1AKAA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 149
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1akaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1akaA01
3M5UA 2VMOA 4MQPA 3MAFA 3N0LA 2BI9A 4K2BA 2VMUA 1I41A 3DZZA 1N31A 4F5LA 3LWSA 3F0HA 1OATA 3RCHA 4RITA 3ASAA 3G8MA 4WLHA 1SZKA 4B9BA 3AEOA 3IF2A 1IX7A 2QB3A 4LW4A 1FG3A 1BJ4A 2D61A 1AJRA 4EB5A 1M4NA 3NU7A 5G09A 1DGDA 2DKBA 1GD9A 1XI9A 2CSTA 2VMYA 1AAWA 1BQAA 1GEWA 5M49A 2X3LA 4W1XA 1DJUA 3AEMA 3QM2A 5J8QA 4F4EA 3DODA 3LVKA 4JF1A 2AY1A 3AELA 2FN6A 1OHYA 2YCNA 3AV7A 2X5FA 4BHDA 2JJFA 3FKDA 2OGAA 2R5CB 2Z9VA 1AJSA 4WD2A 2HP2A 4W8IA 2BWNA 3PIUA 4PIWA 2DGLA 3JZLA 3W1IA 4WXFA 4AO9A 4F5JA 1AIBA 4E1OA 4IW7A 3E9KA 2AY9A 3AOWA 3FQ8A 4BMKA 2JJEA 1QZ9A 1ARTA 1AMQA 2OGEA 4WYDA 1AMRA 4ZM4A 3UE8A 1LC5A 4JF0A 3LVMA 1D7SA 1UU0A 5FT6A 1CJ0A 1C4KA 5I92A 2VMWA 4AZJA 2BIEA 4LNJA 5F9SA 1GEYA 1AX4A 1D7UA 3ISLA 3B1EA 2R2NA 2ORDA 1YOOA 1TPLA 3OKSA 1N2TA 1MDOA 4HF8A 4ISYA 3B8XA 3NYTA 1S0AA 1B4XA 1M0QA 1AHYA 2Z1YA 4Q31A 2Z20A 3ZRRA 3FFHA 1AIAA 1G7XA 3ATHA 3HBXA 5EAAA 5DB5A 4EB7A 4XJPA 3NDNA 4IYOA 4Y0DA 2VMVA 4F5MA 1P3WA 3FQAA 1OXPA 1S08A 4IY7A 4W1VA 1T3IA 1V2EA 3DRDA 2VMQA 3FVUA 4ATQA 5LH9A 2Z9UA 1YJSA 4H51A 3GR9A 1KKJA 2CJHA 2W7HA 2HOZA 2DGMA 1LK9A 1VP4A 3H14A 3QPGA 4RKCA 2BWPA 4N0BA 1AHXA 2VI8A 3QHXA 3DU4A 4XQ2A 3Q8NA 4Q76A 2WK8A 1OXOA 9AATA 4IXSA 1E5FA 3L44A 3PDBB 4I8AA 1XEYA 1LW5A 2ZY5A 3KE3A 3A9XA 2C0RA 1SVVA 2E7IA 2C44A 3KKIA 2DKJA 2AY8A 4R5ZA 1MAQA 4JEVA 4K2MA 1MAPA 1YIZA 4MY5A 3LVLB 2VMXA 3AEMC 1DKAA 1UKJA 1IX6A 3OP7A 5EAVA 1LKCA 2CH1A 4K2IA 4EU1A 2W7FA 3WKRA 1TARA 1AAMA 4ATPA 3G0TA 2VIAA 2ZP7A 2WK7A 4WXGA 3HVYA 3I5TA 2HORA 1QJ3A 1WYUA 2PB0A 3BCXA 2OKJA 2VLHA 3BWNC 4E77A 4M2KA 3ZRPA 1C7NA 3PJ0A 3NUBA 1IVRA 4ZLVA 1MDXA 4FFCA 1RV3A 1M0NA 3EI6A 3II0A 1GDEA 4M2JA 1C7OA 3AEPA 1DGEA 3FSLA 1M0PA 2WKAA 2NMPA 5BJ4A 3L8AA 5D95A 1C7GA 5EUDA 3DR4A 2BWOA 4BA5A 1QISA 4LW2A 4A00A 1LC7A 4WB0B 4JEXA 3NTJA 1GC4A 4GRXA 1DTYA 4PVFA 4GEBA 1J32A 3NX3A 5M4BA 3NNKA 1S07A 1AMSA 2D65A 3CQ4A 3MAUA 4A72A 4WYCA 5EUEA 4FL0A 3PGYA 2O7CA 2EO5A 5EQCA 2AATA 3E2YA 4KYOA 1ASBA 1N8PA 2DR1A 4E3RA 3B1CA 2Z1ZA 3P6KA 1OHVA 2WK9A 3CBFA 4Y0IA 2F8JA 5FT4A 1ASEA 4F5GA 2D66A 2YKVA 2GMUA 2BHXA 3RBLA 4J5UA 4DGTA 3R9AA 1IAYA 4IYOB 3RQ1A 5LHAA 2W8JA 5EFSA 2ZY2A 1WYTB 3BV0A 3BWNA 2X8UA 3LG0A 1PMMA 2D64A 4CVQA 4WYFA 4ZWVA 1X28A 3BB8A 1FC4A 3WCNA 2FM1A 2D7YA 1AICA 1I43A 2ZUKA 3E2FA 1ASDA 1CQ8A 1V2DA 2YCTA 3A9ZA 3MKJA 1GC0A 2VGVA 3FFRA 1E5EA 1BJOA 1W3UA 4ZWMA 4Y0HA 3TCMA 4RJ0A 1PG8A 3AEJC 3E77A 5G4JA 1ARSA 1KMJA 3CAIA 4UHNA 2W7GA 3E6GA 3CQ6A 3PD6A 3ZRQA 4AZKA 2YRRA 3B1DA 4NOGA 4A0GA 2JJHA 1VJOA 2VGSA 3NRAA 1O69A 4UHOA 1D7VA 2D63A 1B5PA 2W7EA 2BYJA 3BS8A 1CL2A 4PFFA 2ZY4A 1BJWA 2HUUA 5EUNA 1AKBA 3JWAA 3GJUA 2O1BA 3WGBA 3ELPA 1G7WA 5G0AA 4RAEA 5DJ9A 3BWOA 4OMAA 1G4XA 2YCPA 2OKKA 1RVUA 3DXVA 2HUIA 1BW0A 3VOMA 3HLMA 4GE7A 5JAYA 3MC6C 4ADCA 4RM1A 1GEXA 1QGNA 8AATA 3PA9A 3PD6B 1M7YA 1D7RA 1D2FA 2TPLA 4U2HA 4P7YA 2W7LA 1W7NA 2XBNA 1GCKA 1Z7DA 4AOAA 4ADDA 3A2BA 4ZSWA 1UU2A 3MAFB 1Y4IA 4DQ6A 1ZOBA 5G2QA 2BIAA 4A0RA 1H1CA 2CY8A 3FZ7A 2GB3A 4WYGA 4A6TA 1IJIA 4LC3A 3UWCA 1TASA 4ADBA 2V0YA 3WX9A 3PDBA 4M2MA 4GSAA 4JEWA 5G2PA 3LY1A 2EPJA 5D5SA 3VAXA 4R2NA 4U1TA 4OBVA 1X29A 3NU8A 4MKJA 1QITA 1WYUB 3BN1A 2VYCA 3HDOA 3NYSA 4IXZA 2E7JA 2FYFA 2W8TA 2YHKA 3EZ1A 3PDXA 2ZSLA 3EI7A 3TQXA 4OTLA 3WY7A 1O61A 3GZDC 3JU7A 4OT8A 1LC8A 4AH3A 4F5HA 4BQ0A 3VK4A 3D6KA 1KL2A 3DC1A 1I48A 3MC6A 3AOVA 5E4ZA 4P3MA 4R8DA 4JE5D 2CINA 1TOEA 2VMTA 3JWBA 4TN4A 2HOYA 2E54A 1V2FA 3F6TA 5FT8A 2W8UA 4MKKA 5G4IA 2HOXA 2HP1A 4CXRA 1EJIA 2G6WA 2C7TA 5E3KA 2YKYA 1B9HA 3RUYA 4Q6RA 3WGCA 2EH6A 3K40A 3G7QA 4OCAA 5TF5A 3VK2A 4F5IA 5M46A 1DFOA 1TOKA 4DBCA 3QN6A 1S09A 3K28A 4WLJA 3LVJA 2FNIA 3N75A 4OYTA 4PFNA 4ZDOA 2AY3A 1VEFA 1RVYA 2BIGA 2VGTA 3FVXA 4XJLA 7AATA 2X5DA 3B46A 4ZDPA 4GE4A 1V72A 1AKCA 1ASGA 1ELUA 2V1PA 3A8UX 3FDBA 3FTBA 3PPLA 3LV2A 4IXOA 3ELEA 3W1JA 2EZ1A 1S06A 2Z9XA 3I16A 3USFA 2BKWA 1IBJA 1CQ7A 1KMKA 1WKGA 2Q7WA 3JW9A 2W7IA 4ZASA 1TOGA 2VMRA 4UQVA 2ZSMA 4XK1A 4F5FA 4ZSYA 2W8VA 3AENB 1Z3ZA 1WYVB 1X2AA 3COGA 4RJYA 5IWQA 4E3QA 1B8GA 1YNUA 2AY2A 3FDDA 1M0OA 2PB2A 2PO3A 1SF2A 4MQRA 4A0FA 2E7UA 1EQBA 1BKGA 4J8LA 2ZYJA 3RBFA 1BT4A 2W8WA 4ZM3A 4ITGA 2AEUA 3BC8A 1WSTA 4A0HA 1DJEA 1DJ9A 2W7MA 2JISA 3IHJA 4XAUA 2VGUA 3GZDA 1MLZA 5DX5A 3HMUA 4A6UA 3QGUA 2BI5A 3R4TA 4UHMA 4W5KA 1GBNA 5C6UA 1TATA 3E2ZA 4WYEA 5M4DA 3MADA 2CJGA 2AY6A 2GSAA 1AMAA 1H0CA 1PFFA 3K7YA 4GE9A 1ZODA 3P1TA 5HDMA 3WLXA 4OC9A 4RKDA 5E5IA 4Q75A 1EG5A 1ASLA 3BCBA 3GETA 3EZSA 3H7FA 1ASCA 4WB0A 1X0MA 4HVKA 2CFBA 3DR7A 4W91A 1IX8A 2EZ2A 1O4SA 2OQXA 1ELQA 4LNMA 4XJMA 1JF9A 1SZSA 4R5FA 1KL1A 1YAAA 2QB2A 4JEZA 4XEWA 3TFUA 2R5CA 2RFVA 3VP6A 2FNUA 1ARIA 1TOJA 3AENA 1IUGA 3NYUA 3FRKA 4LNLA 3ECDA 2VGWA 3EUCA 1AKAA 5AX8A 3T32A 3E2ZB 1W7MA 3DXWA 1AY8A 4CXQA 3EI5A 1KKPA 3HL2A 4OBUA 3EIAA 2QBTA 2AY7A 2HZPA 4A6RA 2W7JA 1J04A 1FG7A 2CJDA 1G4VA 3NUIA 1B9IA 4ADEA 3EI8A 1IAXA 3WZFA 4CBSA 4XJOA 3EI9A 1WKHA 2BI2A 2C81A 1W7LA 3DYDA 2AY5A 3FZ8A 1TOIA 2O0RA 3FZ6A 2BYLA 3I4JA 3F9TA 1UU1A 1SPAA 3FD0A 3BCAA 3HQTA 5HXXA 1AHEA 2CB1A 4WP0A 3TFTA 1WYVA 3QI6A 4ZDLA 4ZAHA 2JGTA 4CBRA 1QJ5A 4QGRA 1ORDA 5EIGA 1ASAA 4EFFA 2EGYA 3WKSA 4B98A 1JS3A 2VMSA 4L0OA 3VK3A 1RV4A 2VMPA 3AEJA 2VMZA 2GQNA 1CZCA 2YOBA 3A9YA 4RLGA 4JEYA 1O62A 4EMYA 1ZC9A 2Z67A 2CANA 2QLRA 2Z9WA 3W1HA 2YKXA 1MLYA 1AHFA 1YJZA 3CQ5A 1MGVA 2OATA 1MDZA 1C0NA 2HUFA 3FQ7A 3JTXA 1ASMA 2CTZA 2JJGA 3ZZKA 4W1WA 2VIBA 1SFFA 1GC3A 2ZJGA 1OHWA 3EIBA 4TV7A 2R0TA 1AY5A 4IX8A 5HHYA 2DOUA 1U08A 4MGRA 5BJ3A 1ECXA 2GMSA 4ITXA 3UAKA 1BS0A 5F8VA 5EIGB 4N0WA 2FQ6A 2CH2A 3KGWA 1ASFA 1I29A 2VLFA 3QBOA 1SZUA 3HT4A 1CL1A 2ZC0A 1WYTA 3ZZJA 4F5KA 2VMNA 1ARHA 2JG2A 2W7KA 3GZCA 4TMRA 2BI3A 3FCRA 3PAAA 4GDYA 1QIRA 1YIYA 1M32A 2D7ZA 1YJYA 2Z61A 4MSOA 1GC2A 4WXBA 1M6SA 2D5YA 1AY4A 1JG8A 3MEBA 4BA4A 1BJNA 3N5MA 3RI6A 1LW4A 4UOYA 3ACZA 1BQDA 2BI1A 2AY4A 1CZEA 1AHGA 1LS3A 2DGKA 4O6ZA 1ARGA 3RCHB 2VI9A 3GSBA 3GWPA 4WYAA 4AO4A 3TATA 3AATA 4KAMA 3KGXA 1BJOB 3MBBA 2W7DA 2R5EA 5DJ1A 2VGZA 2XH1A 1CS1A 4RIZA 2ZY3A 1ASNA 2YKUA 3WCOA 1CQ6A 1C9CA 1B5OA 1JS6A 1PMOA 4JE5A 3FVSA 2YRIA 2QA3A 1W23A 4WBTA 3GBXA 3ASBA 1AJSB 5FT5A 4KXKA 5K8BA 2QMAA 2AEVA 4MQQA
