1AK2A

Adenylate kinase isoenzyme-2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
220
structure length
220
Chain Sequence
PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords ADENYLATE KINASE ISOENZYME-2
publication title The structure of bovine mitochondrial adenylate kinase: comparison with isoenzymes in other compartments.
pubmed rcsb
total genus 75
structure length 220
sequence length 220
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ak2A00
1E0JA 5L8VA 3LRPA 4M9XA 1NMXA 2J0UA 2C03A 4IVPA 1RFLA 1RKBA 2GK7A 2G6BA 4LBVA 1JBKA 3GJ3A 2PBRA 2WWIA 4HB4A 2JLQA 4MGIR 3SHWA 3AKDA 5CK4A 3FMFA 4DSTA 3ZLJA 3NEJA 2K5UA 2ZQ5A 3KQNA 1Z29A 3WP1B 5FL3A 1G3RA 3WHLA 4DSOA 3E5HA 4HI0E 3KKNA 4UNRA 1GKUB 4NPHA 2BV3A 3CX7A 4AK9A 2YV5A 1E69A 1FMJA 2C77A 2R62A 4FINA 2NTYC 1Z08A 4LJ7A 1AKEA 2YWEA 5FOVA 4L8GA 2F9LA 2QAJA 3N70A 2WSSD 3CH5A 3VKWA 1JQLB 3FFAA 4V0LA 2CXXA 1ZD1A 4YLGA 1US8B 4QNRA 3PV0A 4IJMA 2OV2A 3I32A 1JB1A 4B3DA 2G77B 1E79A 4PPQA 4D2IA 2WZQA 4PPGA 5FOTA 4WXRA 3U61B 4XD7A 5FH9A 4B3BA 4OL0A 5F2EA 2PZFA 2GA8A 4AYWA 5B58C 4ZPXA 4XWKA 3HR7A 2XNDD 4B2LA 1KTVA 2ONKA 4XVQA 4US1R 1VG8A 3A36A 2WJYA 2FSGA 2ZREA 1VCNA 1X8KA 5KHOC 4LDJA 5EZ6B 1W2GA 4KODA 1KI1A 4GNKA 3FHTA 5DN6A 3K70D 4ZKEA 4JVNA 1BYIA 5FBRB 1AQUA 3BK7A 1AJEA 2ZSEA 1P61B 1PUIA 2FSFA 4DRZA 2BJWA 2CE7A 2JLZA 4ZV4A 3KFVA 5L3QB 1XCMA 3RS7A 2QU8A 5JCPA 3HU3A 5D3MA 4TQUS 5K8UA 1MRSA 4GOJA 1XP8A 3R8FA 3OE7A 1UDXA 2NGRA 4IRUB 2JA1A 2Q0HA 3T1OA 2IWRA 4HDCA 4KV9A 2X77A 1G5PA 2X2EA 5EP2A 5DHAA 1XTIA 1COWD 4DLVA 3TMKA 3MD0A 3NVAA 2NMVA 1II9A 1MRNA 2PMDA 1CJKC 4BZXA 3AVTA 2WSMA 1XEXA 1GRNA 2DY1A 3A1VA 1G7CA 3L0SA 4BLRA 2V7QA 3CPJB 2OCAA 4PC6A 4DIEA 3WMEA 3CWZA 3GJ7A 2V9PA 4WOPA 3TW8B 4QM7A 4G5GA 2HLDA 1KI3A 1DG1G 1TF7A 2V54A 2WWGA 3QXXA 4O0MA 1CBUA 1ZNZA 3CM0A 1BH2A 1N6OA 4PR0A 1ZRHA 2Q3HA 3HPQA 2H16A 1GDDA 2QMOA 2JJ2D 4W9MC 3GLIB 721PA 3LXRA 1HE1C 4XWOA 3LX8A 4H9GA 1LF5A 2VA8A 2IYUA 4LHXA 1IY0A 1E1QD 2N1BA 1H65A 4JBWA 5M04A 2A3RA 3QPWA 1CF4A 3FOZA 2QRZA 1XU4A 4IDHA 4DB2A 3LW7A 4KLZA 1YU9A 2RH5A 2UKDA 5D3MB 2OSBA 3W6PA 2WOJA 1Z0JA 3L82B 4GBMA 2QENA 1B23P 4JMPA 1G1MA 1ZVQA 2GXQA 4HSEA 5JHHB 1CJUC 2CK3D 4RFVA 1UEIA 2ZYTX 3GJ8A 4AY2A 2HXSA 4CVNA 1E0KA 4Q5IA 4IOMA 3MLEA 3WMGA 5GJCA 3LWNA 4M1YA 1CP2A 4C0JA 2PZGA 1FFHA 4BLPA 1F2TA 3AEZA 3GLIE 1U8ZA 4B2PA 4ACAA 3IBGA 1BS1A 1XEXB 3KXIA 3VR1A 4TMKA 3NIBA 5AJVB 2QBYB 5CB8A 3U5ZB 1F3OA 2C98A 5E4FA 821PA 3BWDD 4Q1BA 2MMCA 1EX7A 1WA5A 1TADA 1SVKA 3W8NA 1DAMA 4PHHA 1IN8A 2W83A 4B47A 4IW3B 4ZCMA 1G21E 1UAAA 3TSOA 4OJQA 1A1VA 1WBBA 1SKYB 4TYPA 2GJAA 2F3RA 2P65A 5ANRB 3PITA 2G83A 4Q9IA 4QJ5A 2JGNA 1E79D 3LO5A 3I4LA 2QI9C 1G7TA 4IOJA 3IILA 4P4UA 4XD7D 2GXUA 3V9PA 1T3HA 4AD8A 1GILA 2ONJA 5JEEA 1GKIA 1ZU4A 4QGGA 4EPYA 1P2SA 1R10A 1A7JA 5FBVB 5LB2A 3ZZTA 4BWYA 3PUXA 1XFAA 1QG4A 1QHNA 4OK5A 4DC9A 2IS6A 1I2MA 3DHWC 5DYIA 1NY6A 4A15A 4UNQA 4D82A 3C16C 5JRZA 2ZYUX 3GFPA 4AURA 3FVQA 2FH5B 5JI3E 3GJXC 3PXGA 4E22A 3NHAA 1VKJA 1Z6AA 1XZPA 1E2NA 2ZRBA 2YHSA 3I8XA 3KKMA 2GEUA 4A0FA 3AF0A 1XMJA 2A5JA 1M7GA 3TRFA 5JS7A 3CNNA 3OEHD 2ZRDA 3JVVA 5A0FA 4A2PA 4PHTA 4PXAA 3EZ7A 4TLAA 2IUUA 2IYLD 1JAIA 1SHZA 2L0XA 2P2LA 4EIWA 3CPEA 1RZ3A 1DE0A 3B85A 3OE7D 4X8MA 1UDWA 1UM8A 1D9ZA 2RGBA 3A1SA 3GD7A 4W7SA 4GL2A 1Z6XA 2FJUA 3L8ZA 3GEHA 6Q21A 4PO1A 3VFDA 2JEOA 3ADBA 2ZI4A 2ZVQX 4ARZA 2F7SA 4NH0A 3VQTA 1NVVR 4QBFA 3MSXA 1S1CA 3CPHA 2JIZA 3RYTC 4TYYA 1V43A 4AI6A 2GZHA 4TL9A 4WW0A 5FPSA 2V7QD 5BXQC 2GJ8A 4TSFA 4ZCLA 2B92A 1G8GA 3G82C 2Q9BA 2HLDD 5DIFA 1DTSA 3OIWA 1G7SA 4JVSB 3RS2A 4UJ5A 2QM7A 3ZVNA 2GAAA 5HZKA 1GAJA 3P26A 4CEIB 4LYFA 1GVNB 1KJZA 2MSEB 4GRAA 4P31A 4B3GA 3E1SA 2G1KA 3PCRB 1SXJE 1CR4A 3QKUA 3ZQJA 5KUTA 3C5HA 5K8TA 2Q3MA 5JBQA 1GITA 3DEFA 2WJHA 3EIQA 4FXPA 2G1JA 4MKGA 2A5DA 3ZZ0A 4WIAA 4NCJA 1HE8B 3VHLB 3QKRA 5CM9C 3TAUA 1JR3A 2A5FA 5L3SB 3VNVA 5G3YA 4O2LA 1AZSC 1E3MA 2QMUA 3A37A 3O8DA 4KAXA 4NYJQ 2ZJZA 2D06A 1R6BX 2ZR7A 4KCGA 5C18A 1GKYA 2HT6A 1QHGA 4LJ5A 5H68A 5SZIA 4POAA 4AIIA 2OILA 2OXCA 1J2JA 1W5SA 2NO9A 3ETLA 1KY3A 1NVXQ 2QPOA 4URXR 2IWHA 1W7AA 3P4XA 3FKSD 2ZR0A 2O5VA 3BERA 1SVOA 2WKPA 4NYMQ 1L7VC 2F1HA 3U4QB 5TY0A 1VG1A 1TQDA 4YMVA 1NNEA 5FI0B 2ZXUA 3QG5A 3F0TA 4DWJA 3NBFA 1G6HA 1OF1A 1SZPA 2ATXA 3H84A 2WWFA 3T1QA 3B1YA 5A5GA 2UVQA 1AS0A 4Y0VA 5H70A 3KKQA 4A82A 2I1VB 1P2UA 4A0HA 4DHEA 1E9DA 2G88A 1RYHA 3UKDA 2BEJA 2W0SA 4LYHA 4Q02A 1N5IA 2A5GA 2GJSA 1Q44A 2I1QA 2OLKA 3EW9A 5CJPA 2ZM5A 4TL7A 1SGWA 1ZM4A 1HA3A 1OPXA 4V0NA 3GLGA 1TMKA 5FBLB 4TZ6A 4FN5A 2GKSA 4Z8YA 1AKYA 1M8PA 1ZCBA 1ZP6A 3DMNA 1R4AA 1T8TA 1K5DA 3QVVA 4M2LA 5DI9A 2ZE5A 1G3MA 1W36B 4A9AA 1W0JA 5AUQA 4B75A 4B44A 2N46A 2ZYVX 5J4LA 1IJEA 3A1UA 2EFHB 1CR1A 1ZNWA 5C46F 4LV8B 3EWSA 3B1VA 4BFVA 5CLLA 4KFRA 4WA7A 1KI6A 3BB1A 2HV8A 2C8VA 4GZLA 1YZNA 2WPDA 1IAQA 5LD2B 1XMSA 1OHHA 4Q1EA 5HKKD 3WBJA 3IIJA 3P32A 1XB2A 3TVDA 3U6BA 4R98A 2DBYA 5TV2A 5JEDA 3UATA 3EC1A 4MRVA 4TYNA 2OM2A 3CR8A 3LV8A 3OIYA 2Q3FA 3B9QA 2XB4A 5BWMA 4TYQA 4HAXA 3NBXX 2XNSA 3GLHB 1KNXA 4O25A 5TB5A 4JLOA 1Q22A 1AA9A 2B7BA 5DYGA 