L4XA 1QU2A 2X5KO 1EDDA 1W88A 3NANA 5H02A 2ZT8A 4B7XA 3PQ4A 4QJ3A 3D7KA 4IQ4A 5LJIA 1RBMA 1F4PA 3MS4A 2O2SA 4FLMA 4MP8A 2ZZMA 4X1KA 2YQZA 4FXOA 3U4CA 1TW2A 1WQ3A 2QL9A 1CBUA 5I3CA 3GFQA 4E5VA 3UMSA 5AVYA 1MGPA 3QU2A 1RPNA 2CBXA 2MMCA 4PSCA 2P27A 4QL3A 1J33A 2VG8A 3X1ZA 3ZY2A 5F51A 3HBNA 4NBSA 1I3OA 3G1UA 3A3PA 5C9ZA 2VSXA 2OZLA 3IDZA 5KYNA 4Y1RB 1VC2A 1JG4A 1VPLA 1Y7TA 3P8ZA 1XXHE 2DSNA 4KE7A 4L1KA 2C54A 4TKVA 2B6HA 2RGNC 5C1BA 3PQ6A 4JXXA 4LJRA 4DM7A 4D8YA 3BQMB 2FZWA 1IQUA 2CYCA 3U6KA 4WEQA 2OCKA 1L7RA 2FAXA 4J0GA 3SMQA 4A16A 4WKNA 1ONPA 1PI3A 3HI4A 4O2AF 3SKVA 3C3EA 2SKEA 3D6AA 1CE8A 2COKA 3QUSA 1R4AA 3KLOA 1JGTA 3RKRA 2B92A 4X64B 4M0DA 3LG2A 1GNQA 1X9IA 3Q8LA 4Q1EA 2X4GA 4XYLA 3RFUA 2XE4A 4RK4A 1KBZA 1UBFA 1RJGA 2P68A 4HNGA 1E18A 1XJCA 5D6NA 1E6CA 1JU4A 4HJRA 5LZ4A 2VK1A 4Q03A 3N58A 2Q0HA 4ALIA 2VNAA 2WWWA 2XDAA 1XTQA 3PA6A 3NWEA 4ZEWA 4ID9A 5DM70 1JIKA 5EWJA 5HJEA 2WU1A 1N0IA 4AJ1A 4XDZA 4L08A 3FWHA 5LN1A 1GXSB 1FLNA 2C8JA 1F2UB 2OAP1 1KRWA 3C6YA 4X3CA 2QUHA 1OTXA 2Y66A 4ALLA 4JLMA 1AKVA 4EF5A 1YE3A 2JHPA 2FCRA 3V7WA 1TPYA 4FHFA 2CEAA 3P96A 1EE9A 1RXSA 2C7GA 2OFXA 2WP8J 1WKBA 1BQ4A 1SJ9A 3E9MA 3UJCA 2O3SA 2C8KA 1J7KA 5DMXA 4F8YA 2OG2A 1RI2A 3W4KA 4XXHA 2VK4A 5FFNA 5ARCA 4MQ4A 4LQ4A 1T3TA 3SXUB 4BB0A 2WSLA 1G2PA 5DZSA 5BN4A 4BMCA 4Y6GB 3BICA 1TAQA 1W4CA 3VA7A 3IBCA 4JUAA 3MC1A 4FYJA 4WZ6A 4RD3A 3VPXA 2GNAA 2BPOA 5CEEA 1T13A 3ROKA 3QFTA 5GJCA 1VXRA 3HY6A 3ZBQA 3VJLA 1E6EA 3PD0A 2NO4A 4AZVA 2BJVA 1XRNA 4ZFNA 3EDCA 1V3TA 1DDGA 2VQDA 3TW8B 1OB5A 3RCBA 4L8GA 1ML3A 1W25A 4FC7A 1BDHA 5EE0A 2CYAA 4UKDA 5IBPA 2GPAA 2IZ0A 4HEHA 4MWOA 5KAPA 2VBCA 3H2YA 4AMBA 2HCFA 2ZQYA 1WMAA 3BJIC 1H94A 2HJHA 1AGRA 3F6BX 4JVNA 5SICE 4XEHA 2HA2A 4W1PA 3NTQA 1Z07A 3MB5A 3OD1A 3SYRA 4MUYA 1UJBA 4R2IA 1GLGA 4CM3A 1UZMA 4DDKA 