1AKHA

Mat a1/alpha2/dna ternary complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
49
structure length
49
Chain Sequence
b'ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 19
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhA00
1MBKA 2XGDA 1ZQ3P 2XGCA 3HOXJ 2E19A 1BJZA 4BBSJ 1G2HA 1MBEA 3NAUA 3A03A 5E3OA 2YUSA 3TP0A 2MG4A 4C2MJ 1W0TA 4QIWN 1X2NA 4CYCA 2DA6A 3A01A 5EZHA 1JTYA 1K83J 3WHBA 3S14J 1BW6A 3PM1A 2IAIA 4A3IJ 5M5YJ 2FD5A 2RAEA 1HCRA 1P7JA 2GLOA 2ZB9A 4QTRA 3BG5A 2CU7A 3CQZJ 5EYRA 4A93J 3M3YJ 1FEXA 5EG0A 1ZR2A 1B72B 2YS9A 3IV5A 5FJ8J 2EH3A 2L7MP 1T56A 1MBHA 4D7MA 3TW6A 5M5WJ 5K7FA 1NK2P 4FCYA 2M2EA 3BQZA 5F08A 5IYCJ 2E2HJ 2LY9A 3TW7A 2MGQA 1MSFC 3K7AJ 2ME6A 3LNQA 1UG2A 4M3FA 4V2FA 4IHYA 4AYBN 2L0KA 2JK3A 2XB5A 1TC3C 4M3DA 2NS7A 5FLVA 1HDPA 2N8GA 2O7OA 5HODA 2JA6J 1IC8A 3Q3SA 4EEFG 3GBGA 3D1NI 2R7ZJ 1A6IA 1I50J 3M4OJ 1MBFA 3GTLJ 2WAQN 2KT0A 2HYJA 2L7FP 3JRIA 4D5CA 4S0HB 2LTPA 1H89C 3ZQCA 2R5YA 4JYKA 1NK3P 3HOZJ 5IYDJ 2EZHA 2CUFA 3B6CA 1QVUA 3S16J 1Z77A 1JT6A 3BR0A 5M3FJ 2Y31A 3HDDA 1WPKA 3DCFA 3F0CA 2FJ1A 4UUSB 2KDZA 1JTXA 2EZLA 2R5ZA 4BXXJ 1H8AC 2XRLA 3BG3A 1DU0A 1PUFB 4M6VA 1RESA 1VI0A 1UHSA 2DMUA 2CRGA 2HOAA 1BL0A 1YRNA 4FTHA 1MBJA 3S17J 3SJMA 2X6OA 3LSJA 4Y7NJ 1OCPA 4NDLA 2EZIA 2CQQA 2XB0X 2DJNA 2FQ4A 3PO2J 2IEKA 3HOVJ 1ETOA 3OOUA 2X9DA 1Y1VJ 5IP7J 1POGA 1MSEC 3LSGA 1T33A 2M0CA 2HXIA 3HGYA 4C3IJ 1IGNA 2DA7A 4A3LJ 2JA7J 1GDTA 5C4JJ 5IPAA 1U9OA 1JUSA 1RKWA 1Z0XA 2ECBA 3CMYA 1OJLA 2LVSA 2XPWA 5IOZA 4L5EA 1XS9A 4FISA 2CQXA 3FISA 4MFDA 3HOUJ 4MIMA 1QRYA 3RQIA 1FTZA 2DMPA 2W48A 2LK2A 3H0GJ 5F0FA 1NTCA 1MNMC 1WH5A 3ZQHA 3MVPA 2ID3A 3O8GA 1LFBA 3Q0VA 1IJWC 1JKRC 1IV6A 1ZKGA 3Q0WA 1BW5A 3BTIA 4BBRJ 3QPSA 2LD5A 5K7HA 2HDDA 3JRHA 1PUFA 1Q1VA 5BNGA 2ECCA 4C3JJ 3RZOJ 1AU7A 1UMQA 1VF9A 1QPIA 1HDDC 5FKOA 1RR7A 5DS9A 3JRGA 3B6AA 5IOYA 2Y9ZA 3HBLA 3H3VK 2OF7A 1HOMA 3LOCA 5EEAA 3JRFA 1ETWA 2DA5A 3OSGA 2DMQA 2M8GX 2MW8A 1Y1WJ 3HOYJ 1GUUA 1JUMA 5EDNA 5K7ZA 4IHXA 3S15J 2P81A 3A02A 3W6VA 4A3BJ 3ZOBA 1JUPA 2TCTA 4BY1J 5FKNA 4D7NA 1ZTRA 1FTTA 1ENHA 1TWHJ 3BTJA 3JRBA 2JMWA 3FKIJ 