2ORVA 2ECKA 3AVQA 2NIPA 2H1LA 3BS4A 2WMNB 1E2MA 1UKZA 2DPXA 2JIZD 3HJNA 5FI1B 4EUNA 4Q66C 3RRYA 1D5CA 3WHKA 1TNDA 4JL8A 2QTVB 4DLYA 1WP9A 5TMPA 2BJVA 3SYKA 1KY2A 1YRBA 2UZ3A 1W48A 1AN0A 1SULA 2AXPA 3DZ8A 4M1SA 1WDTA 1UKEA 3AP3A 5F9HA 4BQSA 2X8AA 1XXHE 4BFYA 2IF2A 4A1FA 2QE7A 5TDHA 4EFNA 1JPJA 3Q5EA 1GM5A 4PC3A 1KI6B 2FN4A 4CZ2A 1FTNA 2CL7X 1OB5A 1N6PA 3ZD6A 3EA0A 1W4BA 1UBEA 5J4KA 3TR0A 5AUOB 4M53A 4PPNA 4Q9LA 1GOTA 1NBMA 4QNMA 1G3UA 2V3CC 5JJLA 1JR3D 1JJVA 1NSTA 2EWWA 3DPUA 1W36D 3TE6A 5FTKA 4LYJA 4AC9A 5HCIA 2OCYC 4IDNA 2ZAOA 4ITRC 4I4LA 2XZPA 1QRAA 3NWJA 2BBSA 2HCBA 3FMPB 3ASYA 3SJZA 1Z3IX 5FR2A 4PAQA 3QSYA 5KU1A 4JLJA 4KYUA 2GXSA 1U2RA 2JJ8A 2JJ1A 4TMVA 3A4NA 3SZRA 5BW8A 1BOFA 4FMBB 1Q21A 4UXJA 2AWNA 3LD9A 4TZ0A 8OHMA 1LNZA 3KQLA 2DWQA 2J45A 1KSFX 3SN6A 1YHNA 3EAQA 3WNCA 3W34A 4RZ3A 2D4HA 2O8FA 4O2RA 5J4HA 1G291 1G3QA 2VRWA 4C0QC 3QNUA 1R2QA 3PEUA 1DVRA 3B5JA 3ND8A 4KFTA 1NLYA 1F6BA 5GJVC 3X1ZA 2R2AA 1HQYE 4GFDA 1XEWY 1F48A 1Z6TA 5CITA 1CKEA 2AN9A 4NCKA 2QORA 4KU4A 1ZBDA 4PHFA 4ZDIA 1RW4A 1KI7A 2IYWA 1NG1A 1ZINA 4FCVA 4AKIA 2GEDA 3HR8A 4ZI3A 4US2R 2W6ID 3B6EA 3EPHA 1CR2A 3H2YA 4L9WA 3IGFA 1VIAA 3BB4A 1U0HC 3DKPA 2BMJA 3SI7A 3BIFA 4ZI2A 1Z0KA 4GOKA 1JEDA 4HATA 1W0JD 3Q7QA 2WJGA 4BE7B 1HURA 4U5XA 1E0SA 2VPPA 1X86B 2WVJA 2GETA 1N0UA 4FMDF 2NZJA 3RRZA 4I81A 2W6JA 3W3ZB 4ZDKA 1I4DD 3ZIAD 2WPDD 1KMHB 1DEKA 1OHHD 2YNMA 3P1JA 5FBQB 4D0NA 4F38A 3C4JA 1DAKA 1Q1ZA 3NH6A 5DE3A 4D80A 3GJ6A 2XB2A 2F43B 4DVGA 5FUVA 2EFCB 1XX6A 1QZXA 4UQOA 1JR6A 2EQBA 2YWGA 4R71A 1PZNA 3WP0A 4YMUA 4Z54A 1OXTA 4DDTA 3SC3A 4AKEA 4OJKA 2JATA 3U3KA 2O0JA 4DCUA 1N5JA 4JVMA 4G0NA 1JI0A 1W4CA 2CVHA 2C9CA 1R8SA 1AGPA 1E4VA 2AKAB 2ZRFA 4L15A 1ESNA 4WZAE 5IF9A 3U7EB 4PZLA 5EXSA 1Z28A 2J87A 4RZXA 5KNCA 3QY0A 1YVDA 1GRQA 2OFOA 2YOGA 1NMZA 3B1WA 3QF4A 3W90A 1NLFA 4BZQA 5HR5A 4MGZR 3T12A 3GLFA 3DO6A 4KSBA 4YQFA 4OQMA 1NIJA 1PLJA 2NO1A 1E6CA 3EA5A 2CEAA 1E2FA 4NE2A 2W2TA 2B8TA 4H1UA 5JMTA 2J7PA 4DLZA 3EPLA 1YR6A 1TL7C 2BDTA 1KK1A 2AL7A 4WBSA 3U3JA 3QXJA 3AVPA 4DLTA 2JCSA 4M0LA 4P0TA 1U0LA 1NVUQ 1FTSA 4RCYA 5EQTA 2WAXA 3VR6A 4KITB 2QE7D 1E9CA 1W0KA 4F7WA 2FZ4A 3N5CA 2VQSA 2ANCA 3K0AA 1MO3A 2D7CA 1N2CE 5AJXA 3CRVA 1Q1BA 3AF1A 2FMXA 1EESA 5DO9A 4KVGA 4MYHA 3ZS9A 1G5TA 1NBMD 1ZM7A 2ZS7A 3QQ5A 2ZJ8A 2OLJA 3DDCA 1DARA 3HYTA 3V4RA 3CX8A 4JBXA 3REFA 1FUUA 1A5TA 4PC2A 1IBRA 4PO8A 4LGMA 1PLLA 4I99A 4PSAA 4PTLA 4NZYA 3IKJA 4YC7A 1OFTA 1QHXA 2D2FA 1WB9A 3MAAC 3RS5A 2A7QA 1G5RA 3UG6A 5KOYA 2JJ1D 1IXSB 1SVLA 2A30A 2ORIA 5TXGA 1NP6A 4PSVA 2OE2A 1SVMA 4XVRA 3UPUA 2FGKA 3OAAA 2WICA 4DB4A 1KO1A 5B2ZA 3GLFB 1BYUA 2GJKA 3BFVA 1GUAA 3PUVA 4F92B 4B35A 3CLVA 5JI2E 2QQEA 3OEEA 1EWQA 4UXIA 2O8EA 3DOEA 3KZ1E 1S3GA 4IDQA 3LFUA 3D31A 1OH5A 3AP1A 1ZAKA 2B7CA 2C96A 4YDSA 3DM9B 3K0AB 2VSXA 3Q5DA 4AYXA 3KJEA 2P3SA 4IEIA 4BFZA 2OUKA 3BH6A 4ZDWA 2PJZA 5FFMA 3FMOB 3ZGXA 3WYGA 4ERNA 4RZ2A 4QG7A 1XCGB 2PT5A 3C5CA 3AVUA 1OXSC 3UK6A 2FNAA 3C8UA 1KDPA 5FTMA 1AM4D 1YR7A 1T9HA 1UADA 3B7GA 1HTWA 2XGJA 1II0A 4Q18A 1CJTC 4DKXA 4E09A 2B6HA 3CF2A 2G0TA 5E7MA 4A0RA 2XTZA 4KHZA 1ZC3A 3U7HB 2W6JD 3AVXA 4ILEA 4LJ4A 3DVLA 1ESMA 4FI3C 2QTFA 1E2EA 1GSIA 3SDZA 1S8FA 2BMEA 4LK2A 2CLSA 1DAFA 1XJCA 5IK2A 5JJIA 1TQ4A 3SHFA 3V00A 1Z8FA 5DNYB 3F8TA 3U3MA 4FW9A 3SS8A 4RD6A 4LBWA 1BMFA 1GP2A 4TT3A 4C0KA 2PX0A 2BOVA 4CDGA 4L9SA 3WYAA 3T35A 1YZGA 2O8EB 3RS4A 3N2IA 4QBHA 2J0UB 3KKPA 2WMOB 3IPXA 221PA 4UNSA 1FPMA 2A9KA 3O8BA 5IDVA 1ZMXA 2DR3A 2ZTSA 1LF0A 2GDJA 3KJHA 2P6NA 3B1ZA 2YOFA 4M9ZA 2BBOA 2V6IA 2OEPA 4Q7JB 4B2IA 1P6XA 1P75A 1P73A 3B2EA 5AWFC 2ZJ5A 2R9VA 4LSGA 2J7PD 1P62B 4M8NE 4C0SA 1IXZA 3VR3A 2J1LA 4C9BA 4MYTA 2BBWA 1DAGA 1TPZA 1DO2A 1SQ5A 1T3LA 3OZXA 4LC1A 4PQRA 4PAMA 2XJ4A 5DGXA 2FSHA 3KB1A 4Q4LA 3JZAA 2ZROA 1B0UA 2QGZA 4JLBA 4DCSA 4RD4A 1KOFA 3VX4A 1VTKA 2VHQA 5K8LA 3C15C 4F4CA 4PC1A 1EG7A 2F3TA 4JL6A 1M7BA 2QN6A 2XTMA 5KTYA 1U0JA 1SHKA 2Z83A 1EFTA 5TVKA 4LWZA 4ASUA 1GIAA 4IFEA 1M1YE 2EU8A 4OBEA 3UMFA 4MKHA 1C4OA 3TR5A 1CLUA 1NKSA 1OYYA 3L8YA 2PH1A 2P67A 3T15A 3AGQA 2H18A 3U6KA 2CNWA 3K9LA 3QXHA 1T5LA 5B64A 4Q47A 4FWTA 1NN3A 1K6MA 1CXZA 3MJRA 4FMDB 5E95A 3D7MA 3B1XA 1D6JA 1HQCA 2Q6TA 3OAAD 2MMGA 1J70A 1U8YA 3AVVA 1WCV1 1OXUA 3I5XA 3H1TA 1QF9A 4LJ6A 1DADA 2D3WA 2JLSA 3IIMA 4XJXA 2R8RA 2WBLC 1GWNA 3K9HA 3PEWA 1XPRA 2PJRA 4HLQB 4OI0A 1XF9A 1X1RA 3OEED 2JDID 3KQUA 2W2VA 1RVDA 4MUAA 1HUQA 3BD9A 1AIPA 4LBYA 4DT1A 4YDHB 4PO9A 4HAUA 3HYRA 3VHXA 3B13B 4RD0A 3CF0A 4JLKA 5EXXA 1J90A 2GILA 5UKDA 2J0QA 4G5RA 1SKYE 2C04A 4BUJA 2YOHA 4WZ6A 1KJYA 1G16A 3MCAA 4B3CA 1G4UR 2Z43A 1FL9A 2FZLA 2GWHA 3PR1A 4P3YA 4QJ3A 2GCPA 5G53C 3NDBB 1E9FA 4M9SA 3T61A 1U90A 1G20E 3CUEF 3QEOA 3X1YA 1FQJA 1XEWX 4MH0R 1FOEB 4MKIA 2CVFA 4R9UC 2QTHA 1VG9B 2NO0A 4Q4HA 4D81A 5F9FA 4TLEA 5E7JA 3BC1A 3WXMA 3UWKA 2DCUA 3SR0A 1WMSA 2QGNA 2ZSBA 1WXQA 1W46A 2V8OA 4DDUA 3K1JA 2O8CA 4MYUA 3G5UA 4DJTA 3MG9A 3QI2A 2LWIA 1E1RA 1KI9A 2P6UA 5JSZA 1DBSA 1LVGA 3NC0C 2W58A 3LLUA 5LPNA 3ECCA 1R7RA 4K46A 2QPAA 1O87A 4LV6A 4TT3D 4UKDA 1S96A 1U81A 2QP9X 2RGNC 3PUYA 4TL8A 3LQRA 