2AG0A 3B6EA 4YMSA 2GCOB 3G7SA 1UH5A 2JL1A 1JXAA 4KO4S 1PFQA 1U65A 1U2DA 1ZL2A 2R7KA 3HB9A 4N3BA 4LXHA 1RYZA 1YU9A 2A5DA 3OJEA 4O08A 2MT9A 4UVGA 1C0IA 3BG5A 5JJKA 2R8BA 1E3MA 1GRNA 4KQMA 1VKJA 4G5HA 3A10A 3LQRA 5KWIA 3AV3A 5DLEA 4A8PA 5JXJA 3RSCA 3QYAA 2XEDA 2CDCA 5AW8A 1QVWA 4L6AA 2ZTLA 3MWDB 4DDVA 1YQGA 1XLUA 4P35A 4ES6A 4DKXA 1OBCA 2R79A 1B0AA 1ORTA 1GPDG 3FCEA 4MPRA 1WSAA 2POQX 1M1YA 2GTPA 3FCUB 1A96A 1DC6A 4LISA 3OEEA 1HTBA 1NVAA 3KT8A 4UEOA 3WL6A 3C8UA 3WLNA 1BVRA 2CNLA 4QEDA 5KNBA 4TYQA 4AECA 3QJYA 3DE5X 4EUSA 2B8EA 5K3FA 4UMDA 3IIMA 1MJNA 1PV1A 1G7RA 1U2QA 3DSRA 4EKDA 3NHSA 4ZGGA 3T4EA 2E87A 3KALA 3L0DA 3WKAA 1SQ0A 1YC5A 4X20A 3X3HA 4AK9A 4EEKA 1SBTA 2RKWA 4IBOA 1NXPA 1JA0A 3Q7PA 4IIEA 2GCEA 4FEAA 2CJXA 4XQCA 5AXAA 3TRHA 2DQYA 1BRTA 1NI3A 3G7NA 3T41A 3ZWAA 2CCJA 2WFLB 4MR7A 3L0SA 3ZH9B 2QRMA 4WCDA 4A2PA 1NUPA 4AG5A 1CDEA 3FUWA 4RTMA 1VHTA 5GAJA 2VZ0A 3DZDA 1C29B 1O94C 2HX1A 2ZYAA 1DXHA 4Q1DA 3A9TA 3HU1A 1VKHA 1U8FO 1OV6A 3Q3VA 5JLAA 3SGLA 4LOKA 1FSZA 1E3LA 3M4XA 1VPTA 5AKZA 4DSZA 3O9ZA 1HI9A 2R751 4NBVA 1QR6A 4WWHA 3NAZA 2OV3A 3I2YX 3WJ7A 3U60B 4RCYA 5ALIA 4Q15A 3EPLA 1EX7A 1WDKA 1Z6PA 4HLUC 4OA8A 4XFKA 5T4BA 3STTA 1EWRA 2CXNA 2JCVA 4FQ5A 4D43A 3Q98A 3A1CA 4TM8A 1ONNA 4KRXA 3W05A 3EXEB 4CKEA 2JIQA 1CJVC 3DBOB 2I8LA 4ZVVA 4CIWA 1EE1A 1HETA 1P4JA 4MVJP 3CCCA 4XFDA 2HT1A 2ZZNA 3HB0A 3DH0A 3KTAA 4UMVA 1USUA 1YGPA 3OFKA 4D81A 1XTRA 2XE8A 2G5CA 4RD0A 2PLWA 4TS3A 2FPUA 1IFXA 1X1BA 3OI7A 1X7YB 5BNIA 1ELOA 3ZCPA 1YQTA 4YJ3B 3PNYA 1NPTO 1EBUA 3KAJA 4EPTA 1QQAA 3GRAA 4OJMX 4A6PA 3HDGA 3B8EA 4NYJQ 5LLSA 1YMUA 4OX9B 2Y71A 4LDRA 1XAGA 3C7CB 1WBBA 2B5OA 1YOBA 4LDQA 4NH4A 4DUYB 4FCVA 2AJ8A 1RVV1 4CCWA 4OHMA 4BX8A 2QNRA 3AYXB 1ZD5A 4B3GA 3WTCA 1BAPA 5DN6A 1XZQA 4RMJA 3Q88A 5DLYA 3ST7A 2P77A 3UHOA 3FUXA 1L7EA 