1EF4A 4XRMA 5FLMJ 1D5YA 2CUEA 1ETQA 2WB1N 2JA8J 3MN2A 1ETVA 2L7ZA 4DYCA 2NOGA 2COBA 3RZDJ 5EF6A 1B8IB 3JRAA 1SANA 3LSPA 2EQRA 4MO7A 5JLWA 1U9NA 4A3DJ 2HI3A 4JX6A 3ZQIA 1A5JA 3SDGA 4M3EA 2ELKA 3MKLA 1TWAJ 2CJJA 2TRTA 3ZQGA 3L1PA 3HM5A 3QQAA 4A3MJ 2O8KA 3HEFA 3GTMJ 3BR6A 3ZQFA 4UUTA 3S1RJ 1ZGWA 1MBGA 1LE8B 4FE7A 2DTZA 3IH2A 2EBIA 3JREA 4A69C 3TP3A 5DTDA 1ETYA 1F36A 2LLKA 3UKGA 1MH3A 4D5FA 1FIPA 1IDYA 1JKOC 1JKPC 4DZJA 1IDZA 3I4NJ 5EGOB 1AKHB 2LFBA 3G1LA 5M5XJ 4A3JJ 1B72A 1WGXA 1X58A 2HQ5A 4RDUA 3K2AA 1XC5A 1RKTA 3S1NJ 2JN6A 2K9QA 1GV2A 2D5VA 2K9NA 3QPLA 2XPUA 5C4XJ 5IYBJ 2DN0A 2LP0A 3HOWJ 5E3MA 1RPWA 2E2IJ 1MH4A 5F0CA 2VUMJ 1W0UA 1ETKA 1IUFA 1QVTA 2WV1A 2GM4A 2LKXA 2Y2ZA 5F1JA 5GPCA 1ZR4A 4DZPA 4CYCB 2VPRA 3A01B 3GTGJ 2DA1A 1LE8A 3BR1A 3HB9A 5F04A 1R9TJ 4MFEA 5FKMA 1I3QJ 4J19A 2E1OA 4I76A 4IHWA 2AHQA 4X1EA 2HXOA 1X2MA 3HGGA 4W1UA 1RETA 4XIDA 4UUSA 1P7IA 3TEDA 4DYRA 2GBYA 5M3MJ 4HNVA 1OCTC 3NARA 3GTJJ 5IP6A 1S7EA 5F27A 3FK6A 3S2HJ 4Y52J 1JJ6C 1ZK8A 3GTKJ 1CQTA 3S2DJ 3JRDA 1WI3A 2MSYA 1IRZA 1GT0C 5J1UA 2AO9A 2B63J 3OSFA 2JWTA 3S1MJ 3I4MJ 4G12A 3OIOA 5GP9A 2NVTJ 4X6AJ 4LOCA 4JX4A 4BY7J 5GPAA 9ANTA 2G0EA 2VI6A 2FX0A 4M3GA 1O4XA 3CCYA 4A3GJ 1E3OC 4A3FJ 2ID6A 1ETXA 4AC0A 2R93J 3Q0UA 5J1RA 2E2JJ 1WCMJ 2JA5J 2R5YB 2DMNA 3VPRA 3SFIA 1K61A 5C3EJ 2XSDC 4JP0A 1F43A 2Y9YA 3HKZN 3FIWA 2VKEA 3GTOJ 2HOSA 3O8HA 4ABZA 2R5ZB 4JX5A 1TWCJ 1OFCX 3BTLA 3DEWA 2QCOA 1ORKA 1YRNB 4V2GA 3JR9A 1HLVA 5FKKA 1HF0A 1TWGJ 3ZQLA 1JGGA 4IEJA 1JT0A 1LFUP 3GTQJ 4XK4A 3S1QJ 2LR8A 2XPVA 2K9SA 1H88C 4XRSA 4B4CA 4C3HJ 1FIAA 1ITYA 3IH4A 5EZGA 2M9HA 4A3KJ 1AHDP 2Y0SN 4DYQA 2I10A 3RKQA 5J1YA 4A3CJ 2OPTA 1BA5A 2H8RA 1JJ8C 2H1KA 1DU6A 1GV5A 2M34A 1WH7A 1JKQC 4MLOA 1U78A 5FKLA 4M3BA 3LSRA 1B8IA 4FE4A 5C44J 1FJLA 4AUXA 3G1MA 2L9RA 1SFOJ 5E3NA 2R92J 2IBDA 2NS8A 5J3LA 1I6HJ 1TWFJ 3G1OA 2DA4A 4B1RA 2R0QC 2NVXJ 2YU9J 3BT9A 4XRSG 3BQYA 4BKXA 1APLC 2DMTA 3BR3A 2ME0A 5JLXA 2Y30A 4IHVA 3CDLA 2HOTA 3BR2A 2NVYJ 2EZKA 1XG1A 4I6ZA 2O9LA 3FK7A 3BTCA 2NVQJ 2K40A 1VNDA 1GVDA 4A3EJ 3JRCA 2PMZN 2X48A 5EGOA 1AKHA 3PO3J 2DA3A 3IH3A 5EG0B 1VFCA 4B3AA 2QF7A 4W97A 3WHCA 2VKVA 4QSHA 5F0HA 5IP9J 2XGEA 4XICA 3GTPJ 1U8BA 4GFBA 3BG9A 1IG7A 3C2BA 2DA2A 4DW6A 4RBOA 3BR5A 2JJ7A 5E3LA 3E7LA