4HZIA 4TMWA 1S3SA 3Q85A 4IKEA 2RGNA 1OH6A 1T5IA 4BRWA 5DLQC 4DT1B 5F98A 1NKTA 2OCPA 4JIMA 2ZRAA 1YQTA 1KZ7B 3IBYA 4RKFA 5HPYB 4P32A 2QZ4A 4BZPA 1GNRA 2QP3A 4U02A 2FEMA 1DS6A 3EPKA 1UKVY 3HWSA 5CLQA 2UZIR 1WQ1R 5DN6D 2MSCB 1G17A 4D0GA 2VHTA 4Q9JA 2JASA 1NF3A 3CKLA 5BN3A 1F2TB 1OV4A 2KJQA 3L43A 4WAUA 1MO6A 1EXMA 1XJQA 2BBTA 4HB3A 4AKGA 4TLBA 3ADDA 5DH9A 4MA4A 5C4MA 2RCNA 1FMLA 2IL1A 4Q4HB 1ZJ6A 1G8HA 2ODWA 4HYYA 3GP8A 3KB2A 1CULC 4Z8XA 4B71A 3TH5A 2PLRA 1OIWA 2FEOA 2XTNA 2VTKA 1TUEA 4UJ3A 1UKYA 2O8CB 3H0KA 5JJKA 3IEVA 2NPFA 5G41A 4Q1FA 2FE4A 4B43A 5GJBA 3FHOA 1S1MA 2GJ9A 1OIVA 2CCKA 4RD2A 3TAHA 4URUR 4GDFA 3M1IA 2OCBA 1KMQA 3AM1A 2AFIE 4IDPA 3LDAA 1UBCA 2ERYA 4UNPA 2YWFA 2YJTD 4Q4AA 1MR3F 3FFBA 2CNWD 3B60A 2NO6A 1KDTA 2ZI3A 3BGWA 1DG3A 1ZIOA 3D8BA 1E0AA 4B6FA 5AJYA 3P4YA 5SZHB 3ZVRA 2PCJA 5KPDA 2O8DA 2OO7A 1Z22A 2CLCX 2ZJOA 1SXJC 4OI4A 4FCTA 1RRGA 2P5SA 1LFDB 4A6XA 5FOUA 1SXJA 3W3AA 1NY5A 1G3IA 1X1SA 4Q7MB 2RKOA 2X19A 2GRJA 4ESVA 1Q20A 2IYXA 1TF5A 4M21A 3IQWA 2QUZA 1EFHA 1RJ9A 1KSHA 3N2EA 3QXCA 3T5DA 4ACBA 5CIQA 4A2QA 3A8TA 4IEEA 2GHIA 2JLXA 4C0BA 3QG1A 4US0R 1RC8A 2PL3A 2WHXA 3BOSA 3MWYW 3CRRA 4B3XA 3UMSA 2Y8EA 2FWRA 4DUGA 3OESA 4KI0A 3ZJYA 5J5CA 2J7KA 2IYYA 5CDFE 4Q19A 2EYUA 5F3WB 3JVUA 3RRNA 4OHXA 1IN5A 2NPIA 3ZH9B 4QL3A 4ARZB 1LB1B 1Z0DA 3IO3A 2D62A 4DBLC 2FX3A 4DXAA 1Z5ZA 1E9BA 5FUYA 3SEAA 2ZANA 3C14C 3OFNA 4W5HA 4M22A 5EP3A 2REOA 4Q4AB 1E9SA 1HYQA 2IBMA 4CEJA 2GF0A 1SVSA 1TU4A 2J59A 2VP6A 1PLKA 4CF7A 3EPJA 2KSQA 3EWAA 3PFIA 2CCGA 3EG5A 4AYTA 2RGAA 5JRJA 1K5GA 2O8DB 2RAPA 4Q1DA 1P9RA 1V5WA 5J47A 2ZYWX 1NJFA 3SJBA 1EK0A 2F1IA 3Q3JB 1VIYA 2ZI6A 2NOAA 3FKQA 3B78A 2IS4A 3TNFA 1D8TA 2LKDA 4HLDA 4BEBA 1E2DA 1C1YA 2ANBA 3ADKA 1XD9A 5HZHA 4G01B 4MRSA 4RVCA 4W5JA 2FU5C 4II7A 2ZSAA 3PENA 3QKRB 5JWOA 3OIUA 2VIIA 4YMSA 5CYOA 4IXNA 4NHOA 5AJWA 1EFRA 1GTVA 3GLHE 1KZGB 2QMEA 1SVIA 3PQCA 2VHCA 2ORWA 3RWOA 4P33A 3W9YA 1D9XA 4EAQA 3NH9A 4LV5B 1JECA 1U9IC 3AF4A 4K81B 2XEXA 2CBZA 1JPNA 3T1TA 1P4SA 1U9IA 2HJVA 2I4IA 2ZSDA 4Z1MA 3THYA 2XSZA 1T0HB 1Z6YA 3K53A 2WWWA 4Q4JA 1SVWA 4HUTA 3ICQB 4DLRA 4A4DA 1WF3A 1A2BA 5B57C 1QG2A 1AS3A 1U98A 4D4JA 4CEJB 4DSUA 1CS4C 4YMWA 1YRAA 3W5IA 4DEXA 4Y0AA 1H8EA 4JLAA 1E9AA 4PZZA 3HPRA 1R5BA 1L4YA 2IYQA 4JLMA 3AVWA 1DAIA 2VSFA 2OZEA 5FPYA 3F3YA 1YJ5A 2ZRMA 1Q3HA 1TF2A 4UXHA 2RGCA 4NCIA 2REBA 4FMCF 2F1JA 1G9XA 1M34E 4TQ9A 4BEJA 3PUZA 2VL7A 3NHBA 3UWOA 4B74A 1KYIA 3VKHA 3GLGB 1U99A 4LJ8A 2QP4A 4TSFD 5EE5B 3THOA 4GP6A 4DZZA 2WKQA 1VHTA 4LJAA 4NU0A 5CIWA 3U44A 2OAQ1 4RFSA 1NJGA 1XXHA 3O8RA 3EARA 2AXNA 3VNUA 2ZRPA 1ANKA 1E9EA 3TW4A 2Q9CA 5JWRA 4IXMA 5FBWB 5HE9A 2IHBA 121PA 4Q21A 3WMFA 3TQCA 1OJLA 3THYB 4BASA 1J99A 3HU2A 2HEIA 2GESA 5EXPA 4NMMA 1IN4A 3GJ4A 4JBYA 1MO5A 4Q4JB 5H1YA 2PEYA 5AUPB 4DLXA 2BKEA 2ZUCA 4DSNA 1ZIPA 1IY1A 1OSNA 4LY6A 2XJ9A 2IEYA 2BVNA 4DUGD 3AGPA 1KDRA 2C9YA 1KO5A 2FPKA 1J7KA 4XSHA 1ZU5A 2EFEB 1XPOA 4BPBA 1R0YA 2ZRKA 3ND9A 2G3YA 2BCGY 2ZS8A 2HJGA 4IOLA 4L16A 2AR7A 2DFKB 1I4TD 1KNQA 2RGDA 1LV7A 4QHSA 2IK8A 3WY9A 1DPFA 2QRNA 2ZI9A 3PEVA 3U44B 4RFSB 1XXHB 5K8IA 1S4QA 4CRWB 4BLQA 1S9DA 4CGZA 5FPKA 1W49A 2FOLA 5EJEA 5KYKA 3KJGA 2ZI7A 4JLDA 2KWIA 3W8RA 4C0AC 4V0ME 3H86A 1NMYA 1W4AA 2H7VA 2Z0MA 4FIDA 5KSOA 1XD2A 3KX2A 2BIFA 3B8HA 3SU8A 3WBKA 3AUXA 2QPTA 2RMKA 4D4LA 1NN1A 3FGNA 4JKYA 2R6GA 2QQ0A 4ESHA 1KKMA 4A6PA 1FUKA 4MRRA 3LXXA 3I5YA 3LQQA 5BN5A 5JCZA 1J8MF 1Q1EA 1DAHA 4IHQA 1N6HA 2OHFA 1EFRD 4RSGA 2JLRA 4C0HA 2OXRA 2E87A 1E4YA 2ZR9A 5EE3A 4FCWA 4BLTA 3D3QA 4C3ZA 2H5EA 4N3NA 4MITA 4JSYA 1UF9A 4QC2A 1S0UA 3DKVA 3QKSA 4NYJR 4WVFA 3K0EA 5JHGB 4V02A 2IYZA 2IYVA 2ZSFA 4LI0A 2PCLA 4Z1MD 3IQXA 2YZ2A 4JKIA 2OFWA 1JXMA 1ZM9A 2AWOA 4B33A 2PT7A 4NONA 2ZU0C 3SYLA 2W2XA 3EZFA 5JFGA 4Q1CA 2AFHE 2O8FB 1GL6A 1KHTA 3FB4A 3QBVA 2HCJB 1KI2A 3QF7A 4NYMR 2ZAMA 5FOWA 3PEYA 1AK2A 4LHWA 1H8ED 4XWAA 4JYBA 1IN7A 4I1SA 3UG7A 3I73A 1E98A 3X1WA 1XCPA 3I72A 1LS1A 1XBTA 4OQFA 4ZIRA 1PJRA 3PJRA 3CX6A 1P9WA 3AF2A 2VLIA 3B82A 4GI7A 4B73A 4LHYA 3X2SA 2HYDA 4ZDJA 1XD2B 2KBEA 2Z4RA 2XAUA 2KI5A 1F5NA 2ZS9A 4AKHA 1SKQA 1ZNYA 3AKEA 1M74A 3O47A 2CJWA 3IDQA 3CNOA 3KQHA 2ZRHA 4BFXA 5KDOA 1T3SA 4RZUA 4OHYA 1XPUA 2YVUA 5L3RA 1KAGA 1OW3B 2YC4C 1FX0A 1KJWA 2XZLA 2NG1A 4ON9A 2FFBA 2R6FA 1Z06A 2XNDA 4G3XA 2WAYA 1H8HA 5JZVA 4NDZA 3LH5A 3ICEA 2IF0A 4OQLA 3CZPA 4G5QA 1OKKA 2BMFA 3V4FA 5C2JB 1Z63A 3K70C 4TTQA 4X8HA 4OI2A 4AG6A 1OIXA 1Y3AA 4OI1A 5G40A 3CNLA 1QBKC 2P5TB 3RLFA 1E94E 2VBCA 2ZITA 4C0LA 1CEEA 1NVWQ 1QHYA 1XTRA 2VF7A 1EFCA 2GVZC 2CDNA 3RSOA 1XJ0A 3IIKA 4LUCA 5DSZA 2QG6A 3TKLA 5FTLA 2XZOA 1A2KC 4JLNA 3KDSE 1PUJA 3NBYC 2Z6VA 2QAGC 1YE8A 2FFHA 5FTJA 3RRMA 2IYTA 1XD8A 1G7RA 4BLOA 2IX3A 4MKFA 1DAEA 2QAGA 4LX0A 4TMXA 2R6AA 2PEZA 3QF4B 3A4MA 4GPTA 1COWA 5GJWC 2WV9A 2W00A 2J0VA 4QFMA 1W44A 2CHGA 2CL0X 2GCOA 4JLVA 4PFSA 3TBKA 2CJWB 3TQFA 2O0KA 4MDFA 4QGAA 1VECA 4HLCA 3E70C 5KSPA 5C4GB 3U3RA 4QKQA 1P3JA 2YKGA 5EE9A 1I2DA 1FX0B 1XTJA 1FNNA 4JLPA 5KSZA 1XDBA 1TQ2A 2PLFA 3FHCB 1ELOA 1GFIA 3A58B 1OB2A 5BYJA 3R9WA 3QKTA 1S2MA 1X8JA 2OAP1 3CRW1 3L2OB 1AGRA 