1AKEA

Structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between adenylate kinase from Escherichia coli and the inhibitor Ap5A refined at 1.9 A resolution. A model for a catalytic transition state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1991-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1akeA00
3CONA 2YVUA 3KUDA 3EC2A 3MCAA 3QENA 2GK7A 1SVWA 5BN5A 2VPPA 3KB1A 2IUTA 4R7ZA 3PVSA 1OYYA 2CMKA 4A2PA 4HZIA 1DO0A 1NY5A 1NG1A 2ZI9A 2L0XA 3CM0A 3K09C 1W5SA 4IHQA 3PITA 1D9XA 1E98A 4NYIR 2RH5A 1CR0A 1Q3TA 4PAOA 4TMVA 4B3DA 2DY1A 1CTQA 1BIFA 1WXQA 1QVAA 3OIWA 2GEUA 1G41A 3U4QA 3NTUA 2HJVA 1XCMA 1UKVY 4WOPA 3VR4A 5FPYA 4LDJA 5G40A 3U7FB 1T3SA 1BMFD 3IO5A 4IXMA 4TZ0A 2C04A 4O25A 4LZZA 2FE4A 2C77A 1AN0A 1BS1A 1XWIA 1JNYA 2WMOB 3KTAA 1Z2AA 1NJGA 1N6OA 1OH6A 4A1FA 4KFSA 4PHHA 2A9KA 1GRRA 3C5HA 4FMBB 2WWHA 2PJZA 4TTQA 1HH4A 4HDOB 4OK5A 4P4TA 2WBLC 3KQNA 1BKDR 2HYDA 3THYA 3A1WA 1WB9A 3AB3A 4FW9A 4Q9KA 4C0HA 3KJHA 3BRWD 1YR8A 3F8TA 4TYYA 3WBKA 2BEKA 4JLBA 4LGMA 3NBYC 4EFLA 5JRZA 1NLYA 1NVVR 3AF1A 4TYQA 1WE2A 1RJ9B 1Z0IA 1X8KA 2BCJQ 2QI9C 1N6RA 3B82A 3C15C 5CYOA 5EE1A 3EA0A 4FCWA 3TR5A 4I81A 3OEHD 3K0CA 2BMFA 2MMCA 1T3LA 1GKYA 1XF9A 3SHWA 4PAQA 1RFLA 4A8JC 4CEIB 4MRVA 2GZDA 1IN6A 2ZRPA 3K70C 1IQPA 1W4CA 1G3UA 3K0FA 2XGJA 1E0AA 5JHHB 1IY1A 1NG9A 5EXXA 4ZCLA 3QEOA 2VL7A 1ZNXA 5IK2A 4GI7A 5AUOB 4Q02A 121PA 2GCOB 4WW0A 1LB1B 1SKYB 3A37A 2HT6A 3HDTA 1E9DA 4LBVA 3A8TA 2FA9A 4PFSA 1G5RA 2QUZA 1ZM4A 2ZE8A 4D4LA 3WY9A 2R65A 4M1SA 2ZRFA 2RMKA 4LJ6A 3KKMA 1QHHB 4DLXA 4JVNA 3C8UA 2NQ2C 2RGCA 1RYFA 2NOAA 2GF0A 3EZ9A 2IBMA 3SHFA 2LWIA 4DDTA 3O8CA 1B23P 3IQWA 1FP6A 3T34A 2DBYA 5BQ5A 1FQJA 1NRJB 1IAQA 1VG0B 1XTKA 1YZNA 2ZITA 1HV8A 3AP3A 4NONA 4QBFA 2CK3D 2HXYA 2BKUA 3EARA 4TLBA 2LKCA 3CRVA 3PFIA 4GP7A 1OFHA 3Q7QA 3U7HB 1E2PA 1HQYE 2FSHA 5DI3A 4BFTA 4DLSA 1XJQA 3FYHA 3CW2A 2V8OA 4XTCS 1G3QA 3PUXA 2FPKA 4D0GA 1QHNA 1G18A 4GT1A 5H70A 5HE8A 3MSXA 5JI2E 1SVKA 1Z6GA 2LKDA 3WMEA 4C0KA 3B9PA 5LB4A 3QEJA 4F4CA 2WOJA 2B7CA 5JJLA 2A5FA 5LD2C 3AQ4A 2D62A 1P73A 3U3RA 3THXB 3ETLA 2HF9A 1RC8A 2JJ1D 1JI0A 2H18A 1CP2A 4X8LA 4B3CA 3ZLJA 2CL0X 2GCPA 4OHXA 4ZCIA 4KODA 1YJ5A 2AL7A 3TUIC 2D74A 4BFYA 1KIMA 2P6RA 2QMUA 1A7JA 3M0EA 1OHHD 5E7MA 5F2EA 4CEJB 4QNMA 1G3MA 4P4SB 2ATVA 1KKLA 1XD2A 4PPFA 3H84A 1VG1A 4JZKA 3CRQA 2A5JA 4XWOA 1HURA 2OCAA 5KTYA 2CVFA 2QAGB 1W36D 5FPHA 2D7DA 4OJQA 4QJ5A 1ZC3A 2ERXA 5FR2A 1KJZA 2EW1A 4JMPA 4G0NA 3GQBA 3WRXC 3THYB 1UM8A 3Q85A 1MR3F 2ZI7A 1NY6A 2J41A 4JVMA 3D8BA 2HF8A 3GLGB 1HYQA 1FUKA 1XRJA 2V7QD 2EYQA 1AIPA 3QG5A 1GNPA 1QHIA 1T91A 2DYKA 2YOHA 3NHAA 4AI6A 2WKRA 2PLFA 5B2ZA 1CIPA 2GETA 3QE0A 4CYMA 4NCJA 3MGCA 4MYTA 5GVSA 2XXAB 2BOVA 2JIZD 3K9GA 1G7CA 2ZRJA 3WP0A 4B2IA 1VMAA 2BV3A 4MRRA 3CX7A 1HEIA 1E94E 2ZRGA 3K53A 4G3XA 4OHWA 4HUQA 1G9XA 4DSOA 5FR1A 2OCBA 2BDTA 1JQJC 2FPLA 1Y3AA 4Q1CA 1Z0DA 1ZIOA 4BFUA 4YQFA 3KX2A 4RCYA 1UKZA 2ORVA 3GLHA 1CKEA 3UMSA 5TXGA 3R9XA 4UXHA 4X8HA 3LVRE 3OESA 2VRWA 3FDIA 2XZOA 1WF3A 2JLUA 3EIEA 3T5DA 3AUYA 1TQ6A 3DOEA 1FNMA 5JZVA 2YYZA 4RCZA 3A1TA 2JLXA 1KI6B 2QORA 4D4JA 1S2MA 2ZYVX 2JASA 3UANA 2B92A 4MYHA 4AYWA 4QG7A 4DEXA 5KPDA 5GJWC 3VKWA 4EPRA 1J99A 1VKJA 1EG7A 4RY2A 4A0HA 2FFBA 1N25A 4IOLA 2GBLA 4BUJA 3MWYW 3T5GA 1AS0A 1N6LA 1KI4A 3I4LA 4QGAA 1OXXK 1SXJD 4QGGA 2IEYA 4M9XA 3R9WA 1TAGA 2Z4SA 4E03A 4MYCA 2VF8A 3BB1A 1TADA 2ZSEA 4AKEA 3B85A 3SBDA 3QNUA 3GLIB 2D4HA 2IS6A 1X1SA 2H57A 1UADA 2W6ID 3T35A 1YU9A 2PCJA 4DIEA 4IOKA 5FI1B 1KMQA 4IEIA 2SHKA 4JT4A 4LYJA 5SZHB 4QHYA 4B74A 4B47A 3OF5A 1JR3D 2E87A 2GAAA 1U9IA 3C41J 3ONWA 1D2MA 4BASA 2Q9AA 3QKSB 2WIAA 4IVRA 2ZI6A 3LFUA 3TRFA 2GF9A 4K8OA 2WSMA 3MRSA 4KSCA 4QRHA 1FOEB 1Q21A 4YC7A 4A0GA 2D06A 4C9BA 2EWVA 4ZIRB 1CULC 2PBRA 2RGBA 5SZJA 3R7WA 4OQMA 1P60A 1F2TB 4W5JA 1KTVA 1RRGA 3FGNA 1JXMA 1FTNA 4S35A 3RAPR 4Q66C 3VU9B 2MSEB 2GDJA 4D4KA 2NG1A 5JFGA 4RD6A 4TLDA 5A4JA 3IO3A 5AK0A 1J8YF 4P32A 4YMUA 5KSPA 2JDID 3WYFA 4NCNA 4LYFA 5KNDA 4HAUA 1YRBA 2JLYA 3K09A 3KDSE 1Z47A 2J9RA 4P33A 3RS2A 3J81k 2OLJA 3W3ZB 2JAQA 2FH5B 2K5UA 4Q9LA 3W9YA 3THWA 1XXHB 3AF4A 4PPQA 4OI4A 2JDIA 2ZANA 1YE8A 2ODWA 5DN6D 4F93B 1VDZA 1N5KA 2AWNA 3QOFA 4DZZA 2E1RA 3ZIAA 1J8MF 1E9CA 4FMCB 4Z51A 1E2HA 2OM2A 2XJ9A 4HZUA 4KLZA 5D3QA 4EKDA 5JWRA 3MJRA 3E5HA 2OCYC 1PLKA 1KNQA 2V6JA 2Q0HA 3ND8A 3VR5A 1OPXA 4IDPA 4MKIA 4L8GA 4B71A 1VCIA 1HA3A 1E4YA 1MH1A 4KI0A 1PZNA 4EJSA 2XNDA 1E9AA 1XMJA 1E9RA 5BN4A 5KO2A 1BOFA 4CDGA 4OQNA 1SHKA 5HCNA 1NBMD 3MWJA 4TTPA 2I1QA 2JGNA 1CBUA 2AFHE 4HUQB 2FDCA 4CEJA 3PUZA 2QQ0A 3ZVMA 2YHSA 1GG2A 1J2JA 1UDXA 1Z5ZA 5FBQB 1SKQA 2KE5A 2ZE5A 3AVXA 3CIOA 2PT5A 1H8HD 4O0MA 3HP1A 1Q57A 5CDFE 5K8LA 1IM2A 1R0XA 1EFHA 1J70A 1TQ4A 2PJRA 5CLLA 2VHQA 1XCGB 3OEHA 1W5TA 2WOOA 3L0OA 5EZ5A 4EUNA 1L7VC 1XZPA 1KSGA 2QZ4A 1C1YA 2A5DA 3ZS8A 1DG1G 2QTFA 4B2PA 3K0SA 1AQUA 4LX0A 4J0QA 3AVWA 1HT2E 1KMHB 2V9PA 4ESVA 2Q6TA 3CF0A 3L0SA 2FFQA 1R8QA 3W6PA 2P6NA 1LNZA 1KNXA 2H92A 3GJ7A 3SI7A 4IKEA 1II8B 2OBLA 5DI9A 3WMGA 2IS2A 1T0JB 4QKQA 2ZUBA 1II9A 2QP9X 4OL0A 1GVNB 