1AKAA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
401
structure length
401
Chain Sequence
b'SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
total genus 149
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1akaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1akaA01
2BIAA 3WKRA 5I92A 4XJOA 4N0BA 3WCNA 4ADBA 3LVJA 1AICA 1QGNA 4W1XA 1CQ6A 2C81A 1V2EA 1OATA 1WYTB 1XI9A 2VGZA 4BHDA 4PIWA 1AY8A 1W23A 3MADA 2V1PA 4OC9A 2VMWA 3DRDA 3DR4A 4UHOA 3FRKA 1FG3A 2FNUA 1OXOA 1TOGA 1YAAA 2YKYA 1D7UA 1M0QA 2V0YA 2WK8A 3QBOA 3ECDA 2CH1A 4ZASA 1YJSA 3EI5A 1QITA 4F5MA 1TATA 1UU0A 4J8LA 2ZY5A 4ZM3A 2VLFA 2VMRA 4WYGA 2QB3A 1GC0A 4ADCA 1BQDA 1AY5A 1H0CA 3EUCA 1JF9A 4MGRA 3GZCA 2X5DA 3G0TA 3JU7A 4XJMA 1GEWA 3NYTA 3AEMC 2Z9UA 4LW4A 4DQ6A 4W5KA 4WB0A 1C7GA 2AY5A 4K2IA 2BHXA 1SZKA 4AOAA 3FFRA 3BV0A 3EI9A 4Y0HA 2Z20A 4RITA 1AAMA 2OATA 3ZRPA 4E3RA 4ISYA 4UOYA 3M5UA 4E3QA 1RV3A 1X28A 1QJ5A 1WYVA 2HP1A 2RFVA 3Q8NA 1IAYA 4Y0IA 1WKHA 3NUIA 2W7FA 4WXGA 1GC3A 2VMQA 2W8JA 1LS3A 4K2BA 1D7VA 3WY7A 1GEXA 3DZZA 3KE3A 2EZ1A 3JWAA 1W7NA 3WGCA 1O69A 3PIUA 4XJLA 2ZY4A 3COGA 1TARA 4A6UA 2BWPA 4E1OA 1H1CA 4EB7A 3ASAA 3E9KA 1SZSA 1ORDA 2R0TA 3W1JA 4OBVA 3WCOA 5FT5A 2R5CB 3BS8A 2JJHA 5G2QA 3RBLA 1OHYA 2GB3A 3HL2A 3PDBA 1ZOBA 5EAVA 3W1HA 1GCKA 1P3WA 1DJEA 1BJOB 1FG7A 4JEVA 1SVVA 3RCHA 3ATHA 1S07A 3ZZJA 4MKJA 3E6GA 1DGDA 1ARIA 1TOEA 4XEWA 5J8QA 4A0FA 5BJ4A 4RJ0A 2W8UA 3PPLA 5M49A 1AHGA 1AX4A 4AZJA 2O7CA 1D7SA 4XK1A 4ZWMA 3KGWA 3PA9A 4XJPA 4GSAA 3CQ5A 2VMOA 4A0HA 2BWOA 2O1BA 4GRXA 5EQCA 4Y0DA 1EJIA 2X3LA 1O62A 2PB2A 3ASBA 4WP0A 4WYFA 3L44A 1MAPA 3GWPA 2WKAA 1O4SA 5G4IA 1O61A 3EZSA 1AMAA 4BQ0A 2X5FA 2AEVA 3K7YA 2DR1A 4PVFA 1J32A 2AEUA 5DJ9A 1M0OA 1MLZA 1M4NA 5M46A 1YJYA 3GJUA 3MAFA 3AENB 4DGTA 1DJUA 4ZWVA 1IUGA 1GEYA 1IX8A 3GZDA 4EU1A 1PMMA 2AY8A 3BN1A 5G09A 1ARGA 2FM1A 2Z1ZA 2OGEA 1IX6A 4R8DA 1CZCA 1B5OA 2BIEA 2D65A 1ELQA 3MKJA 4LNJA 2W7MA 3TATA 4OMAA 4AO4A 1IAXA 2DGKA 4OCAA 3KGXA 3OP7A 4R2NA 1ASAA 1AHFA 2VI8A 2ZSMA 3TCMA 2D7ZA 2JJEA 3BCXA 2HUUA 4IXOA 4R5ZA 1M0PA 1B5PA 2Z9XA 2D7YA 3HBXA 3QI6A 1ECXA 2VYCA 4W91A 3QN6A 2VGTA 3AEOA 1QIRA 1I43A 5E3KA 3UE8A 2VMTA 4LC3A 2AATA 4OBUA 4OT8A 2BIGA 1G4VA 2E7IA 2BI3A 2QA3A 3B1EA 3A9ZA 1I29A 1GC2A 3E2FA 2YCPA 4ZDOA 2VMSA 1PMOA 2Z67A 3I16A 2E54A 4H51A 5C6UA 3RUYA 4RIZA 1N2TA 3N0LA 4WYDA 4EFFA 2QLRA 3DYDA 1AJSB 1FC4A 1TOIA 4OTLA 4IYOB 1PFFA 2XH1A 1S08A 3E77A 3K28A 4F5LA 3FFHA 4F4EA 4RM1A 4AH3A 1VP4A 1ARHA 3AEJC 4FFCA 3OKSA 2EH6A 1ASMA 2ZY3A 4BA5A 4ATQA 3CAIA 4CVQA 3AV7A 1B9HA 1UU1A 4L0OA 3TFTA 4AO9A 2R5CA 2JJFA 3JWBA 2CB1A 2JGTA 3FVXA 4ADDA 2CANA 1KMKA 2BKWA 1X2AA 3FKDA 2W7EA 2FNIA 1OHWA 3FTBA 4ZDLA 5EUEA 1U08A 3DXVA 1AMRA 2ZC0A 4N0WA 1BT4A 5FT4A 3NDNA 1RVYA 4ZSWA 4P7YA 1CL2A 2VGUA 2CJDA 2QBTA 4ITGA 1GDEA 4PFFA 1IBJA 1WYUB 4KYOA 3L8AA 2CSTA 1JS3A 3P1TA 4W1WA 4XAUA 4A6RA 3E2YA 4EB5A 5K8BA 1T3IA 4R5FA 3ELPA 3EI6A 2EO5A 2YCNA 1C0NA 3HMUA 5EAAA 3HDOA 3CQ4A 1RV4A 3NYSA 4A0GA 1I48A 7AATA 2HOXA 2BWNA 1PG8A 4UQVA 2E7JA 1AKAA 3AENA 4BMKA 4OYTA 4TV7A 3N75A 2W7DA 2W7IA 2W8WA 1JS6A 4WLHA 1BKGA 1QJ3A 5BJ3A 3I5TA 5G4JA 4F5JA 2TPLA 2AY6A 1QZ9A 2DKJA 3RI6A 4RKCA 2GMSA 1AIAA 2X8UA 4NOGA 2YCTA 2Z9WA 1JG8A 3USFA 1CJ0A 4F5KA 5HHYA 5G2PA 1LW5A 1ARSA 5LHAA 2R5EA 1AHEA 3JW9A 2VLHA 1YIYA 4MKKA 1ASBA 3UWCA 1KMJA 1V2DA 3BCAA 4JE5A 4E77A 3PAAA 2HUIA 5FT6A 1ASDA 3R9AA 2EGYA 4JF0A 2HZPA 3E2ZA 3N5MA 8AATA 2HP2A 1OHVA 3LG0A 1GC4A 1ASGA 1DTYA 2OQXA 3GZDC 4Q75A 2CY8A 1AMQA 3JZLA 1UKJA 1BS0A 1ARTA 4JEXA 4MQRA 1B8GA 2BI9A 3NX3A 4WD2A 2NMPA 2D66A 2VMVA 3H7FA 3G7QA 1W7MA 2E7UA 1S06A 2C0RA 3NTJA 4W8IA 5F8VA 5HDMA 4WLJA 3WGBA 4XQ2A 4A6TA 4WYCA 5FT8A 3HVYA 1CL1A 3RQ1A 1AJSA 2AY4A 2JISA 2YHKA 3EI8A 3B1DA 4IY7A 4WXBA 4F5GA 3F9TA 1G7WA 2BI2A 3MC6A 4JEYA 4RAEA 1WYTA 4WXFA 1I41A 4GE7A 2W7HA 2FYFA 4IXSA 4JE5D 4Q6RA 1S0AA 3MEBA 1E5FA 1CS1A 2W8TA 5F9SA 1KKPA 4WB0B 5EFSA 4P3MA 4UHMA 3ZZKA 3B46A 3EZ1A 3NNKA 3BWNC 1V2FA 4AZKA 1ASEA 3ACZA 2GMUA 1WYVB 3VK3A 4Q76A 3K40A 2C44A 1Z3ZA 5M4DA 2AY1A 1G4XA 5LH9A 1ASCA 2EZ2A 1C4KA 3PJ0A 4MY5A 3DR7A 3BWOA 2OGAA 1IX7A 3EIAA 4ZSYA 3FQ8A 3LVKA 2BI1A 1ZC9A 1MDZA 4ZM4A 3BCBA 1LC8A 3QGUA 3UAKA 1WSTA 1KL1A 2Q7WA 5TF5A 1SPAA 1XEYA 4IXZA 4RKDA 2AY2A 3T32A 2Z1YA 4WBTA 3RBFA 2VMPA 2AY7A 2VMXA 3FZ8A 3VAXA 5G0AA 1ASNA 3A2BA 1MAQA 4MQQA 1AHXA 3W1IA 2C7TA 3IHJA 3RCHB 1C7OA 2ZJGA 2VMNA 3GETA 3DU4A 3VK4A 4MQPA 3MAUA 4GE4A 4CBSA 2ZY2A 3HQTA 3AOVA 2OKKA 5M4BA 1DJ9A 1GD9A 1CQ7A 1TPLA 1V72A 5HXXA 3QPGA 4JEWA 4TMRA 3FQ7A 4KXKA 2VIAA 4K2MA 5D5SA 3NYUA 4KAMA 2W8VA 2YKUA 3DODA 3NU7A 2ZP7A 4M2JA 3AOWA 1YOOA 4UHNA 1BJOA 1W7LA 2ZYJA 2CINA 2ORDA 4CBRA 1EQBA 1BJNA 2WK7A 3FD0A 4MSOA 1C7NA 3FZ7A 5EIGB 4ITXA 2Z61A 3MAFB 1BQAA 2JJGA 1MDXA 2BYLA 2YRRA 3GBXA 1YNUA 1M0NA 2FN6A 1C9CA 2DOUA 4GDYA 5DJ1A 3II0A 4HF8A 3FDDA 4F5FA 3HT4A 4RJYA 3WKSA 4WYAA 3ZRQA 4IW7A 3TFUA 2G6WA 3LVMA 2OKJA 3NUBA 5EUNA 3TQXA 3QM2A 1Y4IA 3G8MA 2D63A 2ZUKA 2HOZA 1IJIA 3FVSA 2DKBA 3P6KA 1MDOA 2VMZA 1AHYA 2W7JA 1VJOA 3PD6B 1TASA 3AEJA 1KL2A 3VOMA 1LKCA 1VEFA 4ADEA 2R2NA 2VGWA 2BI5A 1WKGA 1X0MA 2AY3A 3KKIA 1YIZA 4HVKA 2QMAA 3LWSA 3FQAA 3IF2A 4ATPA 4WYEA 3R4TA 2QB2A 1ASFA 2W7GA 9AATA 3EIBA 2VGVA 1LK9A 3MC6C 4J5UA 2VGSA 1B9IA 4O6ZA 2W7LA 3AEMA 4U1TA 1G7XA 2F8JA 2O0RA 1N8PA 2D5YA 2DGLA 3GSBA 4Q31A 3B1CA 4PFNA 4W1VA 3WZFA 4LNMA 1RVUA 4U2HA 2ZSLA 1D2FA 1ELUA 2D61A 4JEZA 3FZ6A 3F6TA 1BW0A 3PGYA 4M2MA 5E4ZA 2YKXA 3LV2A 4LNLA 5EUDA 4B9BA 2YOBA 4M2KA 3FSLA 2WK9A 3A8UX 4FL0A 1AJRA 3B8XA 4ZLVA 4IYOA 1UU2A 3FVUA 1AY4A 2HOYA 2EPJA 3FCRA 4A72A 3GR9A 2VIBA 2AY9A 5DB5A 3EI7A 2CJGA 1SF2A 3ISLA 1EG5A 1MLYA 4B98A 4GEBA 2HORA 3DC1A 1Z7DA 3HLMA 1AKBA 4ZAHA 2JG2A 2PB0A 2VMYA 2XBNA 3D6KA 1S09A 1DKAA 2VMUA 1AKCA 1BJ4A 2GQNA 1D7RA 1M32A 3WX9A 3I4JA 5DX5A 2W7KA 2DGMA 4F5IA 1CZEA 3CBFA 2GSAA 5EIGA 3VP6A 1YJZA 3ZRRA 3JTXA 4CXQA 4EMYA 1J04A 1LC5A 4TN4A 3VK2A 2BYJA 5D95A 1WYUA 3FDBA 1TOKA 4I8AA 1SZUA 1W3UA 3BB8A 3DXWA 4A0RA 1X29A 1LW4A 1SFFA 1IVRA 3QHXA 1OXPA 3MBBA 1ASLA 3PDBB 3NRAA 2YKVA 5E5IA 3LY1A 1E5EA 4A00A 1AAWA 3CQ6A 4ZDPA 4F5HA 1ZODA 2Z9VA 3NU8A 2CFBA 2CH2A 4QGRA 1QISA 1N31A 2PO3A 3AEPA 3PDXA 4LW2A 2CTZA 1M6SA 3BC8A 3PD6A 1MGVA 1TOJA 4JF1A 3E2ZB 3ELEA 3WLXA 2D64A 3AATA 3H14A 4BA4A 1DGEA 4GE9A 3A9XA 4IX8A 4DBCA 1DFOA 2HUFA 1M7YA 2CJHA 2YRIA 1BJWA 4CXRA 5JAYA 5IWQA 3LVLB 3BWNA 1KKJA 1B4XA 3AELA 1LC7A 1CQ8A 3A9YA 5AX8A 1AMSA 3F0HA 1GBNA 2VI9A 2FQ6A 4RLGA 1AIBA