4OYHA 3I3SR 2GBLC 1NN0A 1US8A 2ODEA 1W5TA 4J0QA 1KKLA 1QHHA 2JJ2A 2GBLA 3G0HA 3U3OA 3GEIA 1S9HA 4I1OA 421PA 3EZ2A 2GTPA 3HDTA 3IEUA 1L8QA 1FNMA 4MYCA 3H4MA 4HB0A 1I4LD 2ZJAA 3CF6R 2R6DA 4R2IA 2KBFA 3AUYA 4MRNA 4NBSA 1WRBA 2V6JA 3TSWA 2RHDA 2RGGA 3FWYA 1KSJA 1KI8A 4XH9B 2ASEA 2QAGB 3RC8A 3LVQE 2CK3A 2Q9AA 3C41J 5SZKB 4BFWA 1CRPA 1RRFA 3CO5A 4TTPA 2CHQA 4KFSA 1R8QA 2GCOB 1IN6A 3T34A 2VO1A 2VHJA 2ZJBA 3FTQA 4XVUA 5JECA 1QHIA 5L3QA 3DMDA 1N6IA 4WXPA 2OFXA 3SJAA 3K9GA 2C5LA 4X8OA 5FPTA 3D6TB 2CHVA 3IHLA 2J5XA 3K0FA 2IT1A 4OK6A 3GEEA 4GSYA 1LW7A 3BH7A 4DLWA 5GADl 2VYFA 1VCMA 2B21A 2GK6A 1NVVQ 1CR0A 2IC5A 3I62A 3TIFA 4DCVA 1G19A 1QHHB 1M2OB 2WJVA 3W6OA 2FFAA 1MT0A 1ZYUA 3K0CC 5FTNA 4EPWA 2GNOA 4KVAA 5AJZA 5BN4A 2LCFA 3K0CA 1Z6GA 3BAFA 1OFHA 4PQFA 3TK1A 4CIDA 1R0WA 5LB4A 3M6AA 3PVSA 4IVQA 4HAVA 3BJIC 4TQAA 1AZTA 1RE0A 1LTQA 4TL6A 4DEYA 1N5KA 5CM8B 1L2TA 1TEVA 3SJCA 1H8HD 1W0KD 1TUIA 4JL5A 1U8AA 5C1BA 4TTRA 1OKKD 2IYSA 3AVYA 4KJZA 2SHKA 2ZRJA 4P4SA 3TJZA 3GLIA 1N25A 1RRCA 2GCNA 5FOXA 2GEVA 1JJ7A 1ZUNB 1VMAA 3TVTA 5KNDA 2AD1A 1KI4A 4TLDA 3OEHA 4UNNA 2BEKA 2HT1A 1OE0A 4HLUC 2WJJA 5EUMA 3A6PC 2RGXA 2N42A 4HLUA 3WNBA 4Q00A 1BO6A 3LBIA 3NKVA 1LS6A 3Q9LA 3K0FB 4L4UA 2ZPTX 4KLNA 3CZQA 1EX6A 1PVOA 2LKCA 3I61A 2ZI5A 2HXYA 4DDVA 4QOSA 3CR7A 3WRYC 2DFNA 4A0GA 2RHMA 3EX7C 1IJFA 2O0HA 4F93B 2ATVA 1YZLA 1GL7A 3THXA 2DHRA 2QBYA 3FMIA 2C95A 2H92A 3UIEA 1UBGA 1P2VA 1AQYA 2ZRGA 4TN1A 3BE4A 2B8WA 1F2UA 4C4PA 1YZUA 2EVWX 4YONB 4EJSC 2VP0A 2CLDX 3GMTA 1P2TA 2ZRNA 1E96A 4EJSA 3RS0A 3ZQ6A 2EWVA 4HB2A 4HDOB 2WTUA 1KO8A 1MV5A 4P4SB 4QXAA 3QUSA 3ZD7A 1KDOA 4W5WA 3EIHA 3LBHA 5LDDC 1XTSA 2WWHA 2HF9A 1QVRA 1Z0FA 1E2GA 2I3BA 2C2HA 5KNBA 5GVSA 3FYHA 3CONA 3FPAA 4EPRA 1M6NA 3R9IA 4PQYA 1AS2A 2IXEA 2REXB 5KDLA 1ZNXA 4B48A 1E99A 2AK3A 4GZMA 4R7ZA 4JVLA 4JT4A 3C7KA 1ZUHA 2BM1A 4V0KA 1PV4A 3GFTA 1R0XA 4N0DA 4PSKA 1TU3A 4B76A 2X2FA 3O8CA 3LX5A 4E5UA 4C2UA 2P6RA 1E2PA 3KXKA 3PUWA 5IK2D 1XRJA 3SOPA 4EDHA 3FKSA 2O52A 3SYNA 1N5LA 1G8YA 3BORA 2AX4A 1Q0UA 5GVRA 3IHWA 2G0NA 1BMFD 1T4GA 2QMHA 3THXB 4A2WA 1XZQA 4DLUA 5J4YA 4KSCA 2VEDA 3RDPA 3U60B 3MWLA 1F2UB 1VYUA 1N6RA 2J46A 4KFUA 1X8LA 1GNPA 5KPJA 1D2NA 1E2JA 1IM2A 3KUCA 4EJSB 4KBFA 1N6LA 3WNDA 2J0SA 2ZRLA 5FL7A 3QVUA 2VF8A 1N0VC 1P9NA 3CWQA 2FDCA 2F9MA 4O3MA 4XTCS 4GMDA 2BMDA 2ZRIA 4N1AA 3TSZA 4B34A 3LA6A 3DM5A 2RGEA 1BKDR 2OBNA 3P20A 5CK5A 5AK0A 3LVRE 3ZS8A 1Z0IA 3VX3A 4D0LB 3UMRA 4EKDA 4CEHA 3MUFA 4LHZA 4Q9KA 1OH8A 4D25A 3RSLA 1E9RA 2R65A 4LZZA 1GL9B 1XNJA 2Q21A 3SFVA 2W0MA 1MABA 3DZDA 3RAPR 4I1UA 4URVR 2XOKA 1IQPA 4CEIA 4L5BA 5EE1A 1CJMA 3X1XA 1JXOA 4YMTA 3L0IB 5HE8A 4BECA 1E2HA 5JSZB 2O8BA 4ASUD 2C99A 4N0EA 5HKKA 3M0EA 1W47A 3BFXA 1ONBA 4MRPA 2A5YB 1XTKA 3RANA 3QXSA 3EXAA 4FD2A 5JS8A 3F5FA 4JJZA 1UBFA 1LY1A 4PANA 1E32A 1P60A 3SBEA 2BKUA 4ABYA 5L3SA 3CRMA 3MWKA 4CT5A 5KO2A 3VU9A 3EIEA 1Y63A 2D74A 2FFQA 3X1DA 3FE2A 2JLYA 1P7CA 4A92A 2GZDA 3GCGA 1MKYA 4B3FX 1FP7A 3JZMA 4XOIA 3CW2A 3GFOA 4ZO4A 1Z2AA 4RJLA 3W5JA 2ZJ2A 3AH8A 2ZETA 3SBDA 1EFUA 1TX4B 1Z0AA 3S1AA 5EXTA 3LW8A 2IA5A 1G64A 1Z07A 3U7FB 3U4QA 4LCBA 3IPYA 2Z4SA 4P4TA 3ADCA 1EWRA 3NG1A 5DI3A 2NO7A 1XMIA 3HP1A 2TMKA 4CEHB 2QEQA 3U7GA 3EASA 3ASZA 2QNRA 5CDFA 1L4UA 1MABB 4YXWA 1HY3A 1Z83A 3NTUA 4CW7A 4HDQB 1WE2A 1E2KA 2J41A 3R20A 4RD3A 3ZDQA 1IY2A 1ZCAA 2ZE6A 4XTRA 1D2MA 4K8OA 2QROA 4TYWA 3LBNA 4Q7LA 2O8BB 5A4JA 2V55B 3EZ9A 4RD1A 1Q1QA 1NIPA 2YWHA 1F60A 4F4JA 4RCZA 4F91B 4LHVA 5CB6A 3BB3A 1W36C 2CL6X 1DO0A 5EZ5A 5CYPA 4RY2A 4PX9A 1FQKA 4XIGS 2WOOA 3VU9B 3AP2A 3VTKA 4Q48A 4NYIQ 1JR3E 1KO4A 1UEJA 2FF7A 1KSGA 4NL4H 1G41A 1UFQA 3W6NA 621PA 2KB0A 1OT3A 1NN5A 5LD2C 1E1RD 1ODFA 3QBTA 1YKSA 1SXJB 1YZQA 2C9OA 2F6RA 1NRJB 4GP7A 2OBLA 3DL0A 2IHYA 5HCNA 3IUYA 3S1AB 1JALA 5L3VA 4LYAA 1ETUA 1T8UA 3AQ4A 2WKRA 1RJ9B 4BFTA 4LPKA 1N6KA 5E7IA 2IEZA 3TLXA 4Q7KA 5DI3B 4BLSA 4EPTA 4QHYA 2R6CA 4C7OA 4B32A 2ERXA 4IDOA 4FWIB 3R7WA 2WM9B 1CIPA 2ZUBA 3CBQA 3GLHA 4IFBA 2EFDB 2ZUDA 2H8KA 3B9PA 4MDEA 4OK3A 5FL7D 4JYCA 2J9RA 2R44A 3HU1A 1OXXK 2GXAA 1KK3A 2BCJQ 4KYIB 3NXSA 2JLWA 2D7DA 1MOZA 2W6IA 3LLMA 2BC9A 4QGFA 1OH7A 4TLCA 3T1VA 3GLGE 3P27A 5EP4A 4OHWA 1WBDA 3E2IA 4DLSA 2MSDB 4MGKR 3REGA 5EUQB 1W4RA 3PG5A 1O3YA 2BHRA 3QIAA 2XOKD 2FPMA 3GJ5A 3NEYA 1NL3A 2AKYA 2JLUA 1CU1A 4G5SA 3SNHA 3ZIAA 2IW3A 3IO5A 3TUZC 1ZD8A 4M1OA 4GT1A 3NBZC 4BRUA 5ELXA 1JEEA 4QBIA 4EPVA 2VSOA 4LBZA 2XXAA 1E2IA 3MGCA 1G8PA 3AF3A 5G3ZA 2E9SA 1KAOA 1R5OA 4URWR 4BFUA 2HF8A 3MJHA 1HT2E 4CT4B 1ZC4A 3U2QA 2A2ZA 4C7OB 1T91A 2H17A 3QJYA 2FV8A 4URZR 2DFTA 3RS3A 3R7WB 2CE2X 4HAWA 1E2LA 1RYFA 3M4YA 5BQ5A 3RC3A 3ONWA 2CMKA 2Z5FA 4ZKDA 1RRPA 3ZVMA 1SXJD 1YR9A 1ZW6A 3WYFA 4QM6A 1X6VA 1BIFA 4NTZA 1XEFA 3RHFA 1TQ6A 3RVBA 1C9KA 3PIRA 2D2EA 1HV8A 2ZVPX 5HTKA 1VHLA 521PA 1YZTA 4LOAA 4KXFB 4D4KA 2QSYA 5FOSA 3BFKA 5J40A 3RWMB 2OBMA 1NSFA 2FG5A 2AD5A 3NC1C 3KL4A 3KXLA 1XWIA 5JLJA 2QSZA 2VP4A 2GF9A 1KO7A 2ODBA 2AK2A 4QBGB 2G9NA 3UXMA 4KBGA 1VG0B 3DOFA 4YXWD 4EFLA 4M9QA 1OXVA 3CH4B 2XITA 3QENA 4HAYA 4V0OA 2WWYA 1TAGA 4D26A 3NDPA 1EGAA 5SZJA 5KSYA 1W1WA 