2FEPA 3K20A 4NG5A 4L72A 4GMXA 1RZ3A 3ZCQA 4MUAA 2V7EA 3DFUA 3PG5A 1QQTA 5IJAA 2B4TO 3AR9A 2K6GA 3KXPA 4H3KB 3LY7A 4TWRA 3W90A 1X7WA 4K9PA 3J81A 9LDTA 2IU0A 4WD3A 4HDNB 3VI4B 4IOKA 1I2AA 1NQ5A 5J4LA 2HA7A 5AVQA 3TL2A 2P5YA 5AJZA 1TYDE 5LU9A 1C3OB 3HI6A 4J49A 1RPZA 2KBFA 3DFZA 4GLBA 5I9TA 1NJGA 3DAPA 2P2LA 3FMVA 2ZWIA 4CQMA 5BV0A 1FPQA 1JTFA 4DQ0A 2VYCA 1QTQA 3FYUA 1XEWX 1M75A 2HXYA 2XGMA 2NT4A 2Y3IA 1TK3A 2IW1A 4PS0A 4W7HA 5FJIA 3LZDA 2R6DA 3R7SA 2DPHA 2O2YA 2BP7A 3OM8A 3U9SA 4PHTA 4H1WA 3U7QA 2PZJA 3HZZA 4BFVA 4HGZA 3LT2A 5D7BA 2PGOA 2UYQA 1R6AA 4OUKX 1R6DA 5FWYA 3L6BA 1X0XA 3QXSA 3ZHQA 4J90A 1HLFA 1P7CA 3ZE2B 1N6PA 3ACCA 5DBHX 3LWNA 2XVMA 3FROA 1BS9A 1UZAA 3AHHA 3Q4GA 1COWA 1CJUC 1M54A 2VTBA 1XRQA 4A8JC 4LOLA 1QYIA 4F3RA 2H1HA 4BKMA 2JK0A 2QMQA 5C1DA 1USIA 1O97D 2GD6A 4GM0A 2FN8A 1MV8A 2BKEA 3ZXXA 4IRMA 3LP5A 2BRUA 1XIVA 2RHJA 3LPDA 3HGMA 3UJ6A 5JHHB 1H2FA 3OICA 4HDSB 3HBMA 1ACMA 1NLMA 4WIAA 1G5IA 2J5KA 4RVFA 1DAHA 3ILVA 2H54A 2WM8A 4TTIA 5DHRA 2DMRA 1OV4A 3ZWNA 2WWTA 2B82A 2Y27A 1E77A 1NT4A 3A70A 3EPPA 3VU1A 1UJNA 4BU1A 1V45E 2Q2QA 3DP9A 3G82C 1C9JA 1N2CA 1IPFA 1N8SA 3QBJA 3F5SA 1QGUB 3R3YA 1VPDA 3DBIA 3TXYA 2CK3D 3WL3A 5GOTA 3C6ZA 4RTSA 1EQ2A 4WGFA 3TCNA 4RJIA 5KJFA 1IXSB 1U1IA 1ZK0A 3FF4A 3N2NA 1SHZA 3DNMA 3QK7A 5TDHA 3RB8A 1FJHA 1M8KA 1JG2A 2AZDA 1N8KA 2GWRA 3KJZA 5IAJA 2RGRA 1WCYA 4URUR 2OXCA 1OI7A 2CNDA 3A14A 4L8FA 4EPXA 4O4HA 2B35A 1H4SA 1R0CA 3SVTA 3MCZA 5CDFE 1IN6A 5HJ7A 3WB0A 5ER9A 4YMUA 1E99A 4LJ6A 1G19A 1ZAYA 4FZRA 4YS6A 4UARA 2QRNA 2XCSB 2OORA 4JS0A 3K2BA 4IEFB 2BFCA 2V6JA 1OT3A 3H1AA 3M3HA 2YHIA 5KSOA 5G0VA 3RVJA 1TKBA 4KFTA 4YGXB 3CZ4A 1FQJA 3VDMA 1GN8A 2ZI3A 1VMDA 1BGXT 4LZAA 3DOJA 2NO1A 3DTYA 3FB1A 3FGNA 3ZI4A 4BVKA 2BZ0A 2MYNA 3GB9A 3SZGA 1G9TA 2BCEA 2DWCA 3NPAA 1XLTA 4ZGWA 