chains in the Genus database with same CATH superfamily
2BIAA 3WKRA 5I92A 4XJOA 4N0BA 3WCNA 4ADBA 3LVJA 1AICA 1QGNA 4W1XA 1CQ6A 2C81A 1V2EA 1OATA 1WYTB 1XI9A 2VGZA 4BHDA 4H63Q 4PIWA 1AY8A 1W23A 3MADA 2V1PA 4OC9A 2VMWA 3DRDA 3DR4A 4UHOA 3FRKA 1FG3A 2FNUA 1OXOA 1TOGA 1YAAA 2YKYA 1D7UA 1M0QA 2V0YA 2WK8A 3QBOA 3ECDA 2CH1A 4ZASA 1YJSA 3EI5A 1QITA 4F5MA 1TATA 1UU0A 4J8LA 2ZY5A 4ZM3A 2VLFA 2VMRA 4WYGA 2QB3A 1GC0A 4ADCA 1BQDA 1AY5A 1H0CA 3EUCA 1JF9A 4MGRA 3GZCA 2X5DA 3G0TA 3JU7A 4XJMA 1GEWA 5KTBA 3NYTA 3AEMC 2Z9UA 4LW4A 4DQ6A 4W5KA 4WB0A 1C7GA 2AY5A 4K2IA 2BHXA 1SZKA 4AOAA 3FFRA 3BV0A 3EI9A 4Y0HA 2Z20A 4RITA 1AAMA 2OATA 3ZRPA 2FKIA 4E3RA 4ISYA 4UOYA 3M5UA 4E3QA 1RV3A 1X28A 1QJ5A 1WYVA 2HP1A 2RFVA 3Q8NA 1IAYA 4Y0IA 1WKHA 3NUIA 2W7FA 4WXGA 1GC3A 2VMQA 2W8JA 1LS3A 4K2BA 1KAFA 1D7VA 3WY7A 1GEXA 3DZZA 3KE3A 2EZ1A 3JWAA 1W7NA 3WGCA 1O69A 3PIUA 4XJLA 2ZY4A 3COGA 1TARA 4A6UA 2BWPA 4E1OA 1H1CA 4EB7A 3ASAA 3E9KA 1SZSA 1ORDA 2R0TA 3W1JA 4OBVA 3WCOA 5FT5A 2R5CB 3BS8A 2JJHA 5G2QA 3RBLA 1OHYA 2GB3A 3HL2A 3PDBA 1ZOBA 5EAVA 3W1HA 1GCKA 1P3WA 1DJEA 1BJOB 1FG7A 4JEVA 1SVVA 3RCHA 3ATHA 1S07A 3ZZJA 4MKJA 3E6GA 2WB6A 1DGDA 1ARIA 1TOEA 4XEWA 5J8QA 4A0FA 5BJ4A 4RJ0A 2W8UA 3PPLA 5M49A 1AHGA 1AX4A 4AZJA 2O7CA 1D7SA 4XK1A 4ZWMA 3KGWA 3PA9A 4XJPA 4GSAA 3CQ5A 2VMOA 4A0HA 2BWOA 2O1BA 4GRXA 5EQCA 4Y0DA 1EJIA 2X3LA 1O62A 2PB2A 3ASBA 4WP0A 4WYFA 3L44A 1MAPA 3GWPA 2WKAA 1O4SA 5G4IA 1O61A 3EZSA 1AMAA 4BQ0A 2X5FA 2AEVA 3K7YA 2DR1A 4PVFA 1J32A 2AEUA 5DJ9A 1M0OA 1MLZA 1M4NA 5M46A 1YJYA 3GJUA 3MAFA 3AENB 4DGTA 1DJUA 4ZWVA 1IUGA 1GEYA 1IX8A 3GZDA 4EU1A 1PMMA 2AY8A 3BN1A 2KFPA 5G09A 1ARGA 2FM1A 2Z1ZA 2OGEA 1IX6A 4R8DA 1CZCA 1B5OA 2BIEA 2D65A 1ELQA 3MKJA 4LNJA 2W7MA 3TATA 4OMAA 4AO4A 1IAXA 2DGKA 4OCAA 3KGXA 3OP7A 4R2NA 3N4SA 1ASAA 1AHFA 2VI8A 2ZSMA 3TCMA 2D7ZA 2JJEA 3BCXA 2HUUA 4IXOA 4R5ZA 1M0PA 1B5PA 2Z9XA 2D7YA 3HBXA 3QI6A 1ECXA 2VYCA 4W91A 3QN6A 2VGTA 3AEOA 1QIRA 1I43A 5E3KA 3UE8A 2VMTA 4LC3A 2AATA 4OBUA 4OT8A 2BIGA 1G4VA 2E7IA 2BI3A 2QA3A 3B1EA 3A9ZA 1I29A 1GC2A 3N4RA 3E2FA 2YCPA 4ZDOA 2VMSA 1PMOA 2Z67A 3I16A 2E54A 4H51A 5C6UA 3RUYA 4RIZA 1N2TA 3N0LA 4WYDA 4EFFA 2QLRA 3DYDA 1AJSB 1FC4A 1TOIA 4OTLA 4IYOB 1PFFA 2XH1A 1S08A 3E77A 3K28A 4F5LA 3FFHA 4F4EA 4RM1A 4AH3A 1VP4A 1ARHA 3AEJC 4FFCA 3OKSA 2EH6A 1ASMA 2ZY3A 4BA5A 4ATQA 3CAIA 4CVQA 3AV7A 1B9HA 1UU1A 4L0OA 3TFTA 4AO9A 2R5CA 2JJFA 3JWBA 2CB1A 2JGTA 3FVXA 4ADDA 2CANA 1KMKA 2BKWA 1X2AA 3FKDA 2W7EA 2FNIA 1OHWA 3FTBA 4ZDLA 5EUEA 1U08A 3DXVA 1AMRA 2ZC0A 4N0WA 1BT4A 5FT4A 3NDNA 1RVYA 4ZSWA 4P7YA 1CL2A 2VGUA 2CJDA 2QBTA 4ITGA 1GDEA 4PFFA 1IBJA 1WYUB 4KYOA 3L8AA 2CSTA 1JS3A 3P1TA 4W1WA 4XAUA 4A6RA 3E2YA 4EB5A 5K8BA 1T3IA 4R5FA 3ELPA 3EI6A 2EO5A 2YCNA 1C0NA 3HMUA 5EAAA 3HDOA 3CQ4A 1RV4A 3NYSA 4A0GA 1I48A 7AATA 2HOXA 2BWNA 1PG8A 4UQVA 2E7JA 1AKAA 3AENA 4BMKA 4OYTA 4TV7A 3N75A 2W7DA 2W7IA 2W8WA 1JS6A 4WLHA 1BKGA 1QJ3A 5BJ3A 3I5TA 5G4JA 4F5JA 2TPLA 2AY6A 1QZ9A 2DKJA 3RI6A 4RKCA 2GMSA 1AIAA 2X8UA 4NOGA 2YCTA 2Z9WA 1JG8A 3USFA 1CJ0A 4F5KA 5HHYA 5G2PA 1LW5A 1ARSA 5LHAA 2R5EA 1AHEA 3JW9A 2VLHA 1YIYA 4MKKA 1ASBA 3UWCA 1KMJA 1V2DA 3BCAA 4JE5A 4E77A 3PAAA 2HUIA 5FT6A 1ASDA 3R9AA 2EGYA 4JF0A 2HZPA 3E2ZA 3N5MA 8AATA 2HP2A 1OHVA 3LG0A 1GC4A 1ASGA 1DTYA 2OQXA 3GZDC 4Q75A 2CY8A 1AMQA 3JZLA 1UKJA 1BS0A 1ARTA 4JEXA 4MQRA 1B8GA 2BI9A 3NX3A 4WD2A 2NMPA 2D66A 2G7JA 2VMVA 3H7FA 3G7QA 1W7MA 2E7UA 1S06A 2C0RA 3NTJA 4W8IA 5F8VA 5HDMA 4WLJA 3WGBA 4XQ2A 4A6TA 4WYCA 5FT8A 3HVYA 1CL1A 3RQ1A 1AJSA 2AY4A 2JISA 2YHKA 3EI8A 3B1DA 4IY7A 4WXBA 4F5GA 3F9TA 1G7WA 2BI2A 3MC6A 4JEYA 4RAEA 1WYTA 4WXFA 1I41A 4GE7A 2W7HA 2FYFA 4IXSA 4JE5D 4Q6RA 1S0AA 3MEBA 1E5FA 1CS1A 2W8TA 5F9SA 1KKPA 4WB0B 5EFSA 4P3MA 4UHMA 3ZZKA 3B46A 3EZ1A 3NNKA 3BWNC 1V2FA 4AZKA 1ASEA 3ACZA 2GMUA 1WYVB 3VK3A 4Q76A 3K40A 2C44A 1Z3ZA 5M4DA 2AY1A 1G4XA 5LH9A 1ASCA 2EZ2A 1C4KA 3PJ0A 4MY5A 3DR7A 3BWOA 2OGAA 1IX7A 3EIAA 4ZSYA 3FQ8A 3LVKA 2BI1A 1ZC9A 1MDZA 4ZM4A 3BCBA 1LC8A 3QGUA 3UAKA 1WSTA 1KL1A 2Q7WA 5TF5A 1SPAA 1XEYA 4IXZA 4RKDA 2AY2A 3T32A 2Z1YA 4WBTA 3RBFA 2VMPA 2AY7A 2VMXA 3FZ8A 3VAXA 5G0AA 1ASNA 3A2BA 1MAQA 4MQQA 1AHXA 3W1IA 2C7TA 3IHJA 3RCHB 1C7OA 2ZJGA 2VMNA 3GETA 3DU4A 3VK4A 4MQPA 3MAUA 4GE4A 4CBSA 2ZY2A 3HQTA 3AOVA 2OKKA 5M4BA 1DJ9A 1GD9A 1CQ7A 1TPLA 1V72A 3H9XA 5HXXA 3QPGA 4JEWA 4TMRA 3FQ7A 4KXKA 2VIAA 4K2MA 5D5SA 3NYUA 4KAMA 2W8VA 2YKUA 3DODA 3NU7A 2ZP7A 4M2JA 3AOWA 1YOOA 4UHNA 1BJOA 1W7LA 2ZYJA 2CINA 2ORDA 4CBRA 1EQBA 1BJNA 2WK7A 3FD0A 4MSOA 1C7NA 3FZ7A 5EIGB 4ITXA 2Z61A 3MAFB 1BQAA 2JJGA 1MDXA 2BYLA 2YRRA 3GBXA 1YNUA 1M0NA 2FN6A 1C9CA 2DOUA 4GDYA 5DJ1A 3II0A 4HF8A 3FDDA 4F5FA 3HT4A 4RJYA 3WKSA 4WYAA 3ZRQA 4IW7A 3TFUA 2G6WA 3LVMA 2OKJA 3NUBA 5EUNA 3TQXA 3QM2A 1Y4IA 3G8MA 2D63A 2ZUKA 2HOZA 1IJIA 3FVSA 2DKBA 3P6KA 1MDOA 2VMZA 1AHYA 2W7JA 1VJOA 3PD6B 1TASA 3AEJA 1KL2A 3VOMA 1LKCA 1VEFA 4ADEA 2R2NA 2VGWA 2BI5A 1WKGA 1X0MA 2AY3A 3KKIA 1YIZA 4HVKA 2QMAA 3LWSA 3FQAA 3IF2A 4ATPA 4WYEA 3R4TA 2QB2A 1ASFA 2W7GA 9AATA 3EIBA 2A1VA 2VGVA 1LK9A 3MC6C 4J5UA 2VGSA 1B9IA 4O6ZA 2W7LA 3AEMA 4U1TA 1G7XA 2F8JA 2O0RA 1N8PA 2D5YA 2DGLA 3GSBA 4Q31A 3B1CA 4PFNA 4W1VA 3WZFA 4LNMA 1RVUA 4U2HA 2ZSLA 1D2FA 1ELUA 2D61A 4JEZA 3FZ6A 3F6TA 1BW0A 3PGYA 4M2MA 5E4ZA 2YKXA 3LV2A 4LNLA 5EUDA 4B9BA 2YOBA 3N7NA 4M2KA 3FSLA 2WK9A 3A8UX 4FL0A 1AJRA 3B8XA 