1AK4C

Human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human cyclophilin A bound to the amino-terminal domain of HIV-1 capsid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/isomerase
molecule keywords CYCLOPHILIN A
total genus 45
structure length 145
sequence length 145
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1ak4C00
1EIAA 1M9DC 3H4EA 3H47A 2XDEA 2V4XA 5HGLA 2M8PA 4U0BA 1P7NA 4XFXA 1EM9A 4U0AA 4U0CA 4XRQA 4DGEC 4HTWA 5HGNA 1M9YC 1M9XC 2KGFA 2WLVA 2XGUA 2XGVA 4E92A 4E91A 5HGMA 4PH0A 4QNBA 4NX4C 2M8NA 1G03A 5HGKA 1L6NA 2EIAA 1AK4C 3BP9A 1D1DA 4U0DA 1M9FC 4INBA 4U0FA 2X82A 4J93A 4PH3A 4DGAC 4WYMA 4XFZA 1U7KA 1M9CC 2PXRC 4B4NA 1GWPA 2JPRA 2WLVB 2PWOA 2PWMA 2X83A 2LF4A 3NTEA 1QRJA 2X2DD 3P05A 4PH2A 4XROA 2GONA 2M8LA 4XFYA 1M9EC 5JPAA 2GOLB 1E6JP 1AFVA 3MGEA 4LQWC 4U0EA 5HGOA 2Y4ZA 2XGYA
chains in the Genus database with same CATH superfamily
1EIAA 1M9DC 3H4EA 3H47A 2XDEA 2V4XA 5HGLA 2M8PA 4U0BA 1P7NA 4XFXA 1EM9A 4U0AA 4U0CA 4XRQA 4DGEC 4HTWA 5HGNA 1M9YC 1M9XC 2KGFA 2WLVA 2XGUA 2XGVA 4E92A 4E91A 5HGMA 4PH0A 4QNBA 4NX4C 2M8NA 1G03A 5HGKA 1L6NA 2EIAA 1AK4C 3BP9A 1D1DA 4U0DA 1M9FC 4INBA 4U0FA 2X82A 4J93A 4PH3A 4DGAC 4WYMA 4XFZA 1U7KA 1M9CC 2PXRC 4B4NA 1GWPA 2JPRA 2WLVB 2PWOA 2PWMA 2X83A 2LF4A 3NTEA 1QRJA 2X2DD 3P05A 4PH2A 4XROA 2GONA 2M8LA 4XFYA 1M9EC 5JPAA 2GOLB 1E6JP 1AFVA 3MGEA 4LQWC 4U0EA 5HGOA 2Y4ZA 2XGYA
chains in the Genus database with same CATH topology
1EIAA 1M9DC 3H4EA 3H47A 2XDEA 2V4XA 5HGLA 2M8PA 4U0BA 1P7NA 4XFXA 1EM9A 4U0AA 4U0CA 4XRQA 4DGEC 4HTWA 5HGNA 1M9YC 1M9XC 2KGFA 2WLVA 2XGUA 2XGVA 4E92A 4E91A 5HGMA 4PH0A 4QNBA 4NX4C 2M8NA 1G03A 5HGKA 1L6NA 2EIAA 1AK4C 3BP9A 1D1DA 4U0DA 1M9FC 4INBA 4U0FA 2X82A 4J93A 4PH3A 4DGAC 4WYMA 4XFZA 1U7KA 1M9CC 2PXRC 4B4NA 1GWPA 2JPRA 2WLVB 2PWOA 2PWMA 2X83A 2LF4A 3NTEA 1QRJA 2X2DD 3P05A 4PH2A 4XROA 2GONA 2M8LA 4XFYA 1M9EC 5JPAA 2GOLB 1E6JP 1AFVA 3MGEA 4LQWC 4U0EA 5HGOA 2Y4ZA 2XGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIA A;  1M9D C;  3H4E A;  3H47 A;  2XDE A;  2V4X A;  5HGL A;  2M8P A;  4U0B A;  1P7N A;  4XFX A;  1EM9 A;  4U0A A;  4U0C A;  4XRQ A;  4DGE C;  4HTW A;  5HGN A;  1M9Y C;  1M9X C;  2KGF