4PTLA 5KWJA 4I36A 1K4YA 3OQ1A 4OLFA 3V7UA 3OJLA 1L3IA 4EHHA 4ETWA 4MWBA 1K8RA 4AO7A 4YCNA 1JILA 2QAGA 4H59A 4A8TA 2HMWA 3P2IA 5CK5A 1OJLA 3CNHA 3PHJA 1N6IA 3GCGA 4F4DA 4PGAA 1MW9X 4BBZA 4DHEA 5F33A 4A2QA 4V0RA 2CJWA 1I1NA 3V46A 3MJRA 3NRBA 4HAVA 3AXSA 3RK1A 4P08A 2GZSA 1B74A 4CF6A 4UDYX 2Z04A 2ZSFA 1X9HA 3N5KA 1J2YA 3T5PA 1NU6A 1F9AA 1H22A 4GKJB 2NZWA 5BWCA 2MYUA 5HQ3A 3EH1A 3JQCA 3QSGA 4J7XA 3VH3A 1U0HC 1XC7A 2EJWA 2I4IA 3O21A 2FZCA 2XQFA 2IEDA 3S44A 4DMGA 4ALJA 4M9CA 1DE0A 1BIFA 1GGKA 2ID4A 2PEZA 2X13A 4MKHA 3ZE7A 4TKZA 4LVOA 5CM9C 5FB3A 3NRCA 3IUSA 4LFCB 3TEJA 5DM1A 5HZHA 3PRYA 3GYGA 1KNXA 3DKVA 4QYMA 4DLTA 2ZRLA 1AVTA 3LUDA 3O8NA 4MHSA 3AV0B 3PQ2A 1W29A 1Z38A 1CTQA 1JDPA 2R6GA 2WT8A 2B8JA 2GM9A 2TECE 3CISA 3CLTD 1P1FA 3CUUA 3PGA1 4NFYA 4REOA 3R3WA 3TZCA 4MQBA 1EVKA 1GHTA 5TVKA 3T3EA 3SDSA 2OV1A 3URKA 3IOCA 1E1NA 1Z6XA 2VNSA 3MMNA 4E6EA 3PHBE 3DWFA 4XCQA 4Q3EA 4W9RA 4C3VA 2YFHA 3F6PA 4HN9A 2CLCX 1TMKA 2O2ZA 3EVNA 3BDIA 3GHHA 3WDKA 5F78A 2CFOA 3V9AA 4V0KA 3A0RB 1CFZA 4GECA 3UHPA 5CXQA 3I9FA 3HR7A 1MR3F 3KD2A 1W5EA 2Y9PB 2VR1A 3O4RA 1VRVA 2HPVA 4L3WA 4MGKR 2DR3A 4NZNA 2WRZA 4L2IB 5F1YA 3TDKA 3H2KA 1RCUA 2EERA 2PH7A 1N7JA 3D3EA 3TTXA 1WZUA 1UOPA 1CRQA 2HH9A 3GFTA 3HCFA 4ZICA 3GEBA 3SC3A 2IOYA 2UXCB 1EM8B 1ZXXA 2PPLA 4MWZA 4Q1FA 3L7JA 5FNVF 4MPJA 4BNKA 1SBHA 2PKQO 4B76A 1UIRA 1NM5C 3E2MA 5KOJA 4YJHB 2ZJOA 1OYYA 3KJQA 3VOSA 1FTWA 2REBA 1LBEA 2XT6A 3DKKA 4PSAA 5J2UF 4G36A 3OC6A 3OCCA 2WJPA 2XBMA 4JITA 3WNZA 1U9JA 2QY6A 4OKIA 4NEQA 1OWPA 3NKFA 1Z56C 4PO8A 3L46A 3DD5A 4EO4A 1U2PA 3GVPA 3QJ5A 3UWKA 4CEJB 4OQ4A 6REQA 1P8AA 3IB6A 4OREX 2C4MA 3RTCA 1IN7A 4HY3A 5I9LA 2OKGA 4IYJA 4F5YA 1M10A 4HYTA 4RTLA 3L04A 1RWNA 1WS6A 1ZU4A 2IZ7A 3G9ZA 3WYAA 5BVHA 1K5DA 3HC7A 3OEWA 3H5IA 3FNFA 4ZCQA 2GKOA 4YX9A 3TL6A 1R0RE 