4ZLVA 4IYOA 2QSRA 1UU2A 3FVUA 1AY4A 2HOYA 2EPJA 3FCRA 4A72A 3GR9A 2VIBA 2AY9A 5DB5A 3EI7A 2CJGA 1SF2A 3ISLA 1EG5A 1MLYA 4B98A 4GEBA 2HORA 3DC1A 1Z7DA 3HLMA 1AKBA 4ZAHA 2JG2A 2PB0A 2VMYA 2XBNA 3D6KA 3N4XA 1S09A 1DKAA 2VMUA 1AKCA 1BJ4A 2GQNA 1D7RA 1M32A 3WX9A 3I4JA 5DX5A 2W7KA 2DGMA 4F5IA 1CZEA 3CBFA 2GSAA 5EIGA 3VP6A 1YJZA 3ZRRA 3JTXA 4CXQA 4EMYA 1J04A 1LC5A 4TN4A 3VK2A 2BYJA 4K05A 5D95A 2EYQA 1WYUA 3FDBA 1TOKA 4I8AA 1SZUA 1W3UA 3BB8A 3DXWA 4A0RA 1X29A 1LW4A 1SFFA 1IVRA 3QHXA 1OXPA 3MBBA 1ASLA 3PDBB 3NRAA 2YKVA 5E5IA 3LY1A 1E5EA 4A00A 1AAWA 3CQ6A 4ZDPA 4F5HA 1ZODA 2Z9VA 3NU8A 2CFBA 2CH2A 4QGRA 1QISA 1N31A 2PO3A 3AEPA 3PDXA 4LW2A 2CTZA 1M6SA 3BC8A 3PD6A 1MGVA 1TOJA 4JF1A 3E2ZB 3ELEA 3WLXA 2D64A 3AATA 3H14A 4BA4A 1DGEA 4GE9A 3A9XA 4IX8A 4DBCA 1DFOA 2HUFA 1M7YA 2CJHA 2YRIA 1BJWA 4CXRA 5JAYA 5IWQA 3LVLB 3BWNA 1KKJA 1B4XA 3AELA 1LC7A 1CQ8A 3A9YA 5AX8A 1AMSA 3F0HA 1GBNA 2VI9A 2FQ6A 4RLGA 1AIBA
chains in the Genus database with same CATH topology
2BIAA 3WKRA 5I92A 4XJOA 4N0BA 3WCNA 4ADBA 3LVJA 1AICA 1QGNA 4W1XA 1CQ6A 2C81A 1V2EA 1OATA 1WYTB 1XI9A 2VGZA 4BHDA 4H63Q 4PIWA 1AY8A 1W23A 3MADA 2V1PA 4OC9A 2VMWA 3DRDA 3DR4A 4UHOA 3FRKA 1FG3A 2FNUA 1OXOA 1TOGA 1YAAA 2YKYA 1D7UA 1M0QA 2V0YA 2WK8A 3QBOA 3ECDA 2CH1A 4ZASA 1YJSA 3EI5A 1QITA 4F5MA 1TATA 1UU0A 4J8LA 2ZY5A 4ZM3A 2VLFA 2VMRA 4WYGA 2QB3A 1GC0A 4ADCA 1BQDA 1AY5A 1H0CA 3EUCA 1JF9A 4MGRA 3GZCA 2X5DA 3G0TA 3JU7A 4XJMA 1GEWA 5KTBA 3NYTA 3AEMC 2Z9UA 4LW4A 4DQ6A 4W5KA 4WB0A 1C7GA 2AY5A 4K2IA 2BHXA 1SZKA 4AOAA 3FFRA 3BV0A 3EI9A 4Y0HA 2Z20A 4RITA 1AAMA 2OATA 3ZRPA 2FKIA 4E3RA 4ISYA 4UOYA 3M5UA 4E3QA 1RV3A 1X28A 1QJ5A 1WYVA 2HP1A 2RFVA 3Q8NA 1IAYA 4Y0IA 1WKHA 3NUIA 2W7FA 4WXGA 1GC3A 2VMQA 2W8JA 1LS3A 4K2BA 1D7VA 3WY7A 1GEXA 3DZZA 3KE3A 2EZ1A 3JWAA 1W7NA 3WGCA 1O69A 3PIUA 4XJLA 2ZY4A 3COGA 1TARA 4A6UA 2BWPA 4E1OA 1H1CA 4EB7A 3ASAA 3E9KA 1SZSA 1ORDA 2R0TA 3W1JA 4OBVA 3WCOA 5FT5A 2R5CB 3BS8A 2JJHA 5G2QA 3RBLA 1OHYA 2GB3A 3HL2A 3PDBA 1ZOBA 5EAVA 3W1HA 1GCKA 1P3WA 1DJEA 1BJOB 1FG7A 4JEVA 1SVVA 3RCHA 3ATHA 1S07A 3ZZJA 4MKJA 3E6GA 2WB6A 1DGDA 1ARIA 1TOEA 4XEWA 5J8QA 4A0FA 5BJ4A 4RJ0A 2W8UA 3PPLA 5M49A 1AHGA 1AX4A 4AZJA 2O7CA 1D7SA 4XK1A 4ZWMA 3KGWA 3PA9A 4XJPA 4GSAA 3CQ5A 2VMOA 4A0HA 2BWOA 2O1BA 4GRXA 5EQCA 4Y0DA 1EJIA 2X3LA 1O62A 2PB2A 3ASBA 4WP0A 4WYFA 3L44A 1MAPA 3GWPA 2WKAA 1O4SA 5G4IA 1O61A 3EZSA 1AMAA 4BQ0A 2X5FA 2AEVA 3K7YA 2DR1A 4PVFA 1J32A 2AEUA 5DJ9A 1M0OA 1MLZA 1M4NA 5M46A 1YJYA 3GJUA 3MAFA 3AENB 4DGTA 1DJUA 4ZWVA 1IUGA 1GEYA 1IX8A 3GZDA 4EU1A 1PMMA 2AY8A 3BN1A 2KFPA 5G09A 1ARGA 2FM1A 2Z1ZA 2OGEA 1IX6A 4R8DA 1CZCA 1B5OA 2BIEA 2D65A 1ELQA 3MKJA 4LNJA 2W7MA 3TATA 4OMAA 4AO4A 1IAXA 2DGKA 4OCAA 3KGXA 3OP7A 4R2NA 3N4SA 1ASAA 1AHFA 2VI8A 2ZSMA 3TCMA 2D7ZA 2JJEA 3BCXA 2HUUA 4IXOA 4R5ZA 1M0PA 1B5PA 2Z9XA 2D7YA 3HBXA 3QI6A 1ECXA 2VYCA 4W91A 3QN6A 2VGTA 3AEOA 1QIRA 1I43A 5E3KA 3UE8A 2VMTA 4LC3A 2AATA 4OBUA 4OT8A 2BIGA 1G4VA 2E7IA 2BI3A 2QA3A 3B1EA 3A9ZA 1I29A 1GC2A 3N4RA 3E2FA 2YCPA 4ZDOA 2VMSA 1PMOA 2Z67A 3I16A 2E54A 4H51A 5C6UA 3RUYA 4RIZA 1N2TA 3N0LA 4WYDA 4EFFA 2QLRA 3DYDA 1AJSB 1FC4A 1TOIA 4OTLA 4IYOB 1PFFA 2XH1A 1S08A 3E77A 3K28A 4F5LA 3FFHA 4F4EA 4RM1A 4AH3A 1VP4A 1ARHA 3AEJC 4FFCA 3OKSA 2EH6A 1ASMA 2ZY3A 4BA5A 4ATQA 3CAIA 4CVQA 3AV7A 1B9HA 1UU1A 4L0OA 3TFTA 4AO9A 2R5CA 2JJFA 3JWBA 2CB1A 2JGTA 3FVXA 4ADDA 2CANA 1KMKA 2BKWA 1X2AA 3FKDA 2W7EA 2FNIA 1OHWA 3FTBA 4ZDLA 5EUEA 1U08A 3DXVA 1AMRA 2ZC0A 4N0WA 1BT4A 5FT4A 3NDNA 1RVYA 4ZSWA 4P7YA 1CL2A 2VGUA 2CJDA 2QBTA 4ITGA 1GDEA 4PFFA 1IBJA 1WYUB 4KYOA 3L8AA 2CSTA 1JS3A 3P1TA 4W1WA 4XAUA 4A6RA 3E2YA 4EB5A 5K8BA 1T3IA 4R5FA 3ELPA 3EI6A 2EO5A 2YCNA 1C0NA 3HMUA 5EAAA 3HDOA 3CQ4A 1RV4A 3NYSA 4A0GA 1I48A 7AATA 2HOXA 2BWNA 1PG8A 4UQVA 2E7JA 1AKAA 3AENA 4BMKA 4OYTA 4TV7A 3N75A 2W7DA 2W7IA 2W8WA 1JS6A 4WLHA 1BKGA 1QJ3A 5BJ3A 3I5TA 5G4JA 4F5JA 2TPLA 2AY6A 1QZ9A 2DKJA 3RI6A 4RKCA 2GMSA 1AIAA 2X8UA 4NOGA 2YCTA 2Z9WA 1JG8A 3USFA 1CJ0A 4F5KA 5HHYA 5G2PA 1LW5A 1ARSA 5LHAA 2R5EA 1AHEA 3JW9A 2VLHA 1YIYA 4MKKA 1ASBA 3UWCA 1KMJA 1V2DA 3BCAA 4JE5A 4E77A 3PAAA 2HUIA 5FT6A 1ASDA 3R9AA 2EGYA 4JF0A 2HZPA 3E2ZA 3N5MA 8AATA 2HP2A 1OHVA 3LG0A 1GC4A 1ASGA 1DTYA 2OQXA 3GZDC 4Q75A 2CY8A 1AMQA 3JZLA 1UKJA 1BS0A 1ARTA 4JEXA 4MQRA 1B8GA 2BI9A 3NX3A 4WD2A 2NMPA 2D66A 2G7JA 2VMVA 3H7FA 3G7QA 1W7MA 2E7UA 1S06A 2C0RA 3NTJA 4W8IA 5F8VA 5HDMA 4WLJA 3WGBA 4XQ2A 4A6TA 4WYCA 5FT8A 3HVYA 1CL1A 3RQ1A 1AJSA 2AY4A 2JISA 2YHKA 3EI8A 3B1DA 4IY7A 4WXBA 4F5GA 3F9TA 1G7WA 2BI2A 3MC6A 4JEYA 4RAEA 1WYTA 4WXFA 1I41A 4GE7A 2W7HA 2FYFA 4IXSA 4JE5D 4Q6RA 1S0AA 3MEBA 1E5FA 1CS1A 2W8TA 5F9SA 1KKPA 4WB0B 5EFSA 4P3MA 4UHMA 3ZZKA 3B46A 3EZ1A 3NNKA 3BWNC 1V2FA 4AZKA 1ASEA 3ACZA 2GMUA 1WYVB 3VK3A 4Q76A 3K40A 2C44A 1Z3ZA 5M4DA 2AY1A 1G4XA 5LH9A 1ASCA 2EZ2A 1C4KA 3PJ0A 4MY5A 3DR7A 3BWOA 2OGAA 1IX7A 3EIAA 4ZSYA 3FQ8A 3LVKA 2BI1A 1ZC9A 1MDZA 4ZM4A 3BCBA 1LC8A 3QGUA 3UAKA 1WSTA 1KL1A 2Q7WA 5TF5A 1SPAA 1XEYA 4IXZA 4RKDA 2AY2A 3T32A 2Z1YA 4WBTA 3RBFA 2VMPA 2AY7A 2VMXA 3FZ8A 3VAXA 5G0AA 1ASNA 3A2BA 1MAQA 4MQQA 1AHXA 3W1IA 2C7TA 3IHJA 3RCHB 1C7OA 2ZJGA 2VMNA 3GETA 3DU4A 3VK4A 4MQPA 3MAUA 4GE4A 4CBSA 2ZY2A 3HQTA 3AOVA 2OKKA 5M4BA 1DJ9A 1GD9A 1CQ7A 1TPLA 1V72A 3H9XA 5HXXA 3QPGA 4JEWA 4TMRA 3FQ7A 4KXKA 2VIAA 4K2MA 5D5SA 3NYUA 4KAMA 2W8VA 2YKUA 3DODA 3NU7A 2ZP7A 4M2JA 3AOWA 1YOOA 4UHNA 1BJOA 1W7LA 2ZYJA 2CINA 2ORDA 4CBRA 1EQBA 1BJNA 2WK7A 3FD0A 4MSOA 1C7NA 3FZ7A 5EIGB 4ITXA 2Z61A 3MAFB 1BQAA 2JJGA 1MDXA 2BYLA 2YRRA 3GBXA 1YNUA 1M0NA 2FN6A 1C9CA 2DOUA 4GDYA 5DJ1A 3II0A 4HF8A 3FDDA 4F5FA 3HT4A 4RJYA 3WKSA 4WYAA 3ZRQA 4IW7A 3TFUA 2G6WA 3LVMA 2OKJA 3NUBA 5EUNA 3TQXA 3QM2A 1Y4IA 3G8MA 2D63A 2ZUKA 2HOZA 1IJIA 3FVSA 2DKBA 3P6KA 1MDOA 2VMZA 1AHYA 2W7JA 1VJOA 3PD6B 1TASA 3AEJA 1KL2A 3VOMA 1LKCA 1VEFA 4ADEA 2R2NA 2VGWA 2BI5A 1WKGA 1X0MA 2AY3A 3KKIA 1YIZA 4HVKA 2QMAA 3LWSA 