chains in the Genus database with same CATH superfamily
3M5UA 2VMOA 4MQPA 3MAFA 3N0LA 2BI9A 4K2BA 2VMUA 1I41A 3DZZA 1N31A 4F5LA 3LWSA 3F0HA 1OATA 3RCHA 4RITA 3ASAA 3G8MA 4WLHA 1SZKA 4B9BA 3AEOA 3IF2A 1IX7A 2QB3A 4LW4A 1FG3A 1BJ4A 2D61A 1AJRA 4EB5A 1M4NA 3NU7A 5G09A 1DGDA 2DKBA 1GD9A 1XI9A 2CSTA 2VMYA 1AAWA 1BQAA 1GEWA 5M49A 2X3LA 4W1XA 1DJUA 3AEMA 3QM2A 5J8QA 4F4EA 3DODA 3LVKA 4JF1A 2AY1A 3AELA 2FN6A 1OHYA 2YCNA 3AV7A 2X5FA 4BHDA 2JJFA 3FKDA 2OGAA 2R5CB 2Z9VA 1AJSA 4WD2A 2HP2A 4W8IA 2BWNA 3PIUA 4PIWA 2DGLA 3JZLA 3W1IA 4WXFA 4AO9A 4F5JA 1AIBA 4E1OA 4IW7A 3E9KA 2AY9A 3AOWA 3FQ8A 4BMKA 4H63Q 2JJEA 1QZ9A 1ARTA 1AMQA 2OGEA 4WYDA 1AMRA 4ZM4A 3UE8A 1LC5A 4JF0A 3LVMA 1D7SA 1UU0A 5FT6A 1CJ0A 1C4KA 5I92A 2VMWA 4AZJA 2BIEA 4LNJA 5F9SA 1GEYA 1AX4A 1D7UA 3ISLA 3B1EA 2R2NA 2ORDA 1YOOA 1TPLA 3OKSA 1N2TA 1MDOA 4HF8A 4ISYA 3B8XA 3NYTA 1S0AA 1B4XA 1M0QA 1AHYA 2Z1YA 4Q31A 2Z20A 3ZRRA 3FFHA 1AIAA 1G7XA 3ATHA 3HBXA 5EAAA 5DB5A 4EB7A 4XJPA 3NDNA 4IYOA 4Y0DA 2VMVA 4F5MA 1P3WA 3FQAA 2WB6A 1OXPA 1S08A 4IY7A 4W1VA 1T3IA 1V2EA 3DRDA 2VMQA 3FVUA 4ATQA 5LH9A 2Z9UA 1YJSA 4H51A 3GR9A 1KKJA 2CJHA 2W7HA 2HOZA 2DGMA 1LK9A 1VP4A 3H14A 3QPGA 4RKCA 2BWPA 4N0BA 1AHXA 2VI8A 3QHXA 3DU4A 4XQ2A 3Q8NA 4Q76A 2WK8A 1OXOA 9AATA 4IXSA 1E5FA 3L44A 3PDBB 4I8AA 1XEYA 1LW5A 2ZY5A 3KE3A 3A9XA 2C0RA 1SVVA 2E7IA 2C44A 3KKIA 2DKJA 2AY8A 4R5ZA 1MAQA 4JEVA 4K2MA 1MAPA 1YIZA 4MY5A 3LVLB 2VMXA 3AEMC 1DKAA 1UKJA 1IX6A 3OP7A 5EAVA 2KFPA 1LKCA 2CH1A 4K2IA 4EU1A 2W7FA 3WKRA 1TARA 1AAMA 4ATPA 3G0TA 2VIAA 2ZP7A 2WK7A 4WXGA 3HVYA 3I5TA 2HORA 1QJ3A 1WYUA 2PB0A 3BCXA 2OKJA 2VLHA 3BWNC 4E77A 4M2KA 3ZRPA 1C7NA 3PJ0A 3NUBA 1IVRA 4ZLVA 1MDXA 4FFCA 1RV3A 1M0NA 3EI6A 3II0A 1GDEA 4M2JA 1C7OA 3AEPA 1DGEA 3FSLA 1M0PA 2WKAA 2NMPA 5BJ4A 3L8AA 5D95A 1C7GA 5EUDA 3DR4A 2BWOA 4BA5A 1QISA 4LW2A 4A00A 1LC7A 4WB0B 4JEXA 3NTJA 1GC4A 4GRXA 1DTYA 4PVFA 4GEBA 1J32A 3NX3A 5M4BA 3NNKA 1S07A 1AMSA 2D65A 3CQ4A 3MAUA 4A72A 4WYCA 5EUEA 4FL0A 3PGYA 2O7CA 2EO5A 5EQCA 2AATA 3E2YA 4KYOA 1ASBA 1N8PA 2DR1A 4E3RA 3B1CA 2Z1ZA 3P6KA 1OHVA 2WK9A 3CBFA 4Y0IA 2F8JA 5FT4A 1ASEA 4F5GA 2D66A 2YKVA 2GMUA 2BHXA 3RBLA 4J5UA 4DGTA 3R9AA 1IAYA 4IYOB 3RQ1A 5LHAA 2W8JA 5EFSA 2ZY2A 1WYTB 3BV0A 3BWNA 2X8UA 3LG0A 1PMMA 2D64A 3N7NA 4CVQA 4WYFA 4ZWVA 1X28A 3BB8A 1FC4A 3WCNA 2FM1A 2D7YA 1AICA 1I43A 2QSRA 2ZUKA 3E2FA 1ASDA 1CQ8A 1V2DA 2YCTA 3A9ZA 3MKJA 1GC0A 2VGVA 3FFRA 1E5EA 1BJOA 1W3UA 4ZWMA 4Y0HA 3TCMA 4RJ0A 1PG8A 3AEJC 3E77A 5G4JA 1ARSA 1KMJA 3CAIA 4UHNA 2W7GA 3E6GA 3CQ6A 3PD6A 3ZRQA 4AZKA 2YRRA 3B1DA 4NOGA 4A0GA 2JJHA 1VJOA 2VGSA 3NRAA 1O69A 4UHOA 1D7VA 2D63A 1B5PA 2W7EA 2EYQA 2BYJA 3BS8A 1CL2A 4PFFA 2ZY4A 1BJWA 2HUUA 5EUNA 1AKBA 3JWAA 3GJUA 4K05A 2O1BA 3WGBA 3ELPA 1G7WA 5G0AA 4RAEA 5DJ9A 3BWOA 4OMAA 1G4XA 2YCPA 2OKKA 1RVUA 3DXVA 2HUIA 1BW0A 3VOMA 3HLMA 4GE7A 5JAYA 3MC6C 4ADCA 4RM1A 1GEXA 1QGNA 8AATA 3PA9A 3PD6B 1M7YA 1D7RA 1D2FA 2TPLA 4U2HA 4P7YA 2W7LA 1W7NA 2XBNA 1GCKA 1Z7DA 4AOAA 4ADDA 3A2BA 4ZSWA 1UU2A 3MAFB 1Y4IA 4DQ6A 1ZOBA 5G2QA 2BIAA 4A0RA 1H1CA 2CY8A 3FZ7A 2GB3A 4WYGA 4A6TA 1IJIA 4LC3A 3UWCA 1TASA 4ADBA 2V0YA 3WX9A 3PDBA 4M2MA 4GSAA 4JEWA 5G2PA 3LY1A 2EPJA 5D5SA 3VAXA 4R2NA 4U1TA 4OBVA 1X29A 3NU8A 4MKJA 1QITA 1WYUB 3BN1A 2VYCA 3HDOA 3NYSA 4IXZA 2E7JA 2FYFA 2W8TA 2YHKA 3EZ1A 3PDXA 2ZSLA 3EI7A 3TQXA 4OTLA 3WY7A 1O61A 3GZDC 3JU7A 4OT8A 1LC8A 4AH3A 4F5HA 4BQ0A 3VK4A 2A1VA 2G7JA 3D6KA 1KL2A 3DC1A 1I48A 3MC6A 3AOVA 5E4ZA 4P3MA 4R8DA 4JE5D 2CINA 1TOEA 2VMTA 3JWBA 4TN4A 2HOYA 2E54A 1V2FA 3F6TA 5FT8A 2W8UA 4MKKA 5G4IA 2HOXA 2HP1A 4CXRA 1EJIA 2G6WA 2C7TA 5E3KA 2YKYA 1B9HA 3RUYA 4Q6RA 3WGCA 2EH6A 3K40A 3G7QA 4OCAA 5TF5A 3VK2A 4F5IA 5M46A 1DFOA 1TOKA 4DBCA 3QN6A 1S09A 3K28A 4WLJA 3LVJA 2FNIA 3N75A 4OYTA 4PFNA 4ZDOA 2AY3A 1VEFA 1RVYA 2BIGA 2VGTA 3FVXA 4XJLA 7AATA 2X5DA 3B46A 4ZDPA 4GE4A 1V72A 1AKCA 1ASGA 1ELUA 2V1PA 3A8UX 3FDBA 3FTBA 3PPLA 3LV2A 4IXOA 3ELEA 3W1JA 2EZ1A 1S06A 2Z9XA 3I16A 3USFA 2BKWA 1IBJA 1CQ7A 1KMKA 1WKGA 2Q7WA 3JW9A 2W7IA 4ZASA 1TOGA 2VMRA 2FKIA 4UQVA 2ZSMA 4XK1A 4F5FA 4ZSYA 2W8VA 3AENB 1Z3ZA 1WYVB 1X2AA 3COGA 4RJYA 5IWQA 4E3QA 1B8GA 1YNUA 2AY2A 3FDDA 1M0OA 2PB2A 2PO3A 1SF2A 4MQRA 4A0FA 3N4XA 2E7UA 1EQBA 1BKGA 4J8LA 2ZYJA 3RBFA 1BT4A 2W8WA 4ZM3A 4ITGA 2AEUA 3BC8A 1WSTA 4A0HA 1DJEA 1DJ9A 2W7MA 2JISA 3IHJA 4XAUA 2VGUA 3GZDA 1MLZA 5DX5A 3HMUA 4A6UA 3QGUA 2BI5A 3R4TA 4UHMA 4W5KA 1GBNA 5C6UA 1TATA 3E2ZA 4WYEA 5M4DA 3H9XA 3MADA 2CJGA 2AY6A 2GSAA 1AMAA 1H0CA 1PFFA 3K7YA 4GE9A 1ZODA 3P1TA 5HDMA 3WLXA 4OC9A 4RKDA 5E5IA 4Q75A 1EG5A 1ASLA 3BCBA 3GETA 3EZSA 3H7FA 1ASCA 4WB0A 1X0MA 4HVKA 2CFBA 3DR7A 4W91A 1IX8A 2EZ2A 1O4SA 2OQXA 1ELQA 4LNMA 4XJMA 1JF9A 1SZSA 4R5FA 1KL1A 3N4RA 1YAAA 2QB2A 4JEZA 4XEWA 3TFUA 2R5CA 2RFVA 3VP6A 2FNUA 1ARIA 1TOJA 3AENA 1IUGA 3NYUA 3FRKA 4LNLA 3ECDA 2VGWA 3EUCA 1AKAA 5AX8A 3T32A 3E2ZB 1W7MA 3DXWA 1AY8A 4CXQA 3EI5A 1KKPA 3HL2A 4OBUA 3EIAA 2QBTA 2AY7A 3N4SA 2HZPA 4A6RA 2W7JA 1J04A 1FG7A 2CJDA 1G4VA 3NUIA 1B9IA 4ADEA 3EI8A 1KAFA 1IAXA 3WZFA 4CBSA 4XJOA 3EI9A 1WKHA 2BI2A 2C81A 1W7LA 3DYDA 2AY5A 3FZ8A 1TOIA 2O0RA 3FZ6A 2BYLA 3I4JA 3F9TA 1UU1A 1SPAA 3FD0A 3BCAA 3HQTA 5HXXA 1AHEA 2CB1A 4WP0A 3TFTA 1WYVA 3QI6A 4ZDLA 4ZAHA 2JGTA 4CBRA 1QJ5A 4QGRA 1ORDA 5EIGA 1ASAA 4EFFA 2EGYA 3WKSA 4B98A 1JS3A 2VMSA 4L0OA 3VK3A 1RV4A 2VMPA 3AEJA 2VMZA 2GQNA 1CZCA 2YOBA 3A9YA 4RLGA 4JEYA 1O62A 4EMYA 1ZC9A 2Z67A 2CANA 2QLRA 2Z9WA 3W1HA 2YKXA 1MLYA 1AHFA 1YJZA 3CQ5A 1MGVA 2OATA 1MDZA 1C0NA 2HUFA 3FQ7A 3JTXA 1ASMA 2CTZA 2JJGA 3ZZKA 4W1WA 2VIBA 1SFFA 1GC3A 2ZJGA 1OHWA 3EIBA 4TV7A 2R0TA 1AY5A 4IX8A 5HHYA 2DOUA 1U08A 4MGRA 5BJ3A 1ECXA 2GMSA 4ITXA 3UAKA 1BS0A 5F8VA 5EIGB 4N0WA 2FQ6A 2CH2A 3KGWA 1ASFA 1I29A 2VLFA 3QBOA 1SZUA 3HT4A 5KTBA 1CL1A 2ZC0A 1WYTA 3ZZJA 4F5KA 2VMNA 1ARHA 2JG2A 2W7KA 3GZCA 4TMRA 2BI3A 3FCRA 3PAAA 4GDYA 1QIRA 1YIYA 1M32A 2D7ZA 1YJYA 2Z61A 4MSOA 1GC2A 4WXBA 1M6SA 2D5YA 1AY4A 1JG8A 3MEBA 4BA4A 1BJNA 3N5MA 3RI6A 1LW4A 4UOYA 3ACZA 1BQDA 2BI1A 2AY4A 1CZEA 1AHGA 1LS3A 2DGKA 4O6ZA 1ARGA 3RCHB 2VI9A 3GSBA 3GWPA 4WYAA 4AO4A 3TATA 3AATA 4KAMA 3KGXA 1BJOB 3MBBA 2W7DA 2R5EA 5DJ1A 2VGZA 2XH1A 1CS1A 4RIZA 2ZY3A 1ASNA 2YKUA 3WCOA 1CQ6A 1C9CA 1B5OA 1JS6A 1PMOA 4JE5A 3FVSA 2YRIA 2QA3A 1W23A 4WBTA 3GBXA 3ASBA 1AJSB 5FT5A 4KXKA 5K8BA 2QMAA 2AEVA 4MQQA