chains in the Genus database with same CATH superfamily
4LLGF 1W7PA 3RCOA 3HOXJ 4BBSJ 2M8EA 1F4KA 3F8NA 3OS0A 3ZMVA 2PLYA 3A03A 4A6DA 5D8LB 2MG4A 3FBIB 4BACA 3H3ZA 1P9QC 3I56I 3ESWB 3KIOA 3M1CA 2XF6A 4NBQA 4IOCF 1NH3A 2K7LA 5HS9A 3PNTA 1MGTA 3H3UA 3MFKA 2LY2A 2OZ6A 5M5YJ 5LEJA 2YSRA 1P7JA 5L3DA 1RC9A 4QTRA 5J8CA 3KEOA 1IZ1A 4IQ4A 5EG0A 2FUG2 3C3WA 1B72B 4BQNA 2MLGA 2F4MB 4RAZA 4D7MA 1MBHA 4UVBA 2F5CA 3DLAA 5CVJA 2M2EA 3SZTA 5K7FA 4BDYA 1LKXA 2E2HJ 2ME6A 4V2FA 4EVIA 1LUJB 1IRFA 1WJEA 2JK3A 5ICFA 1MJBA 1BR1A 2COMA 4I02A 4N9IA 1IN4A 3KYDB 2NS7A 1PP7U 2VBWA 1HDPA 4XONA 2W84A 2VXDA 4BE1A 3OMYA 2RQPA 4EEFG 3I3LA 3GBGA 3BZCA 3FXRA 4YFKF 3K69A 5TGTA 3M4OJ 4BU2A 2A6HF 4M74A 4KNYA 1IW7F 2QM3A 2X1EA 1SD4A 2FF4A 2KT0A 3JRIA 2EK5A 4BJ6C 4S0HB 1H89C 2DT5A 3FXLA 5DCMA 2R5YA 1JGSA 2VN2A 4HQMA 3HOZJ 1W36D 1Z77A 2RREA 4HA8A 5M3FJ 4KA4A 3HDDA 3F21A 3X2QH 2ZJPF 3V8JA 3KZZA 1F5TA 4IVNA 1WQ2A 4U7BA 2QSFX 2XKPA 2EZLA 4I98B 2NNNA 2L9SA 3IWFA 3BG3A 1DU0A 4L0ZB 4AM3A 3F6OA 1PUFB 1RESA 1B6AA 3R0JA 4NB5A 2DMUA 2CRGA 2HOAA 1YQAA 1MZBA 3NRVA 2QSGX 2LBFB 2LRDA 4B8XA 3T5XA 1MMAA 3OYCA 2KQRA 2WWYA 1QO0D 2BXYA 2ZFUA 3TOAA 3P7NA 3MEXA 1Q1HA 1J75A 1BI1A 1KQ0A 1POGA 2RGVA 1R4NB 3LSGA 2JVGA 2CUJA 2W00A 4BHBA 4IO9F 4CCOA 3HGYA 4PCQA 5IT9Z 2DA7A 2E34A 2HPIA 1K7AA 2H1LA 3QP5A 4ZZDA 5C4JJ 3HKZA 1E3PA 3CMYA 3MZHA 4EM1A 3GF2A 1X1DA 1A31A 4E7JA 2WY7Q 3P5JA 4RGRA 1P4XA 1OCZH 1TTYA 1XCBA 5TRDA 2VIXA 3FBNB 2LKPA 4OAZA 1EKEA 4BBRJ 4R79A 1XTAA 2MA3A 4OMZA 4YIRX 1PUFA 2EJRA 3WTTC 2IA0A 4RGUA 1ZRFA 3I71A 4GO1A 1QPIA 5TJJA 2HQAA 1B59A 1QPMA 2DI3A 1RR7A 4HV5A 5DS9A 1X3ZB 3H9GA 3CTAA 3FF5A 2UXNA 2VKDA 5K1YA 2DT7B 2E60A 4MQVA 5ICCA 1FOWA 1D8JA 2DK5A 1S72I 1G4DA 2OF7A 3TGNA 1HOMA 5D5VB 1E17A 2YX7A 4S04A 3JRFA 2MW8A 3OR1C 2FBKA 1GUUA 1LDJA 2DPDA 2ZSIB 3K4BA 2X6WA 4IHXA 4RMNA 1FLIA 2XGXA 3VYSB 2P81A 3W6VA 3ZOBA 5FKNA 2CW0F 1ZTRA 1YOVB 4U0VA 4HNUA 3BTJA 3SFZA 4XR6A 4EQQA 5BOXA 2OD5A 4XRMA 4XOTA 5FLMJ 5JI6A 