3FQAA 3IF2A 4ATPA 4WYEA 3R4TA 2QB2A 1ASFA 2W7GA 9AATA 3EIBA 2A1VA 2VGVA 1LK9A 3MC6C 4J5UA 2VGSA 1B9IA 4O6ZA 2W7LA 3AEMA 4U1TA 1G7XA 2F8JA 2O0RA 1N8PA 2D5YA 2DGLA 3GSBA 4Q31A 3B1CA 4PFNA 4W1VA 3WZFA 4LNMA 1RVUA 4U2HA 2ZSLA 1D2FA 1ELUA 2D61A 4JEZA 3FZ6A 3F6TA 1BW0A 3PGYA 4M2MA 5E4ZA 2YKXA 3LV2A 4LNLA 5EUDA 4B9BA 2YOBA 3N7NA 4M2KA 3FSLA 2WK9A 3A8UX 4FL0A 1AJRA 3B8XA 4ZLVA 4IYOA 2QSRA 1UU2A 3FVUA 1AY4A 2HOYA 2EPJA 3FCRA 4A72A 3GR9A 2VIBA 2AY9A 5DB5A 3EI7A 2CJGA 1SF2A 3ISLA 1EG5A 1MLYA 4B98A 4GEBA 2HORA 3DC1A 1Z7DA 3HLMA 1AKBA 4ZAHA 2JG2A 2PB0A 2VMYA 2XBNA 3D6KA 3N4XA 1S09A 1DKAA 2VMUA 1AKCA 1BJ4A 2GQNA 1D7RA 1M32A 3WX9A 3I4JA 5DX5A 2W7KA 2DGMA 4F5IA 1CZEA 3CBFA 2GSAA 5EIGA 3VP6A 1YJZA 3ZRRA 3JTXA 4CXQA 4EMYA 1J04A 1LC5A 4TN4A 3VK2A 2BYJA 4K05A 5D95A 2EYQA 1WYUA 3FDBA 1TOKA 4I8AA 1SZUA 1W3UA 3BB8A 3DXWA 4A0RA 1X29A 1LW4A 1SFFA 1IVRA 3QHXA 1OXPA 3MBBA 1ASLA 3PDBB 3NRAA 2YKVA 5E5IA 3LY1A 1E5EA 4A00A 1AAWA 3CQ6A 4ZDPA 4F5HA 1ZODA 2Z9VA 3NU8A 2CFBA 2CH2A 4QGRA 1QISA 1N31A 2PO3A 3AEPA 3PDXA 4LW2A 2CTZA 1M6SA 3BC8A 3PD6A 1MGVA 1TOJA 4JF1A 3E2ZB 3ELEA 3WLXA 2D64A 3AATA 3H14A 4BA4A 1DGEA 4GE9A 3A9XA 4IX8A 4DBCA 1DFOA 2HUFA 1M7YA 2CJHA 2YRIA 1BJWA 4CXRA 5JAYA 5IWQA 3LVLB 3BWNA 1KKJA 1B4XA 3AELA 1LC7A 1CQ8A 3A9YA 5AX8A 1AMSA 3F0HA 1GBNA 2VI9A 2FQ6A 4RLGA 1AIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BIA A;  3WKR A;  5I92 A;  4XJO A;  4N0B A;  3WCN A;  4ADB A;  3LVJ A;  1AIC A;  1QGN A;  4W1X A;  1CQ6 A;  2C81 A;  1V2E A;  1OAT A;  1WYT B;  1XI9 A;  2VGZ A;  4BHD A;  4PIW A;  1AY8 A;  1W23 A;  3MAD A;  2V1P A;  4OC9 A;  2VMW A;  3DRD A;  3DR4 A;  4UHO A;  3FRK A;  1FG3 A;  2FNU A;  1OXO A;  1TOG A;  1YAA A;  2YKY A;  1D7U A;  1M0Q A;  2V0Y A;  2WK8 A;  3QBO A;  3ECD A;  2CH1 A;  4ZAS A;  1YJS A;  3EI5 A;  1QIT A;  4F5M A;  1TAT A;  1UU0 A;  4J8L A;  2ZY5 A;  4ZM3 A;  2VLF A;  2VMR A;  4WYG A;  2QB3 A;  1GC0 A;  4ADC A;  1BQD A;  1AY5 A;  1H0C A;  3EUC A;  1JF9 A;  4MGR A;  3GZC A;  2X5D A;  3G0T A;  3JU7 A;  4XJM A;  1GEW A;  3NYT A;  3AEM C;  2Z9U A;  4LW4 A;  4DQ6 A;  4W5K A;  4WB0 A;  1C7G A;  2AY5 A;  4K2I A;  2BHX A;  1SZK A;  4AOA A;  3FFR A;  3BV0 A;  3EI9 A;  4Y0H A;  2Z20 A;  4RIT A;  1AAM A;  2OAT A;  3ZRP A;  4E3R A;  4ISY A;  4UOY A;  3M5U A;  4E3Q A;  1RV3 A;  1X28 A;  1QJ5 A;  1WYV A;  2HP1 A;  2RFV A;  3Q8N A;  1IAY A;  4Y0I A;  1WKH A;  3NUI A;  2W7F A;  4WXG A;  1GC3 A;  2VMQ A;  2W8J A;  1LS3 A;  4K2B A;  1D7V A;  3WY7 A;  1GEX A;  3DZZ A;  3KE3 A;  2EZ1 A;  3JWA A;  1W7N A;  3WGC A;  1O69 A;  3PIU A;  4XJL A;  2ZY4 A;  3COG A;  1TAR A;  4A6U A;  2BWP A;  4E1O A;  1H1C A;  4EB7 A;  3ASA A;  3E9K A;  1SZS A;  1ORD A;  2R0T A;  3W1J A;  4OBV A;  3WCO A;  5FT5 A;  2R5C B;  3BS8 A;  2JJH A;  5G2Q A;  3RBL A;  1OHY A;  2GB3 A;  3HL2 A;  3PDB A;  1ZOB A;  5EAV A;  3W1H A;  1GCK A;  1P3W A;  1DJE A;  1BJO B;  1FG7 A;  4JEV A;  1SVV A;  3RCH A;  3ATH A;  1S07 A;  3ZZJ A;  4MKJ A;  3E6G A;  1DGD A;  1ARI A;  1TOE A;  4XEW A;  5J8Q A;  4A0F A;  5BJ4 A;  4RJ0 A;  2W8U A;  3PPL A;  5M49 A;  1AHG A;  1AX4 A;  4AZJ A;  2O7C A;  1D7S A;  4XK1 A;  4ZWM A;  3KGW A;  3PA9 A;  4XJP A;  4GSA A;  3CQ5 A;  2VMO A;  4A0H A;  2BWO A;  2O1B A;  4GRX A;  5EQC A;  4Y0D A;  1EJI A;  2X3L A;  1O62 A;  2PB2 A;  3ASB A;  4WP0 A;  4WYF A;  3L44 A;  1MAP A;  3GWP A;  2WKA A;  1O4S A;  5G4I A;  1O61 A;  3EZS A;  1AMA A;  4BQ0 A;  2X5F A;  2AEV A;  3K7Y A;  2DR1 A;  4PVF A;  1J32 A;  2AEU A;  5DJ9 A;  1M0O A;  1MLZ A;  1M4N A;  5M46 A;  1YJY A;  3GJU A;  3MAF A;  3AEN B;  4DGT A;  1DJU A;  4ZWV A;  1IUG A;  1GEY A;  1IX8 A;  3GZD A;  4EU1 A;  1PMM A;  2AY8 A;  3BN1 A;  5G09 A;  1ARG A;  2FM1 A;  2Z1Z A;  2OGE A;  1IX6 A;  4R8D A;  1CZC A;  1B5O A;  2BIE A;  2D65 A;  1ELQ A;  3MKJ A;  4LNJ A;  2W7M A;  3TAT A;  4OMA A;  4AO4 A;  1IAX A;  2DGK A;  4OCA A;  3KGX A;  3OP7 A;  4R2N A;  1ASA A;  1AHF A;  2VI8 A;  2ZSM A;  3TCM A;  2D7Z A;  2JJE A;  3BCX A;  2HUU A;  4IXO A;  4R5Z A;  1M0P A;  1B5P A;  2Z9X A;  2D7Y A;  3HBX A;  3QI6 A;  1ECX A;  2VYC A;  4W91 A;  3QN6 A;  2VGT A;  3AEO A;  1QIR A;  1I43 A;  5E3K A;  3UE8 A;  2VMT A;  4LC3 A;  2AAT A;  4OBU A;  4OT8 A;  2BIG A;  1G4V A;  2E7I A;  2BI3 A;  2QA3 A;  3B1E A;  3A9Z A;  1I29 A;  1GC2 A;  3E2F A;  2YCP A;  4ZDO A;  2VMS A;  1PMO A;  2Z67 A;  3I16 A;  2E54 A;  4H51 A;  5C6U A;  3RUY A;  4RIZ A;  1N2T A;  3N0L A;  4WYD A;  4EFF A;  2QLR A;  3DYD A;  1AJS B;  1FC4 A;  1TOI A;  4OTL A;  4IYO B;  1PFF A;  2XH1 A;  1S08 A;  3E77 A;  3K28 A;  4F5L A;  3FFH A;  4F4E A;  4RM1 A;  4AH3 A;  1VP4 A;  1ARH A;  3AEJ C;  4FFC A;  3OKS A;  2EH6 A;  1ASM A;  2ZY3 A;  4BA5 A;  4ATQ A;  3CAI A;  4CVQ A;  3AV7 A;  1B9H A;  1UU1 A;  4L0O A;  3TFT A;  4AO9 A;  2R5C A;  2JJF A;  3JWB A;  2CB1 A;  2JGT A;  3FVX A;  4ADD A;  2CAN A;  1KMK A;  2BKW A;  1X2A A;  3FKD A;  2W7E A;  2FNI A;  1OHW A;  3FTB A;  4ZDL A;  5EUE A;  1U08 A;  3DXV A;  1AMR A;  2ZC0 A;  4N0W A;  1BT4 A;  5FT4 A;  3NDN A;  1RVY A;  4ZSW A;  4P7Y A;  1CL2 A;  2VGU A;  2CJD A;  2QBT A;  4ITG A;  1GDE A;  4PFF A;  1IBJ A;  1WYU B;  4KYO A;  3L8A A;  2CST A;  1JS3 A;  3P1T A;  4W1W A;  4XAU A;  4A6R A;  3E2Y A;  4EB5 A;  5K8B A;  1T3I A;  4R5F A;  3ELP A;  3EI6 A;  2EO5 A;  2YCN A;  1C0N A;  3HMU A;  5EAA A;  3HDO A;  3CQ4 A;  1RV4 A;  3NYS A;  4A0G A;  1I48 A;  7AAT A;  2HOX A;  2BWN A;  1PG8 A;  4UQV A;  2E7J A;  1AKA A;  3AEN A;  4BMK A;  4OYT A;  4TV7 A;  3N75 A;  2W7D A;  2W7I A;  2W8W A;  1JS6 A;  4WLH A;  1BKG A;  1QJ3 A;  5BJ3 A;  3I5T A;  5G4J A;  4F5J A;  2TPL A;  2AY6 A;  1QZ9 A;  2DKJ A;  3RI6 A;  4RKC A;  2GMS A;  1AIA A;  2X8U A;  4NOG A;  2YCT A;  2Z9W A;  1JG8 A;  3USF A;  1CJ0 A;  4F5K A;  5HHY A;  5G2P A;  1LW5 A;  1ARS A;  5LHA A;  2R5E A;  1AHE A;  3JW9 A;  2VLH