chains in the Genus database with same CATH topology
3M5UA 2VMOA 4MQPA 3MAFA 3N0LA 2BI9A 4K2BA 2VMUA 1I41A 3DZZA 1N31A 4F5LA 3LWSA 3F0HA 1OATA 3RCHA 4RITA 3ASAA 3G8MA 4WLHA 1SZKA 4B9BA 3AEOA 3IF2A 1IX7A 2QB3A 4LW4A 1FG3A 1BJ4A 2D61A 1AJRA 4EB5A 1M4NA 3NU7A 5G09A 1DGDA 2DKBA 1GD9A 1XI9A 2CSTA 2VMYA 1AAWA 1BQAA 1GEWA 5M49A 2X3LA 4W1XA 1DJUA 3AEMA 3QM2A 5J8QA 4F4EA 3DODA 3LVKA 4JF1A 2AY1A 3AELA 2FN6A 1OHYA 2YCNA 3AV7A 2X5FA 4BHDA 2JJFA 3FKDA 2OGAA 2R5CB 2Z9VA 1AJSA 4WD2A 2HP2A 4W8IA 2BWNA 3PIUA 4PIWA 2DGLA 3JZLA 3W1IA 4WXFA 4AO9A 4F5JA 1AIBA 4E1OA 4IW7A 3E9KA 2AY9A 3AOWA 3FQ8A 4BMKA 4H63Q 2JJEA 1QZ9A 1ARTA 1AMQA 2OGEA 4WYDA 1AMRA 4ZM4A 3UE8A 1LC5A 4JF0A 3LVMA 1D7SA 1UU0A 5FT6A 1CJ0A 1C4KA 5I92A 2VMWA 4AZJA 2BIEA 4LNJA 5F9SA 1GEYA 1AX4A 1D7UA 3ISLA 3B1EA 2R2NA 2ORDA 1YOOA 1TPLA 3OKSA 1N2TA 1MDOA 4HF8A 4ISYA 3B8XA 3NYTA 1S0AA 1B4XA 1M0QA 1AHYA 2Z1YA 4Q31A 2Z20A 3ZRRA 3FFHA 1AIAA 1G7XA 3ATHA 3HBXA 5EAAA 5DB5A 4EB7A 4XJPA 3NDNA 4IYOA 4Y0DA 2VMVA 4F5MA 1P3WA 3FQAA 2WB6A 1OXPA 1S08A 4IY7A 4W1VA 1T3IA 1V2EA 3DRDA 2VMQA 3FVUA 4ATQA 5LH9A 2Z9UA 1YJSA 4H51A 3GR9A 1KKJA 2CJHA 2W7HA 2HOZA 2DGMA 1LK9A 1VP4A 3H14A 3QPGA 4RKCA 2BWPA 4N0BA 1AHXA 2VI8A 3QHXA 3DU4A 4XQ2A 3Q8NA 4Q76A 2WK8A 1OXOA 9AATA 4IXSA 1E5FA 3L44A 3PDBB 4I8AA 1XEYA 1LW5A 2ZY5A 3KE3A 3A9XA 2C0RA 1SVVA 2E7IA 2C44A 3KKIA 2DKJA 2AY8A 4R5ZA 1MAQA 4JEVA 4K2MA 1MAPA 1YIZA 4MY5A 3LVLB 2VMXA 3AEMC 1DKAA 1UKJA 1IX6A 3OP7A 5EAVA 2KFPA 1LKCA 2CH1A 4K2IA 4EU1A 2W7FA 3WKRA 1TARA 1AAMA 4ATPA 3G0TA 2VIAA 2ZP7A 2WK7A 4WXGA 3HVYA 3I5TA 2HORA 1QJ3A 1WYUA 2PB0A 3BCXA 2OKJA 2VLHA 3BWNC 4E77A 4M2KA 3ZRPA 1C7NA 3PJ0A 3NUBA 1IVRA 4ZLVA 1MDXA 4FFCA 1RV3A 1M0NA 3EI6A 3II0A 1GDEA 4M2JA 1C7OA 3AEPA 1DGEA 3FSLA 1M0PA 2WKAA 2NMPA 5BJ4A 3L8AA 5D95A 1C7GA 5EUDA 3DR4A 2BWOA 4BA5A 1QISA 4LW2A 4A00A 1LC7A 4WB0B 4JEXA 3NTJA 1GC4A 4GRXA 1DTYA 4PVFA 4GEBA 1J32A 3NX3A 5M4BA 3NNKA 1S07A 1AMSA 2D65A 3CQ4A 3MAUA 4A72A 4WYCA 5EUEA 4FL0A 3PGYA 2O7CA 2EO5A 5EQCA 2AATA 3E2YA 4KYOA 1ASBA 1N8PA 2DR1A 4E3RA 3B1CA 2Z1ZA 3P6KA 1OHVA 2WK9A 3CBFA 4Y0IA 2F8JA 5FT4A 1ASEA 4F5GA 2D66A 2YKVA 2GMUA 2BHXA 3RBLA 4J5UA 4DGTA 3R9AA 1IAYA 4IYOB 3RQ1A 5LHAA 2W8JA 5EFSA 2ZY2A 1WYTB 3BV0A 3BWNA 2X8UA 3LG0A 1PMMA 2D64A 3N7NA 4CVQA 4WYFA 4ZWVA 1X28A 3BB8A 1FC4A 3WCNA 2FM1A 2D7YA 1AICA 1I43A 2QSRA 2ZUKA 3E2FA 1ASDA 1CQ8A 1V2DA 2YCTA 3A9ZA 3MKJA 1GC0A 2VGVA 3FFRA 1E5EA 1BJOA 1W3UA 4ZWMA 4Y0HA 3TCMA 4RJ0A 1PG8A 3AEJC 3E77A 5G4JA 1ARSA 1KMJA 3CAIA 4UHNA 2W7GA 3E6GA 3CQ6A 3PD6A 3ZRQA 4AZKA 2YRRA 3B1DA 4NOGA 4A0GA 2JJHA 1VJOA 2VGSA 3NRAA 1O69A 4UHOA 1D7VA 2D63A 1B5PA 2W7EA 2EYQA 2BYJA 3BS8A 1CL2A 4PFFA 2ZY4A 1BJWA 2HUUA 5EUNA 1AKBA 3JWAA 3GJUA 4K05A 2O1BA 3WGBA 3ELPA 1G7WA 5G0AA 4RAEA 5DJ9A 3BWOA 4OMAA 1G4XA 2YCPA 2OKKA 1RVUA 3DXVA 2HUIA 1BW0A 3VOMA 3HLMA 4GE7A 5JAYA 3MC6C 4ADCA 4RM1A 1GEXA 1QGNA 8AATA 3PA9A 3PD6B 1M7YA 1D7RA 1D2FA 2TPLA 4U2HA 4P7YA 2W7LA 1W7NA 2XBNA 1GCKA 1Z7DA 4AOAA 4ADDA 3A2BA 4ZSWA 1UU2A 3MAFB 1Y4IA 4DQ6A 1ZOBA 5G2QA 2BIAA 4A0RA 1H1CA 2CY8A 3FZ7A 2GB3A 4WYGA 4A6TA 1IJIA 4LC3A 3UWCA 1TASA 4ADBA 2V0YA 3WX9A 3PDBA 4M2MA 4GSAA 4JEWA 5G2PA 3LY1A 2EPJA 5D5SA 3VAXA 4R2NA 4U1TA 4OBVA 1X29A 3NU8A 4MKJA 1QITA 1WYUB 3BN1A 2VYCA 3HDOA 3NYSA 4IXZA 2E7JA 2FYFA 2W8TA 2YHKA 3EZ1A 3PDXA 2ZSLA 3EI7A 3TQXA 4OTLA 3WY7A 1O61A 3GZDC 3JU7A 4OT8A 1LC8A 4AH3A 4F5HA 4BQ0A 3VK4A 2A1VA 2G7JA 3D6KA 1KL2A 3DC1A 1I48A 3MC6A 3AOVA 5E4ZA 4P3MA 4R8DA 4JE5D 2CINA 1TOEA 2VMTA 3JWBA 4TN4A 2HOYA 2E54A 1V2FA 3F6TA 5FT8A 2W8UA 4MKKA 5G4IA 2HOXA 2HP1A 4CXRA 1EJIA 2G6WA 2C7TA 5E3KA 2YKYA 1B9HA 3RUYA 4Q6RA 3WGCA 2EH6A 3K40A 3G7QA 4OCAA 5TF5A 3VK2A 4F5IA 5M46A 1DFOA 1TOKA 4DBCA 3QN6A 1S09A 3K28A 4WLJA 3LVJA 2FNIA 3N75A 4OYTA 4PFNA 4ZDOA 2AY3A 1VEFA 1RVYA 2BIGA 2VGTA 3FVXA 4XJLA 7AATA 2X5DA 3B46A 4ZDPA 4GE4A 1V72A 1AKCA 1ASGA 1ELUA 2V1PA 3A8UX 3FDBA 3FTBA 3PPLA 3LV2A 4IXOA 3ELEA 3W1JA 2EZ1A 1S06A 2Z9XA 3I16A 3USFA 2BKWA 1IBJA 1CQ7A 1KMKA 1WKGA 2Q7WA 3JW9A 2W7IA 4ZASA 1TOGA 2VMRA 2FKIA 4UQVA 2ZSMA 4XK1A 4F5FA 4ZSYA 2W8VA 3AENB 1Z3ZA 1WYVB 1X2AA 3COGA 4RJYA 5IWQA 4E3QA 1B8GA 1YNUA 2AY2A 3FDDA 1M0OA 2PB2A 2PO3A 1SF2A 4MQRA 4A0FA 3N4XA 2E7UA 1EQBA 1BKGA 4J8LA 2ZYJA 3RBFA 1BT4A 2W8WA 4ZM3A 4ITGA 2AEUA 3BC8A 1WSTA 4A0HA 1DJEA 1DJ9A 2W7MA 2JISA 3IHJA 4XAUA 2VGUA 3GZDA 1MLZA 5DX5A 3HMUA 4A6UA 3QGUA 2BI5A 3R4TA 4UHMA 4W5KA 1GBNA 5C6UA 1TATA 3E2ZA 4WYEA 5M4DA 3H9XA 3MADA 2CJGA 2AY6A 2GSAA 1AMAA 1H0CA 1PFFA 3K7YA 4GE9A 1ZODA 3P1TA 5HDMA 3WLXA 4OC9A 4RKDA 5E5IA 4Q75A 1EG5A 1ASLA 3BCBA 3GETA 3EZSA 3H7FA 1ASCA 4WB0A 1X0MA 4HVKA 2CFBA 3DR7A 4W91A 1IX8A 2EZ2A 1O4SA 2OQXA 1ELQA 4LNMA 4XJMA 1JF9A 1SZSA 4R5FA 1KL1A 3N4RA 1YAAA 2QB2A 4JEZA 4XEWA 3TFUA 2R5CA 2RFVA 3VP6A 2FNUA 1ARIA 1TOJA 3AENA 1IUGA 3NYUA 3FRKA 4LNLA 3ECDA 2VGWA 3EUCA 1AKAA 5AX8A 3T32A 3E2ZB 1W7MA 3DXWA 1AY8A 4CXQA 3EI5A 1KKPA 3HL2A 4OBUA 3EIAA 2QBTA 2AY7A 3N4SA 2HZPA 4A6RA 2W7JA 1J04A 1FG7A 2CJDA 1G4VA 3NUIA 1B9IA 4ADEA 3EI8A 1IAXA 3WZFA 4CBSA 