1Y56A 1MMGA 2BGCA 4CCJA 2KZVA 3NWTA 3MN2A 1ETVA 4G8XA 3HOTA 4DYCA 3RQ4A 2COBA 5FD5A 5EF6A 1SANA 4LIUA 1G8XA 1VQ7I 4CYDA 1Z3YA 2DFHA 2EQRA 1K6OA 5JLWA 1U9NA 3WTZA 2AS5F 1FMVA 5KAFC 1A5JA 3GCMA 2HVQA 1DGRM 4M3EA 1PP8F 1XDSA 1U6GA 2E1NA 2DOFA 2QYOA 3BP8A 3WTYC 3ZQGA 4D1QA 3DKYA 1TT5B 3WG9A 3QQAA 2VLAA 1Z7UA 4A3MJ 3L2CA 3G73A 3GTMJ 3CMMA 3MZYA 5D6EA 1Z6TA 2DYRH 2K02A 3ASNH 3AG4H 2EBIA 3ONQA 1W36C 2ELHA 2EFNA 2UUZA 5CVUA 5H20A 1ETYA 4UNOA 2HPMA 4LMYA 1I1SA 3ZQQA 1BJAA 1XMKA 2G7HA 2KFDA 3JTHA 3HRMA 5DCFA 5D4SA 1WGXA 1K78B 5HS8A 2HQ5A 3PNYA 3MAJA 4QWQA 2JZYA 1FY7A 1D0YA 1RKTA 1TQMA 5KK1A 5A2QZ 1EJ9A 1B9NA 2K9QA 3QPLA 2XPUA 2DN0A 2LP0A 3KFWX 3J81K 2EFPA 4HRIA 2RKHA 5E3MA 2CUZA 1G3TA 2HVSA 2A3SA 3DPLC 2DLLA 4MQ9F 4EJOA 4UV8A 4AIJA 1KQ8A 2F2EA 1X3WB 2KIUA 1LVKA 2VUMJ 1U5TB 3BPXA 1J7KA 2GM4A 2A61A 5CYVA 3QRFF 2PG4A 1USTA 2FOKA 3BWGA 5J4VA 4RB2C 2DO7A 5LBQA 4WXCA 4ZC3A 2ZNZA 2ZCWA 1MNDA 1MD0A 5F04A 2HKXA 4HSRA 2XAJA 4MFEA 2VC0A 2W82A 2ISYA 4I76A 1R00A 1W5SA 1G3SA 2CO5A 1G3YA 2HDWA 4XIDA 1IUYA 2Q8KA 4UUSA 1P7IA 4AYBA 4XLCA 1D5VA 3EDPA 3R6SA 1VQ9I 2Z1DA 1GXPA 3CF5F 3V8KA 3PUBA 3CCUI 2DW4A 1SD7A 2MSYA 1R1VA 2DJIA 5FLXK 1FBQA 5LHHA 2A5WA 3OSFA 1WJ5A 1ZAOA 3DBHB 3OL3A 1U5TC 3F6VA 2DQLA 1BN5A 5GP9A 3BCAA 4BEHB 2VONA 3CESA 2X85A 3SEQA 4JX4A 3CC4I 4DOZA 2ZNYA 2ADUA 2QENA 2VXZA 4M3GA 1O4XA 1REPC 3R4KA 1DP7P 4A3GJ 4A3FJ 2AXTC 1T38A 1ETXA 4IQJA 4AC0A 2R93J 4Y13A 2ZXWH 4I09A 2H6BA 5J1RA 2E2JJ 1FSEA 1WCMJ 3GLLA 2JA5J 3BZ6A 1VQMI 3VPRA 1K61A 3SFIA 2EV5A 2XSDC 4IHSA 3WODF 2Y9YA 3MKWB 1S8NA 3FIWA 2VKEA 3GTOJ 2HOSA 4L5JA 3N4MA 5BPDA 1P6RA 1HKSA 1HSTA 3O8HA 4Z6YA 3K0LA 4IRGA 2BVLA 2VL8A 1OFCX 3BTLA 1UFMA 3E1SA 2XVCA 1ORKA 2ZJQF 1I39A 1EV7A 3NWSA 2ZJRF 1YRNB 4CGZA 1HF0A 5GTHC 3ZQLA 4IEJA 3FXUA 3NEUA 3RJPA 3GTQJ 4G7OF 2WBMA 3G4SI 2XPVA 2CGPA 3S3MA 2VJ5A 5F6FA 2W57A 2XV4S 1R58A 4XRSA 3KPHA 5KNLA 1KYWA 3K1MA 1XX5A 5EZGA 1ACIA 5B66C 4U87A 4A3KJ 2PJRA 4XORA 4DYQA 4A3CJ 2VOPA 4XRFA 2OPTA 1BA5A 4WXHA 2H8RA 2KLOA 1PUEE 3VOEA 1GXQA 2M34A 3K1NA 3I55I 5E79C 1FNNA 2YU3A 2F48A 4FE4A 1X1AA 2NRAC 2GOXB 1FJLA 1G3WA 2IPQX 4AUXA 