4HAYA 3ZCUA 3LL7A 1G7SA 4TXLA 1NXSA 3HUFA 5KDDA 3EW7A 1RSZA 4CM9A 1UK8A 4DMFA 5JBQA 3MK31 1R0SA 2C5SA 3I5UA 3GQBB 1WMSA 3OOEA 5ER6A 3T1YB 2NQTA 1FMFA 3B7GA 3VPGA 1J8DA 4OMUA 1GDHA 2JASA 1IY8A 3C70A 3C45A 3UQZA 3HU5A 3WQRA 4CT4B 2NNWB 4JUDX 5DHUA 3PL5A 4DCSA 4OAPA 2ZUFA 1Q22A 4U4AA 3IAM1 2DE0X 1ZINA 4Y18A 1JLLB 4ZZIA 1X1DA 5FBQB 5AUNB 4GP6A 1RXWA 2CLDX 2QYHA 4PAWA 4YNBA 1UR5A 3FNGA 1NLUA 2JAQA 2PRSA 2VJMA 1Z5ZA 3L1KA 4OM7A 5L4NA 3WGIA 2PYIA 3PBKA 5CFLA 3AEYA 5MDHA 3WGQA 3R3SA 4GSYA 1YAHA 1NKSA 1LLDA 4JJKA 4PG6A 5JRDS 5JZVA 4DS3A 4NKRA 1YRWA 3QI2A 5C52B 4UBNA 2O3RA 3AB7A 5F52A 2VUSA 3OY2A 1YOVB 3L6CA 3O82A 2GF9A 3DUFB 2KE5A 3OKPA 4UD6A 2PZ8A 5L95A 4R8VA 4EGAA 4UZSA 2O7RA 1ENOA 3KYIB 3A6PC 4MQLA 1MC4A 4XWAA 1QTRA 1H66A 1BROA 4HYQA 1UWCA 4X1OA 3WB9A 5B58C 3F67A 2FUG6 4EW1A 4X1IA 1E94E 2EGHA 1SXJB 2GLUA 1A9ZA 2WTNA 2CT8A 2HDWA 2HIMA 4UUPA 1EUCB 2IYFA 3MJHA 4F2HA 3R20A 5HHTA 3R5SA 2PLRA 3D54D 3K0FB 2ZRPA 4YC7A 2PE5A 2I71A 1SUAA 1QCYA 3PUIA 2VDWA 2A30A 5AUQA 2BHLA 3OPVA 1WA5A 2AS0A 2YXBA 5JEEA 1KERA 3L49A 4GMDA 1AHHA 2HRRA 4QRDA 1Q3KA 1TYBE 2KB0A 5C1IA 2FPPA 4C0KA 3WAJA 4KRFA 2QTFA 1SBZA 1HYGA 2C77A 4DABA 2RGWA 2VBFA 2IYYA 1QDLB 2W98A 5HDQA 3VR0A 1FJGB 2QP4A 1QJCA 1SEVA 2QAIA 3QEMA 3R0XA 4HPJB 1T1GA 3JD0A 1B6TA 3I32A 3KXIA 4OBWA 1AQLA 4XD7A 4YIKA 1KAHA 2HPHA 4RTJA 3MF4A 3D2BA 2LV8A 2OOSA 3ZLTA 5MFPA 1KZ1A 3M6XA 1P3JA 4R7GA 3C24A 3VOTA 1LPMA 1BU8A 3TGWA 3WKCA 1FU7A 4YMVA 4KPUB 3LUAA 5JZOA 3VKGA 2RCYA 1C9DB 3U7EB 1I8TA 3L43A 3BKXA 5I48A 3O4JA 2X7XA 3OZUA 4G4JA 3QGMA 3IURA 1N7IA 3OOWA 1YH3A 4KJXA 3P2KA 1ZONA 4CUJA 4IVQA 1JBEA 2J46A 1OX4A 4L5IA 3K9BA 1L3CA 1F60A 3UJBA 2QN6A 4RV9A 4A6DA 5LMNB 1O6BA 1TX4B 4OTZA 5FLEX 4MUKA 1CP2A 2EP8A 4TLMB 1WD7A 3GF4A 4C7JA 2I6FA 2MSDB 5SY6A 1ZNYA 2EZ8A 2GZRA 4NXNB 2AI1A 2GO7A 