A;  1YIY A;  4MKK A;  1ASB A;  3UWC A;  1KMJ A;  1V2D A;  3BCA A;  4JE5 A;  4E77 A;  3PAA A;  2HUI A;  5FT6 A;  1ASD A;  3R9A A;  2EGY A;  4JF0 A;  2HZP A;  3E2Z A;  3N5M A;  8AAT A;  2HP2 A;  1OHV A;  3LG0 A;  1GC4 A;  1ASG A;  1DTY A;  2OQX A;  3GZD C;  4Q75 A;  2CY8 A;  1AMQ A;  3JZL A;  1UKJ A;  1BS0 A;  1ART A;  4JEX A;  4MQR A;  1B8G A;  2BI9 A;  3NX3 A;  4WD2 A;  2NMP A;  2D66 A;  2VMV A;  3H7F A;  3G7Q A;  1W7M A;  2E7U A;  1S06 A;  2C0R A;  3NTJ A;  4W8I A;  5F8V A;  5HDM A;  4WLJ A;  3WGB A;  4XQ2 A;  4A6T A;  4WYC A;  5FT8 A;  3HVY A;  1CL1 A;  3RQ1 A;  1AJS A;  2AY4 A;  2JIS A;  2YHK A;  3EI8 A;  3B1D A;  4IY7 A;  4WXB A;  4F5G A;  3F9T A;  1G7W A;  2BI2 A;  3MC6 A;  4JEY A;  4RAE A;  1WYT A;  4WXF A;  1I41 A;  4GE7 A;  2W7H A;  2FYF A;  4IXS A;  4JE5 D;  4Q6R A;  1S0A A;  3MEB A;  1E5F A;  1CS1 A;  2W8T A;  5F9S A;  1KKP A;  4WB0 B;  5EFS A;  4P3M A;  4UHM A;  3ZZK A;  3B46 A;  3EZ1 A;  3NNK A;  3BWN C;  1V2F A;  4AZK A;  1ASE A;  3ACZ A;  2GMU A;  1WYV B;  3VK3 A;  4Q76 A;  3K40 A;  2C44 A;  1Z3Z A;  5M4D A;  2AY1 A;  1G4X A;  5LH9 A;  1ASC A;  2EZ2 A;  1C4K A;  3PJ0 A;  4MY5 A;  3DR7 A;  3BWO A;  2OGA A;  1IX7 A;  3EIA A;  4ZSY A;  3FQ8 A;  3LVK A;  2BI1 A;  1ZC9 A;  1MDZ A;  4ZM4 A;  3BCB A;  1LC8 A;  3QGU A;  3UAK A;  1WST A;  1KL1 A;  2Q7W A;  5TF5 A;  1SPA A;  1XEY A;  4IXZ A;  4RKD A;  2AY2 A;  3T32 A;  2Z1Y A;  4WBT A;  3RBF A;  2VMP A;  2AY7 A;  2VMX A;  3FZ8 A;  3VAX A;  5G0A A;  1ASN A;  3A2B A;  1MAQ A;  4MQQ A;  1AHX A;  3W1I A;  2C7T A;  3IHJ A;  3RCH B;  1C7O A;  2ZJG A;  2VMN A;  3GET A;  3DU4 A;  3VK4 A;  4MQP A;  3MAU A;  4GE4 A;  4CBS A;  2ZY2 A;  3HQT A;  3AOV A;  2OKK A;  5M4B A;  1DJ9 A;  1GD9 A;  1CQ7 A;  1TPL A;  1V72 A;  5HXX A;  3QPG A;  4JEW A;  4TMR A;  3FQ7 A;  4KXK A;  2VIA A;  4K2M A;  5D5S A;  3NYU A;  4KAM A;  2W8V A;  2YKU A;  3DOD A;  3NU7 A;  2ZP7 A;  4M2J A;  3AOW A;  1YOO A;  4UHN A;  1BJO A;  1W7L A;  2ZYJ A;  2CIN A;  2ORD A;  4CBR A;  1EQB A;  1BJN A;  2WK7 A;  3FD0 A;  4MSO A;  1C7N A;  3FZ7 A;  5EIG B;  4ITX A;  2Z61 A;  3MAF B;  1BQA A;  2JJG A;  1MDX A;  2BYL A;  2YRR A;  3GBX A;  1YNU A;  1M0N A;  2FN6 A;  1C9C A;  2DOU A;  4GDY A;  5DJ1 A;  3II0 A;  4HF8 A;  3FDD A;  4F5F A;  3HT4 A;  4RJY A;  3WKS A;  4WYA A;  3ZRQ A;  4IW7 A;  3TFU A;  2G6W A;  3LVM A;  2OKJ A;  3NUB A;  5EUN A;  3TQX A;  3QM2 A;  1Y4I A;  3G8M A;  2D63 A;  2ZUK A;  2HOZ A;  1IJI A;  3FVS A;  2DKB A;  3P6K A;  1MDO A;  2VMZ A;  1AHY A;  2W7J A;  1VJO A;  3PD6 B;  1TAS A;  3AEJ A;  1KL2 A;  3VOM A;  1LKC A;  1VEF A;  4ADE A;  2R2N A;  2VGW A;  2BI5 A;  1WKG A;  1X0M A;  2AY3 A;  3KKI A;  1YIZ A;  4HVK A;  2QMA A;  3LWS A;  3FQA A;  3IF2 A;  4ATP A;  4WYE A;  3R4T A;  2QB2 A;  1ASF A;  2W7G A;  9AAT A;  3EIB A;  2VGV A;  1LK9 A;  3MC6 C;  4J5U A;  2VGS A;  1B9I A;  4O6Z A;  2W7L A;  3AEM A;  4U1T A;  1G7X A;  2F8J A;  2O0R A;  1N8P A;  2D5Y A;  2DGL A;  3GSB A;  4Q31 A;  3B1C A;  4PFN A;  4W1V A;  3WZF A;  4LNM A;  1RVU A;  4U2H A;  2ZSL A;  1D2F A;  1ELU A;  2D61 A;  4JEZ A;  3FZ6 A;  3F6T A;  1BW0 A;  3PGY A;  4M2M A;  5E4Z A;  2YKX A;  3LV2 A;  4LNL A;  5EUD A;  4B9B A;  2YOB A;  4M2K A;  3FSL A;  2WK9 A;  3A8U X;  4FL0 A;  1AJR A;  3B8X A;  4ZLV A;  4IYO A;  1UU2 A;  3FVU A;  1AY4 A;  2HOY A;  2EPJ A;  3FCR A;  4A72 A;  3GR9 A;  2VIB A;  2AY9 A;  5DB5 A;  3EI7 A;  2CJG A;  1SF2 A;  3ISL A;  1EG5 A;  1MLY A;  4B98 A;  4GEB A;  2HOR A;  3DC1 A;  1Z7D A;  3HLM A;  1AKB A;  4ZAH A;  2JG2 A;  2PB0 A;  2VMY A;  2XBN A;  3D6K A;  1S09 A;  1DKA A;  2VMU A;  1AKC A;  1BJ4 A;  2GQN A;  1D7R A;  1M32 A;  3WX9 A;  3I4J A;  5DX5 A;  2W7K A;  2DGM A;  4F5I A;  1CZE A;  3CBF A;  2GSA A;  5EIG A;  3VP6 A;  1YJZ A;  3ZRR A;  3JTX A;  4CXQ A;  4EMY A;  1J04 A;  1LC5 A;  4TN4 A;  3VK2 A;  2BYJ A;  5D95 A;  1WYU A;  3FDB A;  1TOK A;  4I8A A;  1SZU A;  1W3U A;  3BB8 A;  3DXW A;  4A0R A;  1X29 A;  1LW4 A;  1SFF A;  1IVR A;  3QHX A;  1OXP A;  3MBB A;  1ASL A;  3PDB B;  3NRA A;  2YKV A;  5E5I A;  3LY1 A;  1E5E A;  4A00 A;  1AAW A;  3CQ6 A;  4ZDP A;  4F5H A;  1ZOD A;  2Z9V A;  3NU8 A;  2CFB A;  2CH2 A;  4QGR A;  1QIS A;  1N31 A;  2PO3 A;  3AEP A;  3PDX A;  4LW2 A;  2CTZ A;  1M6S A;  3BC8 A;  3PD6 A;  1MGV A;  1TOJ A;  4JF1 A;  3E2Z B;  3ELE A;  3WLX A;  2D64 A;  3AAT A;  3H14 A;  4BA4 A;  1DGE A;  4GE9 A;  3A9X A;  4IX8 A;  4DBC A;  1DFO A;  2HUF A;  1M7Y A;  2CJH A;  2YRI A;  1BJW A;  4CXR A;  5JAY A;  5IWQ A;  3LVL B;  3BWN A;  1KKJ A;  1B4X A;  3AEL A;  1LC7 A;  1CQ8 A;  3A9Y A;  5AX8 A;  1AMS A;  3F0H A;  1GBN A;  2VI9 A;  2FQ6 A;  4RLG A;  1AIB A; 
#chains in the Genus database with same CATH topology
 2BIA A;  3WKR A;  5I92 A;  4XJO A;  4N0B A;  3WCN A;  4ADB A;  3LVJ A;  1AIC A;  1QGN A;  4W1X A;  1CQ6 A;  2C81 A;  1V2E A;  1OAT A;  1WYT B;  1XI9 A;  2VGZ A;  4BHD A;  4H63 Q;  4PIW A;  1AY8 A;  1W23 A;  3MAD A;  2V1P A;  4OC9 A;  2VMW A;  3DRD A;  3DR4 A;  4UHO A;  3FRK A;  1FG3 A;  2FNU A;  1OXO A;  1TOG A;  1YAA A;  2YKY A;  1D7U A;  1M0Q A;  2V0Y A;  2WK8 A;  3QBO A;  3ECD A;  2CH1 A;  4ZAS A;  1YJS A;  3EI5 A;  1QIT A;  4F5M A;  1TAT A;  1UU0 A;  4J8L A;  2ZY5 A;  4ZM3 A;  2VLF A;  2VMR A;  4WYG A;  2QB3 A;  1GC0 A;  4ADC A;  1BQD A;  1AY5 A;  1H0C A;  3EUC A;  1JF9 A;  4MGR A;  3GZC A;  2X5D A;  3G0T A;  3JU7 A;  4XJM A;  1GEW A;  5KTB A;  3NYT A;  3AEM C;  2Z9U A;  4LW4 A;  4DQ6 A;  4W5K A;  4WB0 A;  1C7G A;  2AY5 A;  4K2I A;  2BHX A;  1SZK A;  4AOA A;  3FFR A;  3BV0 A;  3EI9 A;  4Y0H A;  2Z20 A;  4RIT A;  1AAM A;  2OAT A;  3ZRP A;  2FKI A;  4E3R A;  4ISY A;  4UOY A;  3M5U A;  4E3Q A;  1RV3 A;  1X28 A;  1QJ5 A;  1WYV A;  2HP1 A;  2RFV A;  3Q8N A;  1IAY A;  4Y0I A;  1WKH A;  3NUI A;  2W7F A;  4WXG A;  1GC3 A;  2VMQ A;  2W8J A;  1LS3 A;  4K2B