1ZUIA 5L3QA 2VYFA 3BS4A 4A2QA 3RRMA 3ADBA 4DKXA 3CWQA 3LX8A 1G20E 1Z2CA 5J47A 3IHLA 1E6CA 2YWFA 1KDPA 1KYIA 4MQBA 1P6XA 5JWOA 2MSCB 3DZDA 3NH9A 3LBIA 4ZIRA 1E4VA 5EE3A 1NLFA 4DCUA 4JLOA 4ASUA 3AVVA 4GMDA 3I3SR 3I92A 1ZBDA 4Q1BA 5TARA 1IN4A 1TU3A 3SYLA 2AXPA 3IBGA 1NI3A 1EXMA 4U02A 3WRYC 4V03A 2VSOA 1PJRA 3CPJB 1E9FA 3ASYA 1XJ0A 4OI1A 1AKYA 3GEEA 4Q4HA 2RGDA 2JLRA 1I4DD 3TR0A 5J4HA 1NL3A 1T8TA 1V5WA 2WSSA 4IDQA 1U99A 1AA9A 1QVRA 2ANCA 2QY9A 4FMDF 3QUSA 1MO4A 3BJIC 4B3BA 2ERYA 1KDTA 2CNWD 2G3YA 4AKGA 2ZJYA 3F0TA 4HB0A 2CE7A 2W6JD 4GBMA 4Q1FA 1IN7A 4AYXA 4ILEA 4MA4A 4C0SA 4CEIA 3RS5A 1Z3IX 3VKHA 3MG9A 4L16A 3D31A 2CDNA 4IOJA 1E69A 1SXJA 2MMGA 1EFUA 4MH0R 4E09A 1G6HA 2FF7A 1ZM2A 3SDZA 1JPJA 1W4RA 2FFAA 1FMJA 2YC4C 3L43A 5BXQC 3M1IA 4HEJA 4KHZA 3TE6A 2WHXA 3FFBA 2J1LA 5FPSA 5AWFC 5J4KA 3U60B 3V00A 2O5VA 3CX8A 2ZU0C 3CZQA 2QG6A 1E79D 4GOJA 1IXSB 5AUPB 2IUSA 3LW8A 2ZM5A 3LNCA 2VP2A 1OFTA 2BHRA 5FL3A 1W46A 2WKPA 3TIFA 3MWKA 5FTKA 2ZRNA 1ESMA 2RGNA 3LH5A 1CS4C 1KK2A 1K6MA 2J45A 2FNAA 5AR1A 5CB8A 2IYRA 1W0JD 1DELA 2G88A 3DKVA 3BH0A 1GTVA 4N3NA 2I4IA 2PZEA 2FOLA 4UNQA 3T15A 3ZQ6A 1YZLA 1KGDA 1P5ZB 4XWAA 2ZU6A 1KSFX 3AF3A 2CVHA 3JZMA 1QHXA 3ECCA 4W7SA 3QVVA 2G1JA 3NH6A 1XTRA 3VQTA 1XEFA 3NBFA 4HZUB 4YMWA 3TSZA 1FP7A 1Z06A 3MLEA 2NZ8A 5HKKA 4QBIA 5FPKA 4HAZA 4K46A 5DSZA 4HLQB 4EPVA 3G5UA 3SFZA 1R5OA 3IILA 1SVOA 4EFNA 3C16C 4M9QA 2ZI3A 1GIAA 1Z83A 2CHVA 2FJUA 3PIRA 3O8RA 1GL7A 4E22A 4H9GA 4JJKA 2ZYWX 3EZ7A 5FUYA 3ZZUA 2C9YA 3HU3A 3T12A 4Z54A 4PZZA 3EZ2A 3M6AA 4Z1MD 4OI2A 3EZFA 4NYJQ 3OHMA 4KXFB 3VMFA 5JS7A 4CIDA 1G19A 2JATA 4WZAE 3RRNA 3TSWA 1ETUA 3QVUA 4A0FA 3QKRB 4DT1A 1JB1A 2UZ3A 3RYTC 1NVWQ 1DAEA 2ORWA 1Z29A 1O87A 1KI2A 4R2HA 4WZ6A 4LUCA 2NO6A 2FX3A 2QAGA 4LHYA 4DCTA 2VLIA 2NPFA 4D80A 4GMXA 1Z07A 4UXJA 1SVSA 1T4GA 3TGPA 2CE2X 4GZMA 3VR1A 2FEOA 2KJQA 4M2LA 2O8BB 4US2R 5H68A 1KI8A 3RS3A 4Z8YA 4TSFD 1D8TA 2Z4RA 3HU2A 2QAGC 2A2ZA 3FHOA 4NBSA 3PENA 2TMKA 3AVPA 2ZJ2A 2IYQA 3P20A 1KJWA 3LRPA 1KKMA 3THOA 4NZYA 1U8AA 3LQQA 4QFMA 5LPNA 1VTKA 2C2HA 3OE7A 4XWKA 3H86A 4LY6A 3WHKA 5EE0A 4XVRA 2QT1A 1ZP6A 2CEAA 2GNOA 3FVQA 1E2NA 5HZHA 4LC0A 2JLQA 2GHIA 4OQLA 2JEOA 2QL6A 4TYWA 1TQ2A 2R6DA 2QSZA 3FMOB 4HAVA 3AKEA 3NG1A 4HB3A 4MGYR 4OYHA 4DDWA 5EZ6B 5IK2D 4NPHA 4ZDWA 2IUUA 5TV2A 3A4NA 2OILA 4XSHA 2YJTD 3DL0A 1U90A 5G41A 1EWRA 2JCSA 3WYGA 1IOZA 4FI3C 4JL8A 3T1OA 3GLIE 3A4MA 3KKQA 1SVLA 3R9IA 3CRMA 1PVOA 3EIHA 1OE0A 2ZI4A 3W3AA 1RRCA 5FTMA 2ZRDA 4BRWA 3ZQJA 2RAPA 5AJWA 2X19A 2WWIA 3LY5A 2ECKA 2QT0A 5TVKA 1UDWA 1ZCBA 5TB5A 1KSJA 1UEJA 2VEDA 2WWFA 2IL1A 2R62A 2VF7A 4KU4A 2OAQ1 4HDCA 4PO1A 1F5NA 4KO8A 5EUMA 3FKSD 4LHVA 1SQ5A 4Q47A 3VTKA 4IOMA 2ZREA 3AVOA 4ZPXA 3BIFA 1DADA 1Q1ZA 2CK3A 4EPWA 1S4QA 1E1QA 1F2UA 5DIFA 4LJYA 2GESA 4Y0AA 4MUBA 4HB4A 1W47A 2QM7A 2G6BA 4GOXA 2IXEA 3CLVA 5D3MB 5C46F 1S3GA 4KAXA 2IX3A 2P3SA 3NBXX 3KJIA 3I62A 3OFNA 1VHTA 2KI5A 3IEUA 3LBHA 4PAMA 4PHTA 5P21A 2HT1A 2F3RA 1UAAA 3PG5A 4D26A 3TK1A 2ZRKA 1PLJA 4TLAA 4LHWA 1FTSA 5DLQC 2ZSFA 3IKJA 1RPZA 4LV5B 2WJHA 1LF0A 1MT0A 4PPNA 4TL8A 1QRAA 4Q48A 2W0MA 1S0UA 2W2TA 2B7BA 3CBQA 2GZAA 1Z0KA 4TL6A 2ZAOA 3AGPA 1OHHA 1AQYA 2EFDB 2F43B 4IDHA 4LC1A 1LTQA 3V4FA 1UPTA 1T3HA 3WNBA 4Q7KA 3GD7A 1KAGA 4DHEA 1W0JA 2R6CA 4TLEA 1KOFA 2GJAA 3BD9A 3I61A 1G3RA 4LRWA 2WAYA 1RRPA 1ZC4A 2GXUA 2QPAA 5GJCA 1YRAA 2OAP1 4LYHA 2F9MA 4R9UC 1X6VA 4W9MC 2PEYA 3SFVA 3TUJC 2B8TA 1M7BA 2NTYC 1RJ9A 3B2EA 2DR3A 3QBTA 5HE9A 1T6NA 2Z83A 1CJUC 3MUFA 4LJ8A 3QF7A 1Z63A 4G1UC 1QBKC 4P0TA 4MDEA 4LHZA 3BAFA 3C14C 1IY2A 4A92A 3PCRB 1JAIA 3NC1C 5CM8B 4LHXA 3OAAD 3UKDA 1ZMXA 4JVSB 4NYMR 4O2LA 5A0FA 3U61B 2QSYA 5BWMA 1RZ3A 1II0A 5FTJA 5K8TA 4A36A 4PZLA 2WZQA 3TAUA 3CF2A 4QM7A 1OYWA 3CRRA 5EQTA 1FX0A 2ZR9A 2PLRA 2C8VA 2OO7A 1MABA 1TF5A 4RZUA 4JYCA 2Z43A 3B1WA 2F55A 4LWZA 4BLRA 4CW7A 3LDAA 2OESA 3N2IA 2H5EA 4OHVA 5G3ZA 1NSFA 4CRWB 2QGNA 3IIJA 2HLDD 3C7KA 4TT3D 4LPKA 4URXR 3UG7A 5HCIA 4B3FX 3BORA 1Q12A 3W8RA 1GP2A 1GWNA 1O3YA 2Q3HA 1GKIA 4PC2A 2C9CA 4G5RA 1EESA 3AF0A 4G5SA 2QQEA 3ND9A 721PA 3LXRA 2WIBA 4G01B 1G7SA 3KKPA 4RD3A 4C0BA 521PA 1L4YA 1GSIA 4JL5A 3HR8A 2J7KA 1F60A 2ODNA 4QJ4A 2QENA 3ZZTA 3QXJA 3HPQA 4MGKR 5EXTA 2ZVPX 1S1MA 2W83A 4Q01A 1E79A 3OZXA 2I3BA 2J46A 3QPVA 4DVGA 4B32A 1G21E 4JLJA 2UKDA 3AVYA 1G5TA 5CYPA 2OZEA 3DM5A 3PUYA 4XTRA 4DJTA 1IY0A 1SXJB 4LJ7A 4YDHB 1Q1EA 4DDUA 3ICEA 4F7WA 1MO6A 4JYBA 4ACBA 2QP4A 1UEIA 1XEXB 2JJ8A 2NIPA 1CU1A 3LX5A 3ZIAD 4M21A 1YZTA 3RS4A 1CJVC 3BFVA 3EA5A 2AN9A 3HWSA 4B35A 1CR2A 4KLNA 1Z0FA 2CJWA 2V1UA 4OQFA 2XZLA 1OXSC 1E9SA 1P75A 1Z8FA 1D9ZA 1TX4B 4U00A 4Y0VA 5FBRB 4EQ6A 1QHYA 2FPMA 2QRZA 1XPRA 1V43A 2OSBA 4Q19A 2VO1A 2ZQ5A 4PXAA 2J7PA 4POAA 5JI3E 4URYR 5DI3B 1QG2A 3O47A 4M9SA 1ZM7A 1GOTA 3SZRA 1T9HA 4DLRA 5DN6A 3GLGA 5J5CA 3U7GA 3AGQA 1R6BX 2F1HA 4IJMA 2IK8A 2FMXA 4BFVA 1LY1A 4I1UA 2IS1A 2C99A 4FD2A 2FZLA 2ZS9A 2F1JA 4TMTA 2N1BA 3BB3A 4HLCA 3BE4A 2ZJ8A 4Q1DA 5FOVA 4BFSA 3DKPA 1FQKA 1HE8B 2RGXA 5EP4A 1XPOA 2BCGY 2H16A 4HATA 4B48A 4I99A 4WIAA 5KDLA 5L3SB 4QGHA 1TF2A 1RRFA 