A;  2WLV A;  2XGU A;  2XGV A;  4E92 A;  4E91 A;  5HGM A;  4PH0 A;  4QNB A;  4NX4 C;  2M8N A;  1G03 A;  5HGK A;  1L6N A;  2EIA A;  1AK4 C;  3BP9 A;  1D1D A;  4U0D A;  1M9F C;  4INB A;  4U0F A;  2X82 A;  4J93 A;  4PH3 A;  4DGA C;  4WYM A;  4XFZ A;  1U7K A;  1M9C C;  2PXR C;  4B4N A;  1GWP A;  2JPR A;  2WLV B;  2PWO A;  2PWM A;  2X83 A;  2LF4 A;  3NTE A;  1QRJ A;  2X2D D;  3P05 A;  4PH2 A;  4XRO A;  2GON A;  2M8L A;  4XFY A;  1M9E C;  5JPA A;  2GOL B;  1E6J P;  1AFV A;  3MGE A;  4LQW C;  4U0E A;  5HGO A;  2Y4Z A;  2XGY A; 
#chains in the Genus database with same CATH topology
 1EIA A;  1M9D C;  3H4E A;  3H47 A;  2XDE A;  2V4X A;  5HGL A;  2M8P A;  4U0B A;  1P7N A;  4XFX A;  1EM9 A;  4U0A A;  4U0C A;  4XRQ A;  4DGE C;  4HTW A;  5HGN A;  1M9Y C;  1M9X C;  2KGF A;  2WLV A;  2XGU A;  2XGV A;  4E92 A;  4E91 A;  5HGM A;  4PH0 A;  4QNB A;  4NX4 C;  2M8N A;  1G03 A;  5HGK A;  1L6N A;  2EIA A;  1AK4 C;  3BP9 A;  1D1D A;  4U0D A;  1M9F C;  4INB A;  4U0F A;  2X82 A;  4J93 A;  4PH3 A;  4DGA C;  4WYM A;  4XFZ A;  1U7K A;  1M9C C;  2PXR C;  4B4N A;  1GWP A;  2JPR A;  2WLV B;  2PWO A;  2PWM A;  2X83 A;  2LF4 A;  3NTE A;  1QRJ A;  2X2D D;  3P05 A;  4PH2 A;  4XRO A;  2GON A;  2M8L A;  4XFY A;  1M9E C;  5JPA A;  2GOL B;  1E6J P;  1AFV A;  3MGE A;  4LQW C;  4U0E A;  5HGO A;  2Y4Z A;  2XGY A; 
#chains in the Genus database with same CATH homology
 1EIA A;  1M9D C;  3H4E A;  3H47 A;  2XDE A;  2V4X A;  5HGL A;  2M8P A;  4U0B A;  1P7N A;  4XFX A;  1EM9 A;  4U0A A;  4U0C A;  4XRQ A;  4DGE C;  4HTW A;  5HGN A;  1M9Y C;  1M9X C;  2KGF A;  2WLV A;  2XGU A;  2XGV A;  4E92 A;  4E91 A;  5HGM A;  4PH0 A;  4QNB A;  4NX4 C;  2M8N A;  1G03 A;  5HGK A;  1L6N A;  2EIA A;  1AK4 C;  3BP9 A;  1D1D A;  4U0D A;  1M9F C;  4INB A;  4U0F A;  2X82 A;  4J93 A;  4PH3 A;  4DGA C;  4WYM A;  4XFZ A;  1U7K A;  1M9C C;  2PXR C;  4B4N A;  1GWP A;  2JPR A;  2WLV B;  2PWO A;  2PWM A;  2X83 A;  2LF4 A;  3NTE A;  1QRJ A;  2X2D D;  3P05 A;  4PH2 A;  4XRO A;  2GON A;  2M8L A;  4XFY A;  1M9E C;  5JPA A;  2GOL B;  1E6J P;  1AFV A;  3MGE A;  4LQW C;  4U0E A;  5HGO A;  2Y4Z A;  2XGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...