1AK4C

Human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLOPHILIN A
publication title Crystal structure of human cyclophilin A bound to the amino-terminal domain of HIV-1 capsid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/isomerase
total genus 45
structure length 145
sequence length 145
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1ak4C00
4E91A 3NTEA 4U0BA 2Y4ZA 4U0CA 1M9FC 1AFVA 4DGAC 1P7NA 1U7KA 1G03A 3BP9A 5HGLA 2PXRC 5HGMA 2GOLB 1QRJA 2PWMA 1GWPA 4DGEC 2X82A 4PH0A 4XFZA 2LF4A 2WLVA 4U0EA 5HGKA 4E92A 3P05A 4NX4C 4QNBA 4U0DA 5HGNA 1M9XC 1EIAA 4WYMA 3MGEA 1D1DA 4U0AA 2XGYA 2JPRA 1E6JP 2GONA 4XROA 2M8LA 2V4XA 2XGUA 1AK4C 4INBA 2KGFA 3H47A 3H4EA 4HTWA 2XGVA 2X2DD 1M9EC 2XDEA 2M8PA 4J93A 4LQWC 4PH2A 5HGOA 2X83A 4XFXA 1M9DC 4U0FA 4PH3A 2M8NA 1M9YC 2WLVB 2PWOA 5JPAA 2EIAA 4XRQA 1M9CC 4XFYA 4B4NA 1EM9A 1L6NA
chains in the Genus database with same CATH superfamily
4E91A 3NTEA 4U0BA 2Y4ZA 4U0CA 1M9FC 1AFVA 4DGAC 1P7NA 1U7KA 1G03A 3BP9A 5HGLA 2PXRC 5HGMA 2GOLB 1QRJA 2PWMA 1GWPA 4DGEC 2X82A 4PH0A 4XFZA 2LF4A 2WLVA 4U0EA 5HGKA 4E92A 3P05A 4NX4C 4QNBA 4U0DA 5HGNA 1M9XC 1EIAA 4WYMA 3MGEA 1D1DA 4U0AA 2XGYA 2JPRA 1E6JP 2GONA 4XROA 2M8LA 2V4XA 2XGUA 1AK4C 4INBA 2KGFA 3H47A 3H4EA 4HTWA 2XGVA 2X2DD 1M9EC 2XDEA 2M8PA 4J93A 4LQWC 4PH2A 5HGOA 2X83A 4XFXA 1M9DC 4U0FA 4PH3A 2M8NA 1M9YC 2WLVB 2PWOA 5JPAA 2EIAA 4XRQA 1M9CC 4XFYA 4B4NA 1EM9A 1L6NA
chains in the Genus database with same CATH topology
4E91A 3NTEA 4U0BA 2Y4ZA 4U0CA 1M9FC 1AFVA 4DGAC 1P7NA 1U7KA 1G03A 3BP9A 5HGLA 2PXRC 5HGMA 2GOLB 1QRJA 2PWMA 1GWPA 4DGEC 2X82A 4PH0A 4XFZA 2LF4A 2WLVA 4U0EA 5HGKA 4E92A 3P05A 4NX4C 4QNBA 4U0DA 5HGNA 1M9XC 1EIAA 4WYMA 3MGEA 1D1DA 4U0AA 2XGYA 2JPRA 1E6JP 2GONA 4XROA 2M8LA 2V4XA 2XGUA 1AK4C 4INBA 2KGFA 3H47A 3H4EA 4HTWA 2XGVA 2X2DD 1M9EC 2XDEA 2M8PA 4J93A 4LQWC 4PH2A 5HGOA 2X83A 4XFXA 1M9DC 4U0FA 4PH3A 2M8NA 1M9YC 2WLVB 2PWOA 5JPAA 2EIAA 4XRQA 1M9CC 4XFYA 4B4NA 1EM9A 1L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E91 A;  3NTE A;  4U0B A;  2Y4Z A;  4U0C A;  1M9F C;  1AFV A;  4DGA C;  1P7N A;  1U7K A;  1G03 A;  3BP9 A;  5HGL A;  2PXR C;  5HGM A;  2GOL B;  1QRJ A;  2PWM A;  1GWP A;  