A;  1KAF A;  1D7V A;  3WY7 A;  1GEX A;  3DZZ A;  3KE3 A;  2EZ1 A;  3JWA A;  1W7N A;  3WGC A;  1O69 A;  3PIU A;  4XJL A;  2ZY4 A;  3COG A;  1TAR A;  4A6U A;  2BWP A;  4E1O A;  1H1C A;  4EB7 A;  3ASA A;  3E9K A;  1SZS A;  1ORD A;  2R0T A;  3W1J A;  4OBV A;  3WCO A;  5FT5 A;  2R5C B;  3BS8 A;  2JJH A;  5G2Q A;  3RBL A;  1OHY A;  2GB3 A;  3HL2 A;  3PDB A;  1ZOB A;  5EAV A;  3W1H A;  1GCK A;  1P3W A;  1DJE A;  1BJO B;  1FG7 A;  4JEV A;  1SVV A;  3RCH A;  3ATH A;  1S07 A;  3ZZJ A;  4MKJ A;  3E6G A;  2WB6 A;  1DGD A;  1ARI A;  1TOE A;  4XEW A;  5J8Q A;  4A0F A;  5BJ4 A;  4RJ0 A;  2W8U A;  3PPL A;  5M49 A;  1AHG A;  1AX4 A;  4AZJ A;  2O7C A;  1D7S A;  4XK1 A;  4ZWM A;  3KGW A;  3PA9 A;  4XJP A;  4GSA A;  3CQ5 A;  2VMO A;  4A0H A;  2BWO A;  2O1B A;  4GRX A;  5EQC A;  4Y0D A;  1EJI A;  2X3L A;  1O62 A;  2PB2 A;  3ASB A;  4WP0 A;  4WYF A;  3L44 A;  1MAP A;  3GWP A;  2WKA A;  1O4S A;  5G4I A;  1O61 A;  3EZS A;  1AMA A;  4BQ0 A;  2X5F A;  2AEV A;  3K7Y A;  2DR1 A;  4PVF A;  1J32 A;  2AEU A;  5DJ9 A;  1M0O A;  1MLZ A;  1M4N A;  5M46 A;  1YJY A;  3GJU A;  3MAF A;  3AEN B;  4DGT A;  1DJU A;  4ZWV A;  1IUG A;  1GEY A;  1IX8 A;  3GZD A;  4EU1 A;  1PMM A;  2AY8 A;  3BN1 A;  2KFP A;  5G09 A;  1ARG A;  2FM1 A;  2Z1Z A;  2OGE A;  1IX6 A;  4R8D A;  1CZC A;  1B5O A;  2BIE A;  2D65 A;  1ELQ A;  3MKJ A;  4LNJ A;  2W7M A;  3TAT A;  4OMA A;  4AO4 A;  1IAX A;  2DGK A;  4OCA A;  3KGX A;  3OP7 A;  4R2N A;  3N4S A;  1ASA A;  1AHF A;  2VI8 A;  2ZSM A;  3TCM A;  2D7Z A;  2JJE A;  3BCX A;  2HUU A;  4IXO A;  4R5Z A;  1M0P A;  1B5P A;  2Z9X A;  2D7Y A;  3HBX A;  3QI6 A;  1ECX A;  2VYC A;  4W91 A;  3QN6 A;  2VGT A;  3AEO A;  1QIR A;  1I43 A;  5E3K A;  3UE8 A;  2VMT A;  4LC3 A;  2AAT A;  4OBU A;  4OT8 A;  2BIG A;  1G4V A;  2E7I A;  2BI3 A;  2QA3 A;  3B1E A;  3A9Z A;  1I29 A;  1GC2 A;  3N4R A;  3E2F A;  2YCP A;  4ZDO A;  2VMS A;  1PMO A;  2Z67 A;  3I16 A;  2E54 A;  4H51 A;  5C6U A;  3RUY A;  4RIZ A;  1N2T A;  3N0L A;  4WYD A;  4EFF A;  2QLR A;  3DYD A;  1AJS B;  1FC4 A;  1TOI A;  4OTL A;  4IYO B;  1PFF A;  2XH1 A;  1S08 A;  3E77 A;  3K28 A;  4F5L A;  3FFH A;  4F4E A;  4RM1 A;  4AH3 A;  1VP4 A;  1ARH A;  3AEJ C;  4FFC A;  3OKS A;  2EH6 A;  1ASM A;  2ZY3 A;  4BA5 A;  4ATQ A;  3CAI A;  4CVQ A;  3AV7 A;  1B9H A;  1UU1 A;  4L0O A;  3TFT A;  4AO9 A;  2R5C A;  2JJF A;  3JWB A;  2CB1 A;  2JGT A;  3FVX A;  4ADD A;  2CAN A;  1KMK A;  2BKW A;  1X2A A;  3FKD A;  2W7E A;  2FNI A;  1OHW A;  3FTB A;  4ZDL A;  5EUE A;  1U08 A;  3DXV A;  1AMR A;  2ZC0 A;  4N0W A;  1BT4 A;  5FT4 A;  3NDN A;  1RVY A;  4ZSW A;  4P7Y A;  1CL2 A;  2VGU A;  2CJD A;  2QBT A;  4ITG A;  1GDE A;  4PFF A;  1IBJ A;  1WYU B;  4KYO A;  3L8A A;  2CST A;  1JS3 A;  3P1T A;  4W1W A;  4XAU A;  4A6R A;  3E2Y A;  4EB5 A;  5K8B A;  1T3I A;  4R5F A;  3ELP A;  3EI6 A;  2EO5 A;  2YCN A;  1C0N A;  3HMU A;  5EAA A;  3HDO A;  3CQ4 A;  1RV4 A;  3NYS A;  4A0G A;  1I48 A;  7AAT A;  2HOX A;  2BWN A;  1PG8 A;  4UQV A;  2E7J A;  1AKA A;  3AEN A;  4BMK A;  4OYT A;  4TV7 A;  3N75 A;  2W7D A;  2W7I A;  2W8W A;  1JS6 A;  4WLH A;  1BKG A;  1QJ3 A;  5BJ3 A;  3I5T A;  5G4J A;  4F5J A;  2TPL A;  2AY6 A;  1QZ9 A;  2DKJ A;  3RI6 A;  4RKC A;  2GMS A;  1AIA A;  2X8U A;  4NOG A;  2YCT A;  2Z9W A;  1JG8 A;  3USF A;  1CJ0 A;  4F5K A;  5HHY A;  5G2P A;  1LW5 A;  1ARS A;  5LHA A;  2R5E A;  1AHE A;  3JW9 A;  2VLH A;  1YIY A;  4MKK A;  1ASB A;  3UWC A;  1KMJ A;  1V2D A;  3BCA A;  4JE5 A;  4E77 A;  3PAA A;  2HUI A;  5FT6 A;  1ASD A;  3R9A A;  2EGY A;  4JF0 A;  2HZP A;  3E2Z A;  3N5M A;  8AAT A;  2HP2 A;  1OHV A;  3LG0 A;  1GC4 A;  1ASG A;  1DTY A;  2OQX A;  3GZD C;  4Q75 A;  2CY8 A;  1AMQ A;  3JZL A;  1UKJ A;  1BS0 A;  1ART A;  4JEX A;  4MQR A;  1B8G A;  2BI9 A;  3NX3 A;  4WD2 A;  2NMP A;  2D66 A;  2G7J A;  2VMV A;  3H7F A;  3G7Q A;  1W7M A;  2E7U A;  1S06 A;  2C0R A;  3NTJ A;  4W8I A;  5F8V A;  5HDM A;  4WLJ A;  3WGB A;  4XQ2 A;  4A6T A;  4WYC A;  5FT8 A;  3HVY A;  1CL1 A;  3RQ1 A;  1AJS A;  2AY4 A;  2JIS A;  2YHK A;  3EI8 A;  3B1D A;  4IY7 A;  4WXB A;  4F5G A;  3F9T A;  1G7W A;  2BI2 A;  3MC6 A;  4JEY A;  4RAE A;  1WYT A;  4WXF A;  1I41 A;  4GE7 A;  2W7H A;  2FYF A;  4IXS A;  4JE5 D;  4Q6R A;  1S0A A;  3MEB A;  1E5F A;  1CS1 A;  2W8T A;  5F9S A;  1KKP A;  4WB0 B;  5EFS A;  4P3M A;  4UHM A;  3ZZK A;  3B46 A;  3EZ1 A;  3NNK A;  3BWN C;  1V2F A;  4AZK A;  1ASE A;  3ACZ A;  2GMU A;  1WYV B;  3VK3 A;  4Q76 A;  3K40 A;  2C44 A;  1Z3Z A;  5M4D A;  2AY1 A;  1G4X A;  5LH9 A;  1ASC A;  2EZ2 A;  1C4K A;  3PJ0 A;  4MY5 A;  3DR7 A;  3BWO A;  2OGA A;  1IX7 A;  3EIA A;  4ZSY A;  3FQ8 A;  3LVK A;  2BI1 A;  1ZC9 A;  1MDZ A;  4ZM4 A;  3BCB A;  1LC8 A;  3QGU A;  3UAK A;  1WST A;  1KL1 A;  2Q7W A;  5TF5 A;  1SPA A;  1XEY A;  4IXZ A;  4RKD A;  2AY2 A;  3T32 A;  2Z1Y A;  4WBT A;  3RBF A;  2VMP A;  2AY7 A;  2VMX A;  3FZ8 A;  3VAX A;  5G0A A;  1ASN A;  3A2B A;  1MAQ A;  4MQQ A;  1AHX A;  3W1I A;  2C7T A;  3IHJ A;  3RCH B;  1C7O A;  2ZJG A;  2VMN A;  3GET A;  3DU4 A;  3VK4 A;  4MQP A;  3MAU A;  4GE4 A;  4CBS A;  2ZY2 A;  3HQT A;  3AOV A;  2OKK A;  5M4B A;  1DJ9 A;  1GD9 A;  1CQ7 A;  1TPL A;  1V72 A;  3H9X A;  5HXX A;  3QPG A;  4JEW A;  4TMR A;  3FQ7 A;  4KXK A;  2VIA A;  4K2M A;  5D5S A;  3NYU A;  4KAM A;  2W8V A;  2YKU A;  3DOD A;  3NU7 A;  2ZP7 A;  4M2J A;  3AOW A;  1YOO A;  4UHN A;  1BJO A;  1W7L A;  2ZYJ A;  2CIN A;  2ORD A;  4CBR A;  1EQB A;  1BJN A;  2WK7 A;  3FD0 A;  4MSO A;  1C7N A;  3FZ7 A;  5EIG B;  4ITX A;  2Z61 A;  3MAF B;  1BQA A;  2JJG A;  1MDX A;  2BYL A;  2YRR A;  3GBX A;  1YNU A;  1M0N A;  2FN6 A;  1C9C A;  2DOU A;  4GDY A;  5DJ1 A;  3II0 A;  4HF8 A;  3FDD A;  4F5F A;  3HT4 A;  4RJY A;  3WKS A;  4WYA A;  3ZRQ A;  4IW7 A;  3TFU A;  2G6W A;  3LVM A;  2OKJ A;  3NUB A;  5EUN A;  3TQX A;  3QM2 