1IXRC 2V4ZA 4LC0A 5FPHA 3OIVA 4E07A 3GJ0A 1HT1E 2GZAA 2XXAB 3CB4A 1TEXA 3OFND 1G8FA 4JS0A 1VCOA 1VYTA 1ZM3A 1DOAA 4DIDA 1NBME 2IXGA 2ZEJA 1G18A 1P72A 4HZUA 2EFGA 2P0EA 4I1VA 2VH5R 1NG9A 1E2QA 1UPTA 3AB3A 2ZE7A 2PMKA 2ZIAA 3R8CA 1K8RA 2WIBA 2GVDC 4V0MA 3WRXC 2XX3A 2ZU6A 2CCJA 4NP6A 1KMHA 1GZSA 2QY9A 4PPFA 1IONA 2OT3B 4BGDA 2QT1A 4HEJA 1QHSA 1GRRA 3SQXA 4PZYA 2F43A 2HUPA 5BYKA 3THWA 2HYIC 2DWOA 4IOKA 2EYQA 3VAAA 5LBIA 1FZQA 1U94A 2YYZA 2PZEA 3K9NA 4JJKA 4Q1AA 5IRCD 1VCIA 3CIOA 1R5NA 3A1TA 3L0OA 3RNLA 4WZBE 3ZYCA 3I8SA 4MUBA 4Z51A 3SE0A 4OHZA 4EFMA 1FP6A 4X8LA 4EQ6A 1P5ZB 2IS2A 2JLVA 1XMVA 5DISB 1G6OA 2VP9A 3T5GA 4TMZA 3SQWA 4QHTA 4LPSA 2JAQA 3I92A 1G4AE 1CJVC 4M1KA 2XSZD 2YINC 5D3QA 5IHPA 2H57A 3AVOA 1RIFA 3MRSA 1JAHA 5FR1A 1D2EA 3BH0A 4G5OA 3UANA 3Q8XB 4Q9HA 3A4LA 1OFUX 1CTQA 2IUSA 4BFSA 3QE0A 4URYR 2WWXA 1MH1A 1KK2A 1T0JB 1YZKA 4HZUB 4V03A 3RABA 1Q3TA 1N3BA 3OF5A 2DYKA 4JSTA 1VYVA 4M4SA 2PX3A 3VR4A 4AG5A 3KQKA 3QPUA 3MMPA 5H8WA 1Z47A 4NYIR 2NQ2C 2QT0A 2YC2C 2QM8A 3TUJC 4TWZA 4C30A 3BBPA 1A4RA 1R0ZA 2ZRCA 4NCNA 2VHUA 2WSSA 4PC7A 4HUQA 4D4MA 1FW6A 3QPVA 1X3SA 3KFXA 1QVAA 1N0WA 4B6EA 1KGDA 2DWPA 3THWB 2IS1A 2RB4A 1XTQA 1YR8A 1W2HA 1JNYA 4S35A 1QDEA 1N6NA 3FDIA 4KO8A 4PHGA 3AKYA 3MFYA 3QOFA 2WJIA 1OFIA 4EPXA 3I1FA 2A78A 4M1WA 3KTAA 4F4IA 4AWXA 4EQ6B 4QJ4A 4DCNA 5JWHA 3J81k 1TTTA 1RPZA 3BRWD 3Q7PA 3VKGA 2OG2A 3SFZA 1II8A 3QKSB 4LRWA 5IT5A 2OESA 4U7DA 1MO4A 4PAOA 4OQNA 1OYWA 1Q57A 3GLFE 3A1WA 2BM0A 4A8JC 3ZVLA 4MGYR 4QRHA 2GAOA 3GPLA 4A8JA 4C2TA 4OHVA 4DCTA 2ZE8A 5B30A 1T6NA 2WIAA 2X1VA 3CRQA 1JQJC 1ZD9A 4XSGA 2HDNB 5E3HA 2DB3A 1KK0A 4LJ9A 2QA5A 5AR1A 2F1RA 2IUTA 2KE5A 5CJ2A 5FUWA 4OQXA 3EZ6A 4ZIRB 3VMFA 4NCHA 3GQBA 4OKSA 1CRQA 4E03A 2FPLA 1UJ2A 2FA9A 1VDZA 3KJIA 4HUQB 5AUNB 1ZM2A 4JT2A 2FGJA 4M1TA 2DFLA 2F55A 4GMXA 4GOXA 3AV0B 4Q01A 3VR2A 3R9XA 4U00A 3VR5A 4A36A 4IVRA 1GNQA 3TGPA 2VP5A 2IXFA 4M1MA 2V1UA 4D6PA 1KIMA 3LY5A 1HH4A 1J8YF 3LAWA 1NI3A 3EC2A 5EE0A 2E1RA 4H1VA 2EW1A 1IHUA 2NZ8A 3OHMA 3Q72A 3MWJA 4DDWA 2FSIA 1Q12A 3KTAB 1DELA 3K0SA 5FUXA 5DHFA 2ZJYA 5J4VA 3L0PA 3T06B 1A82A 4G1UC 1GG2A 3K09C 4R2HA 3LNCA 1ZUIA 4FMCB 4CYMA 1II8B 1VPLA 2C78A 3K09A 3KKOA 1M7HA 3TUIC 2AHOA 4ZCIA 4RKEA 4NKRA 1IOZA 4JZKA 3QEJA 4Q03A 4MQBA 4S2EA 1NLZA 3K8YA 5KDDA 1Z2CA 2J3EA 3K70B 4TMTA 3BXZA 1HEIA 1OLOA 3KUDA 5TARA 5P21A 2QL6A 1E1QA 5EP1A 4A8JB 4LJYA 2VP2A 2JDIA 3AKCA 4HAZA 4QGHA 2V1XA 2BWJA 3ZZUA 2IYRA 2ODNA
chains in the Genus database with same CATH superfamily
1YVEI 3R3XA 1LVUA 4PYNA 5DTMA 3M1YA 3VJLA 4ZAVA 2MU1A 1RKBA 3T9CA 4OB8A 2PZJA 1G5QA 1PJ2A 3S1LA 1JBKA 1R6TA 4NDAA 1DMRA 4CIXA 1N5MA 3SHWA 4DNQA 4MUFA 5JIBA 3FMFA 4RVNA 3NEJA 3AERA 1Z5PA 2ZSJA 3V7YA 4LF7B 4GX0A 5T7BA 1QHEA 1W9MA 4NS4A 4QD3A 1T4DA 1X3LA 5FL3A 4YRSA 1G3RA 3QLJA 3IE1A 4MIEA 2HBQA 2WRZA 4CKCA 1A7UA 1QH0A 5HVNA 5E8RA 3A9CA 4D92A 2BGMA 1SC9A 4U4AA 3BA6A 2X14A 3KKNA 4KRFA 3HDGA 5DRTA 1GPAA 4AK9A 1E69A 2B98A 3VBEA 3IYLW 2IP1A 2LPMA 5JQWA 2EKDA 2NTYC 4BZZA 1DGQA 4LJ7A 2IEBA 5FOVA 1KFKB 1R9GA 4AWBA 1NFFA 1PL8A 1MG5A 5B6PA 3CEAA 3OICA 1DIAA 3CH5A 3VKWA 5JS6A 4LSMA 4CQMA 1JQLB 1MB2A 1ML3A 2J9GA 2CXXA 3O2QB 4RGQA 4V0LA 1B43A 4WL0A 3VGPA 4BBPA 2I7CA 2XUZA 3ANSA 4IJMA 2OV2A 4A6DA 3TFOA 1XLVA 4PPQA 4QFBA 2AN1A 2H0AA 3W7AA 4M0CA 4D2IA 3H4IA 1P6QA 5FOTA 5FLXA 3HDHA 2PGOA 4LG1A 3OPMA 1WPRA 1NNI1 4XD7A 3VZDA 3CLTC 1JP7A 4B3BA 3M9XA 5BVHA 2GA8A 4MS4B 2OFFA 3HFGA 1JLLA 1GPKA 3BEDA 4HUJA 2GN0A 5BWBA 2GUGA 4QU5A 2IZ7A 4BMZA 3GDGA 4LTDA 1ABFA 4NZZA 2WSBA 5SYNA 2ZTUA 2EJTA 1KTVA 1FLVA 1JXAA 1IZYA 1GQSA 1UT8A 1VG8A 1OVMA 4FXOA 4G8BA 4US1R 2ZREA 1QIFA 1VCNA 1A77A 2H48A 2RSLA 3EIOA 3OKFA 2O3TA 5C35A 2W42A 3GD5A 1JDNA 5DYYA 3L4KA 2RK6A 1E64A 4G23A 1KI1A 1UZNA 2W2KA 4EKYA 4GNKA 3AERB 3QTBA 5CM2Z 2IRWA 2JFUA 2XY4A 5K8JB 3FHTA 2QVCA 1S2GA 1EVYA 4C0WA 5AVSA 5FBRB 1GGNA 4W9RA 2J3DA 4WKNA 4WK4B 1OGYA 2ZSEA 3M34A 1PUIA 2FSFA 3RC9A 3OCVA 2CE7A 4B0OA 4CKCB 3QSGA 4ZV4A 2JLZA 2PO5A 1XCMA 2HWUA 1WNFA 1ISJA 3VSAA 2JKYA 4BFLA 4UU7A 4TQUS 1IZ8A 4UU0A 1LNSA 1YZVA 4P3KA 1KETA 2O59A 3Q6NA 2R751 1Z4JA 3ABIA 1IQRA 2IZOA 4N6OA 2IYFA 3OE7A 1XAHA 1UDXA 2NGRA 1T3ZA 3NAGA 2PJRA 4K05A 4EF5A 2Q0HA 4QSMA 1KPGA 2Z3WA 3I2GA 4CQMB 2IYOA 2J6CA 2IWRA 4B7ZA 4KV9A 5B1YA 5AYVA 2PJUA 4FIZA 4JDPA 3ZWAA 3NKFA 4F3YA 5HS4A 3IUBA 1COWD 4DLVA 3PX2A 3TMKA 2XAAA 3SLRA 3NEAA 2CYBA 1EUCA 2UUAB 4N39A 1P4RA 2NMVA 3MTIA 4QODA 2FWPA 4RK5A 5CURA 1QGZA 3CVOA 1ENZA 1V41E 3W6ZA 1EJ0A 2C29D 3OTIA 5BVHB 3L0SA 5CB4A 4K3VA 3H5TA 5JAIA 1AUOA 1JLLB 4B17A 4E13A 2X6QA 2I87A 1RR6A 1K6IA 2OCAA 2Q2OA 2XB8A 2BR5A 3CSSA 4KIFA 4PC6A 4MGHA 1Z8DA 4ZVTA 4EZIA 4WOPA 4GAEA 4G1BA 3J7AC 1KI3A 2V54A 2NV6A 4O0MA 4CFZA 4IZ6A 1Q11A 1U2DC 4A1OA 1ZNZA 2BL4A 3CM0A 3MCVA 5TQVA 4DMKA 1KP9A 2DPLA 1M1ZA 1BKSB 4J0DA 1ZRHA 4LNHA 1G2PA 4HKTA 2KHZA 3PFNA 2NSJA 4Y98A 2JJ2D 2W2KB 3L04A 4W9MC 5DULA 5CA1A 3M1AA 4C2AA 2ENWA 1YO6A 1AXRA 3LX8A 3U7RA 4B8ZA 4LHXA 1DUSA 1O97D 3JWPA 1H65A 2Y05A 1EUQA 3DHNA 2WY2D 2C4VA 2XUGA 2YX1A 3QLVC 4H4DA 4RHCA 4Q3CA 1L5QA 2IUYA 4L72A 2OP1A 1UK8A 5IWAB 2GDZA 