5F7ZA 3KQWA 5BT8A 5HNKA 2F9MA 1KQFA 1CJBA 1H6DA 3BJEA 5BQ5A 4YMHA 3O95A 4RY9A 3DMTA 2PRIA 3LUPA 1MN6A 3UWMA 2H4HA 3I72A 1PT6A 1P4AA 5LD2C 5FIUA 4LSMA 1HH4A 3G0HA 1E96A 4OHZA 4TN5A 3OQMA 2WE7A 4NMMA 2JFXA 2P6OA 2ERXA 2A5YB 2JA1A 4KQFA 1VIVA 3AR6A 1OX6A 5JZMA 3AKZA 2ZVQX 5UKDA 1B0UA 4CT5A 2J9YB 1CIPA 3ILYA 5JBIA 5AIAA 3C39A 4KR0A 3ZH2A 1QZXA 2C8VA 3C0KA 1EJ0A 4JJ6A 1WAMA 3HYSA 5E0KB 5HRCA 2JLYA 1L1FA 4GDMA 1Z2AA 1H2WA 3JYPA 1MABB 2PRZA 1CRPA 4ARZB 2BGKA 1N2ZA 3AETB 4MIYA 3RVLA 2D74A 1GTZA 1C50A 4IF4A 3WWYA 4AZ3A 1U3TA 1YA6A 4CM5A 3ECSA 2VDKB 3BMNA 2HEGA 3ELBA 1TVEA 4M2LA 4B7UA 4C6SA 1NYQA 2CNWA 1K63A 2O3UA 1U8XX 3BRCA 3E70C 1PG5A 3LC7O 5KHAA 1PZFA 5EIHA 3ZX4A 5FPYA 4YJ3F 1C1YA 3NIDB 3OEED 2P3SA 4R01A 3ZU3A 1RJ9B 1N9GA 3AR5A 2Y1XA 4YQYA 1S6YA 5KNBD 2P9HA 4JDUA 4O4JA 2QTWB 2C5FA 1IZ8A 1VHWA 3ECCA 4O4IB 3WYFA 4BDSA 5FOQA 3LUCA 4L5CA 1JN0A 3ROPA 1P7VA 1QH0A 4KQEA 2XUJA 3IXLA 1C4OA 2P6NA 3SJZA 5THKA 4E1VA 4QBGB 3SM9A 2W6IA 4IFIA 4MI3A 2Q1XA 4PAOA 5B58T 1V5EA 2JB9A 3L7BA 3T3DA 2RI6A 4KN6A 1XN1A 2H00A 1A71A 3BXXA 5AW2A 4J6EA 1RLJA 5FI3A 2Y0CA 1KDYA 1S0UA 2ZUWA 3DL2A 4QSMA 1Z6QA 2HQBA 3RADC 3M6MD 4HNUA 4QDTA 4BDTA 3NDJA 3RUHA 4S2UA 4C4AA 4PYJA 4UDXX 3B6ZA 3H87A 3DE7X 3EPHA 3VKUA 4B3RB 4X7PA 1PS8A 4FE3A 1OBHA 6CHYA 2QOEA 4JZKA 5KSWB 1C7FA 4Z0HO 5J3JA 1NV8A 4O59O 5TY0A 3CMCO 4GZ6A 4EHNA 3H1BA 5HIMA 4DA8A 2GJSA 4KN8A 3TUIC 4Y6LA 4DW8A 1VMKA 2D2FA 5K3CA 3DUWA 1Z8DA 3RD5A 1RWPA 2GRAA 5C5EA 4QNMA 1X70A 2ZI7A 1J0CA 3FPJA 4MYCA 1KZ7B 4Y6PA 2GFQA 4IDBA 4ZYXA 3CCBA 1PGPA 3UJPA 5AESA 5J43A 4L07A 1GCAA 2JI8A 5ALUA 1YF3A 1QHHB 2AXQA 5CA0B 4RK1A 1XVLA 3FRHA 3SBDA 2EFCB 3E3LA 1RNLA 1G3UA 2AD1A 2IHJA 3WLSA 2CMKA 1Q74A 4P3YA 2WIFA 4ZMSA 1VCIA 1M6YA 4D8VA 2XT0A 2IZZA 3OZSA 4ZIRB 2W8BA 3CZRA 2XQIA 3LUHA 2ZUDA 2RGXA 3F7OA 4R81A 