A;  1Y4I A;  3G8M A;  2D63 A;  2ZUK A;  2HOZ A;  1IJI A;  3FVS A;  2DKB A;  3P6K A;  1MDO A;  2VMZ A;  1AHY A;  2W7J A;  1VJO A;  3PD6 B;  1TAS A;  3AEJ A;  1KL2 A;  3VOM A;  1LKC A;  1VEF A;  4ADE A;  2R2N A;  2VGW A;  2BI5 A;  1WKG A;  1X0M A;  2AY3 A;  3KKI A;  1YIZ A;  4HVK A;  2QMA A;  3LWS A;  3FQA A;  3IF2 A;  4ATP A;  4WYE A;  3R4T A;  2QB2 A;  1ASF A;  2W7G A;  9AAT A;  3EIB A;  2A1V A;  2VGV A;  1LK9 A;  3MC6 C;  4J5U A;  2VGS A;  1B9I A;  4O6Z A;  2W7L A;  3AEM A;  4U1T A;  1G7X A;  2F8J A;  2O0R A;  1N8P A;  2D5Y A;  2DGL A;  3GSB A;  4Q31 A;  3B1C A;  4PFN A;  4W1V A;  3WZF A;  4LNM A;  1RVU A;  4U2H A;  2ZSL A;  1D2F A;  1ELU A;  2D61 A;  4JEZ A;  3FZ6 A;  3F6T A;  1BW0 A;  3PGY A;  4M2M A;  5E4Z A;  2YKX A;  3LV2 A;  4LNL A;  5EUD A;  4B9B A;  2YOB A;  3N7N A;  4M2K A;  3FSL A;  2WK9 A;  3A8U X;  4FL0 A;  1AJR A;  3B8X A;  4ZLV A;  4IYO A;  2QSR A;  1UU2 A;  3FVU A;  1AY4 A;  2HOY A;  2EPJ A;  3FCR A;  4A72 A;  3GR9 A;  2VIB A;  2AY9 A;  5DB5 A;  3EI7 A;  2CJG A;  1SF2 A;  3ISL A;  1EG5 A;  1MLY A;  4B98 A;  4GEB A;  2HOR A;  3DC1 A;  1Z7D A;  3HLM A;  1AKB A;  4ZAH A;  2JG2 A;  2PB0 A;  2VMY A;  2XBN A;  3D6K A;  3N4X A;  1S09 A;  1DKA A;  2VMU A;  1AKC A;  1BJ4 A;  2GQN A;  1D7R A;  1M32 A;  3WX9 A;  3I4J A;  5DX5 A;  2W7K A;  2DGM A;  4F5I A;  1CZE A;  3CBF A;  2GSA A;  5EIG A;  3VP6 A;  1YJZ A;  3ZRR A;  3JTX A;  4CXQ A;  4EMY A;  1J04 A;  1LC5 A;  4TN4 A;  3VK2 A;  2BYJ A;  4K05 A;  5D95 A;  2EYQ A;  1WYU A;  3FDB A;  1TOK A;  4I8A A;  1SZU A;  1W3U A;  3BB8 A;  3DXW A;  4A0R A;  1X29 A;  1LW4 A;  1SFF A;  1IVR A;  3QHX A;  1OXP A;  3MBB A;  1ASL A;  3PDB B;  3NRA A;  2YKV A;  5E5I A;  3LY1 A;  1E5E A;  4A00 A;  1AAW A;  3CQ6 A;  4ZDP A;  4F5H A;  1ZOD A;  2Z9V A;  3NU8 A;  2CFB A;  2CH2 A;  4QGR A;  1QIS A;  1N31 A;  2PO3 A;  3AEP A;  3PDX A;  4LW2 A;  2CTZ A;  1M6S A;  3BC8 A;  3PD6 A;  1MGV A;  1TOJ A;  4JF1 A;  3E2Z B;  3ELE A;  3WLX A;  2D64 A;  3AAT A;  3H14 A;  4BA4 A;  1DGE A;  4GE9 A;  3A9X A;  4IX8 A;  4DBC A;  1DFO A;  2HUF A;  1M7Y A;  2CJH A;  2YRI A;  1BJW A;  4CXR A;  5JAY A;  5IWQ A;  3LVL B;  3BWN A;  1KKJ A;  1B4X A;  3AEL A;  1LC7 A;  1CQ8 A;  3A9Y A;  5AX8 A;  1AMS A;  3F0H A;  1GBN A;  2VI9 A;  2FQ6 A;  4RLG A;  1AIB A; 
#chains in the Genus database with same CATH homology
 2BIA A;  3WKR A;  5I92 A;  4XJO A;  4N0B A;  3WCN A;  4ADB A;  3LVJ A;  1AIC A;  1QGN A;  4W1X A;  1CQ6 A;  2C81 A;  1V2E A;  1OAT A;  1WYT B;  1XI9 A;  2VGZ A;  4BHD A;  4H63 Q;  4PIW A;  1AY8 A;  1W23 A;  3MAD A;  2V1P A;  4OC9 A;  2VMW A;  3DRD A;  3DR4 A;  4UHO A;  3FRK A;  1FG3 A;  2FNU A;  1OXO A;  1TOG A;  1YAA A;  2YKY A;  1D7U A;  1M0Q A;  2V0Y A;  2WK8 A;  3QBO A;  3ECD A;  2CH1 A;  4ZAS A;  1YJS A;  3EI5 A;  1QIT A;  4F5M A;  1TAT A;  1UU0 A;  4J8L A;  2ZY5 A;  4ZM3 A;  2VLF A;  2VMR A;  4WYG A;  2QB3 A;  1GC0 A;  4ADC A;  1BQD A;  1AY5 A;  1H0C A;  3EUC A;  1JF9 A;  4MGR A;  3GZC A;  2X5D A;  3G0T A;  3JU7 A;  4XJM A;  1GEW A;  5KTB A;  3NYT A;  3AEM C;  2Z9U A;  4LW4 A;  4DQ6 A;  4W5K A;  4WB0 A;  1C7G A;  2AY5 A;  4K2I A;  2BHX A;  1SZK A;  4AOA A;  3FFR A;  3BV0 A;  3EI9 A;  4Y0H A;  2Z20 A;  4RIT A;  1AAM A;  2OAT A;  3ZRP A;  2FKI A;  4E3R A;  4ISY A;  4UOY A;  3M5U A;  4E3Q A;  1RV3 A;  1X28 A;  1QJ5 A;  1WYV A;  2HP1 A;  2RFV A;  3Q8N A;  1IAY A;  4Y0I A;  1WKH A;  3NUI A;  2W7F A;  4WXG A;  1GC3 A;  2VMQ A;  2W8J A;  1LS3 A;  4K2B A;  1D7V A;  3WY7 A;  1GEX A;  3DZZ A;  3KE3 A;  2EZ1 A;  3JWA A;  1W7N A;  3WGC A;  1O69 A;  3PIU A;  4XJL A;  2ZY4 A;  3COG A;  1TAR A;  4A6U A;  2BWP A;  4E1O A;  1H1C A;  4EB7 A;  3ASA A;  3E9K A;  1SZS A;  1ORD A;  2R0T A;  3W1J A;  4OBV A;  3WCO A;  5FT5 A;  2R5C B;  3BS8 A;  2JJH A;  5G2Q A;  3RBL A;  1OHY A;  2GB3 A;  3HL2 A;  3PDB A;  1ZOB A;  5EAV A;  3W1H A;  1GCK A;  1P3W A;  1DJE A;  1BJO B;  1FG7 A;  4JEV A;  1SVV A;  3RCH A;  3ATH A;  1S07 A;  3ZZJ A;  4MKJ A;  3E6G A;  2WB6 A;  1DGD A;  1ARI A;  1TOE A;  4XEW A;  5J8Q A;  4A0F A;  5BJ4 A;  4RJ0 A;  2W8U A;  3PPL A;  5M49 A;  1AHG A;  1AX4 A;  4AZJ A;  2O7C A;  1D7S A;  4XK1 A;  4ZWM A;  3KGW A;  3PA9 A;  4XJP A;  4GSA A;  3CQ5 A;  2VMO A;  4A0H A;  2BWO A;  2O1B A;  4GRX A;  5EQC A;  4Y0D A;  1EJI A;  2X3L A;  1O62 A;  2PB2 A;  3ASB A;  4WP0 A;  4WYF A;  3L44 A;  1MAP A;  3GWP A;  2WKA A;  1O4S A;  5G4I A;  1O61 A;  3EZS A;  1AMA A;  4BQ0 A;  2X5F A;  2AEV A;  3K7Y A;  2DR1 A;  4PVF A;  1J32 A;  2AEU A;  5DJ9 A;  1M0O A;  1MLZ A;  1M4N A;  5M46 A;  1YJY A;  3GJU A;  3MAF A;  3AEN B;  4DGT A;  1DJU A;  4ZWV A;  1IUG A;  1GEY A;  1IX8 A;  3GZD A;  4EU1 A;  1PMM A;  2AY8 A;  3BN1 A;  2KFP A;  5G09 A;  1ARG A;  2FM1 A;  2Z1Z A;  2OGE A;  1IX6 A;  4R8D A;  1CZC A;  1B5O A;  2BIE A;  2D65 A;  1ELQ A;  3MKJ A;  4LNJ A;  2W7M A;  3TAT A;  4OMA A;  4AO4 A;  1IAX A;  2DGK A;  4OCA A;  3KGX A;  3OP7 A;  4R2N A;  3N4S A;  1ASA A;  1AHF A;  2VI8 A;  2ZSM A;  3TCM A;  2D7Z A;  2JJE A;  3BCX A;  2HUU A;  4IXO A;  4R5Z A;  1M0P A;  1B5P A;  2Z9X A;  2D7Y A;  3HBX A;  3QI6 A;  1ECX A;  2VYC A;  4W91 A;  3QN6 A;  2VGT A;  3AEO A;  1QIR A;  1I43 A;  5E3K A;  3UE8 A;  2VMT A;  4LC3 A;  2AAT A;  4OBU A;  4OT8 A;  2BIG A;  1G4V A;  2E7I A;  2BI3 A;  2QA3 A;  3B1E A;  3A9Z A;  1I29 A;  1GC2 A;  3N4R A;  3E2F A;  2YCP A;  4ZDO A;  2VMS A;  1PMO A;  2Z67 A;  3I16 A;  2E54 A;  4H51 A;  5C6U A;  3RUY A;  4RIZ A;  1N2T A;  3N0L A;  4WYD A;  4EFF A;  2QLR A;  3DYD A;  1AJS B;  1FC4 A;  1TOI A;  4OTL A;  4IYO B;  1PFF A;  2XH1 A;  1S08 A;  3E77 A;  3K28 A;  4F5L A;  3FFH A;  4F4E A;  4RM1 A;  4AH3 A;  1VP4 A;  1ARH A;  3AEJ C;  4FFC A;  3OKS A;  2EH6 A;  1ASM A;  2ZY3 A;  4BA5 A;  4ATQ A;  3CAI A;  4CVQ A;  3AV7 A;  1B9H A;  1UU1 A;  4L0O A;  3TFT A;  4AO9 A;  2R5C