1XD2B 4YXWD 2E9SA 4CT4B 4XJXA 4CT5A 1VIAA 1ZD9A 1X86B 3QBVA 3S1AA 3B7GA 1U8YA 2HEIA 4M0LA 1GNQA 4PX9A 3BH7A 3GLGE 3T61A 3O8DA 4UJ3A 1P61B 2RB4A 1W4BA 5BYJA 4GPTA 4HSEA 1AKEA 2NO9A 2P0EA 3RC8A 2O8FA 2OEPA 2ZJZA 3EPKA 3KUCA 1M34E 2JJ2A 3Q5EA 2QROA 3IHWA 4EPXA 3UMFA 1G8GA 1GFIA 2AKYA 5GVRA 3G0HA 4QHTA 1DTSA 4URWR 1SXJE 1YKSA 3RC3A 1JR3A 4EPYA 3VX4A 5IHPA 1H8EA 3EIQA 1M1YE 2J0VA 3BBPA 3SYNA 1M7GA 3LW7A 1DAHA 5CLQA 4LK2A 3AV0B 3Q8XB 3TKLA 1XEWX 2C5LA 2VHJA 2W2VA 2XEXA 2VSXA 2BKEA 2EVWX 4KBFA 4DBLC 2WWGA 2VHCA 2X1VA 4ZV4A 3PQCA 3U4QB 2ZJAA 3W5JA 4MKHA 4KFTA 2EFGA 2IS4A 1OW3B 2HJGA 2N46A 3DHWC 4G5QA 4WA7A 4W5WA 3X1XA 4DLWA 2DHRA 2N42A 4UKDA 1E32A 2ZYUX 3B1XA 4V0KA 2F7SA 3RHFA 4BECA 4E5UA 1K8RA 1R0WA 4HDQB 2GCOA 3VR3A 2OV2A 4FINA 4PR0A 4MRNA 4UNSA 4DCVA 2ZPTX 3SC3A 1ZINA 1Q1QA 2XNDD 3GFOA 4TL7A 2ZRIA 4B73A 2AD1A 2CJWB 5B57C 1JBKA 2V4ZA 3K0AB 1P72A 4TMZA 5JS8A 1E0JA 4EQ6B 2EFEB 3IDQA 3KL4A 4NL4H 2QRNA 5JRJA 3SJBA 2BMJA 1E3MA 1G5PA 3U44B 4L9SA 5HPYB 2VH5R 3RLFA 5CM9C 4QOSA 821PA 1LFDB 1JJVA 1EX7A 1QZXA 5EXPA 5KSZA 4FN5A 1TEVA 5JLJA 4L4UA 4RZ2A 4PHFA 3SN6A 2R6GA 2XAUA 3DMNA 3EASA 5TY0A 4AURA 5GJBA 2VHUA 4TL9A 4ZCMA 4XD7D 2GVDC 3X1DA 4JBXA 3K70D 3EXAA 2Q9BA 2HCBA 2CCKA 4Q21A 5FTLA 2JLVA 5JJKA 1US8A 1VYUA 3GJ3A 4PHGA 3WP1B 4NMMA 3T1VA 1R0YA 4C0QC 5IDVA 3VR2A 3OEEA 4TWZA 3IUYA 3GLFB 1ZD1A 3DEFA 2G0NA 2P5TB 3B8HA 1U8ZA 4A8JA 2BJWA 3BWDD 3OIYA 3ZD6A 2CCJA 4C0AC 3W34A 3KJGA 5EJEA 2GXAA 3I32A 1R7RA 1XXHE 5GJVC 5UKDA 4KV9A 4B6EA 2FV8A 5KU1A 2CLCX 5JHGB 1YZUA 4NYIQ 5E3HA 4TQAA 2R8RA 1N0WA 1CJTC 4IEEA 4BQSA 5EE9A 3UIEA 3BH6A 3FOZA 5EP3A 3IIMA 4FXPA 1CLUA 2O8FB 5J4LA 4BFXA 2PH1A 1F6BA 5JSZB 4Q5IA 3HU1A 3PEUA 3B5JA 4PQYA 4OKSA 4DLTA 621PA 1KAOA 2B21A 3KXKA 2G9NA 3WXMA 1OFIA 3K0CC 4Q03A 3SJZA 5D3MA 5HZKA 1Z6AA 1GAJA 1GUAA 1G1MA 2VP0A 1Z6TA 3WHLA 2QBYB 4BPBA 3CB4A 2HYIC 4I1SA 3TVTA 4JLAA 3AVQA 3HR7A 1MOZA 1U9IC 4DCSA 1W0KA 1A82A 2VHTA 4W5HA 2VTKA 3UPUA 1QDEA 2VP9A 2RCNA 4ZKEA 4F4IA 1MKYA 4LJ5A 2O0KA 5KDOA 4FWTA 2AXNA 2DCUA 3UATA 3IGFA 3ZVLA 4DCNA 2BM1A 2O8DB 3R20A 2IYYA 3BFKA 2W6IA 3QPWA 4RFVA 3QXXA 4DLUA 1P9WA 3CPEA 3LV8A 3NBZC 4D2IA 1XTJA 4RVCA 2GKSA 4DLZA 2UVQA 3PEWA 3U3OA 2CCGA 1W2GA 4DB4A 1EX6A 3X1YA 5F3WB 4DIDA 1WP9A 4HLUA 2HXSA 4Q1EA 1BYUA 2PZGA 2IWRA 4NCKA 3W5IA 4C4PA 1UFQA 4PSKA 1WBDA 4NYJR 3VX3A 4RFSA 5FBWB 1M8PA 4A15A 5DNYB 4OK6A 3UK6A 1U81A 1KK3A 1W2HA 4NCHA 3U3MA 3W8NA 1CR1A 3PUWA 4PTLA 2QMHA 1S8FA 2GZHA 2AFIE 2BVNA 5CJPA 2D7CA 4BEBA 2JJ1A 1FZQA 1R5NA 2FZ4A 3V9PA 4B3XA 5HR5A 2A5YB 3RNLA 1D2EA 2XB2A 1XMIA 1JECA 1I4LD 2YOFA 3LBNA 4JLMA 1XPUA 5FOSA 1S9DA 4RD2A 4TLCA 1OF1A 3MAAC 1SVMA 2BBTA 4X8MA 4DB2A 3N2EA 3DDCA 3LLUA 4HI0E 2XJ4A 3EZ6A 1NKTA 3LA6A 4LJ9A 3PXGA 3CKLA 2NO0A 1NVVQ 3AKCA 4D4MA 1P2SA 2CHQA 3QQ5A 2GXSA 4AD8A 1RIFA 4D82A 2IF0A 1R8SA 3IPXA 2ZR7A 3HYRA 1OT3A 1M6NA 2REOA 2RGNC 1K5GA 3U7EB 1IJEA 4BFZA 2W0SA 1IXZA 4TMWA 3U44A 3RWOA 1NBMA 5BN3A 5AJXA 3I8XA 4NH0A 1Q3HA 2W00A 3G82C 4PC1A 4QGFA 1EGAA 5EP1A 4NHOA 3TUZC 4OI0A 1NVUQ 1MO5A 2Z6VA 4NTZA 1G8FA 4B44A 1KI3A 2GWHA 1YQTA 2PMKA 1OKKD 3KQUA 3GLFE 1G16A 2BEJA 3QF4A 2ZJOA 1AS2A 4DC9A 3KB2A 5FBLB 1NP6A 3ZS9A 4EIWA 1WDTA 1XP8A 3CNOA 1FNNA 3BC1A 2OFWA 4A6XA 4YMVA 2YKGA 2QMOA 2ZROA 4BLTA 2BM0A 2DFLA 1NLZA 2J3EA 4LI0A 2GRJA 1AM4D 3GFTA 2AX4A 4XD7A 3A36A 3UMRA 2EQBA 3OFND 3RDPA 4PC6A 1AS3A 3NIBA 4WAUA 1OIWA 1IBRA 1FMLA 4JL6A 4IDNA 4JKYA 1SVIA 3EC1A 1GNRA 3QIAA 4NYMQ 4DT1B 3KQHA 3EPJA 1W36C 1YR7A 3P4YA 2V6IA 4NU0A 5B58C 3NXSA 5KSOA 1E2MA 4NCIA 4DLVA 421PA 1EFTA 4IDOA 1ZUHA 1FW6A 1DVRA 3S1AB 3FTQA 5L3RA 1P7CA 2XOKA 1AJEA 4WBSA 4GZLA 4LPSA 1GL6A 2AK2A 2LCFA 2ONKA 3SJCA 1VCNA 1YZKA 1E2EA 2VIIA 2CLSA 3KXLA 4R71A 1WQ1R 2JJ2D 5FBVB 4TMXA 1QG4A 2H1LA 2WPDD 2XNSA 2CXXA 2J0UA 2IYXA 3CNLA 1VHLA 5K8IA 5GADl 2OBNA 4M1YA 3AF2A 2IXFA 2QA5A 3HJNA 1MRNA 5E7JA 4E07A 4V0LA 4EJSC 3OIUA 4LSGA 2BMEA 4MKGA 4RZ3A 4B43A 2P65A 1XEWY 1XDBA 4LV8B 1NJFA 4IFEA 4ZKDA 3C5CA 2XZPA 3SOPA 3MJHA 1XZQA 3B6EA 5BW8A 3QXSA 1G17A 4A2WA 4ASUD 1HQCA 1D5CA 1P9NA 2X77A 4IVPA 2QTVB 3CWZA 2FFHA 2ZI5A 2V3CC 1YR6A 1LS1A 1IN5A 2GJKA 4Q4AB 2REBA 1N3BA 4ZDIA 4LOAA 3MWLA 1VIYA 1N2CE 1NN1A 1G3IA 1AGPA 2VSFA 3K9HA 2D3WA 1UF9A 4ON9A 4N0EA 5JWHA 1EK0A 3FE2A 1W49A 5AUQA 5FUWA 2NMVA 2O0JA 1X3SA 1XFAA 2CNWA 4JVLA 4R98A 3QG1A 5LBIA 2W6JA 2GA8A 2Q9CA 3B1ZA 1VYTA 3TH5A 3UXMA 2KBEA 4HYYA 4Q1AA 1N0UA 2WMNB 3AKYA 3SNHA 3QSYA 4US0R 3T06B 5B64A 3I8SA 3T1QA 1Z0AA 1GILA 1Q1BA 3B13B 3K0FB 4TYPA 3AVTA 2ZYTX 1L2TA 3SQXA 1P2TA 4A9AA 2P6UA 4M22A 5FOXA 3M4YA 3QF4B 4KYUA 1HTWA 3Q72A 1PV4A 3FKQA 1DAIA 4B2LA 2Q21A 2RGEA 4MDFA 4Q9HA 3K0EA 4IRUB 4QXAA 1M7HA 3IPYA 4D81A 2YOGA 4YDSA 4GRAA 5HKKD 5KOYA 4D0LB 2QM8A 1GKUB 1E9BA 4JKIA 1N6PA 4HAYA 4KBGA 3I72A 2O8CA 2ZSBA 1TPZA 2YZ2A 2Q3MA 1DPFA 1ZNZA 5L8VA 3ADDA 2JLZA 3CRW1 2DWQA 2ZJBA 5F9FA 5J4VA 4PANA 5SZIA 4D6PA 2P2LA 2FSGA 4A8JB 4LYAA 4WXPA 4ZDJA 1KO7A 5DYIA 2JIZA 1KI7A 3UWKA 5FFMA 4JBWA 1U0JA 5IF9A 2C98A 3PEVA 3F3YA 4BGDA 1NIPA 4RSGA 4BLQA 1XMVA 4DEYA 3ICQB 4BLOA 5C2JB 2DFNA 1SXJC 4EFMA 2J5XA 