4NARA 1Z0JA 1ZO8A 5DPMA 3PQ5A 2ECPA 1T5DX 3L82B 5DLEA 5EKTA 4CKYA 3DA8A 4CG3A 4OVKA 3WJ7A 4DF3A 2OXIA 3T7DA 1NZDA 3FIUA 3PPIA 4QPZA 4QUIA 5JHHB 2ZYTX 4OXQA 1RM5A 3KEGA 3V6LA 4D41A 5L4SA 4AY2A 3GGJA 4ER5A 3DOJA 2VT3A 4N9QA 1EUCB 1FFHA 1YCFA 4R1PA 4LJRA 2UUCB 3K1TA 3UK2A 2G7ZA 4UDYX 4B2PA 3IBGA 1EJBA 3ES9A 1BS1A 4LK3A 1A1SA 2PD6A 5HF6A 5F73A 1E9VA 1XZLA 2BGTA 2E6UX 1EDOA 1FVHA 1TAHA 1UT6A 2FTKE 2G67A 3CZ9A 2G5PA 3NIBA 1IEVA 2C98A 3MQFA 5E4FA 3U5ZB 4IQ0A 3BWDD 1GA6A 3GYBA 2ADMA 5DNDA 3ZV3A 5T4FA 1SVKA 3W8NA 4EYOA 1IN8A 1EQ2A 2XQFA 3AT1A 4PZCA 4QA9A 3V1KA 4B6JA 2C9MA 3TSOA 2BLNA 1A1VA 2NP6A 1GG9A 3FLMA 3VOTA 2HJ9A 5ANRB 1R4NB 2B9VA 5CCBA 3BCUA 4H31A 1E77A 1X1QA 2DM6A 5CA1B 5B3KA 1RFGE 1JDZA 2QI9C 1JHXA 4H7JA 2FPGA 3IILA 3V9PA 1F3LA 1Z2OX 1UPUA 5JAQA 2ONJA 2RIPA 5JEEA 1OTHA 2VDRB 4EPYA 1P2SA 1R10A 1DKMA 1BDBA 1ITZA 1ORVA 4BIIA 3BJRA 3IBSA 4X7BA 1XFAA 2AI1A 4OU5A 3MBKA 3GEGA 1ODIA 2C3YA 4PZAA 4OK5A 4DY4A 4DEVA 3E05A 3QWBA 4AQ7A 1MB4A 3E7XA 2FR1A 3F78A 3GFFA 4HSGA 1NY6A 3C4VA 4EHKA 4A15A 3C16C 5JRZA 1F4LA 3OLVA 4J16A 1H6CA 3FVQA 2FH5B 3JQ7A 2VP3A 4AULA 1C7IA 3GJXC 2BF4A 3P0EA 4ILKA 5ABPA 5JAHA 2MIIA 1XZPA 1J9ZA 2ZRBA 5JNSA 2PUTA 3D6VA 3SSMA 1I7DA 1A5BB 1Y34E 4ZXFA 2H2DA 3NS7A 1EFKA 4FYPA 4JJ7A 4DXHA 4WEOA 3OEHD 4QEZA 4C7KA 4PRKA 1J33A 4GO1A 1Z73A 4OA5A 2Y93A 4TLAA 1QPZA 1KKUA 2IYLD 2OO5C 3ROPA 2P2LA 1D3AA 2JZOA 3FB1A 1Z4KA 5MGBA 3OM8A 1ZLYA 3B85A 4ZI5A 4U7WA 4U1RA 2WHRA 1UDWA 3KRTA 2RGBA 3HJHA 1L3BA 1ULHA 1W94A 4HXFB 2FJUA 1CZNA 3L8ZA 2DTEA 5JARA 3MLBA 4DMCA 4DYDA 3DFZA 3IAEA 2VWGA 2IHKA 5THKA 4ARZA 2VJOA 3ADBA 2P4EA 3Q41A 3EK2A 3IRUA 4LJLA 5EMLA 3CPHA 3QU7A 1VP9A 2JIZA 1XU7A 4TYYA 4ED9A 4ARCA 2WIDA 3X44A 3EBPA 2PKEA 1DV1A 1P1BA 3LK6A 4AI6A 4ZC8A 4TL9A 3NB0A 5BXQC 2ZZNA 2AQKA 4KQIA 5AI9A 3UUWA 4KE9A 2XNCA 3NORA 4TPKA 4KWCA 1MNAA 1G8GA 1SK8A 2COKA 3G82C 1M9NA 4X41A 4CU5A 2Q9BA 2HLDD 3QUBA 1DXHA 2EDAA 4WQMA 5DIFA 7AT1A 3OIWA 1HC7A 4JVSB 4QDKA 1RI4A 3C3BA 3RS2A 3UAZA 3AKZA 3HRIA 2QM7A 3Q87B 4UJ5A 8LDHA 1TYCA 5ERYA 3GZ4A 4X7MA 3JQ7B 3ZVNA 2GAAA 2CLKB 3WDSA 2LNDA 3A4IA 4CEIB 1VKRA 4LYFA 3O8QA 4B3GA 4W5TA 2WDPA 3PCRB 4G0MA 3P9XA 3ZQJA 4KXWA 2OGWA 5DCUA 5KUTA 5GINE 2ZKIA 3ND6A 2PWPA 1GITA 2WJHA 5JNTA 1GDTA 5LL6P 4IJ6A 4WIAA 3MT9A 3QKRA 1QMGA 2A5FA 3VNVA 5G3YA 4JHLA 3PRJA 2XWBF 3IPRA 1UP6A 1AZSC 1EIWA 3A37A 3N2LA 3HCFA 1X1AA 5JPIA 4C7XA 2ZR7A 5C18A 4DIBA 1GD1O 2XRZA 5HJ7A 3L8MA 1W5SA 1M8KA 4ZRMA 3RVKA 3CYFA 3V4PB 2PTHA 1I4OA 1R6UA 1VJTA 1NVXQ 2FPRA 2QPOA 1D2HA 1GZDA 3F7NA 3QPBA 1N34B 2VDJA 3HVJA 2IWHA 4URXR 3MFQA 4FOOA 5AHKA 3RFFA 3CINA 2O5VA 1FQWA 1U3FA 3BERA 4BVJA 1JQ5A 4NYMQ 1L7VC 4YN3A 1NVDA 2FRDC 5DCYA 4BJ5A 5IABA 1VG1A 2XCTB 1TQDA 1O9GA 1UFVA 5IDYA 4DBLE 1NNEA 3PB3A 4WFIA 1JDBC 2ZXUA 1JLKA 2F8SA 3GFGA 1ARZA 3NBFA 3HXOA 4CKBB 4DC1A 1B14A 3H84A 5A5GA 4CV0A 2PPLA 2UVQA 4Y2RA 3WB9A 4Y0VA 2ZB8A 2CXQA 3MYRA 5JSUA 1THZA 1HNXB 4LZLA 1ZVMA 3FSEA 4A82A 2SKCA 2I1VB 3IEXA 5DK6A 1P2UA 1U5BA 4DHEA 3O8QB 1XYYA 1RYHA 2GCIA 4XWTA 3UKDA 4E11A 5AW4A 2W0SA 1M2VA 1K2WA 2PAAA 1N5IA 2WIFA 3G89A 4LYHA 4PTYA 4Q02A 4ZVVA 2J9ZB 2IU4A 1F06A 3ZG6A 2H4XA 3D8TA 4TL7A 1SGWA 1YAJA 3HYSA 1OPXA 4V0NA 4BKPA 2B1QA 3UPDA 2D0OB 5FBLB 3AZPA 3SX0A 2GKSA 2CHEA 4M7OA 4MWOA 1YZYA 3N1UA 1U0EA 1OLSA 2CFRA 4M54A 1ZCBA 2V5AA 1R4AA 1N0IA 3DBOB 3IMKA 5TR9A 2O0MA 4FX2A 4BDSA 4QYSA 3BGSA 2FFJA 4OD0A 2ZYVX 3AM3A 2Z1MA 1IJEA 3CN9A 3PBKA 3NW9A 5EIBD 5C46F 4LV8B 2XCQA 2HKIA 4D8WA 4JGBA 3T9FA 4CM1A 5LQAA 3HLKA 2IXAA 4ZT2A 2CBGA 4RZQA 2HV8A 1YZNA 2WPDA 4YRPA 3IT2A 1Z0ZA 4MJ3A 4IVNA 4CL0A 2Y9MB 4OO3A 4U7FA 3IIJA 3P32A 1XB2A 1RSZA 2DBYA 5FWXA 2R2GA 3GWGA 3N0VA 3UATA 4HFRA 4DBVO 1TIBA 5IHXA 2UYOA 5TQJA 1L5SA 2OM2A 3SZ3A 3OIYA 4N5IX 4W4TA 2Q3FA 3PGLA 4RZHA 3RFVA 5BWMA 1QLHA 1M67A 1ODSA 2O6HA 5ADVA 3GLHB 4MWDA 1VJGA 4JLOA 1W19A 3B52X 3SPXA 3FOWA 1Q22A 5IVPA 5AM1A 2CB0A 2ECKA 2ORVA 3AVQA 3PXAA 4UBIA 3UV7A 3GI1A 3BS4A 3H9CA 4YJFA 1RAEA 1M2VB 1VXOA 4YCBA 2XMRA 4PYRA 4DL9A 1K7XB 1ZCFA 3HJNA 4DR1B 2DPXA 2IH4A 3G2IA 4MR8A 4QVIA 1YBHA 3D7SA 2VHVA 3KL2A 1D5CA 4EUEA 2BZ1A 1VP3A 4OKIA 2BJVA 1QE3A 3EEYA 4YUYA 4E7OA 1OLSB 5G0TA 2PUAA 2IOYA 2ZAYA 5T5QA 3CVJA 3U62A 1R9MA 1UWVA 3PDJA 3NHWA 1WDTA 3NHKA 1V11A 4HN2A 4IIUA 4C20A 2E85A 2EZUA 3PX3A 5FNZA 4MR9A 1NU8A 1O03A 3WGOA 5CG1A 3KSBC 2XBUA 2GT1A 4J7XA 1RRMA 2QE7A 3T7EA 2RK3A 1Q14A 5C80A 2DT5A 2QD4A 2O20A 3CUUA 3EUFA 5KMGA 1YF3A 1O9BA 1XQ6A 4CZ2A 3BK1A 1NBIA 4HOYA 2NUTA 4AWAA 3BE8A 4N48A 1N6PA 1GQRA 2NZXA 2V65A 3D0OA 3EA0A 1W4BA 3O9ZA 3P19A 3IAUA 3PQDA 2WU3A 5HDQA 3C3PA 3EUWA 4M53A 3PTAA 4R0NA 2H4JA 3AEYA 1CFJA 3DONA 1U3GA 3G0GA 1NBMA 2RH4A 2V6MA 3WB2A 1G3UA 5B1IA 1JR3D 1JJVA 1NSTA 1YA4A 4GOLD 1XVAA 3R41A 4J4TA 3RTEA 3R7AA 1TZJA 3SXJA 3TE6A 5GIPE 1JYEA 1YT5A 1T4MA 3IQDB 1VCHA 1SB8A 2XZPA 4P4GA 1KQPA 1U7DA 1UDRA 3ZCQA 5E4JA 3NWJA 4IGAA 4L6CA 3FMPB 3ASYA 3WICA 3SJZA 4OQZA 1EWTA 5FR2A 1ECLA 4W5QA 3LP8A 2GPWA 5KU1A 2GXSA 3VPAA 4RM3A 2C2OA 5FLYA 1I32A 3A4NA 1NOJA 4PZEA 4YJFB 2CDCA 3UKJA 3HMQA 1FB5A 1GLVA 1LNZA 2J45A 1QV7A 1L5ZA 2WHQA 4JASB 4II2A 1YHNA 4MR8B 3EAQA 