3JAMZ 2L9RA 1WI9A 4I7HA 5D4RA 1U3EM 2IBDA 2NS8A 2RV8A 5KCMA 2C6YA 2RN7A 4DBQA 1YS6A 1O3TA 3H5NA 3K4LA 2W4SA 1R6RA 2DMTA 4YELA 4F3QA 3E5UA 5JLXA 2RNJA 1OISA 2Y30A 3HJEA 1RUOA 3LQRA 3CDLA 4A2UA 1ODDA 1OLTA 4UB6C 2VJJA 1RZ4A 2CG4A 3FK7A 3BTCA 3HRSA 1VNDA 4A3EJ 2XSJC 2WB1A 3RDIA 3JRCA 2PMZN 2X48A 2ESNA 1AKHA 2L01A 4EGZA 3IHUA 4HLYA 1LEAA 1FYMA 4XSZF 5IT9K 3WTXC 3J7AY 4ZYDA 5DEQA 4N9HA 5FGMA 2EIMH 4LG3A 1SVMA 3OYIA 4KIGA 4Y17A 4P9FA 4KIFA 5F0HA 2XGEA 4XICA 3GTPJ 2L02A 1SMTA 3Q9VA 4UB8C 4XLAA 2DA2A 3BR5A 3TO6A 4L0YB 2BVMA 1R1UA 1L0OC 3PIOF 2M3AA 1MBKA 1Y8RB 4E7KA 3U2RA 5J40A 2XGCA 2B9SA 1G2HA 3BZKA 3OYHA 2HTJA 3KEYA 3ZRGA 2DAOA 2VE8A 3DU5A 1Z6RA 2DOAA 3NAUA 4GXOA 4ZYGA 2YUSA 2O5RA 2GA2A 3OS2A 1U8RA 4PSXA 2XAUA 4ZJZA 1FYKA 4CYCA 1OR7A 1SVLA 2XDVA 2IS6A 3GX4X 3DEEA 3FMRA 4C9YA 3H35A 1K83J 3S14J 3C1DA 2VBXA 5CJ9A 1O3QA 3PM1A 2IAIA 2VT2A 4XM3A 4HW0A 1T6SA 2ISZA 1HCRA 2GLOA 3T0YA 3DBLB 3LAJA 3R60A 2OZUA 3CQZJ 3L2RA 3F8BA 3SZPA 1EA3A 2UV1A 5DUKA 4H0EA 1FEXA 5FD6A 4IPAA 1E0EA 4XN0A 1WFXA 1XSXA 2L9NA 5FJ8J 3JTGA 5HDNA 1D1BA 2LG4A 1T56A 4HEA2 5M5WJ 3W2AA 1BI0A 2VPLA 3BQZA 3EETA 5F08A 2LNBA 2JPBA 1G59A 4IZZA 1XSVA 2MGQA 1MMNA 3HSEA 3K7AJ 3MWMA 4EGYA 3EQLF 3JSOA 1BM9A 3CO6C 2JVHA 5DD4A 3LSTA 1TW2A 1S7AA 2O8XA 3I59B 3KYCB 4K2EA 4L5IA 4ESFA 3OV8A 4RAFA 5HODA 3V4GA 1YS7A 1IC8A 2QBYB 3ELKA 3Q9SA 2LOOA 2ACJA 3WE2A 1PYVA 2JRTA 3H92A 1UCRA 3HZJA 4JQFA 3GTLJ 2WAQN 3CCLI 2VQHA 2MYSA 4MTEA 2CQKA 4BYYA 4JYKA 1R22A 3G2BA 2EZHA 3OYGA 3HSFA 3S16J 4HZFA 1QGPA 1WPKA 1BIBA 3W6JB 2FJ1A 3E5QA 4S05A 2M5WA 4ZTJA 1JTXA 1ZYRF 2EV6A 2R5ZA 4OIQF 3CUOA 3PJRA 2BZTA 3DV8A 3TBIA 5A2QK 5FB2A 1FYLA 5HLGA 2J5PA 1UHSA 3MCZA 4AIHA 2X1DA 3I0TA 2X6OA 5CPRB 3I5UA 4NDLA 2BBYA 2MD5A 2IW5A 3F8FA 4YIIA 1RRJA 4J01A 1BOAA 2EZIA 2CQQA 2KRHA 2Q2EB 2DJNA 2V26A 3G3ZA 5JHFA 3CCVI 3AFHA 3HOVJ 3OOUA 4V19K 3ERED 5BQTA 2XKOA 1DQUA 4FASD 1MSEC 1T33A 2M0CA 4UVAA 4HNTA 2HXIA 4CH7A 4RAYA 3FHNA 4C3IJ 5HNFA 2HDCA 3REOA 2LC2A 4ETSA 5IPAA 1SVOA 3CMEI 2MFZA 1OJLA 2LVSA 5CQEA 3CLQA 1JXSA 1P4AA 3IWZA 4I0AA 5IOZA 1XS9A 4B48A 1MIJA 4WX9A 2CQXA 2R7DA 2OCEA 