4XJOA 3EI9A 1WKHA 2BI2A 2C81A 1W7LA 3DYDA 2AY5A 3FZ8A 1TOIA 2O0RA 3FZ6A 2BYLA 3I4JA 3F9TA 1UU1A 1SPAA 3FD0A 3BCAA 3HQTA 5HXXA 1AHEA 2CB1A 4WP0A 3TFTA 1WYVA 3QI6A 4ZDLA 4ZAHA 2JGTA 4CBRA 1QJ5A 4QGRA 1ORDA 5EIGA 1ASAA 4EFFA 2EGYA 3WKSA 4B98A 1JS3A 2VMSA 4L0OA 3VK3A 1RV4A 2VMPA 3AEJA 2VMZA 2GQNA 1CZCA 2YOBA 3A9YA 4RLGA 4JEYA 1O62A 4EMYA 1ZC9A 2Z67A 2CANA 2QLRA 2Z9WA 3W1HA 2YKXA 1MLYA 1AHFA 1YJZA 3CQ5A 1MGVA 2OATA 1MDZA 1C0NA 2HUFA 3FQ7A 3JTXA 1ASMA 2CTZA 2JJGA 3ZZKA 4W1WA 2VIBA 1SFFA 1GC3A 2ZJGA 1OHWA 3EIBA 4TV7A 2R0TA 1AY5A 4IX8A 5HHYA 2DOUA 1U08A 4MGRA 5BJ3A 1ECXA 2GMSA 4ITXA 3UAKA 1BS0A 5F8VA 5EIGB 4N0WA 2FQ6A 2CH2A 3KGWA 1ASFA 1I29A 2VLFA 3QBOA 1SZUA 3HT4A 5KTBA 1CL1A 2ZC0A 1WYTA 3ZZJA 4F5KA 2VMNA 1ARHA 2JG2A 2W7KA 3GZCA 4TMRA 2BI3A 3FCRA 3PAAA 4GDYA 1QIRA 1YIYA 1M32A 2D7ZA 1YJYA 2Z61A 4MSOA 1GC2A 4WXBA 1M6SA 2D5YA 1AY4A 1JG8A 3MEBA 4BA4A 1BJNA 3N5MA 3RI6A 1LW4A 4UOYA 3ACZA 1BQDA 2BI1A 2AY4A 1CZEA 1AHGA 1LS3A 2DGKA 4O6ZA 1ARGA 3RCHB 2VI9A 3GSBA 3GWPA 4WYAA 4AO4A 3TATA 3AATA 4KAMA 3KGXA 1BJOB 3MBBA 2W7DA 2R5EA 5DJ1A 2VGZA 2XH1A 1CS1A 4RIZA 2ZY3A 1ASNA 2YKUA 3WCOA 1CQ6A 1C9CA 1B5OA 1JS6A 1PMOA 4JE5A 3FVSA 2YRIA 2QA3A 1W23A 4WBTA 3GBXA 3ASBA 1AJSB 5FT5A 4KXKA 5K8BA 2QMAA 2AEVA 4MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M5U A;  2VMO A;  4MQP A;  3MAF A;  3N0L A;  2BI9 A;  4K2B A;  2VMU A;  1I41 A;  3DZZ A;  1N31 A;  4F5L A;  3LWS A;  3F0H A;  1OAT A;  3RCH A;  4RIT A;  3ASA A;  3G8M A;  4WLH A;  1SZK A;  4B9B A;  3AEO A;  3IF2 A;  1IX7 A;  2QB3 A;  4LW4 A;  1FG3 A;  1BJ4 A;  2D61 A;  1AJR A;  4EB5 A;  1M4N A;  3NU7 A;  5G09 A;  1DGD A;  2DKB A;  1GD9 A;  1XI9 A;  2CST A;  2VMY A;  1AAW A;  1BQA A;  1GEW A;  5M49 A;  2X3L A;  4W1X A;  1DJU A;  3AEM A;  3QM2 A;  5J8Q A;  4F4E A;  3DOD A;  3LVK A;  4JF1 A;  2AY1 A;  3AEL A;  2FN6 A;  1OHY A;  2YCN A;  3AV7 A;  2X5F A;  4BHD A;  2JJF A;  3FKD A;  2OGA A;  2R5C B;  2Z9V A;  1AJS A;  4WD2 A;  2HP2 A;  4W8I A;  2BWN A;  3PIU A;  4PIW A;  2DGL A;  3JZL A;  3W1I A;  4WXF A;  4AO9 A;  4F5J A;  1AIB A;  4E1O A;  4IW7 A;  3E9K A;  2AY9 A;  3AOW A;  3FQ8 A;  4BMK A;  2JJE A;  1QZ9 A;  1ART A;  1AMQ A;  2OGE A;  4WYD A;  1AMR A;  4ZM4 A;  3UE8 A;  1LC5 A;  4JF0 A;  3LVM A;  1D7S A;  1UU0 A;  5FT6 A;  1CJ0 A;  1C4K A;  5I92 A;  2VMW A;  4AZJ A;  2BIE A;  4LNJ A;  5F9S A;  1GEY A;  1AX4 A;  1D7U A;  3ISL A;  3B1E A;  2R2N A;  2ORD A;  1YOO A;  1TPL A;  3OKS A;  1N2T A;  1MDO A;  4HF8 A;  4ISY A;  3B8X A;  3NYT A;  1S0A A;  1B4X A;  1M0Q A;  1AHY A;  2Z1Y A;  4Q31 A;  2Z20 A;  3ZRR A;  3FFH A;  1AIA A;  1G7X A;  3ATH A;  3HBX A;  5EAA A;  5DB5 A;  4EB7 A;  4XJP A;  3NDN A;  4IYO A;  4Y0D A;  2VMV A;  4F5M A;  1P3W A;  3FQA A;  1OXP A;  1S08 A;  4IY7 A;  4W1V A;  1T3I A;  1V2E A;  3DRD A;  2VMQ A;  3FVU A;  4ATQ A;  5LH9 A;  2Z9U A;  1YJS A;  4H51 A;  3GR9 A;  1KKJ A;  2CJH A;  2W7H A;  2HOZ A;  2DGM A;  1LK9 A;  1VP4 A;  3H14 A;  3QPG A;  4RKC A;  2BWP A;  4N0B A;  1AHX A;  2VI8 A;  3QHX A;  3DU4 A;  4XQ2 A;  3Q8N A;  4Q76 A;  2WK8 A;  1OXO A;  9AAT A;  4IXS A;  1E5F A;  3L44 A;  3PDB B;  4I8A A;  1XEY A;  1LW5 A;  2ZY5 A;  3KE3 A;  3A9X A;  2C0R A;  1SVV A;  2E7I A;  2C44 A;  3KKI A;  2DKJ A;  2AY8 A;  4R5Z A;  1MAQ A;  4JEV A;  4K2M A;  1MAP A;  1YIZ A;  4MY5 A;  3LVL B;  2VMX A;  3AEM C;  1DKA A;  1UKJ A;  1IX6 A;  3OP7 A;  5EAV A;  1LKC A;  2CH1 A;  4K2I A;  4EU1 A;  2W7F A;  3WKR A;  1TAR A;  1AAM A;  4ATP A;  3G0T A;  2VIA A;  2ZP7 A;  2WK7 A;  4WXG A;  3HVY A;  3I5T A;  2HOR A;  1QJ3 A;  1WYU A;  2PB0 A;  3BCX A;  2OKJ A;  2VLH A;  3BWN C;  4E77 A;  4M2K A;  3ZRP A;  1C7N A;  3PJ0 A;  3NUB A;  1IVR A;  4ZLV A;  1MDX A;  4FFC A;  1RV3 A;  1M0N A;  3EI6 A;  3II0 A;  1GDE A;  4M2J A;  1C7O A;  3AEP A;  1DGE A;  3FSL A;  1M0P A;  2WKA A;  2NMP A;  5BJ4 A;  3L8A A;  5D95 A;  1C7G A;  5EUD A;  3DR4 A;  2BWO A;  4BA5 A;  1QIS A;  4LW2 A;  4A00 A;  1LC7 A;  4WB0 B;  4JEX A;  3NTJ A;  1GC4 A;  4GRX A;  1DTY A;  4PVF A;  4GEB A;  1J32 A;  3NX3 A;  5M4B A;  3NNK A;  1S07 A;  1AMS A;  2D65 A;  3CQ4 A;  3MAU A;  4A72 A;  4WYC A;  5EUE A;  4FL0 A;  3PGY A;  2O7C A;  2EO5 A;  5EQC A;  2AAT A;  3E2Y A;  4KYO A;  1ASB A;  1N8P A;  2DR1 A;  4E3R A;  3B1C A;  2Z1Z A;  3P6K A;  1OHV A;  2WK9 A;  3CBF A;  4Y0I A;  2F8J A;  5FT4 A;  1ASE A;  4F5G A;  2D66 A;  2YKV A;  2GMU A;  2BHX A;  3RBL A;  4J5U A;  4DGT A;  3R9A A;  1IAY A;  4IYO B;  3RQ1 A;  5LHA A;  2W8J A;  5EFS A;  2ZY2 A;  1WYT B;  3BV0 A;  3BWN A;  2X8U A;  3LG0 A;  1PMM A;  2D64 A;  4CVQ A;  4WYF A;  4ZWV A;  1X28 A;  3BB8 A;  1FC4 A;  3WCN A;  2FM1 A;  2D7Y A;  1AIC A;  1I43 A;  2ZUK A;  3E2F A;  1ASD A;  1CQ8 A;  1V2D A;  2YCT A;  3A9Z A;  3MKJ A;  1GC0 A;  2VGV A;  3FFR A;  1E5E A;  1BJO A;  1W3U A;  4ZWM A;  4Y0H A;  3TCM A;  4RJ0 A;  1PG8 A;  3AEJ C;  3E77 A;  5G4J A;  1ARS A;  1KMJ A;  3CAI A;  4UHN A;  2W7G A;  3E6G A;  3CQ6 A;  3PD6 A;  3ZRQ A;  4AZK A;  2YRR A;  3B1D A;  4NOG A;  4A0G A;  2JJH A;  1VJO A;  2VGS A;  3NRA A;  1O69 A;  4UHO A;  1D7V A;  2D63 A;  1B5P A;  2W7E A;  2BYJ A;  3BS8 A;  1CL2 A;  4PFF A;  2ZY4 A;  1BJW A;  2HUU A;  5EUN A;  1AKB A;  3JWA A;  3GJU A;  2O1B A;  3WGB A;  3ELP A;  1G7W A;  5G0A A;  4RAE A;  5DJ9 A;  3BWO A;  4OMA A;  1G4X A;  2YCP A;  2OKK A;  1RVU A;  3DXV A;  2HUI A;  1BW0 A;  3VOM A;  3HLM A;  4GE7 A;  5JAY A;  3MC6 C;  4ADC A;  4RM1 A;  1GEX A;  1QGN A;  8AAT A;  3PA9 A;  3PD6 B;  1M7Y A;  1D7R A;  1D2F A;  2TPL A;  4U2H A;  4P7Y A;  2W7L A;  1W7N A;  2XBN A;  1GCK A;  1Z7D A;  4AOA A;  4ADD A;  3A2B A;  4ZSW A;  1UU2 A;  3MAF B;  1Y4I A;  4DQ6 A;  1ZOB A;  5G2Q A;  2BIA A;  4A0R A;  1H1C A;  2CY8 A;  3FZ7 A;  2GB3 A;  4WYG A;  4A6T A;  1IJI A;  4LC3 A;  3UWC A;  1TAS A;  4ADB A;  2V0Y A;  3WX9 A;  3PDB