2BBSA 4Q4JB 3TVDA 1VECA 5JSZA 2IYSA 1T5LA 2IYVA 4RD0A 3GCGA 3KKOA 3DZ8A 5KNCA 5AJZA 4C2UA 3BK7A 1TTTA 2WWYA 2XTNA 2RGAA 3THXA 3ZVRA 1KHTA 3GLHE 1K5DA 2BBWA 2FG5A 3DMDA 4V0OA 4WVFA 3H0KA 1B0UA 3QJYA 3VHXA 3DM9B 4GFDA 5FL7A 1A2BA 1XCPA 2R44A 4JT2A 4O2RA 2GCNA 4PSAA 3T1TA 1FUUA 2XSZA 1HT1E 3RRYA 4V0NA 1DG3A 2ZS7A 4HAXA 4C0JA 2HLDA 4TT3A 3EW9A 3GLHB 5JECA 1OXUA 1KO8A 4JLDA 2J87A 5HTKA 1GZSA 3ZGXA 2X8AA 3FMIA 3LAWA 1I2DA 2R9VA 2C03A 3QXCA 4JSYA 2GK6A 5ANRB 1ZCAA 3D7MA 3KKNA 2IWHA 1I2MA 4JSTA 3SYKA 1WCV1 4H1VA 3KJEA 3A58B 4JLNA 1DEKA 1Q0UA 2J0UB 1T5IA 1ANKA 5JMTA 5EXSA 2ZVQX 4KITB 1NMXA 1OH5A 4U5XA 1ZU4A 2XOKD 3F5FA 1LW7A 3KFXA 2O8BA 2QEQA 1PLLA 1VPLA 2G77B 3AKDA 2PEZA 2VP5A 4CEHB 1G8YA 3AEZA 2ZRAA 3X1WA 2ZTSA 2H7VA 1IN8A 2GEDA 3VAAA 1EFCA 3L0IB 4DSNA 3PUVA 2BWJA 4URUR 2IYLD 3WBJA 4DDVA 2J7PD 1OH8A 2AR7A 4Q4AA 4B3GA 4A6PA 4MGZR 4MUAA 2I1VB 1AK2A 2D2EA 5F98A 1DOAA 2V54A 4ABYA 1R5BA 1ZM9A 5TMPA 5CJ2A 3QKRA 4DSTA 1HUQA 3MD0A 1XTIA 1DAGA 3VHLB 4WXRA 2WJVA 2DWOA 1WRBA 4Q7LA 1TEXA 3QPUA 1COWD 1PUIA 3I1FA 5FOWA 4HB2A 3GJ5A 1NSTA 4B76A 5KDDA 3CR8A 4DLYA 2GTPA 3CH5A 4HLDA 2B8WA 4YONB 1F3OA 2GJSA 2ZRHA 2C95A 3RWMB 3UWOA 4AWXA 1TU4A 2F9LA 1NN0A 2IYUA 3BFXA 3RSOA 3NWJA 2IW3A 2R6AA 2J59A 4TZ6A 2IC5A 2QU8A 5DO9A 1ZVQA 6Q21A 2VP6A 4YMTA 3THWB 3RANA 2DWPA 4QNRA 3A1SA 3U3KA 4LJAA 1X8JA 4I1VA 2WTUA 1Z6XA 3IBYA 3SU8A 2HDNB 4B6FA 1OKKA 3EAQA 3VFDA 4Q4JA 4URZR 5LDDC 1KZ7B 1E96A 4QJ3A 3QI2A 2DFTA 4KJZA 1QHGA 1VG8A 5CK5A 1DBSA 3GEIA 2Q3FA 2RKOA 1DAKA 2ONJA 1OXVA 4EDHA 2FGKA 5C18A 3BOSA 2ZS8A 3RS0A 3AP1A 4LBZA 2OBMA 4A4DA 4KCGA 1ZJ6A 1YZGA 2OUKA 4TYNA 3CUEF 4RZXA 3X2SA 3A4LA 3BERA 2QN6A 3GMTA 4IW3B 1JR6A 2ZEJA 3ZZ0A 3JZAA 3UG6A 1JPNA 1KJYA 2AK3A 4OQXA 2RHMA 4AC9A 3H4MA 4PSVA 4OBEA 2V55B 1KI1A 3B60A 4LCBA 5IT5A 1QF9A 4PC3A 3RABA 4YMSA 1HY3A 1W48A 2AWOA 3Q5DA 4KSBA 5EUQB 3K1JA 4V02A 3ZYCA 2YINC 2O0HA 1GM5A 4I1OA 5C1BA 3EPLA 1GITA 2AHOA 2QE7A 2XTZA 3QKTA 1OIXA 3GP8A 2BBOA 3OAAA 4ARZB 5M04A 3TW8B 4AK9A 2YC2C 3DO6A 4H1UA 1YZQA 1LVGA 2QGZA 5DGXA 1ZU5A 2A5GA 3AP2A 3CNNA 4GDFA 5G53C 4C7OB 2GAOA 1TUEA 1II8A 2PX3A 3SE0A 2WJIA 1KK0A 4Q7JB 2WWXA 3TMKA 1UKYA 2ZE6A 5DISB 1XD9A 2BC9A 2IYTA 3N70A 1Z6YA 1ZAKA 3E70C 5L3QB 1J90A 4KFRA 1OLOA 2ORIA 4ZDKA 2CHGA 1P9RA 5G3YA 4F92B 2PT7A 1BMFA 2GJ8A 4JLKA 4PQRA 3IIKA 3TQFA 4XVUA 3IQXA 1NNEA 1D6JA 4TTRA 4XOIA 3I73A 1XD8A 3OIVA 5ELXA 4ZI2A 1DS6A 1YHNA 1E0KA 2ASEA 4Q4LA 1HE1C 4Q9IA 3FB4A 3A6PC 1FX0B 3I5YA 5LD2B 2IHYA 4N1AA 3LVQE 1NBME 2X2EA 4URVR 1KO4A 1MABB 2FWRA 3Q3JB 4BZQA 1CXZA 2A30A 1VYVA 5CDFA 4M1MA 4KFUA 1ZW6A 1BYIA 1KO5A 4L15A 1UBCA 1KDRA 2B6HA 4L9WA 3P26A 2GEVA 1E9EA 1KO1A 2GILA 4RD4A 2NO1A 4BFWA 4CZ2A 4BZPA 4XH9B 2FSFA 4CEHA 4OHYA 2CLDX 5KUTA 2HCJB 4NE2A 1W44A 5DHFA 1Z08A 1XTQA 1U0HC 3H2YA 3MMPA 1XMSA 3AM1A 2FGJA 2ATXA 2OT3B 1ZNWA 4MRPA 4IVQA 1SULA 1E2LA 2OCPA 1Z0JA 1H8HA 1LS6A 1L4UA 2QNRA 3K9LA 1E1RD 1KSHA 4AG6A 1TNDA 3CPHA 2O8EA 3VR6A 4BLPA 1OB5A 3L8ZA 3CX6A 3NDBB 4WZBE 3R8CA 1ONBA 5CIWA 4DSUA 5AJVB 4C3ZA 4PPGA 5KHOC 3KXIA 3TQCA 4AG5A 1U94A 1US8B 3NEJA 3ZDQA 4BRUA 4QL3A 4XSGA 1ELOA 4QHSA 2QMEA 3L82B 4US1R 2C9OA 1JQLB 2XB4A 1A2KC 1KI9A 1G8HA 2QPOA 3EWSA 1Z22A 5FUVA 1CEEA 4G5OA 5E7IA 1Q22A 2F1RA 3W90A 3R7WB 1NF3A 1F2TA 2KSQA 4NKRA 5CITA 3E1SA 3Q7PA 5FUXA 1E2FA 1VCMA 2IYZA 1OV4A 3ZVNA 1OXTA 4M1OA 1E2GA 1AZTA 2ZIAA 1WBBA 1ZNYA 1I4TD 2ZRCA 1JR3E 5FL7D 4CGZA 2Y8EA 3QY0A 3K70B 1OH7A 1BH2A 3P1JA 1JALA 3CO5A 3FHTA 3TLXA 4Z1MA 1XXHA 4UNNA 4IFBA 1AZSC 4AKHA 3GLIA 3U5ZB 5JEEA 2WWWA 5H8WA 1ESNA 3LQRA 1G6OA 4EAQA 4C7OA 4MGIR 1Q44A 3PJRA 1RW4A 3VNVA 4TSFA 5FTNA 3X1ZA 1CJMA 3SEAA 4C0LA 1S9HA 2V1XA 1G7RA 2WJYA 1XEXA 2XX3A 3FMFA 4OK3A 1RKBA 1W0KD 4JS0A 4GP6A 1NN5A 3WMFA 2PL3A 5KPJA 4BE7B 4JLPA 3QKUA 4EJSB 3H1TA 2FN4A 2DPXA 4PO9A 1NVXQ 3GJ6A 1KY2A 5EP2A 2A78A 3GFPA 5JJIA 1ODFA 3KQKA 1SZPA 5DE3A 5K8UA 2XITA 1MRSA 1LF5A 3R8FA 2WJGA 3NEYA 2PCLA 2ZRMA 2OHFA 4C30A 1CF4A 4DXAA 2X2FA 1ZUNB 1G7TA 4AYTA 4A82A 3BGWA 3FHCB 3FWYA 1R0ZA 2OLKA 1EFRA 2ZSDA 4FCTA 1P2VA 1T8UA 4UNPA 2DFKB 5CIQA 1FFHA 1VG9B 3LLMA 1MV5A 4M9ZA 1T0HB 2IF2A 2NGRA 1ZYUA 4Q18A 5C4MA 4X8OA 4B33A 3ZD7A 3KZ1E 1JEDA 1UBEA 2WJJA 1ZIPA 3BB4A 1M74A 2P5SA 2OXRA 1FL9A 1IONA 1XNJA 1COWA 2R2AA 1P62B 2ODBA 2QBYA 3DVLA 1KMHA 4M1TA 1MO3A 1U98A 2ZETA 2IEZA 4BLSA 4II7A 3WNCA 3FKSA 2A7QA 5FH9A 4Q9JA 2XTMA 3EWAA 1N5JA 1XX6A 4MITA 5H1YA 3SR0A 4YLGA 5IRCD 4ITRC 5L3SA 1E2KA 1E0SA 2GXQA 221PA 4PO8A 1QHSA 4CVNA 2WV9A 4I4LA 2QAJA 3TAHA 5JCZA 2ZRLA 1DAFA 3JVVA 2RHDA 4AKIA 4TQ9A 3B1VA 1Y63A 1U0LA 4DWJA 2NPIA 1J7KA 1KZGB 4HAWA 5L3VA 2ZUCA 2D2FA 5J40A 3L2OB 5CK4A 3RSLA 4IXNA 3U3JA 4UXIA 1E99A 2VQSA 1KDOA 2VBCA 1RVDA 2ZAMA 1R2QA 1G8PA 1S96A 4GNKA 4YXWA 5KYKA 2WM9B 2ANBA 3QXHA 3I5XA 1G291 4L5BA 1XJCA 2EFHB 1JEEA 1UBFA 3K9NA 4M53A 1OJLA 3IEVA 1SGWA 2ODEA 4U7DA 4Q4HB 1OFUX 1Q20A 2YWEA 1KY3A 2PZFA 3FPAA 3PEYA 4XVQA 3OEED 4AY2A 2WICA 4Q7MB 2HUPA 4M1WA 4LBWA 2ZXUA 3V4RA 1GRQA 1SKYE 5JEDA 4DUGD 1YR9A 5AJYA 4ZI3A 1N6NA 5FOUA 1N5LA 2QP3A 5SZKB 2ZUDA 1OB2A 1S1CA 4FIDA 4F38A 2C96A 5KSYA 2QE7D 