2G0TA 1XTUA 4HN2A 1U0FA 4IHJF 2DT8A 2JDIA 3JSXA 4EAAA 4L8LA 3AL2A 3UJ3X 4BYGA 5BUSA 5G41A 1GNPA 3QMWA 3NEJA 5F73A 3ZYZA 5DN6D 5FWXA 2XF2A 2J5XA 4MV7A 3I62A 4RVGA 1TKRA 2GXSA 5WRFA 3RJTA 1ZWLA 2OAGA 4U7PB 4US2R 5HM8A 1IWPB 3W3ZB 4AJLA 3K96A 4PYLA 3HXLA 3MEQA 4LWZA 1A4RA 4YR9A 1C41A 1KI4A 5GMOA 4CGZA 2PCJA 1YR1A 1NUQA 5TARA 3NM6B 3PRKE 2O52A 4OOFA 2G1AA 2X3FA 2ZTSA 4EVRA 1SO8A 3DMYA 2VYNA 1ADJA 1E5XA 1O94D 1SUSA 2AFIB 2OAQ1 2Q1UA 3S8YA 4YJ2B 3NH9A 4CQMD 1SK9A 2GARA 3ZV4A 1Z5GA 4ZANA 2RHLA 2WA2A 5FA5A 2XWSA 2ZDQA 3HJCA 4IQFA 5E8JA 2R87A 3L79A 4AJOA 5I7RA 3IBFA 3AJ8A 2W6CX 4GBMA 2INGX 2CC2A 5BWOA 5JYBA 5LA6F 5FOVA 5K45A 4BFYA 1XQVA 2VJOA 4XB6B 2WJ6A 1OYVA 4RA9B 3VU8A 5KYXB 1I36A 2AN9A 1I4TD 4HB4A 1Y9ZA 3PUXA 2Y0EA 2LVBA 2ZXUA 3TXAA 5D01A 1U81A 1L7NA 1NNI1 2ODQA 3KKZA 3NM5A 1COWD 3HLTA 4QULA 4U9UA 1DAEA 2QN3A 4UCWA 2VTKA 3C41J 3KE8A 3HB1A 2PMWB 1CQJA 2W2OA 2YJGA 1DBQA 2PIDA 2QUAA 3UFBA 4ZRDA 3UV7A 1JFTA 3T3OA 1YS7A 1ACLA 3K31A 4HRAA 3SNKA 1FDIA 1KR2A 2MSEB 1O6CA 1M9NA 5EVJA 2C3YA 2YXNA 3V33A 1JI0A 1RC1A 4GI5A 3N7UA 1V39A 5ABPA 2A5FA 2VC2B 3DE3X 2AX4A 4GIBA 4NTZA 3EGDB 4M46A 3L06A 2ODEA 1Z74A 2CXOA 1MVNA 1Z4LA 3PFFA 2JFUA 4R2XA 3L5OA 1ISPA 2FN7A 4MDFA 3DOUA 1ZAKA 2C3OA 1P2DA 2LD4A 4EY4A 4Z3DA 2M6RA 2XNKA 4G1UC 4NFHA 4BNNA 4F3KA 3F7MA 1FFBA 2O2GA 4J7UA 1GR1A 2BT4A 4GP7A 4UXHA 3RJZA 4R05A 1NVTA 4GXQA 2NVUB 1QC5A 4LF5B 1Z2CA 3AFHA 1PW5A 1I4EB 2GNOA 2C9DA 2BGMA 1Y4UA 2KHZA 3ABOB 1HNZB 1ZL0A 3PFWO 4AMUA 1PBTA 1J2UA 3R8CA 2MR6A 2WWYA 3PGJA 2JFZA 4K9MA 4QICA 4FYVA 5LWHA 5C80A 5HP4A 2GN1A 1NFFA 2DG2A 4IVNA 1NW9B 3NBXX 5B30A 4OK5A 4BNGA 3FJYA 3KJHA 3CUWA 3C3JA 1AHNA 1DB3A 2OKCA 2B21A 4JU9A 4QUJA 4NCKA 3MB8A 5ARDA 3ZIDA 1NOIA 2A7QA 3WIBA 4EFMA 2JJQA 2A58A 1VG0B 2VVTA 4WESB 3PRHA 4P3XA 3HLKA 1D4ZA 3WB2A 1GCUA 