A;  4M2M A;  4GSA A;  4JEW A;  5G2P A;  3LY1 A;  2EPJ A;  5D5S A;  3VAX A;  4R2N A;  4U1T A;  4OBV A;  1X29 A;  3NU8 A;  4MKJ A;  1QIT A;  1WYU B;  3BN1 A;  2VYC A;  3HDO A;  3NYS A;  4IXZ A;  2E7J A;  2FYF A;  2W8T A;  2YHK A;  3EZ1 A;  3PDX A;  2ZSL A;  3EI7 A;  3TQX A;  4OTL A;  3WY7 A;  1O61 A;  3GZD C;  3JU7 A;  4OT8 A;  1LC8 A;  4AH3 A;  4F5H A;  4BQ0 A;  3VK4 A;  3D6K A;  1KL2 A;  3DC1 A;  1I48 A;  3MC6 A;  3AOV A;  5E4Z A;  4P3M A;  4R8D A;  4JE5 D;  2CIN A;  1TOE A;  2VMT A;  3JWB A;  4TN4 A;  2HOY A;  2E54 A;  1V2F A;  3F6T A;  5FT8 A;  2W8U A;  4MKK A;  5G4I A;  2HOX A;  2HP1 A;  4CXR A;  1EJI A;  2G6W A;  2C7T A;  5E3K A;  2YKY A;  1B9H A;  3RUY A;  4Q6R A;  3WGC A;  2EH6 A;  3K40 A;  3G7Q A;  4OCA A;  5TF5 A;  3VK2 A;  4F5I A;  5M46 A;  1DFO A;  1TOK A;  4DBC A;  3QN6 A;  1S09 A;  3K28 A;  4WLJ A;  3LVJ A;  2FNI A;  3N75 A;  4OYT A;  4PFN A;  4ZDO A;  2AY3 A;  1VEF A;  1RVY A;  2BIG A;  2VGT A;  3FVX A;  4XJL A;  7AAT A;  2X5D A;  3B46 A;  4ZDP A;  4GE4 A;  1V72 A;  1AKC A;  1ASG A;  1ELU A;  2V1P A;  3A8U X;  3FDB A;  3FTB A;  3PPL A;  3LV2 A;  4IXO A;  3ELE A;  3W1J A;  2EZ1 A;  1S06 A;  2Z9X A;  3I16 A;  3USF A;  2BKW A;  1IBJ A;  1CQ7 A;  1KMK A;  1WKG A;  2Q7W A;  3JW9 A;  2W7I A;  4ZAS A;  1TOG A;  2VMR A;  4UQV A;  2ZSM A;  4XK1 A;  4F5F A;  4ZSY A;  2W8V A;  3AEN B;  1Z3Z A;  1WYV B;  1X2A A;  3COG A;  4RJY A;  5IWQ A;  4E3Q A;  1B8G A;  1YNU A;  2AY2 A;  3FDD A;  1M0O A;  2PB2 A;  2PO3 A;  1SF2 A;  4MQR A;  4A0F A;  2E7U A;  1EQB A;  1BKG A;  4J8L A;  2ZYJ A;  3RBF A;  1BT4 A;  2W8W A;  4ZM3 A;  4ITG A;  2AEU A;  3BC8 A;  1WST A;  4A0H A;  1DJE A;  1DJ9 A;  2W7M A;  2JIS A;  3IHJ A;  4XAU A;  2VGU A;  3GZD A;  1MLZ A;  5DX5 A;  3HMU A;  4A6U A;  3QGU A;  2BI5 A;  3R4T A;  4UHM A;  4W5K A;  1GBN A;  5C6U A;  1TAT A;  3E2Z A;  4WYE A;  5M4D A;  3MAD A;  2CJG A;  2AY6 A;  2GSA A;  1AMA A;  1H0C A;  1PFF A;  3K7Y A;  4GE9 A;  1ZOD A;  3P1T A;  5HDM A;  3WLX A;  4OC9 A;  4RKD A;  5E5I A;  4Q75 A;  1EG5 A;  1ASL A;  3BCB A;  3GET A;  3EZS A;  3H7F A;  1ASC A;  4WB0 A;  1X0M A;  4HVK A;  2CFB A;  3DR7 A;  4W91 A;  1IX8 A;  2EZ2 A;  1O4S A;  2OQX A;  1ELQ A;  4LNM A;  4XJM A;  1JF9 A;  1SZS A;  4R5F A;  1KL1 A;  1YAA A;  2QB2 A;  4JEZ A;  4XEW A;  3TFU A;  2R5C A;  2RFV A;  3VP6 A;  2FNU A;  1ARI A;  1TOJ A;  3AEN A;  1IUG A;  3NYU A;  3FRK A;  4LNL A;  3ECD A;  2VGW A;  3EUC A;  1AKA A;  5AX8 A;  3T32 A;  3E2Z B;  1W7M A;  3DXW A;  1AY8 A;  4CXQ A;  3EI5 A;  1KKP A;  3HL2 A;  4OBU A;  3EIA A;  2QBT A;  2AY7 A;  2HZP A;  4A6R A;  2W7J A;  1J04 A;  1FG7 A;  2CJD A;  1G4V A;  3NUI A;  1B9I A;  4ADE A;  3EI8 A;  1IAX A;  3WZF A;  4CBS A;  4XJO A;  3EI9 A;  1WKH A;  2BI2 A;  2C81 A;  1W7L A;  3DYD A;  2AY5 A;  3FZ8 A;  1TOI A;  2O0R A;  3FZ6 A;  2BYL A;  3I4J A;  3F9T A;  1UU1 A;  1SPA A;  3FD0 A;  3BCA A;  3HQT A;  5HXX A;  1AHE A;  2CB1 A;  4WP0 A;  3TFT A;  1WYV A;  3QI6 A;  4ZDL A;  4ZAH A;  2JGT A;  4CBR A;  1QJ5 A;  4QGR A;  1ORD A;  5EIG A;  1ASA A;  4EFF A;  2EGY A;  3WKS A;  4B98 A;  1JS3 A;  2VMS A;  4L0O A;  3VK3 A;  1RV4 A;  2VMP A;  3AEJ A;  2VMZ A;  2GQN A;  1CZC A;  2YOB A;  3A9Y A;  4RLG A;  4JEY A;  1O62 A;  4EMY A;  1ZC9 A;  2Z67 A;  2CAN A;  2QLR A;  2Z9W A;  3W1H A;  2YKX A;  1MLY A;  1AHF A;  1YJZ A;  3CQ5 A;  1MGV A;  2OAT A;  1MDZ A;  1C0N A;  2HUF A;  3FQ7 A;  3JTX A;  1ASM A;  2CTZ A;  2JJG A;  3ZZK A;  4W1W A;  2VIB A;  1SFF A;  1GC3 A;  2ZJG A;  1OHW A;  3EIB A;  4TV7 A;  2R0T A;  1AY5 A;  4IX8 A;  5HHY A;  2DOU A;  1U08 A;  4MGR A;  5BJ3 A;  1ECX A;  2GMS A;  4ITX A;  3UAK A;  1BS0 A;  5F8V A;  5EIG B;  4N0W A;  2FQ6 A;  2CH2 A;  3KGW A;  1ASF A;  1I29 A;  2VLF A;  3QBO A;  1SZU A;  3HT4 A;  1CL1 A;  2ZC0 A;  1WYT A;  3ZZJ A;  4F5K A;  2VMN A;  1ARH A;  2JG2 A;  2W7K A;  3GZC A;  4TMR A;  2BI3 A;  3FCR A;  3PAA A;  4GDY A;  1QIR A;  1YIY A;  1M32 A;  2D7Z A;  1YJY A;  2Z61 A;  4MSO A;  1GC2 A;  4WXB A;  1M6S A;  2D5Y A;  1AY4 A;  1JG8 A;  3MEB A;  4BA4 A;  1BJN A;  3N5M A;  3RI6 A;  1LW4 A;  4UOY A;  3ACZ A;  1BQD A;  2BI1 A;  2AY4 A;  1CZE A;  1AHG A;  1LS3 A;  2DGK A;  4O6Z A;  1ARG A;  3RCH B;  2VI9 A;  3GSB A;  3GWP A;  4WYA A;  4AO4 A;  3TAT A;  3AAT A;  4KAM A;  3KGX A;  1BJO B;  3MBB A;  2W7D A;  2R5E A;  5DJ1 A;  2VGZ A;  2XH1 A;  1CS1 A;  4RIZ A;  2ZY3 A;  1ASN A;  2YKU A;  3WCO A;  1CQ6 A;  1C9C A;  1B5O A;  1JS6 A;  1PMO A;  4JE5 A;  3FVS A;  2YRI A;  2QA3 A;  1W23 A;  4WBT A;  3GBX A;  3ASB A;  1AJS B;  5FT5 A;  4KXK A;  5K8B A;  2QMA A;  2AEV A;  4MQQ A; 
#chains in the Genus database with same CATH topology
 3M5U A;  2VMO A;  4MQP A;  3MAF A;  3N0L A;  2BI9 A;  4K2B A;  2VMU A;  1I41 A;  3DZZ A;  1N31 A;  4F5L A;  3LWS A;  3F0H A;  1OAT A;  3RCH A;  4RIT A;  3ASA A;  3G8M A;  4WLH A;  1SZK A;  4B9B A;  3AEO A;  3IF2 A;  1IX7 A;  2QB3 A;  4LW4 A;  1FG3 A;  1BJ4 A;  2D61 A;  1AJR A;  4EB5 A;  1M4N A;  3NU7 A;  5G09 A;  1DGD A;  2DKB A;  1GD9 A;  1XI9 A;  2CST A;  2VMY A;  1AAW A;  1BQA A;  1GEW A;  5M49 A;  2X3L A;  4W1X A;  1DJU A;  3AEM A;  3QM2 A;  5J8Q A;  4F4E A;  3DOD A;  3LVK A;  4JF1 A;  2AY1 A;  3AEL A;  2FN6 A;  1OHY A;  2YCN A;  3AV7 A;  2X5F A;  4BHD A;  2JJF A;  3FKD A;  2OGA A;  2R5C B;  2Z9V A;  1AJS A;  4WD2 A;  2HP2 A;  4W8I A;  2BWN A;  3PIU A;  4PIW A;  2DGL A;  3JZL A;  3W1I A;  4WXF A;  4AO9 A;  4F5J A;  1AIB A;  4E1O A;  4IW7 A;  3E9K A;  2AY9 A;  3AOW A;  3FQ8 A;  4BMK A;  4H63 Q;  2JJE A;  1QZ9 A;  1ART A;  1AMQ A;  2OGE A;  4WYD A;  1AMR A;  4ZM4 A;  3UE8 A;  1LC5 A;  4JF0 A;  3LVM A;  1D7S A;  1UU0 A;  5FT6 A;  1CJ0 A;  1C4K A;  5I92 A;  2VMW A;  4AZJ A;  2BIE A;  4LNJ A;  5F9S A;  1GEY A;  1AX4 A;  1D7U A;  3ISL A;  3B1E A;  2R2N A;  2ORD A;  1YOO A;  1TPL A;  3OKS A;  