1DE0A 1W1WA 4O3MA 2EWWA 1EFRD 4C2TA 2REXB 3U6KA 2FEMA 3JVUA 4QM6A 1U2RA 3REGA 4TN1A 4MYUA 3TSOA 3KFVA 4QBGB 1P3JA 2F1IA 2VA8A 3GLFA 1SHZA 3WYAA 1M2OB 2C78A 1A5TA 2YWGA 3K0AA 1FPMA 2J0SA 4A0RA 3GJ4A 3REFA 2EFCB 3ZH9B 4B34A 3VKGA 1H65A 3C4JA 3OE7D 1C9KA 3SBEA 4P31A 1P2UA 2PMDA 4PQFA 1DAMA 1X8LA 4PC7A 1Z28A 2G1KA 2Z0MA 1P4SA 4K81B 2ZE7A 4RD1A 2IYWA 3DPUA 3SJAA 3NVAA 4FCVA 2YNMA 1N6HA 4RKEA 3B78A 3VNUA 4B75A 3EPHA 2KBFA 4NP6A 4FMCF 3TBKA 2OFOA 1X1RA 3CF6R 4D0NA 1E1QD 4HUTA 4P4UA 5E4FA 4XIGS 8OHMA 2H8KA 3MFYA 1TUIA 2CL6X 4ARZA 2FU5C 4ACAA 3GJ8A 2JLWA 2XXAA 3K8YA 4ZO4A 1KK1A 3AVUA 2OG2A 1G64A 1NMYA 3EG5A 4AIIA 2JA1A 1XB2A 1DO2A 2F3TA 3P4XA 3LWNA 1UJ2A 1A1VA 3CR7A 3O8BA 1TF7A 3L0PA 1UKEA 2WSSD 2G83A 4GL2A 3E2IA 4QC2A 1VCOA 2P67A 3TNFA 1IXRC 2BIFA 2WKQA 2CBZA 2ZJ5A 5FPTA 5BYKA 4UQOA 4CF7A 1N6IA 1WA5A 1OSNA 2AD5A 3ADKA 4DRZA 1TQDA 1L8QA 1N0VC 5C4GB 3WNDA 1RYHA 5J4YA 1WMSA 5EE5B 5DHAA 1KI6A 1LV7A 4M4SA 4P3YA 1NIJA 4Z8XA 3TJZA 2G0TA 4JJZA 1W7AA 1IJFA 3GPLA 3GJ0A 4V0ME 3RRZA 4JLVA 1DARA 1YVDA 2WVJA 1A4RA 5FOTA 4M1KA 3AUXA 1CRPA 2ZSAA 2HV8A 4TMKA 1IHUA 3B1YA 4DUGA 1D2NA 2J0QA 5DH9A 4KVGA 2FSIA 4QBHA 1RE0A 5FI0B 2KWIA 3N5CA 1PUJA 3U2QA 4LBYA 3BXZA 5A5GA 4BEJA 4NDZA 4UJ5A 1C4OA 4BZXA 1NMZA 3ZJYA 3RVBA 3A1UA 4N0DA 4PZYA 1E1RA 1EWQA 1CR4A 4UNRA 3W6OA 3NDPA 2RGGA 5B30A 5JBQA 2OFXA 2O8EB 1XBTA 2H17A 2PX0A 2YV5A 3NHBA 4F4JA 2BJVA 2GJ9A 1GL9B 4Q00A 2O8DA 2NZJA 3KTAB 1AGRA 2CL7X 1E2JA 3Q9LA 4GOKA 4V0MA 4RJLA 2QTHA 1W4AA 3CZPA 3ASZA 1NKSA 3TW4A 4FWIB 2IHBA 5CB6A 3A1VA 3U6BA 1E2QA 1TMKA 5JCPA 5AUNB 1CRQA 1ZRHA 1XTSA 2VP4A 1CJKC 3KQLA 4RFSB 1JJ7A 2DB3A 1W36B 4D25A 1JXOA 4FMDB 3DOFA 4M8NE 4S2EA 3LD9A 1E2IA 2EU8A 3D6TB 2A3RA 4LV6A 2UZIR 1G4UR 2R6FA 2W58A 4MKFA 3GJXC 1N6KA 2QPTA 4R2IA 4F91B 5KNBA 3LO5A 5DYGA 4RKFA 2WAXA 3L8YA 3NKVA 1OIVA 4JBYA 1R10A 2YWHA 3QKSA 2NO7A 3PV0A 4KVAA 3EX7C 4OHZA 3RS7A 4JIMA 1F2UB 3NC0C 2Z5FA 5E95A 2GBLC 2IXGA 2OE2A 5TDHA 1GDDA 2O8CB 3CH4B 4BWYA 1ZM3A 1S3SA 3FMPB 2WPDA 2EYUA 1H8ED 2XSZD 2KB0A 2MSDB 1UBGA 2IT1A 2ZRBA 1XU4A 4G5GA 3VU9A 1F48A 2F6RA 3P27A 5LB2A 2GVZC 4ESHA 3D3QA 1R4AA 3SS8A 2O52A 1QHHA 1G4AE 1N5IA 4MRSA 1NN3A 3HYTA 2ZR0A 1GRNA 1TL7C 3GEHA 1ZD8A 1JAHA 2OXCA 3ADCA 3PR1A 4OJKA 2IA5A 4LJ4A 3P32A 3W6NA 2JLSA 3LXXA 1BO6A 1E2DA 2AKAB 4P4SA 3HPRA 2BMDA 2V7QA 3SQWA 3B9QA 4EPTA 3AH8A 2F43A 2W2XA 4ERNA 4HLUC 4GSYA 4KYIB 3FFAA 4TQUS 5F9HA
chains in the Genus database with same CATH superfamily
2XIJA 4ZT2A 1X7DA 1Q17A 2P3LA 3NOXA 3WK5A 3SJUA 2ZCJA 1TM5E 3IQZA 3UCEA 4JBIA 4BP8A 1ADFA 2GK7A 2XRZA 3I6MA 4BY9E 5CT9A 1F0YA 5FADA 4UEJA 1C8KA 2XZDA 2HK9A 4FXOA 4NMWA 4R7ZA 1CZKA 5TPWB 2OXIA 4A2PA 4OATA 3FJ1A 1G63A 2L0XA 4FSHA 4XARA 3B6ZA 4C05A 1KE1A 4OYRA 2NO5A 5BMVB 3JARA 3DO5A 4R84A 5T4HA 3KEGA 4CKEB 4FHDA 4L1KA 1Y6QA 3WGGA 3U4QA 4NBNA 3M9WA 2O6HA 3KYDA 4M6WA 1AK1A 1RWMA 4YK7A 2PK3A 1U28C 1XCMA 3ABZA 1UKVY 3KVRA 3U80A 4U7GA 2CV0A 1T13A 5FPYA 4C08A 1TKAA 4FZRA 3TOVA 2PH7A 4I50F 3KR0A 3BIXA 4FNOA 4H77A 2IDJA 5EMKA 2H1HA 1JLRA 4DNOA 4O25A 4DRXB 4PZAA 5B1YA 1QHEA 4J9UE 1H2XA 1HE4A 1JJBA 1H1TA 1U1IA 1XWIA 3EK2A 1RCFA 4EJ2A 5C81A 1Z15A 3G2PA 1MTZA 2QW1A 4I9GA 3LYAA 2RHOA 4FUQA 1UBHS 5DRTA 1PL7A 1KEVA 2NNLD 2AMFA 1GRRA 3C5HA 2I2FA 3GJSA 2JS7A 2QVCA 1HH4A 1PJ8A 2JBWA 2VDUE 2OTCA 3D0RA 1MPXA 3FCEA 4ND8B 4YRFA 5I5GA 4KRYA 1M34A 3ZK8A 3AB3A 3THYA 4FW9A 4CR7A 3NHZA 2R7AA 2A4MA 4KNVA 4CQLA 5LLSA 2GNPA 2XMGA 3GQVA 3Q7SA 3R5KA 3QLVC 5DNEA 3V6LA 5C51B 3IPLA 3AF1A 5CLHA 5KVCA 1Y6ZA 1Z0IA 2CFSA 5DBEX 5HUJA 3CZ4A 1DWOA 1GN8A 4YP5A 1SRQA 1BQ3A 2W2LA 5G1OA 2P90A 3E7WA 4M83A 2JKVA 2BMFA 5JATA 1T3LA 3QVSA 4O4JF 2JGJA 4Q9DA 3L6BA 4PAQA 1BE8A 4HAIA 3SZUA 4A8JC 2GZDA 1LBTA 2ZRPA 1EHIA 1IQPA 3K70C 4CUJA 4O2AB 3UJDA 5JHHB 4B6RA 1YS2X 1D2CA 1JS1X 2C4HA 2R68A 4R8LA 5JZMA 1W8IA 3L1UA 2VL7A 4JP5A 5CMLA 4YBRA 4QYXA 4DXDA 3DLIA 4Q02A 3HH8A 3N87A 5JY6A 3AUFA 5D2CA 2N0SA 3IUNA 2XYPA 3R0ZA 5I51A 1GXSB 5JPDA 2OLEA 3GK3A 4LBVA 5LKAA 4ZYWA 2H5IA 5LBTA 2FA9A 5CJJA 3UWMA 1CWUA 2AI1A 4NG4A 2QUZA 5CIYA 3C2QA 4XM1A 2ZE8A 4MVXA 1JSZA 1SG9A 5IANA 2A0KA 2ZRFA 4KQMA 3D1LA 1BU8A 2VWPA 4LJ6A 3VPBA 4DJAA 3IJEB 3WB0A 2CHEA 4DLXA 4ZAVA 1EM8B 2VAWA 2YYSA 2NOAA 3EZ9A 1VMDA 1WOYA 4K9DA 4RUKA 1B23P 3H6HA 3TK1A 3IQWA 3M1AA 3U17A 3UH1A 2VTBB 1RWPA 4BGUA 1U8UA 4YAWA 3SJ7A 4KQEA 4A6EA 5CFLA 3O4JA 4NBUA 2F3QA 4FFBB 3AL0C 1ORWA 1Q7EA 1SIUA 3ILSA 3AP3A 3IMFA 5F33A 2AFHB 4L3WA 1PL6A 3OFVA 1QIMA 1IATA 1MRZA 1V1MB 2VHVA 3BQNB 3CRVA 3CW9A 2H4XA 3HCPA 3Q7QA 5BURA 2C7RA 5DI3A 2FSHA 3WIDA 3OJEA 4LNAA 4BJ6A 3LZ6A 4JROA 2OP0A 4MV6A 2M6LA 3S2ZA 3ZWBA 2OWEA 1XQWA 3NDRA 1XZCA 3CMCO 3G2HA 5TQ0B 3MSXA 2K7ZA 2LKDA 1HI9A 4EVIA 4QT4A 1IVNA 1SQ6A 1USKA 2E3JA 3WMEA 5AW9A 3TDNA 5LB4A 1MLDA 1O5TA 4GOOD 1HL7A 3I04M 2BGGA 3U3RA 3AMVA 1P73A 4QPJC 4EITA 2I7VA 3ETLA 4AW9A 1O0SA 3ZZNA 3C98A 3ABQB 2VJDA 4B3CA 4OHXA 2GGSA 4ZCIA 1YJ5A 2A1TS 2D74A 1X1DA 1SXQA 3KL2A 2IH2A 3M0EA 4G63A 3T99A 3SE7A 4P4SB 4GF5A 5EKSA 5FWXA 1CY1A 1XD2A 4PPFA 1E5VA 5HWSA 1VG1A 3OPNA 5I01A 2XVAA 1AUOA 2PD6A 2NUTA 1MC5A 1C4XA 