3MMYB 4MIMA 1R7JA 4MFDA 4CZCA 3HOUJ 1MDMB 1F1ZA 1XN7A 3DFGA 4HV6A 1FTZA 2GXAA 3ERMA 5F0FA 1NTCA 2O3FA 1WH5A 5LRRA 4CDGA 1TL8A 2ID3A 4BS9A 4MTDA 1JKRC 1TLHB 3Q0WA 3KX2A 2GQQA 3CO7C 4L9TA 2HDDA 3JRHA 4AVZA 2ECCA 2XAGA 4RS8A 3RZOJ 1UMQA 4M9ZA 2X6YA 1VF9A 2BV6A 4KISA 1K4TA 1MJAA 4UUVA 5IOYA 3CCMI 2Q2EA 3DP7A 3HBLA 2RNGA 3FMQA 4FETA 3ASOH 3K4MA 2GA1A 4U0YA 2BY1A 2VC1A 3ZQ7A 3CP2A 2G7UA 4XOPA 1JE8A 3L00A 3LOCA 4O5VA 5EEAA 4A12A 2CV1A 3U1DA 2IP2A 3AAFA 1Y1WJ 1SAXA 2K5CA 1QBJA 3S15J 4JBAA 3QYBA 5DM7F 2ZXIA 3F8CA 3IAM2 1FBSA 1E3HA 4IOAF 4D7NA 2OCCH 2XAHA 3QODA 2R7UA 3FKIJ 4HSTA 3TOBA 5B1AH 3TKYA 4JOMA 3MKYB 2STWA 2CUEA 1ETQA 3RKYA 3OYFA 1S5LC 2IA2A 5FROA 2XROA 2BYVE 4KMUX 2L7ZA 4II3A 1O7LA 5DYMA 3S93A 3CCEI 2NOGA 1IAWA 4N4OB 3RZDJ 1MDMA 3KYLA 3CZ6A 1LVAA 4NQWB 3LSPA 2OU2A 4OAYA 2R7QA 4JX6A 1KU9A 3ZQIA 3SDGA 5AONA 2ELKA 3MKLA 1IRGA 2L9VA 1TWAJ 2CYYA 2CJJA 2TRTA 4XKBA 5LLQA 3L1PA 3FXQA 4E4HA 2O8KA 4RM2A 3ZQFA 1SEUA 4UUTA 3R0AA 2V9KA 1BIAA 4OU0A 3IH2A 3VSKA 2EWNA 3NQOA 1S7OA 3JREA 2IRFG 1UG0A 2DTRA 3A1YA 3TP3A 2LLKA 3LSIA 2Z9OA 1MH3A 4D5FA 1FIPA 1IDYA 1IDZA 4RM3A 5EGOB 1FZPB 1YW7A 2L3DA 2QQAA 4A3JJ 3I4PA 3VWBA 3HHHA 3K9TA 1B72A 1YLFA 3ABLH 3K2AA 5H6RA 2BXZA 2EFOA 3OYJA 3F72A 1HKQA 2FOWA 1Y39A 3SDBA 2K9NA 2NXNB 2RQQA 5L3EA 3WGHA 5HLTA 1RR8C 2EIKH 4PGHA 4GGGA 4A0YA 3J7YJ 3OR2C 1RPWA 1ZELA 4FQGA 1MH4A 2M45A 4UXNA 3JAMK 2ELJA 3N97A 4ZTFA 2LDUA 4G94A 2HNHA 1UHMA 1FP1D 1ETKA 2EFWA 4G6QA 1ZGJA 2WV1A 3WU1B 2LF7A 2LKXA 1UAAA 2Y2ZA 3DBRB 3F23A 5J47A 4DZPA 3KP7A 3J7AO 2VPRA 3A01B 3GTGJ 1YO5C 3K10A 2OTJI 2KP6A 4WXDA 3M8JA 2VT3A 1C0WA 3HB9A 2QLZA 4IXAA 3BLYA 1R9TJ 3RKXA 5HVQC 5HDKA 2NS0A 3K4JA 1I3QJ 5F1RA 4J19A 1QHGA 2OQGA 3BDDA 2E36A 1SD6A 1Z05A 2AHQA 4HLXA 4X1EA 4AWXB 3GFIA 2HQRA 3FMSA 2A07F 2O6GE 2STTA 2E5NA 1LJ9A 2K9LA 3WGGA 2O03A 5M3MJ 2RVCA 2ZMEB 2O0YA 3NARA 4R1HA 4LB6B 3GTJJ 1DUXC 3ZN0A 1U0JA 2YR2A 4LFUA 2R7FA 1JJ6C 1XPXA 3GO5A 4BXUA 3D5SC 1UZCA 2HR3A 2QQ8A 2ZO4A 2LBFA 3JRDA 2XIGA 4OIPF 2FBIA 2RC4A 4NNJA 2AO9A 2DCEA 1Z67A 3S1MJ 3I4MJ 1FBUA 5E1WA 5E8IA 2EA2A 2GZWA 2X6XA 4ENMA 3LQQA 4M9XA 3EPZA 4F7ZA 