A;  2JJF A;  3JWB A;  2CB1 A;  2JGT A;  3FVX A;  4ADD A;  2CAN A;  1KMK A;  2BKW A;  1X2A A;  3FKD A;  2W7E A;  2FNI A;  1OHW A;  3FTB A;  4ZDL A;  5EUE A;  1U08 A;  3DXV A;  1AMR A;  2ZC0 A;  4N0W A;  1BT4 A;  5FT4 A;  3NDN A;  1RVY A;  4ZSW A;  4P7Y A;  1CL2 A;  2VGU A;  2CJD A;  2QBT A;  4ITG A;  1GDE A;  4PFF A;  1IBJ A;  1WYU B;  4KYO A;  3L8A A;  2CST A;  1JS3 A;  3P1T A;  4W1W A;  4XAU A;  4A6R A;  3E2Y A;  4EB5 A;  5K8B A;  1T3I A;  4R5F A;  3ELP A;  3EI6 A;  2EO5 A;  2YCN A;  1C0N A;  3HMU A;  5EAA A;  3HDO A;  3CQ4 A;  1RV4 A;  3NYS A;  4A0G A;  1I48 A;  7AAT A;  2HOX A;  2BWN A;  1PG8 A;  4UQV A;  2E7J A;  1AKA A;  3AEN A;  4BMK A;  4OYT A;  4TV7 A;  3N75 A;  2W7D A;  2W7I A;  2W8W A;  1JS6 A;  4WLH A;  1BKG A;  1QJ3 A;  5BJ3 A;  3I5T A;  5G4J A;  4F5J A;  2TPL A;  2AY6 A;  1QZ9 A;  2DKJ A;  3RI6 A;  4RKC A;  2GMS A;  1AIA A;  2X8U A;  4NOG A;  2YCT A;  2Z9W A;  1JG8 A;  3USF A;  1CJ0 A;  4F5K A;  5HHY A;  5G2P A;  1LW5 A;  1ARS A;  5LHA A;  2R5E A;  1AHE A;  3JW9 A;  2VLH A;  1YIY A;  4MKK A;  1ASB A;  3UWC A;  1KMJ A;  1V2D A;  3BCA A;  4JE5 A;  4E77 A;  3PAA A;  2HUI A;  5FT6 A;  1ASD A;  3R9A A;  2EGY A;  4JF0 A;  2HZP A;  3E2Z A;  3N5M A;  8AAT A;  2HP2 A;  1OHV A;  3LG0 A;  1GC4 A;  1ASG A;  1DTY A;  2OQX A;  3GZD C;  4Q75 A;  2CY8 A;  1AMQ A;  3JZL A;  1UKJ A;  1BS0 A;  1ART A;  4JEX A;  4MQR A;  1B8G A;  2BI9 A;  3NX3 A;  4WD2 A;  2NMP A;  2D66 A;  2G7J A;  2VMV A;  3H7F A;  3G7Q A;  1W7M A;  2E7U A;  1S06 A;  2C0R A;  3NTJ A;  4W8I A;  5F8V A;  5HDM A;  4WLJ A;  3WGB A;  4XQ2 A;  4A6T A;  4WYC A;  5FT8 A;  3HVY A;  1CL1 A;  3RQ1 A;  1AJS A;  2AY4 A;  2JIS A;  2YHK A;  3EI8 A;  3B1D A;  4IY7 A;  4WXB A;  4F5G A;  3F9T A;  1G7W A;  2BI2 A;  3MC6 A;  4JEY A;  4RAE A;  1WYT A;  4WXF A;  1I41 A;  4GE7 A;  2W7H A;  2FYF A;  4IXS A;  4JE5 D;  4Q6R A;  1S0A A;  3MEB A;  1E5F A;  1CS1 A;  2W8T A;  5F9S A;  1KKP A;  4WB0 B;  5EFS A;  4P3M A;  4UHM A;  3ZZK A;  3B46 A;  3EZ1 A;  3NNK A;  3BWN C;  1V2F A;  4AZK A;  1ASE A;  3ACZ A;  2GMU A;  1WYV B;  3VK3 A;  4Q76 A;  3K40 A;  2C44 A;  1Z3Z A;  5M4D A;  2AY1 A;  1G4X A;  5LH9 A;  1ASC A;  2EZ2 A;  1C4K A;  3PJ0 A;  4MY5 A;  3DR7 A;  3BWO A;  2OGA A;  1IX7 A;  3EIA A;  4ZSY A;  3FQ8 A;  3LVK A;  2BI1 A;  1ZC9 A;  1MDZ A;  4ZM4 A;  3BCB A;  1LC8 A;  3QGU A;  3UAK A;  1WST A;  1KL1 A;  2Q7W A;  5TF5 A;  1SPA A;  1XEY A;  4IXZ A;  4RKD A;  2AY2 A;  3T32 A;  2Z1Y A;  4WBT A;  3RBF A;  2VMP A;  2AY7 A;  2VMX A;  3FZ8 A;  3VAX A;  5G0A A;  1ASN A;  3A2B A;  1MAQ A;  4MQQ A;  1AHX A;  3W1I A;  2C7T A;  3IHJ A;  3RCH B;  1C7O A;  2ZJG A;  2VMN A;  3GET A;  3DU4 A;  3VK4 A;  4MQP A;  3MAU A;  4GE4 A;  4CBS A;  2ZY2 A;  3HQT A;  3AOV A;  2OKK A;  5M4B A;  1DJ9 A;  1GD9 A;  1CQ7 A;  1TPL A;  1V72 A;  3H9X A;  5HXX A;  3QPG A;  4JEW A;  4TMR A;  3FQ7 A;  4KXK A;  2VIA A;  4K2M A;  5D5S A;  3NYU A;  4KAM A;  2W8V A;  2YKU A;  3DOD A;  3NU7 A;  2ZP7 A;  4M2J A;  3AOW A;  1YOO A;  4UHN A;  1BJO A;  1W7L A;  2ZYJ A;  2CIN A;  2ORD A;  4CBR A;  1EQB A;  1BJN A;  2WK7 A;  3FD0 A;  4MSO A;  1C7N A;  3FZ7 A;  5EIG B;  4ITX A;  2Z61 A;  3MAF B;  1BQA A;  2JJG A;  1MDX A;  2BYL A;  2YRR A;  3GBX A;  1YNU A;  1M0N A;  2FN6 A;  1C9C A;  2DOU A;  4GDY A;  5DJ1 A;  3II0 A;  4HF8 A;  3FDD A;  4F5F A;  3HT4 A;  4RJY A;  3WKS A;  4WYA A;  3ZRQ A;  4IW7 A;  3TFU A;  2G6W A;  3LVM A;  2OKJ A;  3NUB A;  5EUN A;  3TQX A;  3QM2 A;  1Y4I A;  3G8M A;  2D63 A;  2ZUK A;  2HOZ A;  1IJI A;  3FVS A;  2DKB A;  3P6K A;  1MDO A;  2VMZ A;  1AHY A;  2W7J A;  1VJO A;  3PD6 B;  1TAS A;  3AEJ A;  1KL2 A;  3VOM A;  1LKC A;  1VEF A;  4ADE A;  2R2N A;  2VGW A;  2BI5 A;  1WKG A;  1X0M A;  2AY3 A;  3KKI A;  1YIZ A;  4HVK A;  2QMA A;  3LWS A;  3FQA A;  3IF2 A;  4ATP A;  4WYE A;  3R4T A;  2QB2 A;  1ASF A;  2W7G A;  9AAT A;  3EIB A;  2A1V A;  2VGV A;  1LK9 A;  3MC6 C;  4J5U A;  2VGS A;  1B9I A;  4O6Z A;  2W7L A;  3AEM A;  4U1T A;  1G7X A;  2F8J A;  2O0R A;  1N8P A;  2D5Y A;  2DGL A;  3GSB A;  4Q31 A;  3B1C A;  4PFN A;  4W1V A;  3WZF A;  4LNM A;  1RVU A;  4U2H A;  2ZSL A;  1D2F A;  1ELU A;  2D61 A;  4JEZ A;  3FZ6 A;  3F6T A;  1BW0 A;  3PGY A;  4M2M A;  5E4Z A;  2YKX A;  3LV2 A;  4LNL A;  5EUD A;  4B9B A;  2YOB A;  3N7N A;  4M2K A;  3FSL A;  2WK9 A;  3A8U X;  4FL0 A;  1AJR A;  3B8X A;  4ZLV A;  4IYO A;  2QSR A;  1UU2 A;  3FVU A;  1AY4 A;  2HOY A;  2EPJ A;  3FCR A;  4A72 A;  3GR9 A;  2VIB A;  2AY9 A;  5DB5 A;  3EI7 A;  2CJG A;  1SF2 A;  3ISL A;  1EG5 A;  1MLY A;  4B98 A;  4GEB A;  2HOR A;  3DC1 A;  1Z7D A;  3HLM A;  1AKB A;  4ZAH A;  2JG2 A;  2PB0 A;  2VMY A;  2XBN A;  3D6K A;  3N4X A;  1S09 A;  1DKA A;  2VMU A;  1AKC A;  1BJ4 A;  2GQN A;  1D7R A;  1M32 A;  3WX9 A;  3I4J A;  5DX5 A;  2W7K A;  2DGM A;  4F5I A;  1CZE A;  3CBF A;  2GSA A;  5EIG A;  3VP6 A;  1YJZ A;  3ZRR A;  3JTX A;  4CXQ A;  4EMY A;  1J04 A;  1LC5 A;  4TN4 A;  3VK2 A;  2BYJ A;  4K05 A;  5D95 A;  2EYQ A;  1WYU A;  3FDB A;  1TOK A;  4I8A A;  1SZU A;  1W3U A;  3BB8 A;  3DXW A;  4A0R A;  1X29 A;  1LW4 A;  1SFF A;  1IVR A;  3QHX A;  1OXP A;  3MBB A;  1ASL A;  3PDB B;  3NRA A;  2YKV A;  5E5I A;  3LY1 A;  1E5E A;  4A00 A;  1AAW A;  3CQ6 A;  4ZDP A;  4F5H A;  1ZOD A;  2Z9V A;  3NU8 A;  2CFB A;  2CH2 A;  4QGR A;  1QIS A;  1N31 A;  2PO3 A;  3AEP A;  3PDX A;  4LW2 A;  2CTZ A;  1M6S A;  3BC8 A;  3PD6 A;  1MGV A;  1TOJ A;  4JF1 A;  3E2Z B;  3ELE A;  3WLX A;  2D64 A;  3AAT A;  3H14 A;  4BA4 A;  1DGE A;  4GE9 A;  3A9X A;  4IX8 A;  4DBC A;  1DFO A;  2HUF A;  1M7Y A;  2CJH A;  2YRI A;  1BJW A;  4CXR A;  5JAY A;  5IWQ A;  3LVL B;  3BWN A;  1KKJ A;  1B4X A;  3AEL A;  1LC7 A;  1CQ8 A;  3A9Y A;  5AX8 A;  1AMS A;  3F0H A;  1GBN A;  2VI9 A;  2FQ6 A;  4RLG A;  1AIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...