3WNCA 4XUCA 3W34A 4H6WA 1U7XA 1F9EA 4H4CA 3MWEB 5LDGA 1TVEA 1QOPB 1V1RB 2GWRA 3O4VA 4I9GA 1R2QA 3PEUA 3EJ6A 1C3VA 2HMAA 4GVPA 5TX7A 1V11B 3X1ZA 4MUIA 3HBLA 4W5NA 2G9UA 1VGQA 2YS7A 3GW8A 1X7WA 3ETGA 4PONA 2UYGA 3FUUA 3K8QA 1Y8ZA 2NUTB 1RW4A 4IDEA 2PQ2A 1ZGZA 2JGKA 1EHYA 3F90A 3LO8A 1MEOA 1THMA 2GEDA 4FCVA 4FI3F 2A67A 3OPYA 3UICA 6LDHA 3B6EA 1E58A 1C30A 1L8AA 1CR2A 1JSCA 1VB3A 3H2YA 4L9WA 4ERXA 1P5RA 3I83A 5E7QA 3DVAA 2BRUC 4RMGA 3PYXA 2I29A 1NPDA 4RXTA 1GYRA 3SI7A 4ZI2A 3RADC 1Z0KA 2UU9B 1JEDA 3U4GA 2A88A 1LPMA 2EW8A 3AHJA 2WJGA 4PGMA 3WLHA 4NS1A 4J9UE 1LJUA 4P3XA 4UDNA 4PFJA 1NYLA 4MUGA 3A6ZA 4ENTA 2NZJA 3RRZA 3FYUC 2W6JA 4ZDKA 1Q0SA 3HHEA 1I5EA 3OX3A 2KYRA 2FVYA 2P8JA 5DN9A 3ZKAA 3ZE7A 2HL6A 1V6AA 3C4JA 3WQQA 4F38A 1DBQA 5EIWA 3NH6A 4OP2A 2CMDA 2F43B 3PXEA 3VOAA 3EYWA 2GZ1A 2VRCD 4GKAA 3DVQX 1BU8A 3V1NA 3A6GA 3LC0A 1CB0A 4BBJA 1PD0A 3U3KA 2O0JA 2X9LA 4DCUA 1OMOA 2WFMA 4F0JA 3OUTA 1V8OA 2BD0A 1W4CA 4JD5A 2CVHA 2AKAB 1R8SA 1AGPA 2E4WA 4L15A 3VTAA 1ESNA 1X7WB 3ZUPA 1VL8A 3U7EB 4PWZA 3TMAA 1PI3A 4IDAA 2VLBA 1HRKA 5ARBA 1GRQA 3DC7A 4X3OA 5HQTA 4BZQA 1RJWA 1HEYA 2OENG 3UTCA 3Q4GA 3OPYB 1V9CA 2YHBA 5DXAA 1E6CA 1C30B 2Q5QA 3EA5A 1DEHA 3NGLA 3QVLA 2BHLA 1PGQA 4H1UA 4KQMA 5G0UA 3DVAB 2O2IA 3T1YB 3L06A 1C0LA 5A6VA 1SUDA 3BWCA 4K9NA 2B61A 1AU9A 1ULUA 1DRWA 3AHDA 3TF5A 2FI1A 1WCWA 4X97A 5G1NA 4UZSA 4KITB 1RM0A 1H69A 2OD7A 2GGSA 2P69A 3N05A 3K4PA 1E9CA 2Q3DA 4CT0A 3S81A 4F7WA 4LXUA 4QZVA 1A5ZA 2FZ4A 1E4EB 2VK4A 1AK9A 1Q50A 4KPGA 4NU8X 3VR6H 3WOHA 5J1SB 3FZQA 1JILA 3DV0A 4KMMA 4OH7A 4C87A 1SM4A 5I8PA 3AINA 1FLAA 4FLMA 3ML1A 3OE5A 4IHKA 3WLOA 2FMXA 1EESA 1ZGGA 4KVGA 1IG0A 2I4LA 1A8UA 3ZS9A 1G5TA 4RESA 4EG7A 3I28A 4S1TA 1WY7A 2IFTA 1WSAA 4U7TB 1ODJA 3B70A 1A5TA 4E08A 2WAMA 4MUXA 2C5AA 4EG0A 2P9JA 3ZHVA 3P52A 3NTXA 2P0AA 4WUVA 1OFTA 2D2FA 3VZRA 3RRXA 2Y92A 3VAZA 3CKKA 3G59A 4XCQA 4NOMA 3WWCA 1IXSB 1SVLA 2Q1XA 4K2AA 4R8SA 3BGIA 2ORIA 2VJPA 4R4JA 2AOTA 3U17A 5I45A 4MHTA 4R2XA 3FETA 1KO1A 4JP8A 1IQUA 1BYUA 4BNWA 4XIFA 5IZCA 3ZJ4A 3GLQA 1AF4A 3CZCA 1KYYA 2IVZA 4MUNA 4BN0A 3VYSB 3PUVA 4DY6A 3CPSA 1E3EA 1HDRA 4B35A 1Q0RA 4LHSA 1TM4E 4H15A 2H7YA 5JI2E 3OEEA 1C7EA 4J9VA 2Y1DA 1MDFA 3SIRA 1IDN1 1LLCA 4L3WA 4C29A 2XRMA 5F7OA 3JQ6A 2O8EA 1PSWA 5IFKA 1E63A 3INGA 4IDQA 5JMPA 1OH5A 1RPAA 2PKQO 2C96A 1S8NA 3PDUA 3ESAA 4J2OA 2ERCA 2P3SA 3C3AA 2HZBA 3DV0B 4D46A 4KQ2A 7MDHA 2PJZA 2HO5A 1KMNA 3PNPA 4KB5A 4Q3EA 3ZGXA 3WYGA 4JB3A 4D96A 2PT5A 3C5CA 2HTFA 3AVUA 2XA1A 8GPBA 4JKOA 1IFXA 4FW8A 2HRDA 3LDFA 3TNLA 3IV6A 1UADA 2XB9A 3DAFA 2YW9A 4YH1A 1UC4B 5DNUA 2BH2A 2FPOA 1G2QA 1II0A 2YJNA 3ROXA 3VHRA 4DKXA 2QL9A 2P90A 1AKWA 5E7MA 3BF8A 3IJPA 1ILEA 2EC5A 2PK3A 3C5WP 1BXGA 1CQXA 1ZC3A 3MXOA 3FUXA 3L7NA 3DVLA 4LJ4A 2QTFA 4L1KA 2AOTB 2PVCA 1BAPA 1W6RA 4UM9D 4RDHA 5I7FA 1Q16A 3CU5A 3EEFA 4LK2A 1DAFA 1CIJA 1TQ4A 3SHFA 1DFIA 1FDVA 1L7AA 3AJAA 1NQAO 2RHHA 1Z8FA 3IVMA 4X93A 3IV9A 4P3PA 4CCYA 3DP7A 4B3RB 4LBWA 4TT3A 1QOQB 2PX0A 1T3TA 3UJPA 1LSJA 2HDHA 4QOIA 4ALKA 2AF3C 2BPOA 3M6WA 3HZHA 4CDGA 3T35A 2GCEA 4RNCA 4LDNA 3RS4A 2O8EB 2HGZA 3E0XA 3A2KA 4N3AA 2Q6VA 4GW3A 1XKTA 4BKUA 1JMKC 221PA 1FPMA 4M76B 4G86A 2OBFA 1GPJA 1C8LA 2A9KA 4L74A 3R77A 3KKZA 1LF0A 2EG5A 4M0UA 1N1GA 3UT5B 4F9GA 4IJKA 1AT1A 2HCFA 3T6KA 4RHXA 1HWYA 4GGPA 1S2NA 2V6IA 2OEPA 4JI2B 1YK0A 2J3MA 1R6DA 2XHZA 2ZBGA 1WVMA 3B2EA 3I6IA 3JWHA 2R9VA 4Y2HA 4YRFA 2XMSA 4J43A 2J7PD 1NVEA 4X20A 1P62B 4TYMA 3NP9A 4MPRA 3G9ZA 4QT4A 1IXZA 1H4TA 3C5VA 1K88A 4YUWA 5K5EA 4NE7A 2JGAA 2DR2A 2F8LA 1TPZA 1SQ5A 3OZXA 2VCEA 3VR6D 4M60A 3I2JA 3KB1A 1QZTA 4Q4LA 4A2CA 1NM5C 3RVQA 1BXGB 2WUEA 4C4TA 4DCSA 3BICA 4AF8A 4RD4A 3LXMA 1VTKA 1NR1A 1MOSA 4JI3B 4NWIA 5H02A 1LCIA 3QHAA 1BW9A 1TMGE 2AMYA 3I2YX 1GCGA 4GZ5A 3AI2A 1I7SB 2F3TA 1XQWA 1J5PA 4BLVA 1M7BA 1EVEA 1MAAA 4LOIA 3FPKA 3TCXB 5C81A 5LNK1 5KTYA 1E8NA 2Z83A 1BTOA 1DJNA 4NE9A 5TVKA 2NP7A 1P0CA 1GIAA 3L01A 1M1YE 2EU8A 4HQ6A 3SC2A 1FP4A 1UP4A 4CCYB 3M6MD 3HXTA 1DXQA 3L9WA 3LT2A 1OYYA 3L8YA 1AGYA 4HEHA 4L02A 4BWVA 2P67A 3UNXA 2FR0A 2IEGA 3AGQA 5CR9A 5TGZA 2CNWA 1JTFA 3T7TA 3DDSA 3JQGA 4G8DA 1N8KA 4JBHA 4YXFA 3HB4X 1L7NA 3KYDA 3LQ2A 4R9RA 3MNFA 1J2UA 3B1XA 3STXA 3ASVA 4LW8A 1MAWA 5B2FA 1GJRA 1HQCA 2Q50A 3G6WA 4Q3NA 4XLLA 1EUDA 2QY6A 3NRBA 3D7LA 1J70A 2Y1EA 1OXUA 4FE4A 2G5CA 3ZZNA 3KVNA 1QM5A 2D3WA 3IIMA 4MKRA 5AKEA 1L7BA 2R8RA 2BFMA 4ZVSA 1Q0TA 2WBLC 4ICIA 1YCGA 2NXJA 1JU9A 2GLXA 2H9IA 2K7ZA 4X20B 2AT1A 2YZNA 2P2GA 3FR8A 4OQDA 1TT7A 2ISQA 2O7NA 2R48A 4V39A 1PIWA 4LFAB 3L7AA 3OBIA 1AIPA 3VH3A 4LBYA 3HWX1 4UBJA 2C7RA 1Z12A 2BAGA 4TROA 3NTQA 4HAUA 1IJKA 4ZOLF 3B13B 1J23A 2Z57A 1O5IA 4G07A 3GRFA 4LE0A 2J0QA 4F7DA 3ICOA 4G9BA 4OG2A 4R1NA 2C04A 4BUJA 1BW9B 1KJYA 5HA5A 2DLCX 1G16A 5D5HA 1IZZA 2XRFA 3ER9A 4C7JA 4DMGA 3SS7X 4OGWA 4RORA 3G5MA 3K4HA 4GL4A 4I1RA 4ALMA 5G53C 1CR6A 2YFQA 2E5WA 1CZKA 3IMFA 3SC2B 1FP4B 3LOQA 3T61A 3USES 4ZYYA 4FN4A 1HDEA 1JSZA 2CVFA 5KNBH 2NO0A 1NR5A 5F9FA 4LXHA 5LXTF 1EA5A 2Q27A 2VPYA 3W05A 3BC1A 4JWTA 4L75A 3UWKA 5CPFA 5FXMA 3KYDB 1WXQA 1V3QE 4Z4GA 3K1YA 5EHNA 4DJTA 4B5LA 