1R5GA 3ZXSA 1DP3A 2DXIA 4BY7J 5GPAA 2KIQA 2M1BA 4ENJA 1IXCA 1OCCH 2G0EA 3DTKA 1TQPA 2VI6A 3IUOA 1E3OC 5LRSA 2ID6A 2FMLA 3M8EA 3GZNB 3EUHC 1RIOH 3WTUC 1V54H 2VOOA 3I58A 4PJMA 5CVRA 2M30A 5J6XA 2VE9A 4XLHA 3ZN1A 2PBIA 4BUPA 4HX4A 2M7BA 3ZGKA 2L4MA 1YE9A 4JP0A 4HG2A 3RTRA 3PNVA 1FP2A 2ZMEC 2LF8A 4ABZA 5JHUA 1WSUA 5LGNA 4JX5A 4M73A 2JSPA 4GYIA 1TWCJ 4B47A 3H0DA 3DEWA 3RPUD 2QCOA 4JK1X 3FXMA 4KMFA 2R7WA 1HLVA 1QQIA 3QPTA 1D0ZA 1JGGA 4YIFA 4TV7A 4UVCA 3ZR8X 2K9SA 3RYRA 1KGSA 1NG6A 1Z7LA 3DLLF 4U0WA 1ITYA 5EJCA 3IH4A 4QPQA 4HDUA 2CV2A 1VQKI 3AL0B 5GAGJ 1XCVA 2LH9A 2OC6A 4IRHA 1AA7A 3K6GA 2Y0SN 3KP3A 5J1YA 3M9AA 4HX8A 3RKQA 1HXDA 1G6NA 1OYWA 3JCUC 5D6FA 2V1UA 1WJFA 4BNCA 2CMPA 4UY8I 2OJED 1I27A 1DU6A 2HZDA 3IC7A 1JKQC 1XGMA 2LREA 3EUAA 1RI7A 3F3XA 4A6EA 2QZ8A 4M3BA 3LSRA 3V7RA 1WZ2A 2PN6A 2LY1A 3DKWA 3G1MA 4CCNA 1Y0UA 2V1XA 4XLEA 3K4KA 1TWFJ 2LKSA 3D5RC 3DXJF 4I99C 4O6JA 2XF7A 4B1RA 3BOQA 2H6CA 1CF7B 3FKJA 3PIPF 1XGOA 2NVXJ 3A2KA 3BT9A 4I2OA 4RA2A 4XRSG 3OYLA 2KKOA 4LITA 5K5RA 1APLC 1H9GA 4IF4A 4IHVA 1W1WE 2HOTA 2IXSA 3TO7A 1B9MA 1XG1A 2KRFA 4I6ZA 3U1KA 5DV5A 5CKTA 1PJRA 2ZKZA 1O7FA 1YTYA 3AL0C 1A35A 3V42A 3C18A 3PO3J 1R49A 1OCOH 3VDXA 1R1TA 4ZYHA 2VASA 1K78A 2K9MA 2A05A 4B3AA 1ZG5A 2D45A 4WWCA 2W7NA 4M6XA 3GFMA 3WG7H 1SMYF 4NUBA 5IP9J 2UWMA 4GFBA 3EYIA 3BG9A 4IL6C 3F8MA 3K1PA 4DW6A 4RBOA 2DYSH 2CFXA 1DGWY 2R4GA 2D1VA 1HW1A 1KYZA 3GZ6A 2R7XA 2X1CA 3H36A 2XGDA 2V4JC 1BJZA 2FNAA 1HC8A 1U5TA 1Y8QB 3J7ZI 2P7CB 2IS4A 1N78A 2EA4A 2V9VA 3TP0A 2F5EA 1W0TA 4Q5SF 5FRMA 2R7VA 4QIWN 2PJPA 2E5ZA 4PFPA 1JI8A 4G6TB 4PGGA 1TNTA 5F64A 5EZHA 2MBFA 2Y0SA 4EMSA 3WHBA 1BW6A 1Z3XA 2A6EF 4A3IJ 4RB0A 4I01A 3K4CA 1T98A 4HDVA 3OYDA 1EH8A 1QZYA 3BG5A 2CU7A 3DF8A 4MNUA 2QEXI 1CGPA 4A93J 4YRVA 1BR2A 3M3YJ 4Q4ZF 1WHUA 2QSHX 4KIBA 2YS9A 3LL7A 3RPUA 2L7MP 3CDHA 1OQYA 3TW6A 4RAGA 1QA6A 3DPUA 5CVVA 3CDIA 1S9HA 3IKTA 1MSFC 4IJAA 2P7VB 3S3OA 4CZZA 1UG2A 4IHYA 2E1CA 1WJCA 6PAXA 3IP4B 2HEOA 2L0KA 4HF2A 4BQAA 2P5VA 3BY6A 4WF2A 2BOLA 1TC3C 4M3DA 4BEHA 3OYKA 5FLVA 3CMAI 2JA6J 4Y15A 3E5XA 3Q3SA 3RKWA 1P4WA 2DDAA 3FXOA 4ESJA 2R7ZJ 