3PXAA 3W06A 4C2TA 2YJ4A 1Y6FA 3A4TA 1CQPA 3T99A 2FSGA 3C4QA 1IYZA 5JVDF 5LXTB 4DMHA 1LVGA 4IIFA 4OQMA 2OK8A 1XXHA 3I42A 4YRQA 3EZNA 4HUJA 1CJTC 1JDZA 3ITDA 1MRNA 2HO5A 1VYVA 5D00A 3O8DA 3ACDA 2PUFA 4I46A 1IONA 5CT9A 1KAOA 1ZK3A 2QVGA 1GM5A 2WINI 2BE7A 3OZ7A 1U02A 2VJBA 1E5TA 3S2SA 3LY8A 3ZCRA 4NJOA 1T5BA 4WJKB 2NSLA 1KJ9A 1SVWA 3WHKA 1WXXA 1ECFA 2DY0A 2IVZA 3W3AH 2WT4A 2J6IA 4L0QA 1I10A 1EPUA 4QYIB 3HKBB 2AXEA 3QLTA 2AR9A 1JDVA 1HOTA 4ZC1A 5GJWC 3SHQA 3BHIA 2I6QA 3TL3A 3IOEA 4EKGA 2A9VA 1K92A 1M74A 1ODKA 1W0JA 2H9AA 3T7JA 3FTNA 1R9NA 2NUBA 3FGPA 4I9GA 2XEXA 4IMPA 4U2KA 5TQ2A 1S7GA 3TLMA 2X1LA 2RGEA 2FGKA 3EJWA 1P2BA 1JI3A 3GGOA 3VPHA 4F2GA 3TD6A 1HT1E 1LC0A 5ALEA 4A7PA 4BNYA 4CT0A 1KZGB 1JYFA 1FUUA 5K0BA 1RKQA 2C92A 3LWBA 5DCWA 3WZLA 1DC4A 3A1FA 4XYMA 3BAZA 3IIKA 1XPJA 3E53A 8ABPA 3IP8A 4IMJB 5JO0A 4IJKA 1XKLA 1QH1A 3PF8A 5CVDA 4N5HX 3L92A 1FJXA 2YV3A 1TQDA 3V4RA 4CFSA 1I3CA 3G9QA 1WHSB 2WD7B 2I2XB 5CTAA 5B6PA 1S8OA 5FBRB 2ZCVA 3K6KA 4GU5A 1N6RA 2FLWA 1IEQA 4LQLA 2VK8A 1JG7A 1LNQA 4KMRA 4Q7JB 1TO2E 1K8YB 4XQGA 1G18A 2B8WA 2G71A 1W581 2R7MA 1KO1A 3H83A 4OXKA 2Q29A 5A4MS 5CDUA 3GLIB 1P6QA 1D2AA 4LHWA 5A5GA 2O9JA 5KQMA 1YJQA 4AROA 1RWWA 2Y4OA 2YHAA 5AK5A 1KAMA 2CNOA 2PSJA 3AHEA 2Q27A 1VBFA 5FOTA 1H1DA 2CMDA 3KPYA 5HKOA 1SBIA 2CL6X 2YWDA 4UAUA 1Z5NA 4QJBA 3LWZA 4JT4A 2QLFA 5CJPA 5HEKA 1V7CA 3FJOA 4D8XA 4RHCA 1ZC4A 5BR8B 3HO1A 4EI2A 3A4NA 1JIIA 3NTRA 3ESQA 3TECE 2WZBA 4FNAA 3A1EA 2RHTA 3FX2A 1NI5A 3UICA 3AU8A 5T4EA 1L4GA 2HUNA 1E8NA 1KVRA 1MAHA 5JC8A 1GADO 4HVCA 1GU1A 5ED0A 4JJEA 2YV1A 2X9VA 1OX5A 2N46A 4M0FA 4BV9A 1Q77A 1USKA 1D9ZA 1S2MA 4FMCF 3ZHVA 2V5VA 3R6TA 4M1KA 5EIBC 3MUFA 1XK7A 1IZ9A 2LPMA 3L8FA 3ADCA 1O9BA 1OXBB 4L76A 4GS5A 1SCKA 4TV9F 4BFCA 4V0ME 2XTAA 1GXSA 4KXNA 4A3SA 5FTLA 2OCBA 4NULA 1KEEB</