5C52B 3ZGLA 1THGA 1E1YA 3AI1A 1XF1A 3N86A 1JQBA 3G8AA 2ZJ3A 2PX2A 4N41A 3JY6A 3LUCA 3Q2OA 1LVGA 3NHYA 1HLDA 2HK8A 3LLUA 2G1PA 1XKQA 1IVSA 3UC5A 1F8FA 1EE2A 1EIZA 1DZIA 2FXIA 3DDZX 5ERXA 1U81A 3RHSA 4PQGA 3LQRA 4HZIA 4RFLA 4YDRA 3LTEA 1PVVA 4I5DA 5KYYA 5G2OA 2AW3A 1EDZA 4Z7QB 3SHTA 2OCPA 4XM0A 1M6YA 1O1YA 2ZIEA 3MPUA 3NNDA 5BSRA 5IJWA 4H6VA 3OLCX 1MB3A 3D4PA 1BEEA 3U31A 2JZCA 1KZ7B 2UZ1B 1ONPA 4G37A 5JSKA 1U8TA 2QZ4A 3BJEA 5JAPA 1N3IA 5I7RA 2FEMA 3VPSA 4EW1A 3SEZA 3F7OA 3VNAA 1R6XA 1Y3HA 4OHRA 5CLQA 4EY6A 5GWXA 3BIWA 3ZWQA 2QX8A 1VFPA 2MSCB 4D0GA 3EJWA 1BQ3A 5DLDA 1S8AA 4Q9JA 3SGLA 2JASA 3YASA 2WUVA 5BN3A 1F2TB 1OV4A 2KJQA 3P0IA 5K0FA 4TV8F 1XJQA 1EXMA 5J2TF 4PLFA 2BBTA 4HMQA 3JQBA 1V16A 4TKLA 4TLBA 3D0RA 4MA4A 3U09A 4LRSB 4CV3A 1J09A 1N8TA 1FMLA 1RJFA 4YRZA 4REQB 2JFOA 1C50A 1G8HA 1I3KA 3Q3GE 5T41A 3S70A 3GF4A 2IH2A 3FN4A 2BGLA 2NSLA 3TH5A 4G63A 1QRTA 4LNAA 3F8WA 3H0KA 1HQKA 4KP7A 3U4DA 4UBLA 4EI7A 1REQA 4B80A 2GR9A 4WNCA 1W0CA 1JEJA 3TLMA 5C7YA 1D7AA 3WRVA 3OU6A 2AG8A 3S55A 2O3UA 3OG9A 4ZCPA 3LQ1A 4QAQA 4RD2A 5L7YA 1J2YA 3A3NA 4URUR 3RRBA 1OBHA 4LOKA 3TAHA 1P1HA 2OCBA 3ZEAA 3AM1A 1S6YA 2W9XA 1QYCA 4IDPA 3LDAA 4AUKA 1PF7E 4NZPA 3HA2A 4Q4AA 4F56A 1MR3F 1RZRD 3B60A 4YY3B 5IAGA 5KYYB 3KHUA 1ZIOA 4PVDA 3EMDA 1E0AA 3D3NA 3SEQA 5EKUA 4AJLA 2QW8A 2X5JO 4N01A 2VDWB 4R7GA 2O8DA 1BA3A 3MCUA 1CNEA 3RASA 1QFYA 1Z22A 2CLCX 3RUEA 1OZ0A 2MDTA 1UIRA 2P5SA 1RS0A 2JEYA 3MT8A 2O2JA 4R01A 3WDLA 4BUZA 1SXJA 3KAKA 4EO4A 1X1SA 5IG2A 2X19A 5C32A 4ESVA 1Q20A 2HMUA 1TF5A 5E1BA 1NZJA 4M21A 4QUEA 3RM3A 2AR0A 4XLTA 2M6RA 3RSZA 1KEVA 2ESRA 2LW7A 1RLJA 3N2EA 3Q3EA 3QXCA 4FGZA 1U31A 4RSHA 4ACBA 4D4HA 3ENQA 4IEEA 2WWTA 2JLXA 2WMDA 4OHKA 1R6AA 1V16B 3K2EA 4US0R 4KYTA 2PL3A 3ZHCA 3BOSA 2GEFA 3MWYW 4WLFA 3R4CA 4KKXB 4E2WA 1Q2XA 1YI8A 4LWQA 3WI7A 4AXXA 3PX7A 2MR5A 4BQIA 1H2YA 3DMGA 3ZJYA 3ZU3A 4GD3Q 3S2ZA 4AN4A 5PNTA 4W5OA 3BK2A 1PYGA 1HXHA 5CDFE 2JI4A 1M2KA 2BN4A 4RC9A 1J8DA 2M6LA 3RRNA 3QOXA 2F4VB 1P3DA 4PLHA 4ROSA 5AHOA 5EXDA 1R8YA 4V2UA 3SF0A 3ZWBA 4F1KA 3QVGA 2FX3A 3LSTA 3VO9A 1Z5ZA 4LECA 1TO6A 3SEAA 4YCDA 2ZANA 1V5GA 4YRTA 3IODA 5EP3A 2QTLA 4Q4AB 3NYRA 1HYQA 4J3FA 2IEDA 4Q93A 1FSPA 4CEJA 1MX1A 1SVSA 4O1MA 5EKSA 4YJKA 3WZMA 1KEEA 3EWAA 4IS2A 4ZMRA 3FHLA 3EG5A 4ZOLA 5LA6F 4AYTA 5JRJA 2J3QA 5KOHA 4EM6A 4QWWA 1Y9EA 2O8DB 1DOHA 1SCIA 2RAPA 3KU4A 1AMUA 4Q1DA 1ZD2P 1KL7A 1P9RA 3OJ0A 3EIFA 1Z0SA 5IAEA 1CZOA 5A9TA 1T35A 1NJFA 2A0UA 5JSQA 2R6JA 1FRFS 5FPQA 2C1XA 4PG4A 4FBLA 3AHGA 4EW2A 2BSAA 2HGSA 2ZI6A 3M4ZA 2AMFA 3B78A 4HRXA 4FKMA 4WDQA 5ALLA 3RFXA 1EWYA 4WKCA 2QTAA 4OLFA 1D8TA 4GG1A 4HLDA 4O2AF 3UXYA 3C7CB 1RWNA 3ADKA 5I8ZA 1N36B 5COBA 4OH1A 5LXTA 1X87A 2HFJA 4G01B 4M8KA 1JPVA 1S5PA 2Q29A 4RVCA 4W5JA 4PN3A 4FQ8A 4GBGA 5U4QA 5F78A 3UM9A 4UTVA 2BFCB 2VIIA 5FD8A 3DT6A 2A0YA 4JP5A 4BO9A 1EFRA 4M7PA 3CIFA 4AZ3A 5EJAA 3GLHE 3PQCA 1MGOA 2Z9DA 1LQUA 3ELWA 1Z5UA 3W9YA 5KWVA 4KFCA 4HP8A 4L5JA 1ZJWA 1L1QA 1JECA 1JR4A 1RDFA 1U9IC 4LWOA 2X76A 3JD1A 4K81B 3V80A 3ETNA 1CDDA 4XVCA 2CBZA 1PQUA 2VYVA 4QG3A 4Z0NA 1CY8A 3QA3E 3QVGB 1MVNA 2QOEA 1YC2A 4PGAA 3PFGA 3NVKI 1HSOA 4MJLA 1DEXA 1ZRMA 1H3NA 3RLIA 1ABEA 3GH3A 4AJEA 1QG2A 1P74A 4CEJB 1FFEA 2PLWA 2VDQB 4F60A 1BOOA 1KEEB 3JXEA 3OCXA 4YMWA 1PDOA 1WETA 4W82A 1E9AA 3HPRA 1W1IA 3MCTA 4ZOLB 5AT1A 5KOHB 1YNSA 5CFNA 5JISA 2QZSA 1SK9A 2VCYA 2J07A 4WCDA 5IC6A 4N0QA 1JLRA 1O7JA 1YJ5A 3FA2A 2ZRMA 4B87A 3N8DA 1NZFA 1ZIXA 2F1JA 1E6MA 2XE4A 1XJ5A 3DBRA 3PNLA 4XQGA 4BEJA 1Y48E 1MZPA 2VL7A 4KWIA 1R9JA 1Y5IA 4TV8A 2YFYA 3UWOA 5JCOA 3V4ZA 4B74A 1KYIA 5J2TA 2YBEA 4L5CA 3B48A 4QDUA 1U99A 1W5AA 3UQZA 1L7MA 3LI2A 5LXTB 4ND7A 1GTMA 1FS6A 4YDQA 1BFKA 3MGKA 3DFFA 4EY7A 3PGKA 3KVOA 2JBWA 3DJYA 4LJAA 3GUYA 4NU0A 4ZGBA 1VA5A 1E7YA 2JGRA 4RFSA 3RI3A 1NJGA 5HBRA 5HK9A 3U44A 3DLPX 3QX7A 3O8RA 2VBIA 2YJ5A 1T8RA 2GEKA 3KT3A 3QMVA 4AZ3B 4OYLA 2ZRPA 5CNKA 1ANKA 1E9EA 3TW4A 2C3PA 2QD2A 4IXMA 5L9AA 2J3HA 2IHBA 2QLBA 2PS3A 3PPXA 4Q21A 3WMFA 3FYTA 3TQCA 4EI2A 1WMEA 2PA0A 5E1MA 1PNOA 1VOTA 2HEIA 4U0KA 5FUQA 4HDAA 3DTVD 5JOQA 1E1CA 2X4GA 3O8NA 4PE5B 4TXHA 5ITSA 3GLVA 4JBYA 4UQLA 1Y7TA 3E81A 3N6XA 2PS9A 5FWDA 4N18A 3GNLA 5BSGA 2BKEA 5CGZA 2ZUCA 4FZ5A 4TXLA 2I55A 2ZQZA 4EJ2A 4NF2A 5FP0A 5IVIA 4LY6A 3WV5A 2I4OA 5HK8A 2X3UA 3EMBA 4FUQA 4ZXPA 1KDRA 2PKRA 4E31A 1ZL0A 2NQ8A 2WP0A 3S28A 4U63A 2PFKA 3SSAA 1ZU5A 4BPBA 1R0YA 2QR5A 2G3YA 4D9MA 2Y1GA 2NSDA 3ZN2A 4BVKA 4U2CA 2K2WA 2CKDA 1EG2A 4IOLA 2AE1A 4BQRA 2EZ8A 3GDFA 4I3GA 4TV8B 3VSDA 2PWAA 4RKWA 1KEZA 3PDIA 2AR7A 5J2TB 2DFKB 1UP7A 4DV7B 2L69A 1KJQA 2RGDA 1U7TA 1Y98A 3LCVB 2X15A 3CUSA 2VTEA 3Q9SA 3IUQA 3ENZA 3UEOA 3AHEA 5FI5A 1YTLA 3VZPA 2V7UA 1NTRA 1R64A 2ZI9A 2QVLA 3OFKA 4ZQGA 4AECA 4Z0HO 5FUMA 3U44B 4RFSB 2I33A 5C5EA 1SUIA 5JYBA 4BLQA 1S9DA 4CGZA 4KN6A 4JI7B 1YJBA 3PJFA 3FPGA 5CX1A 1W49A 4EY5A 2KWIA 1ST3A 3I2IA 3E3LA 4P22A 1HYHA 1LX6A 4PGHA 3ZLTA 2W2LD 2VJBA 4YCMA 5HW0A 3RSCA 3STWA 1Z8NA 2I8LA 2Z0MA 5KSOA 3G1UA 1LBIA 1E1CB 2RMKA 1NN1A 3DC2A 4RKQA 3PTZA 5AHRA 4YP6A 4BNMA 3TOSA 5LP6C 4ESHA 1XNRB 1KKMA 4A6PA 1FUKA 4MRRA 1KR5A