1N2T A;  1MDO A;  4HF8 A;  4ISY A;  3B8X A;  3NYT A;  1S0A A;  1B4X A;  1M0Q A;  1AHY A;  2Z1Y A;  4Q31 A;  2Z20 A;  3ZRR A;  3FFH A;  1AIA A;  1G7X A;  3ATH A;  3HBX A;  5EAA A;  5DB5 A;  4EB7 A;  4XJP A;  3NDN A;  4IYO A;  4Y0D A;  2VMV A;  4F5M A;  1P3W A;  3FQA A;  2WB6 A;  1OXP A;  1S08 A;  4IY7 A;  4W1V A;  1T3I A;  1V2E A;  3DRD A;  2VMQ A;  3FVU A;  4ATQ A;  5LH9 A;  2Z9U A;  1YJS A;  4H51 A;  3GR9 A;  1KKJ A;  2CJH A;  2W7H A;  2HOZ A;  2DGM A;  1LK9 A;  1VP4 A;  3H14 A;  3QPG A;  4RKC A;  2BWP A;  4N0B A;  1AHX A;  2VI8 A;  3QHX A;  3DU4 A;  4XQ2 A;  3Q8N A;  4Q76 A;  2WK8 A;  1OXO A;  9AAT A;  4IXS A;  1E5F A;  3L44 A;  3PDB B;  4I8A A;  1XEY A;  1LW5 A;  2ZY5 A;  3KE3 A;  3A9X A;  2C0R A;  1SVV A;  2E7I A;  2C44 A;  3KKI A;  2DKJ A;  2AY8 A;  4R5Z A;  1MAQ A;  4JEV A;  4K2M A;  1MAP A;  1YIZ A;  4MY5 A;  3LVL B;  2VMX A;  3AEM C;  1DKA A;  1UKJ A;  1IX6 A;  3OP7 A;  5EAV A;  2KFP A;  1LKC A;  2CH1 A;  4K2I A;  4EU1 A;  2W7F A;  3WKR A;  1TAR A;  1AAM A;  4ATP A;  3G0T A;  2VIA A;  2ZP7 A;  2WK7 A;  4WXG A;  3HVY A;  3I5T A;  2HOR A;  1QJ3 A;  1WYU A;  2PB0 A;  3BCX A;  2OKJ A;  2VLH A;  3BWN C;  4E77 A;  4M2K A;  3ZRP A;  1C7N A;  3PJ0 A;  3NUB A;  1IVR A;  4ZLV A;  1MDX A;  4FFC A;  1RV3 A;  1M0N A;  3EI6 A;  3II0 A;  1GDE A;  4M2J A;  1C7O A;  3AEP A;  1DGE A;  3FSL A;  1M0P A;  2WKA A;  2NMP A;  5BJ4 A;  3L8A A;  5D95 A;  1C7G A;  5EUD A;  3DR4 A;  2BWO A;  4BA5 A;  1QIS A;  4LW2 A;  4A00 A;  1LC7 A;  4WB0 B;  4JEX A;  3NTJ A;  1GC4 A;  4GRX A;  1DTY A;  4PVF A;  4GEB A;  1J32 A;  3NX3 A;  5M4B A;  3NNK A;  1S07 A;  1AMS A;  2D65 A;  3CQ4 A;  3MAU A;  4A72 A;  4WYC A;  5EUE A;  4FL0 A;  3PGY A;  2O7C A;  2EO5 A;  5EQC A;  2AAT A;  3E2Y A;  4KYO A;  1ASB A;  1N8P A;  2DR1 A;  4E3R A;  3B1C A;  2Z1Z A;  3P6K A;  1OHV A;  2WK9 A;  3CBF A;  4Y0I A;  2F8J A;  5FT4 A;  1ASE A;  4F5G A;  2D66 A;  2YKV A;  2GMU A;  2BHX A;  3RBL A;  4J5U A;  4DGT A;  3R9A A;  1IAY A;  4IYO B;  3RQ1 A;  5LHA A;  2W8J A;  5EFS A;  2ZY2 A;  1WYT B;  3BV0 A;  3BWN A;  2X8U A;  3LG0 A;  1PMM A;  2D64 A;  3N7N A;  4CVQ A;  4WYF A;  4ZWV A;  1X28 A;  3BB8 A;  1FC4 A;  3WCN A;  2FM1 A;  2D7Y A;  1AIC A;  1I43 A;  2QSR A;  2ZUK A;  3E2F A;  1ASD A;  1CQ8 A;  1V2D A;  2YCT A;  3A9Z A;  3MKJ A;  1GC0 A;  2VGV A;  3FFR A;  1E5E A;  1BJO A;  1W3U A;  4ZWM A;  4Y0H A;  3TCM A;  4RJ0 A;  1PG8 A;  3AEJ C;  3E77 A;  5G4J A;  1ARS A;  1KMJ A;  3CAI A;  4UHN A;  2W7G A;  3E6G A;  3CQ6 A;  3PD6 A;  3ZRQ A;  4AZK A;  2YRR A;  3B1D A;  4NOG A;  4A0G A;  2JJH A;  1VJO A;  2VGS A;  3NRA A;  1O69 A;  4UHO A;  1D7V A;  2D63 A;  1B5P A;  2W7E A;  2EYQ A;  2BYJ A;  3BS8 A;  1CL2 A;  4PFF A;  2ZY4 A;  1BJW A;  2HUU A;  5EUN A;  1AKB A;  3JWA A;  3GJU A;  4K05 A;  2O1B A;  3WGB A;  3ELP A;  1G7W A;  5G0A A;  4RAE A;  5DJ9 A;  3BWO A;  4OMA A;  1G4X A;  2YCP A;  2OKK A;  1RVU A;  3DXV A;  2HUI A;  1BW0 A;  3VOM A;  3HLM A;  4GE7 A;  5JAY A;  3MC6 C;  4ADC A;  4RM1 A;  1GEX A;  1QGN A;  8AAT A;  3PA9 A;  3PD6 B;  1M7Y A;  1D7R A;  1D2F A;  2TPL A;  4U2H A;  4P7Y A;  2W7L A;  1W7N A;  2XBN A;  1GCK A;  1Z7D A;  4AOA A;  4ADD A;  3A2B A;  4ZSW A;  1UU2 A;  3MAF B;  1Y4I A;  4DQ6 A;  1ZOB A;  5G2Q A;  2BIA A;  4A0R A;  1H1C A;  2CY8 A;  3FZ7 A;  2GB3 A;  4WYG A;  4A6T A;  1IJI A;  4LC3 A;  3UWC A;  1TAS A;  4ADB A;  2V0Y A;  3WX9 A;  3PDB A;  4M2M A;  4GSA A;  4JEW A;  5G2P A;  3LY1 A;  2EPJ A;  5D5S A;  3VAX A;  4R2N A;  4U1T A;  4OBV A;  1X29 A;  3NU8 A;  4MKJ A;  1QIT A;  1WYU B;  3BN1 A;  2VYC A;  3HDO A;  3NYS A;  4IXZ A;  2E7J A;  2FYF A;  2W8T A;  2YHK A;  3EZ1 A;  3PDX A;  2ZSL A;  3EI7 A;  3TQX A;  4OTL A;  3WY7 A;  1O61 A;  3GZD C;  3JU7 A;  4OT8 A;  1LC8 A;  4AH3 A;  4F5H A;  4BQ0 A;  3VK4 A;  2A1V A;  2G7J A;  3D6K A;  1KL2 A;  3DC1 A;  1I48 A;  3MC6 A;  3AOV A;  5E4Z A;  4P3M A;  4R8D A;  4JE5 D;  2CIN A;  1TOE A;  2VMT A;  3JWB A;  4TN4 A;  2HOY A;  2E54 A;  1V2F A;  3F6T A;  5FT8 A;  2W8U A;  4MKK A;  5G4I A;  2HOX A;  2HP1 A;  4CXR A;  1EJI A;  2G6W A;  2C7T A;  5E3K A;  2YKY A;  1B9H A;  3RUY A;  4Q6R A;  3WGC A;  2EH6 A;  3K40 A;  3G7Q A;  4OCA A;  5TF5 A;  3VK2 A;  4F5I A;  5M46 A;  1DFO A;  1TOK A;  4DBC A;  3QN6 A;  1S09 A;  3K28 A;  4WLJ A;  3LVJ A;  2FNI A;  3N75 A;  4OYT A;  4PFN A;  4ZDO A;  2AY3 A;  1VEF A;  1RVY A;  2BIG A;  2VGT A;  3FVX A;  4XJL A;  7AAT A;  2X5D A;  3B46 A;  4ZDP A;  4GE4 A;  1V72 A;  1AKC A;  1ASG A;  1ELU A;  2V1P A;  3A8U X;  3FDB A;  3FTB A;  3PPL A;  3LV2 A;  4IXO A;  3ELE A;  3W1J A;  2EZ1 A;  1S06 A;  2Z9X A;  3I16 A;  3USF A;  2BKW A;  1IBJ A;  1CQ7 A;  1KMK A;  1WKG A;  2Q7W A;  3JW9 A;  2W7I A;  4ZAS A;  1TOG A;  2VMR A;  2FKI A;  4UQV A;  2ZSM A;  4XK1 A;  4F5F A;  4ZSY A;  2W8V A;  3AEN B;  1Z3Z A;  1WYV B;  1X2A A;  3COG A;  4RJY A;  5IWQ A;  4E3Q A;  1B8G A;  1YNU A;  2AY2 A;  3FDD A;  1M0O A;  2PB2 A;  2PO3 A;  1SF2 A;  4MQR A;  4A0F A;  3N4X A;  2E7U A;  1EQB A;  1BKG A;  4J8L A;  2ZYJ A;  3RBF A;  1BT4 A;  2W8W A;  4ZM3 A;  4ITG A;  2AEU A;  3BC8 A;  1WST A;  4A0H A;  1DJE A;  1DJ9 A;  2W7M A;  2JIS A;  3IHJ A;  4XAU A;  2VGU A;  3GZD A;  1MLZ A;  5DX5 A;  3HMU A;  4A6U A;  3QGU A;  2BI5 A;  3R4T A;  4UHM A;  4W5K A;  1GBN A;  5C6U A;  1TAT A;  3E2Z A;  4WYE A;  5M4D A;  3H9X A;  3MAD A;  2CJG A;  2AY6 A;  2GSA A;  1AMA A;  1H0C A;  1PFF A;  3K7Y A;  4GE9 A;  1ZOD A;  3P1T A;  5HDM A;  3WLX A;  4OC9 A;  4RKD A;  5E5I A;  4Q75 A;  1EG5 A;  1ASL A;  3BCB A;  3GET A;  3EZS A;  3H7F A;  1ASC A;  4WB0 A;  1X0M A;  4HVK A;  2CFB A;  3DR7 A;  4W91 A;  1IX8 A;  2EZ2 A;  1O4S A;  2OQX A;  1ELQ A;  4LNM A;  4XJM A;  1JF9 A;  1SZS A;  4R5F A;  1KL1 A;  3N4R A;  1YAA A;  2QB2 A;  4JEZ A;  4XEW A;  3TFU A;  2R5C A;  2RFV A;  3VP6 A;  2FNU