1Z8HA 1NA5A 3UAWA 1VSUA 4QFDA 4YP7A 2LZ0A 3SPXA 1Q92A 1EWKA 1SO8A 2H31A 5EQDA 4UTPA 1PEYA 1VL8A 1ISRA 2I62A 2ERXA 3AIMA 4OJQA 1KJZA 3GIDA 4QJ5A 1AUPA 4G0NA 3TW6A 2QTMA 1CFJA 3GQBA 4WWHA 3WV4A 3S2IA 3AEKB 2ZI7A 2AN1A 4MUHA 2I76A 4HNAB 2BISA 2HF8A 1MVOA 1ONOA 3VH4A 3K94A 1ID8A 1NJ5A 4L07A 2EYQA 3HLYA 2VHZA 4PZUA 1GNPA 1QHIA 1T91A 1EFPB 2DYKA 4AI6A 2PLFA 4E0BA 1TCBA 1FTQA 2NU9A 3PFCA 4D8WA 2FG7C 1JR4A 4MYTA 5A05A 5T4BA 3ZXYA 2ERCA 3KT3A 1G7CA 3WP0A 4ZQFA 1VMAA 2BV3A 4L4YA 3K53A 2HI0A 3DAYA 1QONA 3I30X 1QWOA 1EQAA 4INOA 4URFA 1JQKA 4OFWA 1ZGAA 5AOAA 2RIRA 5BNFA 4NOKA 4DSOA 2RH9B 1ULTA 1ZICA 1XAGA 1X38A 2B9VA 2FFJA 1ISGA 2Q2QA 4LZJA 4IF4A 3RUDA 2DBQA 5JC8A 3KX2A 2ISCA 4RCYA 5LP1A 1UKZA 2ORVA 2R8PA 3P5BA 1CKEA 4PYQA 1VJCA 2H4YA 2X23A 1JB9A 5TXGA 2R6R1 3B3AA 1CUIA 3LVRE 2B34A 4IKPA 3UNXA 2BGKA 2RHJA 4DQXA 3QEAZ 4HFMA 3EIEA 4X3OA 1TQ6A 1D1QA 3DOEA 1T9KA 4U2DA 5K3DA 3BXXA 3GRVA 2JLXA 1KI6B 4D46A 4GXNA 1OOEA 2QORA 1X9GA 1C4WA 1JG2A 3AM5A 4X61A 1XQ1A 5GJWC 4F3NA 4Y8VA 5DK4A 2NQTA 3RVRA 2GT1A 4NDAA 3H11A 4PYOA 3ZOKA 1VKJA 1AZWA 1AO3A 2FFBA 1WMDA 3F9RA 2E49A 4U2BA 3MT9A 2XNCA 1PD0A 3NB0A 1VMEA 5JAPA 1N6LA 2PSJA 2PYDA 1H6BA 2IOFA 2C1ZA 4G8BA 1DRWA 1SXJD 3FYUC 4IDCA 1U04A 4MQMA 4WJZA 3UJ9A 3RBXA 3VYTB 5LOVA 3R9WA 3PGKA 3RLIA 1I7SB 1TAGA 2WNSA 4B8ZA 1OZAA 3GBPA 3HHPA 3BB1A 4PX2A 1TADA 4AKEA 2GZRA 3FDXA 1WHSB 2J6IA 5EKDA 3RWBA 2D4HA 1WLSA 2H57A 4PWYA 3OJ0A 4CM8A 3VO1A 4ZEMA 4IOKA 4GZ3A 1KMQA 4IEIA 4DNFA 3WV5A 4LYJA 1GLNA 4QHYA 4B47A 4PYIA 2GAAA 1RXVA 3ONWA 4BASA 4BQRA 3B38A 1Q0RA 2GSDA 3A9CA 3QKSB 4IVRA 4RACA 3TL3A 4PAGA 3KJNA 4DG9A 2J9XB 3HNRA 4G5HA 4K8OA 2GPWA 1NATA 2HA4A 4PU0A 1CUCA 4X64B 4NJEB 4A0GA 1CULC 2H9IA 1Z0SA 2PBRA 2RI0A 5ED0A 5HEKA 3R7WA 3W3AH 4CLRB 1P60A 1F2TB 1KTVA 2JARA 1M6VA 1GADO 1FTNA 2DOKA 2X9QA 2X3UA 2BFAA 2PX5A 4CR8A 4OD0A 4CETA 2GDJA 1W5EA 2H7YA 3DO8A 4EBFA 2C3UA 2ACKA 2J3IA 3HB9A 1UOPA 4ZVNA 3DPIA 3K2QA 1KTIA 2P9HA 2NUTB 1BZYA 1RHRA 3A9UA 4HAUA 3IVXA 3K09A 3TNYA 4CCSA 4DCMA 1KYWA 2R6ZA 3GG9A 3L4BA 1IBKB 3SQNA 2OZVA 2Z6UA 1EMDA 1XDWA 4P33A 3C7TA 5IM5A 2OLJA 3RS2A 3A1FA 2F48A 2FH5B 2ZJFA 3K5PA 3KAPA 5DN9A 1J0BA 2HA7A 2X4GA 4TWIA 3QOXA 2ODWA 3MWDA 1K8XB 3FTFA 5B1IA 3QOFA 1V5GA 3O2NA 2BM9A 5D1HA 2D0IA 3NFRA 5EWJB 1J8MF 3DLTA 1E9CA 2UDPA 4FMCB 2PQMA 1E2HA 2XJ9A 4HZUA 4EKDA 5BWBA 4D0SA 1P19A 5AJTA 4CDNA 4GRDA 4YACA 3NBMA 2NNWB 3IHTA 1PLKA 1KNQA 2WM3A 4FU0A 4KO3S 3ND8A 1RPAA 4RK6A 3G2MA 3LC1O 2YS6A 4JJ4A 1OLXA 2P9ZA 1Y3HA 4IDPA 1U3UA 4L8GA 4B71A 3LTNC 1GSOA 3CUUA 4N7JA 5E6RB 4BV3A 1C5KA 3A9SA 3QNMA 1DQPA 3PDUA 1E9RA 5JCXA 5IWAB 5K3CA 4M46A 4CDGA 3LF2A 4NVRA 1RXIA 2E6UX 3R7NA 3EQZA 3WZMA 4ZQEA 4DMLA 2WTAA 1YNSA 2I1QA 2JGNA 3CQ9A 1CBUA 2AFHE 2IPNA 3IAXA 4HUQB 4M7OA 3IKVA 4YYEA 2Z8YM 4WBNA 1BS9A 5FNVF 2FDCA 3FYUA 4MPRA 4FFOA 1BX1A 1GG2A 2YHSA 3TL2A 1Z5ZA 3VZSA 1WWKA 2AG8A 1SKQA 1W1UA 3WQQA 4XPIB 2C2ZA 3QX8A 3ACBA 5CYGA 2F3UA 3SF0A 2HSDA 3HP1A 2XQFA 2EX1A 3U26A 4N8DA 5JYDA 4PICA 2OB2A 5CDFE 4BYMA 3GJTA 2AFIB 1NVEA 5TEWA 1BNCA 3N8HA 4GXQA 3VGPA 1WSWA 2PJRA 5AESA 5CLLA 4JC8A 3WA6A 1MAUA 4E88A 1WO8A 2WOOA 4WN9A 2P2NA 1U8XX 1Y3FE 3PPXA 4E1AA 4EUNA 4NNPA 5LQDA 1XZPA 2FYTA 1E66A 3MTBA 1C1YA 1KSGA 3H2ZA 4JLUA 4WCFC 5FPPA 3ZS8A 1LZLA 4EEKA 4RU1A 4YRZA 2PVSA 3AVWA 3GN1A 2V9PA 1E92A 1F4PA 4J8PA 2D00A 3H5TA 4DR7B 2XEDA 2BEVB 5CDSA 4RTRA 1N7GA 2H5LA 3QTTA 4IMPA 3W6PA 2DPLA 5CGQB 5MFZA 1KNXA 3B52X 2DH5A 5FB3A 2JGRA 3PYLA 1RWQA 3BWXA 2D1QA 3B1KA 1DKRA 3JAMA 4B3IA 1MQAA 3D1JA 1T0JB 2ZUBA 2QP9X 5JASA 1N2JA 3GCWA 3ESRA 1RAFA 3T5BA 2O5CA 3BS4A 3HCFA 4J2OA 5JIBA 3WZLA 4WNAA 2O0LA 1JDNA 4DKXA 5HW0A 3LX8A 1KZHA 5ED4A 4Z5XA 4W5OA 2YWFA 2X8WA 3BHIA 3BUSA 2GSWA 3F7MA 4W8GA 5KCMA 2X1LA 5F4BA 1JBEA 1EUDB 1P6XA 4HN9A 3V34A 1KMMA 4ZVOA 3LBIA 1E3QA 4QODA 5BQPA 1U63A 4ZIRA 1JGTA 4LVCA 1N32B 5CBKA 4XE5A 3U4HA 3GL9A 2Q1SA 1W5FA 4M8LA 5IFLA 5B55A 3SIRA 5HIIA 1B8NA 1SR8A 3OX4A 4YCNA 4QXQA 4E11A 3ZY4A 1GXSA 5TARA 3HJFA 1IN4A 3A32A 3NVDA 3SYLA 2AXPA 5HZMA 4M49A 1E58A 2EEZA 3WRYC 1AKQA 1TUBB 4PNZA 1GV1A 1GG9A 2WU0A 2VSOA 4ZVTA 4EF4A 5JALA 1KPGA 3CZCA 1PJRA 5I7UA 2DR2A 1P2GA 1A77A 2C5FA 2GRUA 3GEEA 3HVUA 1E5TA 2FR1A 1JZQA 1YASA 4KVZA 5J4HA 2H1IA 3U5TA 1DAPA 2GHTA 2XA2A 3AFIA 2WSSA 4IDQA 4OXKA 4ZI7B 4N39A 4FMDF 3COSA 3E0QA 4L51A 3CO0S 2XI4A 3PQEA 1YWGO 5ICGA 2ERYA 4YRIA 1DTWB 4UDYX 4AKGA 1Z0UA 3MELA 4G1MB 3TOZA 3WI7A 1IN7A 3F6BX 4K7JA 5LP6B 4ILEA 3D7SA 1U9YA 4KQWA 4C0SA 4OHPA 1KH1A 3VKHA 4KAAA 3WL3A 5C35A 1LDNA 3M6IA 3SDZA 4O1MA 4DBLE 1BCSA 2CV1A 4QG3A 1FMJA 1OBFO 4HEJA 4N5IX 2YYAA 5CA0A 2YIDA 2JK1A 3HLTA 4PGHA 4S1OA 4E2XA 4F96A 2Q5JA 3HG7A 2ZIXB 5FPSA 3JQ7B 2C92A 3U3ZA 2YASA 2IJGX 4E5YA 3A6ZA 5B3JC 5J4KA 3Q3CA 2ZM5A 1TU0A 1O03A 1WSBA 2VPYA 4NAVA 1KC1A 3DD5A 1BROA 2W8BB 4E7PA 1OFTA 2BHRA 4ZHQA 2A0UA 2EQ5A 1J0EA 5FL3A 2FPGA 2WKPA 2ZRNA 3LH5A 3PFGA 1CS4C 5BWOA 1L4MA 3RSZA 1EGQA 4L9AA 4B40A 1TXGA 4V0SA 2BSQA 4BO0A 2I4IA 2HL6A 1ISMA 1X92A 2Z9CA 4UNQA 3NW9A 1GZDA 3T15A 5IVPA 1YZLA 2LR0A 3RU9A 4XWAA 1PK8A 3E35A 4MVJA 4EKGA 2ZU6A 2IKSA 2VNSA 