4DGE C;  2X82 A;  4PH0 A;  4XFZ A;  2LF4 A;  2WLV A;  4U0E A;  5HGK A;  4E92 A;  3P05 A;  4NX4 C;  4QNB A;  4U0D A;  5HGN A;  1M9X C;  1EIA A;  4WYM A;  3MGE A;  1D1D A;  4U0A A;  2XGY A;  2JPR A;  1E6J P;  2GON A;  4XRO A;  2M8L A;  2V4X A;  2XGU A;  1AK4 C;  4INB A;  2KGF A;  3H47 A;  3H4E A;  4HTW A;  2XGV A;  2X2D D;  1M9E C;  2XDE A;  2M8P A;  4J93 A;  4LQW C;  4PH2 A;  5HGO A;  2X83 A;  4XFX A;  1M9D C;  4U0F A;  4PH3 A;  2M8N A;  1M9Y C;  2WLV B;  2PWO A;  5JPA A;  2EIA A;  4XRQ A;  1M9C C;  4XFY A;  4B4N A;  1EM9 A;  1L6N A; 
#chains in the Genus database with same CATH topology
 4E91 A;  3NTE A;  4U0B A;  2Y4Z A;  4U0C A;  1M9F C;  1AFV A;  4DGA C;  1P7N A;  1U7K A;  1G03 A;  3BP9 A;  5HGL A;  2PXR C;  5HGM A;  2GOL B;  1QRJ A;  2PWM A;  1GWP A;  4DGE C;  2X82 A;  4PH0 A;  4XFZ A;  2LF4 A;  2WLV A;  4U0E A;  5HGK A;  4E92 A;  3P05 A;  4NX4 C;  4QNB A;  4U0D A;  5HGN A;  1M9X C;  1EIA A;  4WYM A;  3MGE A;  1D1D A;  4U0A A;  2XGY A;  2JPR A;  1E6J P;  2GON A;  4XRO A;  2M8L A;  2V4X A;  2XGU A;  1AK4 C;  4INB A;  2KGF A;  3H47 A;  3H4E A;  4HTW A;  2XGV A;  2X2D D;  1M9E C;  2XDE A;  2M8P A;  4J93 A;  4LQW C;  4PH2 A;  5HGO A;  2X83 A;  4XFX A;  1M9D C;  4U0F A;  4PH3 A;  2M8N A;  1M9Y C;  2WLV B;  2PWO A;  5JPA A;  2EIA A;  4XRQ A;  1M9C C;  4XFY A;  4B4N A;  1EM9 A;  1L6N A; 
#chains in the Genus database with same CATH homology
 4E91 A;  3NTE A;  4U0B A;  2Y4Z A;  4U0C A;  1M9F C;  1AFV A;  4DGA C;  1P7N A;  1U7K A;  1G03 A;  3BP9 A;  5HGL A;  2PXR C;  5HGM A;  2GOL B;  1QRJ A;  2PWM A;  1GWP A;  4DGE C;  2X82 A;  4PH0 A;  4XFZ A;  2LF4 A;  2WLV A;  4U0E A;  5HGK A;  4E92 A;  3P05 A;  4NX4 C;  4QNB A;  4U0D A;  5HGN A;  1M9X C;  1EIA A;  4WYM A;  3MGE A;  1D1D A;  4U0A A;  2XGY A;  2JPR A;  1E6J P;  2GON A;  4XRO A;  2M8L A;  2V4X A;  2XGU A;  1AK4 C;  4INB A;  2KGF A;  3H47 A;  3H4E A;  4HTW A;  2XGV A;  2X2D D;  1M9E C;  2XDE A;  2M8P A;  4J93 A;  4LQW C;  4PH2 A;  5HGO A;  2X83 A;  4XFX A;  1M9D C;  4U0F A;  4PH3 A;  2M8N A;  1M9Y C;  2WLV B;  2PWO A;  5JPA A;  2EIA A;  4XRQ A;  1M9C C;  4XFY A;  4B4N A;  1EM9 A;  1L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...