A;  1ARI A;  1TOJ A;  3AEN A;  1IUG A;  3NYU A;  3FRK A;  4LNL A;  3ECD A;  2VGW A;  3EUC A;  1AKA A;  5AX8 A;  3T32 A;  3E2Z B;  1W7M A;  3DXW A;  1AY8 A;  4CXQ A;  3EI5 A;  1KKP A;  3HL2 A;  4OBU A;  3EIA A;  2QBT A;  2AY7 A;  3N4S A;  2HZP A;  4A6R A;  2W7J A;  1J04 A;  1FG7 A;  2CJD A;  1G4V A;  3NUI A;  1B9I A;  4ADE A;  3EI8 A;  1KAF A;  1IAX A;  3WZF A;  4CBS A;  4XJO A;  3EI9 A;  1WKH A;  2BI2 A;  2C81 A;  1W7L A;  3DYD A;  2AY5 A;  3FZ8 A;  1TOI A;  2O0R A;  3FZ6 A;  2BYL A;  3I4J A;  3F9T A;  1UU1 A;  1SPA A;  3FD0 A;  3BCA A;  3HQT A;  5HXX A;  1AHE A;  2CB1 A;  4WP0 A;  3TFT A;  1WYV A;  3QI6 A;  4ZDL A;  4ZAH A;  2JGT A;  4CBR A;  1QJ5 A;  4QGR A;  1ORD A;  5EIG A;  1ASA A;  4EFF A;  2EGY A;  3WKS A;  4B98 A;  1JS3 A;  2VMS A;  4L0O A;  3VK3 A;  1RV4 A;  2VMP A;  3AEJ A;  2VMZ A;  2GQN A;  1CZC A;  2YOB A;  3A9Y A;  4RLG A;  4JEY A;  1O62 A;  4EMY A;  1ZC9 A;  2Z67 A;  2CAN A;  2QLR A;  2Z9W A;  3W1H A;  2YKX A;  1MLY A;  1AHF A;  1YJZ A;  3CQ5 A;  1MGV A;  2OAT A;  1MDZ A;  1C0N A;  2HUF A;  3FQ7 A;  3JTX A;  1ASM A;  2CTZ A;  2JJG A;  3ZZK A;  4W1W A;  2VIB A;  1SFF A;  1GC3 A;  2ZJG A;  1OHW A;  3EIB A;  4TV7 A;  2R0T A;  1AY5 A;  4IX8 A;  5HHY A;  2DOU A;  1U08 A;  4MGR A;  5BJ3 A;  1ECX A;  2GMS A;  4ITX A;  3UAK A;  1BS0 A;  5F8V A;  5EIG B;  4N0W A;  2FQ6 A;  2CH2 A;  3KGW A;  1ASF A;  1I29 A;  2VLF A;  3QBO A;  1SZU A;  3HT4 A;  5KTB A;  1CL1 A;  2ZC0 A;  1WYT A;  3ZZJ A;  4F5K A;  2VMN A;  1ARH A;  2JG2 A;  2W7K A;  3GZC A;  4TMR A;  2BI3 A;  3FCR A;  3PAA A;  4GDY A;  1QIR A;  1YIY A;  1M32 A;  2D7Z A;  1YJY A;  2Z61 A;  4MSO A;  1GC2 A;  4WXB A;  1M6S A;  2D5Y A;  1AY4 A;  1JG8 A;  3MEB A;  4BA4 A;  1BJN A;  3N5M A;  3RI6 A;  1LW4 A;  4UOY A;  3ACZ A;  1BQD A;  2BI1 A;  2AY4 A;  1CZE A;  1AHG A;  1LS3 A;  2DGK A;  4O6Z A;  1ARG A;  3RCH B;  2VI9 A;  3GSB A;  3GWP A;  4WYA A;  4AO4 A;  3TAT A;  3AAT A;  4KAM A;  3KGX A;  1BJO B;  3MBB A;  2W7D A;  2R5E A;  5DJ1 A;  2VGZ A;  2XH1 A;  1CS1 A;  4RIZ A;  2ZY3 A;  1ASN A;  2YKU A;  3WCO A;  1CQ6 A;  1C9C A;  1B5O A;  1JS6 A;  1PMO A;  4JE5 A;  3FVS A;  2YRI A;  2QA3 A;  1W23 A;  4WBT A;  3GBX A;  3ASB A;  1AJS B;  5FT5 A;  4KXK A;  5K8B A;  2QMA A;  2AEV A;  4MQQ A; 
#chains in the Genus database with same CATH homology
 3M5U A;  2VMO A;  4MQP A;  3MAF A;  3N0L A;  2BI9 A;  4K2B A;  2VMU A;  1I41 A;  3DZZ A;  1N31 A;  4F5L A;  3LWS A;  3F0H A;  1OAT A;  3RCH A;  4RIT A;  3ASA A;  3G8M A;  4WLH A;  1SZK A;  4B9B A;  3AEO A;  3IF2 A;  1IX7 A;  2QB3 A;  4LW4 A;  1FG3 A;  1BJ4 A;  2D61 A;  1AJR A;  4EB5 A;  1M4N A;  3NU7 A;  5G09 A;  1DGD A;  2DKB A;  1GD9 A;  1XI9 A;  2CST A;  2VMY A;  1AAW A;  1BQA A;  1GEW A;  5M49 A;  2X3L A;  4W1X A;  1DJU A;  3AEM A;  3QM2 A;  5J8Q A;  4F4E A;  3DOD A;  3LVK A;  4JF1 A;  2AY1 A;  3AEL A;  2FN6 A;  1OHY A;  2YCN A;  3AV7 A;  2X5F A;  4BHD A;  2JJF A;  3FKD A;  2OGA A;  2R5C B;  2Z9V A;  1AJS A;  4WD2 A;  2HP2 A;  4W8I A;  2BWN A;  3PIU A;  4PIW A;  2DGL A;  3JZL A;  3W1I A;  4WXF A;  4AO9 A;  4F5J A;  1AIB A;  4E1O A;  4IW7 A;  3E9K A;  2AY9 A;  3AOW A;  3FQ8 A;  4BMK A;  4H63 Q;  2JJE A;  1QZ9 A;  1ART A;  1AMQ A;  2OGE A;  4WYD A;  1AMR A;  4ZM4 A;  3UE8 A;  1LC5 A;  4JF0 A;  3LVM A;  1D7S A;  1UU0 A;  5FT6 A;  1CJ0 A;  1C4K A;  5I92 A;  2VMW A;  4AZJ A;  2BIE A;  4LNJ A;  5F9S A;  1GEY A;  1AX4 A;  1D7U A;  3ISL A;  3B1E A;  2R2N A;  2ORD A;  1YOO A;  1TPL A;  3OKS A;  1N2T A;  1MDO A;  4HF8 A;  4ISY A;  3B8X A;  3NYT A;  1S0A A;  1B4X A;  1M0Q A;  1AHY A;  2Z1Y A;  4Q31 A;  2Z20 A;  3ZRR A;  3FFH A;  1AIA A;  1G7X A;  3ATH A;  3HBX A;  5EAA A;  5DB5 A;  4EB7 A;  4XJP A;  3NDN A;  4IYO A;  4Y0D A;  2VMV A;  4F5M A;  1P3W A;  3FQA A;  2WB6 A;  1OXP A;  1S08 A;  4IY7 A;  4W1V A;  1T3I A;  1V2E A;  3DRD A;  2VMQ A;  3FVU A;  4ATQ A;  5LH9 A;  2Z9U A;  1YJS A;  4H51 A;  3GR9 A;  1KKJ A;  2CJH A;  2W7H A;  2HOZ A;  2DGM A;  1LK9 A;  1VP4 A;  3H14 A;  3QPG A;  4RKC A;  2BWP A;  4N0B A;  1AHX A;  2VI8 A;  3QHX A;  3DU4 A;  4XQ2 A;  3Q8N A;  4Q76 A;  2WK8 A;  1OXO A;  9AAT A;  4IXS A;  1E5F A;  3L44 A;  3PDB B;  4I8A A;  1XEY A;  1LW5 A;  2ZY5 A;  3KE3 A;  3A9X A;  2C0R A;  1SVV A;  2E7I A;  2C44 A;  3KKI A;  2DKJ A;  2AY8 A;  4R5Z A;  1MAQ A;  4JEV A;  4K2M A;  1MAP A;  1YIZ A;  4MY5 A;  3LVL B;  2VMX A;  3AEM C;  1DKA A;  1UKJ A;  1IX6 A;  3OP7 A;  5EAV A;  2KFP A;  1LKC A;  2CH1 A;  4K2I A;  4EU1 A;  2W7F A;  3WKR A;  1TAR A;  1AAM A;  4ATP A;  3G0T A;  2VIA A;  2ZP7 A;  2WK7 A;  4WXG A;  3HVY A;  3I5T A;  2HOR A;  1QJ3 A;  1WYU A;  2PB0 A;  3BCX A;  2OKJ A;  2VLH A;  3BWN C;  4E77 A;  4M2K A;  3ZRP A;  1C7N A;  3PJ0 A;  3NUB A;  1IVR A;  4ZLV A;  1MDX A;  4FFC A;  1RV3 A;  1M0N A;  3EI6 A;  3II0 A;  1GDE A;  4M2J A;  1C7O A;  3AEP A;  1DGE A;  3FSL A;  1M0P A;  2WKA A;  2NMP A;  5BJ4 A;  3L8A A;  5D95 A;  1C7G A;  5EUD A;  3DR4 A;  2BWO A;  4BA5 A;  1QIS A;  4LW2 A;  4A00 A;  1LC7 A;  4WB0 B;  4JEX A;  3NTJ A;  1GC4 A;  4GRX A;  1DTY A;  4PVF A;  4GEB A;  1J32 A;  3NX3 A;  5M4B A;  3NNK A;  1S07 A;  1AMS A;  2D65 A;  3CQ4 A;  3MAU A;  4A72 A;  4WYC A;  5EUE A;  4FL0 A;  3PGY A;  2O7C A;  2EO5 A;  5EQC A;  2AAT A;  3E2Y A;  4KYO A;  1ASB A;  1N8P A;  2DR1 A;  4E3R A;  3B1C A;  2Z1Z A;  3P6K A;  1OHV A;  2WK9 A;  3CBF A;  4Y0I A;  2F8J A;  5FT4 A;  1ASE A;  4F5G A;  2D66 A;  2YKV A;  2GMU A;  2BHX A;  3RBL A;  4J5U A;  4DGT A;  3R9A A;  1IAY A;  4IYO B;  3RQ1 A;  5LHA A;  2W8J A;  5EFS A;  2ZY2 A;  1WYT B;  3BV0 A;  3BWN A;  2X8U A;  3LG0 A;  1PMM A;  2D64 A;  3N7N A;  4CVQ A;  4WYF A;  4ZWV A;  1X28 A;  3BB8 A;  1FC4 A;  3WCN A;  2FM1 A;  2D7Y A;  1AIC A;  1I43 A;  2QSR A;  2ZUK A;  3E2F A;  1ASD A;  1CQ8 A;  1V2D A;  2YCT A;  3A9Z A;  3MKJ A;  