1TT5B 4U7JA 4NECA 4UOQA 3GVPA 2XDQB 3MQFA 4FN4A 3PWKA 2TRSB 3ZZ1A 1PV2A 1SXIA 4LVOA 1XTRA 3VQTA 3WJAA 3EIXA 2CFRA 2VBFA 5H83A 4XR4A 4CV2A 5DM2A 4DIMA 3F9CA 4F1KA 3WBBA 4U3JA 4D3YA 3RSGA 3M5CA 5BVGA 1ZL2A 3D4PA 1I2BA 3EF0A 2VJQA 1M6YA 3G5UA 1R5OA 3SMVA 1QH9A 1SZDA 1EAMA 3F74A 2ZI3A 2ZW9A 2FJUA 5FHRA 1EFPA 1FVHA 1RLTA 3DF7A 3QVGB 1NQVA 4E22A 5IG2A 4ZVSA 4N9QA 3ZTWA 3SYTA 5FUYA 4XVCA 3C3WA 1XALA 3HU3A 4PZZA 3STHA 3OZIA 4Z1MD 1QQTA 4MTLA 3EF1A 4OI2A 4LRUA 3OHMA 4QSMA 1F7UA 2VJYA 3VMFA 1MNQA 4DB4A 4R8MA 2Q2WA 4DT1A 1ETUA 3HKDB 3WWPA 4GL4A 1CDZA 1JB1A 3RYTC 3E7XA 2DF8A 5F5NA 5HJ7A 2HPVA 3GN2A 1QYRA 2QTVA 1M6EX 1XWWA 1V2HE 4WZBA 3VPCA 4WADA 4WE3A 2FX3A 2M9MA 1VBKA 3L7MA 4DIKA 3ISJA 3KSZO 1E89A 1SU7A 1MORA 4LHYA 4RHXA 1FFXB 5C7OO 5CW1A 4IUYA 3AR9A 3PNBA 5DCLA 3ELBA 2GN0A 3I58A 1Z07A 2ODTX 1T4GA 2CE2X 1G5HA 3TTWA 4H7DA 3VR1A 2QD2A 2FEOA 4G67A 2ZIWB 2ZKLA 4YJHA 3DE4X 1Y6RA 4KTTE 5D1NA 4O4LB 4PXYA 3WA7A 1QV6A 2KYRA 4BMOB 2YJ6A 5TJ9A 4BTVA 2QVYX 1TCCA 2A2ZA 1XZAA 1MJ5A 3WLSA 4NBSA 5I7FA 4MEAA 1EQ2A 4HMQA 4YPOA 3QVTA 4FLFA 3P20A 3P8ZA 3LBYA 4L4XA 3WJ2A 4FGWA 3WMXA 5FUMA 1B0AA 1IYZA 1HF3A 5LPNA 4GPZA 4EZBA 1ZKMA 1Z5VA 3OZTA 3TCNA 1E4EB 4BV2A 2COUA 2CEAA 3FLAA 4J0FA 3FVQA 3HJAA 3ZGYA 4MYDA 4EL0A 3GB9A 3OLVA 1J9ZA 3UCFA 3GAAA 2GHIA 3UVEA 4OQLA 2JEOA 3FPSA 2OCXA 4UUBA 5LA6F 1OWLA 1ATZA 1CY6A 1H6DA 3PPVA 4HB3A 5THKA 3NG1A 4XXHA 5JPIA 3JD3A 5EZ6B 3AR4A 5G2OA 4QUDA 3A4NA 1Q6YA 4OXYA 1CR6A 3DL0A 5G41A 1DXHA 4XWYA 1T2UA 1LBQA 1FFWA 2OP1A 5CVUA 4KP7A 2ZUTA 1P1IA 3R3XA 4JL8A 9LDTA 3GLIE 2P2YA 3I9NA 4UNIA 1RQGA 3EIHA 1JIJA 2ZI4A 4G1EB 3RTAA 1NZDA 2I55A 2IU4A 1LSJA 2FUNB 4BRWA 4CN8A 6YASA 2WLTA 3LY5A 1MW9X 1NLUA 2YJ4A 4X1OA 3VUEA 4N3AA 1ZCBA 4S0ZA 1COZA 2VEDA 5ENZA 4D9KA 1GPWB 2OCIA 2OAQ1 3ME5A 1KS2A 3B3FA 3D43A 1CDEA 4G36A 2FW8A 3F96A 3DZFA 3RVJA 5BPHA 3PQ7A 5KVAA 2AOTB 3G68A 1V25A 3DQPA 4K8RB 1QAQA 3EA4A 3FYTA 1Q1ZA 2CXRA 4BV9A 4DA9A 5IM4A 4MDYA 2JC3A 1F2UA 2GH1A 3EG9B 4LJYA 3G89A 4JNCA 2PS0A 2R8XA 2VSNA 3Q0TA 4Y0AA 4HVTA 1VE9A 1QQAA 2YIVX 5DULA 2Z30A 4K86A 4X3PA 3G5LA 1W47A 1QS0A 2YNMC 3KZCA 3QKWA 4S1VA 5IAGA 5D3MB 4RNDB 4KAXA 2D59A 3EGVA 4R1NA 1DJLA 1H0RA 4LEIA 2Y67A 4IX1A 4TN5A 5K4GA 3WLIA 2VYQA 1L1EA 3KJIA 1U9CA 4DJDC 3LI2A 3TX6A 1VHTA 3IEUA 4GH5A 4FDTA 4I66A 4R0MA 4V1CI 4PHTA 1ULHA 2PSSA 2HT1A 1H2HA 1UAAA 5G1PA 4YEDA 5SYAA 2Y6UA 2BPOA 3MC1A 4J43A 1RXYA 3OOYA 3VJKA 1L7MA 4PPNA 5LUBA 2P8JA 1C41A 1S0UA 4X20A 5BUQA 1QPGA 2ICAA 2F2TA 3EMDA 4JR0A 2ZSUA 2GZAA 1IMOA 3QRWA 4XCQA 5E4YA 5JAOA 3HGTA 2ZAOA 2V6FA 3AGPA 3KBOA 3OZBA 4IDHA 3SCZA 2IV7A 2EKQA 3V4FA 4QGSA 1UPTA 4PSUA 2PFKA 3GD7A 4ARSA 2NN3C 4CNQA 2ONZA 3OX1A 3R5FA 4Z3OA 2C2YA 2R6CA 3FTCA 5HA5A 4HDRB 1KXJA 1KOFA 4WXHA 4L3VA 2QJRA 3DJYA 3F8WA 4LRWA 1RRPA 2F62A 3ZI4A 5GJCA 1UQUA 1YRAA 4LYHA 3EZYA 4NI5A 3PNPA 3QYJA 4Q3EA 3RE1A 3TXYA 4BNZA 1X6VA 3ZJUA 2DKNA 1M7BA 1J8VA 1RJ9A 3LT0A 3HKBB 4ZTZB 4LJ8A 3BDIA 4G1UC 1QBKC 4NFSA 4P0TA 3HCDA 2ILVA 3E3MA 4P4GA 4B3JA 5FKJA 1JAIA 3M70A 3QE2A 4GMHA 5L6MB 1UJ6A 3TIXB 5BQOA 1AKWA 3U9LA 1ZMXA 4L50A 5JY1A 5L9AA 2X0RA 2I99A 1FLAA 1RZ3A 4BNFA 3IP5A 1II0A 3MUEA 2Z9DA 4UC0A 3TJMA 3ZU2A 2PWBA 4D6YA 3CF2A 4QM7A 3CRRA 1GUBA 2OHOA 5KYGA 2I78A 3FG9A 2VQEB 4L85A 1FX0A 2PLRA 1BN6A 5GM1A 1MABA 1NW4A 4QATA 2IP4A 2PWYA 1T43A 1UJ5A 1XHEA 1V41E 2JIRA 3Q7TA 4PSVA 5EA2A 4LWZA 5ALDA 1BA2A 4INAA 2OESA 1L7AA 4NHEA 2RG7A 3LLVA 3N2IA 2H5EA 4BP9A 5AIBA 2JL1A 2XA1A 2JVKA 1NSFA 4CRWB 2HLDD 2VCHA 3C4VA 3G0GA 4MKRA 2C5HA 3ZCSA 3FDZB 1VPEA 4BN5A 3RV4A 3ROEA 4IP0A 2HCRA 4G1FA 3W8RA 1JFRA 4TWAA 3P2KA 1O3YA 2Q3HA 1GKIA 1P2BA 2QMZA 5FORA 1EESA 1W94A 2TMGA 3DAOA 1HXHA 2RC6A 2QQEA 2Y4NA 3ND9A 1KU0A 3LXRA 4RFLA 1G7SA 4ZVQA 4FDUA 1M5RA 3VTAA 3MCVA 1ZCZA 3PJFA 1CVIA 4BQNA 3B2NA 4G5FA 2NXNA 4YECA 2QENA 4XIFA 3K6SA 3QGMA 4A5SA 4PN7A 1N1GA 5HM6A 2HJ9A 4Q01A 2MYTA 1Y1QA 2MR5A 3BA1A 3QPAA 4MX8A 4GM1A 4YRLA 3CNEA 1O57A 3V8NA 5I9NA 4LF6B 3JQAB 3O9MA 3PDIB 5I5EA 1PUXA 4EAAA 4QOIA 3PC6A 2UKDA 2WYOA 2EKDA 3ANXA 4ETIA 5CYPA 5I8PA 2GN8A 4XTRA 1NSYA 2ESRA 1L4BA 4FGUA 3D6NB 3MHPA 1ZH2A 2FDRA 4BRZA 2JJ8A 2QG4A 1NURA 3D6JA 4J7CA 2WP8J 4JJAA 3F46A 4JK3A 2VYVA 1ZITA 1BS2A 4HTFA 4AZVA 3UK0A 2HMVA 5MDHA 4OPMA 1KAQA 1WP4A 5EWMB 2OPHA 3BFVA 3EA5A 5G0UA 5DNDA 3T7RA 2EBFX 3KPJA 4UPEA 2AMYA 3K7EA 1Z0FA 2VYVD 2R4UA 4MIKA 2XZLA 2B7LA 2Q6OA 4IS2A 1A7KA 1OXSC 1P75A 2GZMA 1PGPA 4H15A 4OG2A 5FBRB 4EQ6A 2I6SA 4AP5A 4FHFA 1LJUA 3VH1A 1V3QE 1F2DA 4AUNA 5FV4A 4Q19A 1BJRE 3I5UA 1Y42X 2NYAA 1WXWA 4E46A 3CVWA 2J7PA 4UZSA 5JI3E 4HQ0A 4URYR 4ZGBA 5GZ3A 3O47A 1LVHA 3AL3A 4OMFG 5LZ9A 1T9HA 4A0QA 2XE7A 1CQIA 3K9QO 3S8MA 4ZGGA 1Q84A 1C0LA 3G7UA 3AZPA 1F2VA 4OHRA 3SHVA 5JU6A 3U7GA 1R6BX 4M76B 1ZOIA 2VJCA 1LY1A 5K8VA 4LTMA 2JAHA 4MUEA 4V0QA 3NV9A 1C3OA 2O7RA 1DX6A 4RS4A 3TQRA 1UK8A 2FZLA 3PRYA 4RTQA 2NWQA 1A8IA 1G66A 3NTXA 1QFMA 4RE6A 4TMTA 1H3FA 1I01A 3BB3A 4LGYA 3LIPA 3BE4A 4Q1DA 2H2WA 2Q3LA 2Q6LA 3R3UA 4LZAA 4TVBA 3DKPA 1QH1B 4YCJA 4BFSA 4DM4A 1FQKA 3A9WA 2DQZA 3BHMA 3TN7A 3WGMA 5A3QA 2BCGY 4HATA 4OGKA 5JSUA 4NDNE 3DV9A 1Y82A 5KDLA 2XCSB 9ATCA 1C30A 2HTEA 4MWSA 2XQKA 2X0NA 5DTEA 3DLBA 3X0DA 4XEHA 3K2EA 2ODPA 2E9SA 1FQOA 4LY0A 4U7PB 4CT5A 1VIAA 1QCYA 4LHSA 3O4IA 4OMDA 4TV8B 3WGIA 1P0PA 4HS4A 3GDOA 3CZRA 4HWOA 3ECAA 5IPFA 5M3BA 4M0LA 3AX6A 1PL0A 4PX9A 2JVJA 2WQ7A 3H2JA 3GLGE 1V35A 2HUNA 2AN3A 5LXTA 4YJGA 2P9FA 2J30A 4P5DA 1U3GA 5JAQA 3KWMA 1NU8A 4ID9A 5H5JA 1G2QA 4GPTA 1MU0A 4IZOA 4ZO7A 4LF5B 1H5UA 4F5WA 2BFDB 2ZK7A 3RU3A 3GRAA 1MP0A 3JASA 3OIDA 3EPKA 1M34E 2WD9A 2VQ6A 1EI9A 1VKZA 2EL7A 3IHWA 3Q5EA 1GGMA 2VBGA 1G8GA 1ZMOA 2VAXA 4YMGA 1GA4A 2AKYA 5GVRA 3ZH2A 3COJA 3IP1A 1SVNA 1XOIA 4NULA 4C5BA 4EHJA 4DR4B 1SXJE 3NAZA 3MIZA 5CNKA 3VX4A 2O7NA 4AB1A 1WMAA 1M7GA 3L1KA 2M6RA 2Q99A 3N2LA 3WSTA 4EHAA 3HM9A 3AV0B 3UICA 1XNQB 5AW0A 3TKLA 5KNDH 2VHJA 2W2VA 2XEXA 4OJYA 3MS2A 3TIVA 1J42A 3GPIA 3QH4A 3W9BA 3IA7A 2WWGA 2VHCA 2X1VA 3L8GA 4YNBA 2ZJAA 4PAWA 4EG4A 4YVFA 1ONPA 1A8UA 2VAMA 3IUEA 4KREA 3BHNA 3P52A 3R5XA 4I5FA 4LIPD 3H7IA 3FCSB 3SC2B 3TINA 4WA7A 1Z13A 5JADA 4C3UA 3THSA 1WZNA 3LCUA 4RIIA 2O59A 1VHWA 2DHRA 1KVSA 3MT7A 4R0NA 4Y9TA 2H5JA 4UKDA 4AF7A 4EYSA 2OD9A 2JEYA 3INNA 1E32A 3B1XA 3PUKA 4ZMBA 2QL7A 1SB9A 1ZEMA 1K8RA 2XA9A 1P7WA 2OZPA 2GCOA 2B99A 2NUAA 3KR2A 1P6UA 4HDQB 3VR3A 4BJHB 1DB3A 3LY8A 4DLPA 1DDIA 5EWMA 3JZDA 1QX3A 2FWBA 2ZPTX 4RA9A 4LKOA 1JQAA 4RY8A 1Q1QA 2QHXA 5FUBA 2HMAA 3W1EA 1HQDA 4QTZA 2CNLA 2IBSA 1YUBA 3P2IA 4C03A 1K3FA 1TMGE 1X19A 2AEFA 3SSOA 3GUHA 3H17A 5CB4B 1EDDA 3KOWA 5JS8A 1E0JA 4ARBA 2V8BA 4J7UA 2I91A 1UAYA 2WG0A 1XRPA 1BFDA 3IDQA 4S24A 3UK2A 4F8EA 1VPVA 2PXXA 3JWGA 2GTIA 3GJRA 1CYEA 3RLFA 5CM9C 4Q12A 4MQEA 3CLHA 4QOSA 5B1HA 2XYQA 4F6RB 2XCUA 3G7SA 1RWVA 4J1SA 1JJVA 1T34A 2P6OA 1SUAA 4O4JA 1QZXA 5EXPA 3TEMA 2ZVDA 3JAKB 5EKUA 5K0NA 3ITNA 1ACMA 2XT9A 2G4CA 4FTWA 4XFKA 3IDZA 5IVKA 1WZ2A 3W1WA 2R6GA 2XAUA 2CMFA 1J56A 1GFWA 2PIDA 2W22A 2Z8YA 3DMNA 2VHUA 3LC2O 4GYWA 2IZ6A 5H82A 2GVDC 3TB4A 3KSRA 2Q9BA 1Y9AA 2CCKA 3DZHA 1UMDB 2YMPA 2OZLB 3VJLA 4PHGA 1I14A 3L8MA 1GUZA 1HL3A 3T1VA 3ZOZA 3DXZA 3OZEA 3OEEA 4O1IA 3BCRA 3WO0A 4JT9A 4TWZA 1LV8A 4KXWA 3GLFB 3FWHA 5HGXA 1X7ZA 3DEFA 1S6YA 3B8HA 4COKA 4S04A 3RR2A 1U8ZA 1YDWA 1GCAA 3DXYA 5HGJA 2CCJA 2QM3A 4CCYA 5BSTA 1IQ0A 3KJGA 3DP7A 3OCZA 3I32A 5FI3A 1SOUA 3DLAA 2COEA 1EM8A 5GJVC 5UKDA 4JC0A 3OPQA 1AKMA 3D54D 1ZMBA 2H9AA 1VB3A 1FSSA 1YOVB 2O3SA 1CJTC 3FX2A 3TTUA 3UIEA 2I8AA 2BRUA 5EP3A 3G5TA 4MQUA 1QIKA 4V3CA 3M5DA 2BFDA 3COWA 4O1HA 3EN0A 1FRQA 4BFXA 3BTSA 3ZE8A 4CNBA 1EXDA 1ML4A 4KDFA 2CXHA 1IDN1 3H16A 3EVCA 4WEQA 3SF8A 4JMLA 2P4HX 4Z6KA 3BF8A 1QE3A 2PMWB 1S3FA 1BE1A 2XTAA 5T8KC 3E23A 2G9NA 2PWPA 2VDWA 3K0CC 3ETDA 3P94A 5DT2A 4KACA 3V7UA 4EHKA 1Z6AA 1GUAA 2PS9A 1Z62A 3JQ8A 5GGYA 3WHLA 5A3RA 3K20A 2YR0A 5HF5A 4WHMA 3CB4A 5E3JA 1BU5A 3TVTA 4XQCA 1IL0A 2H2HA 2EARA 2EJBA 2W2NA 1W0KA 5AVYA 3IV7A 3LBFA 3ELDA 4RETA 3NQ41 1OZ0A 2EV9A 4LZLA 4IXWA 4W5HA 3UPUA 1WABA 3ZVKA 1NR1A 4MINA 1QOZA 2BZSA 3OFJA 1QB7A 1NPDA 1NWCA 2DFPA 4LRSB 3GLUA 3CSUA 4JYMA 4CODB 3VRHA 3ZHUA 2BM1A 3TQOA 4EB6B 2Z6AA 1KBZA 2A9PA 3BFKA 2PX8A 2ZWIA 1VHJA 4Z9XA 4B4WA 4PG8A 5KU7A 4P0PB 4DLUA 3CPEA 4Q9AA 4B09A 3NBZC 3HRHA 1DCTA 3D3EA 4CL2A 1N2EA 1FNSA 2PGOA 3LC0A 2G4LA 3QYFA 4MW6A 3OUUA 4KOEC 3UWSA 1Y7HA 1W2GA 3F6CA 3RC2A 1EX6A 1YQXA 2HPHA 3AI7A 5JCJD 2SKCA 1WP9A 1TCUA 1Q19A 3ZU3A 4C4PA 4L9RA 1IM5A 2Z09A 1EHCA 3NOVA 5LDHA 1EZZA 3PUIA 3WMRA 3SQLA 1Q7TA 4OK6A 3TI9A 3RU2A 1U81A 4NCHA 3U3MA 2F64A 2R1ZA 3L4KA 1NPYA 2GZHA 2E4UA 3AOGA 5FHQA 3RFVA 4EY4A 2PR2A 3JVEA 1P3DA 3E53A 3STUA 5LMNB 1DEHA 1LPPA 4IIJF 5AW2A 3HBAA 2WY2D 3NETA 1T4BA 2DECA 2BF4A 1PR9A 1E9VA 2XQJA 3CVJA 3HA3A 3OPMA 1D2EA 4FFNA 1XMIA 1RP7A 3LQFA 1L4NA 4KB5A 4M88A 9GPBA 2VK2A 1VXOA 2D5BA 2WSLA 3ZE2B 4C22A 1XPUA 4RD2A 5A1TA 4MR7A 1H0KA 5EKTA 3TRKA 3F90A 1Y8AA 2GQ0A 2V7BA 3A3YA 3SM9A 4FB5A 5JW6A 2HW8A 2AG6A 1V3TA 1WZUA 4GM0A 4TV9F 4CTJA 1O54A 4BRSA 2X7JA 3D7LA 3MCUA 5FOQA 5FX2A 2BUBA 3PXGA 3CH6A 3SLRA 1MUUA 3CKLA 2LIVA 2C8KA 1RKUA 1M8KA 1P2SA 3PTLA 1TZJA 3BM5A 4BVHA 4D98A 1DCMA 1TOAA 4AD8A 2PV7A 1C3XA 2Q8PA 5I47A 3IPXA 2C2MA 1EIZA 4FFVA 3SMQA 3EXG2 1H23A 2Q1YA 4QD3A 3H5OA 1E3SA 4KMRA 4F9FA 3A1EA 2RGNC 3U7EB 1D09A 4BFZA 3PCTA 1Y4SA 3L07A 5LSAA 3RWOA 3STYA 5ALHA 2IOQA 2YWRA 3HU5A 3I2GA 1MVLA 1DQSA 4RTSA 4NH0A 1WDMA 1J1ZA 4OQPA 4DILA 3ER8A 1FSFA 1PT8A 4NHOA 3S2EA 3A0UA 1RJWA 2HH9A 4M0KA 1X8XA 3RT9A 1G8FA 4B44A 4MJLA 4UU7A 3OPYB 5CCDA 1OKKD 4ZO8A 1ZRMA 4Y6GB 5IXSA 4AJLA 3KQUA 1IMJA 4J0IA 2ZJOA 5H16A 2UXBB 1AS2A 4IXTA 4MKXA 4EIWA 3DH0A 4LGVA 1GSHA 2H8GA 1GQSA 4PBSA 1FNNA 3BC1A 4XLTA 4UHEA 4D9EA 2XAAA 3WJ7A 3ZGVA 1GARA 1NRWA 1TO1E 3QQPA 4BMYA 1W25A 2VYND 5LR6A 1QPZA 4C6HA 2V6BA 2J3EA 2EKBA 1M1YA 4BO6A 4ID3A 3ZNQA 3ZTYA 2V4MA 3RBVA 2ENWA 3G9ZA 3I42A 2IGBA 2QAIA 4KIFA 5L4SA 4HT3B 1K98A 3NOOA 4Z9FA 1FMLA 3NYQA 4IDNA 4JKYA 4P7FA 4Z7OB 1GNRA 4NYMQ 5JDCC 3WIUA 1M6HA 4DT1B 2DTEA 3P9RA 2H2FA 3P4YA 4OY3A 4PTYA 1JLHA 3RT1A 3BQMB 5B58C 3ND6A 5KSOA 1J6UA 1A9XB 4L78A 4JOCA 421PA 3MWGA 4BX2A 3PC4A 4FDAA 2PX4A 5ITWA 3AW8A 3OI7A 3FTQA 2DT8A 4GXRA 2HQBA 1XVAA 4NSNA 4ZARA 3T1NA