1GC0 A;  2VGV A;  3FFR A;  1E5E A;  1BJO A;  1W3U A;  4ZWM A;  4Y0H A;  3TCM A;  4RJ0 A;  1PG8 A;  3AEJ C;  3E77 A;  5G4J A;  1ARS A;  1KMJ A;  3CAI A;  4UHN A;  2W7G A;  3E6G A;  3CQ6 A;  3PD6 A;  3ZRQ A;  4AZK A;  2YRR A;  3B1D A;  4NOG A;  4A0G A;  2JJH A;  1VJO A;  2VGS A;  3NRA A;  1O69 A;  4UHO A;  1D7V A;  2D63 A;  1B5P A;  2W7E A;  2EYQ A;  2BYJ A;  3BS8 A;  1CL2 A;  4PFF A;  2ZY4 A;  1BJW A;  2HUU A;  5EUN A;  1AKB A;  3JWA A;  3GJU A;  4K05 A;  2O1B A;  3WGB A;  3ELP A;  1G7W A;  5G0A A;  4RAE A;  5DJ9 A;  3BWO A;  4OMA A;  1G4X A;  2YCP A;  2OKK A;  1RVU A;  3DXV A;  2HUI A;  1BW0 A;  3VOM A;  3HLM A;  4GE7 A;  5JAY A;  3MC6 C;  4ADC A;  4RM1 A;  1GEX A;  1QGN A;  8AAT A;  3PA9 A;  3PD6 B;  1M7Y A;  1D7R A;  1D2F A;  2TPL A;  4U2H A;  4P7Y A;  2W7L A;  1W7N A;  2XBN A;  1GCK A;  1Z7D A;  4AOA A;  4ADD A;  3A2B A;  4ZSW A;  1UU2 A;  3MAF B;  1Y4I A;  4DQ6 A;  1ZOB A;  5G2Q A;  2BIA A;  4A0R A;  1H1C A;  2CY8 A;  3FZ7 A;  2GB3 A;  4WYG A;  4A6T A;  1IJI A;  4LC3 A;  3UWC A;  1TAS A;  4ADB A;  2V0Y A;  3WX9 A;  3PDB A;  4M2M A;  4GSA A;  4JEW A;  5G2P A;  3LY1 A;  2EPJ A;  5D5S A;  3VAX A;  4R2N A;  4U1T A;  4OBV A;  1X29 A;  3NU8 A;  4MKJ A;  1QIT A;  1WYU B;  3BN1 A;  2VYC A;  3HDO A;  3NYS A;  4IXZ A;  2E7J A;  2FYF A;  2W8T A;  2YHK A;  3EZ1 A;  3PDX A;  2ZSL A;  3EI7 A;  3TQX A;  4OTL A;  3WY7 A;  1O61 A;  3GZD C;  3JU7 A;  4OT8 A;  1LC8 A;  4AH3 A;  4F5H A;  4BQ0 A;  3VK4 A;  2A1V A;  2G7J A;  3D6K A;  1KL2 A;  3DC1 A;  1I48 A;  3MC6 A;  3AOV A;  5E4Z A;  4P3M A;  4R8D A;  4JE5 D;  2CIN A;  1TOE A;  2VMT A;  3JWB A;  4TN4 A;  2HOY A;  2E54 A;  1V2F A;  3F6T A;  5FT8 A;  2W8U A;  4MKK A;  5G4I A;  2HOX A;  2HP1 A;  4CXR A;  1EJI A;  2G6W A;  2C7T A;  5E3K A;  2YKY A;  1B9H A;  3RUY A;  4Q6R A;  3WGC A;  2EH6 A;  3K40 A;  3G7Q A;  4OCA A;  5TF5 A;  3VK2 A;  4F5I A;  5M46 A;  1DFO A;  1TOK A;  4DBC A;  3QN6 A;  1S09 A;  3K28 A;  4WLJ A;  3LVJ A;  2FNI A;  3N75 A;  4OYT A;  4PFN A;  4ZDO A;  2AY3 A;  1VEF A;  1RVY A;  2BIG A;  2VGT A;  3FVX A;  4XJL A;  7AAT A;  2X5D A;  3B46 A;  4ZDP A;  4GE4 A;  1V72 A;  1AKC A;  1ASG A;  1ELU A;  2V1P A;  3A8U X;  3FDB A;  3FTB A;  3PPL A;  3LV2 A;  4IXO A;  3ELE A;  3W1J A;  2EZ1 A;  1S06 A;  2Z9X A;  3I16 A;  3USF A;  2BKW A;  1IBJ A;  1CQ7 A;  1KMK A;  1WKG A;  2Q7W A;  3JW9 A;  2W7I A;  4ZAS A;  1TOG A;  2VMR A;  2FKI A;  4UQV A;  2ZSM A;  4XK1 A;  4F5F A;  4ZSY A;  2W8V A;  3AEN B;  1Z3Z A;  1WYV B;  1X2A A;  3COG A;  4RJY A;  5IWQ A;  4E3Q A;  1B8G A;  1YNU A;  2AY2 A;  3FDD A;  1M0O A;  2PB2 A;  2PO3 A;  1SF2 A;  4MQR A;  4A0F A;  3N4X A;  2E7U A;  1EQB A;  1BKG A;  4J8L A;  2ZYJ A;  3RBF A;  1BT4 A;  2W8W A;  4ZM3 A;  4ITG A;  2AEU A;  3BC8 A;  1WST A;  4A0H A;  1DJE A;  1DJ9 A;  2W7M A;  2JIS A;  3IHJ A;  4XAU A;  2VGU A;  3GZD A;  1MLZ A;  5DX5 A;  3HMU A;  4A6U A;  3QGU A;  2BI5 A;  3R4T A;  4UHM A;  4W5K A;  1GBN A;  5C6U A;  1TAT A;  3E2Z A;  4WYE A;  5M4D A;  3H9X A;  3MAD A;  2CJG A;  2AY6 A;  2GSA A;  1AMA A;  1H0C A;  1PFF A;  3K7Y A;  4GE9 A;  1ZOD A;  3P1T A;  5HDM A;  3WLX A;  4OC9 A;  4RKD A;  5E5I A;  4Q75 A;  1EG5 A;  1ASL A;  3BCB A;  3GET A;  3EZS A;  3H7F A;  1ASC A;  4WB0 A;  1X0M A;  4HVK A;  2CFB A;  3DR7 A;  4W91 A;  1IX8 A;  2EZ2 A;  1O4S A;  2OQX A;  1ELQ A;  4LNM A;  4XJM A;  1JF9 A;  1SZS A;  4R5F A;  1KL1 A;  3N4R A;  1YAA A;  2QB2 A;  4JEZ A;  4XEW A;  3TFU A;  2R5C A;  2RFV A;  3VP6 A;  2FNU A;  1ARI A;  1TOJ A;  3AEN A;  1IUG A;  3NYU A;  3FRK A;  4LNL A;  3ECD A;  2VGW A;  3EUC A;  1AKA A;  5AX8 A;  3T32 A;  3E2Z B;  1W7M A;  3DXW A;  1AY8 A;  4CXQ A;  3EI5 A;  1KKP A;  3HL2 A;  4OBU A;  3EIA A;  2QBT A;  2AY7 A;  3N4S A;  2HZP A;  4A6R A;  2W7J A;  1J04 A;  1FG7 A;  2CJD A;  1G4V A;  3NUI A;  1B9I A;  4ADE A;  3EI8 A;  1IAX A;  3WZF A;  4CBS A;  4XJO A;  3EI9 A;  1WKH A;  2BI2 A;  2C81 A;  1W7L A;  3DYD A;  2AY5 A;  3FZ8 A;  1TOI A;  2O0R A;  3FZ6 A;  2BYL A;  3I4J A;  3F9T A;  1UU1 A;  1SPA A;  3FD0 A;  3BCA A;  3HQT A;  5HXX A;  1AHE A;  2CB1 A;  4WP0 A;  3TFT A;  1WYV A;  3QI6 A;  4ZDL A;  4ZAH A;  2JGT A;  4CBR A;  1QJ5 A;  4QGR A;  1ORD A;  5EIG A;  1ASA A;  4EFF A;  2EGY A;  3WKS A;  4B98 A;  1JS3 A;  2VMS A;  4L0O A;  3VK3 A;  1RV4 A;  2VMP A;  3AEJ A;  2VMZ A;  2GQN A;  1CZC A;  2YOB A;  3A9Y A;  4RLG A;  4JEY A;  1O62 A;  4EMY A;  1ZC9 A;  2Z67 A;  2CAN A;  2QLR A;  2Z9W A;  3W1H A;  2YKX A;  1MLY A;  1AHF A;  1YJZ A;  3CQ5 A;  1MGV A;  2OAT A;  1MDZ A;  1C0N A;  2HUF A;  3FQ7 A;  3JTX A;  1ASM A;  2CTZ A;  2JJG A;  3ZZK A;  4W1W A;  2VIB A;  1SFF A;  1GC3 A;  2ZJG A;  1OHW A;  3EIB A;  4TV7 A;  2R0T A;  1AY5 A;  4IX8 A;  5HHY A;  2DOU A;  1U08 A;  4MGR A;  5BJ3 A;  1ECX A;  2GMS A;  4ITX A;  3UAK A;  1BS0 A;  5F8V A;  5EIG B;  4N0W A;  2FQ6 A;  2CH2 A;  3KGW A;  1ASF A;  1I29 A;  2VLF A;  3QBO A;  1SZU A;  3HT4 A;  5KTB A;  1CL1 A;  2ZC0 A;  1WYT A;  3ZZJ A;  4F5K A;  2VMN A;  1ARH A;  2JG2 A;  2W7K A;  3GZC A;  4TMR A;  2BI3 A;  3FCR A;  3PAA A;  4GDY A;  1QIR A;  1YIY A;  1M32 A;  2D7Z A;  1YJY A;  2Z61 A;  4MSO A;  1GC2 A;  4WXB A;  1M6S A;  2D5Y A;  1AY4 A;  1JG8 A;  3MEB A;  4BA4 A;  1BJN A;  3N5M A;  3RI6 A;  1LW4 A;  4UOY A;  3ACZ A;  1BQD A;  2BI1 A;  2AY4 A;  1CZE A;  1AHG A;  1LS3 A;  2DGK A;  4O6Z A;  1ARG A;  3RCH B;  2VI9 A;  3GSB A;  3GWP A;  4WYA A;  4AO4 A;  3TAT A;  3AAT A;  4KAM A;  3KGX A;  1BJO B;  3MBB A;  2W7D A;  2R5E A;  5DJ1 A;  2VGZ A;  2XH1 A;  1CS1 A;  4RIZ A;  2ZY3 A;  1ASN A;  2YKU A;  3WCO A;  1CQ6 A;  1C9C A;  1B5O A;  1JS6 A;  1PMO A;  4JE5 A;  3FVS A;  2YRI A;  2QA3 A;  1W23 A;  4WBT A;  3GBX A;  3ASB A;  1AJS B;  5FT5 A;  4KXK A;  5K8B A;  2QMA A;  2AEV A;  4MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...