1MMDA 1P92A 3LSMA 5EEHA 4LJZF 1S6LA 2L7FP 1V4RA 1XGSA 4D5CA 3LA3A 3ML6A 4WK8F 1ERDA 3ZMTA 1YJNI 4ZZLA 5IYDJ 4AD9A 3B6CA 3E97A 3A4CA 2E1MB 2QWWA 3LFKA 2Y31A 1F9NA 3S8PA 3F0CA 4NC8A 5D5WB 4QLCU 4PDKA 1M1EB 3TL4X 1H8AC 4XSXF 1Y6IA 3N05A 2ZBKA 1MMSA 1DDNA 1W5CC 1BL0A 4XKVA 1YRNA 1YI2I 2OTLI 3S17J 1O57A 4ESBA 5GAHJ 2EINH 4Y7NJ 5DD8A 1OCPA 2O61A 1B1BA 2R7OA 2XB0X 2KIFA 2KRCA 2FQ4A 3KLNA 2IEKA 3M7GA 2IS2A 1WJAA 3HXLA 2W24A 3OYEA 3BG6A 3HL2A 2CSOA 2X9DA 1Y1VJ 5IP7J 4KN7X 1HA8A 1JHHA 3RI4A 1XD7A 4Z2YA 1IGNA 4KYWA 3VEPA 4WCGA 4A3LJ 3AG2H 2JA7J 4PZJA 2WA0A 4CO8A 2ECBA 1JUSA 1RKWA 1I5ZA 1Z0XA 3H5RA 3OYNA 4OWRB 4YFNF 3M07A 3I64A 4L5EA 4UHTA 5LGUA 3CCQI 4FISA 1R36A 2GIZA 3FISA 2R3SA 4BE2A 4FHTA 2G9WA 3RPQA 4BQQA 1QRYA 2E1MC 3RQIA 4CHUA 3H0GJ 2XAQA 1ZG1A 1MNMC 2PI0A 1R5HA 3MVPA 3ZQHA 2UZKA 3O8GA 3Q0VA 1IV6A 1IJWC 3KE2A 1ZKGA 3QYFA 4CXFA 4E7HA 3BTIA 1FOYA 3LFUA 2LD5A 2R7RA 5K7HA 4ENKA 4KT5C 5BNGA 1SAUA 4C3JJ 1VQ4I 3BJOA 5L3FA 4YG2F 1VQNI 1X1CA 1OPCA 1Z21A 1HDDC 3DTIA 2DQRA 5FKOA 4Q47A 3OYAA 3B6AA 3JRGA 2P0WA 1EH7A 1T95A 5TISC 5BMZA 3FM3A 3H3VK 1V55H 2P8TA 4B44A 3IL2A 2Z2SB 1X3UA 3AG1H 1ZLKA 2JUCA 1ETWA 2DMQA 1JHFA 4EJUA 3HOYJ 1LEBA 3C2GA 2XHKA 4BH9A 3UR3C 1X4OA 1QZZA 2HS5A 1I3AA 4BY1J 2CFOA 2AQEA 4CCMA 1E2XA 1ENHA 3JRBA 3GLXA 4LIVA 2JMWA 4Y4RA 5JR3A 1H0MA 3HPHA 2MH2A 1YW8A 4BJ5C 2WADA 1MNEA 1LDKB 1N75A 1B8IB 3JRAA 1IO2A 2MD0A 3PL8A 2OQRA 1NG7A 2KPMA 5E8GA 1ON2A 1IN8A 3PUFA 4MO7A 3TDZC 3VFZA 5FFXA 2HI3A 3GMEA 3BJ6A 5B5EC 2VBZA 3BG7A 2FSWA 1LB2A 4DQ2A 4PK4A 5LGTA 2BW3B 3OS1A 2VJ4A 4BGDA 4CCKA 2ICWG 1BOBA 3CP8A 4G6DA 2KJCA 4XMYA 2PMZA 3HEFA 2I5UA 1A36A 3S1RJ 2KDOA 1LE8B 4FE7A 3CD6I 2DTZA 1BI2A 3I53A 5HS7A 2NVUB 4IHTA 4A69C 5DTDA 1F36A 3BJAA 1X1PA 3QU3A 3UKGA 3OIQA 3AKZA 3VYUB 1JKPC 2GAUA 2LFBA 4EJWA 1TQIA 4GRIA 2OA4A 2DK8A 1ZG3A 5FO5A 3SHFA 1A6QA 4D9JA 1I1GA 1W4MA 2D1HA 3CCRI 1FSHA 1TW3A 2F4OB 3ZMSA 4CA0A 4YFXF 1Z1DA 5LEKA 4LG0B 3OYMA 3U9GA 4E7IA 1GV2A 3BPVA 5BPIA 1T39A 5C4XJ 5IYBJ 2A69F 1FT9A 2HKOA 5IY5H 4ITVA 4LGWA 4C30A 3ECOA 4ZDPA 2ZJ2A 2E2IJ 2W85A 1HW5A 3PFIA 4L9VA 3RYPA 1O3SA 1W7PB 5HNHA 4H4KC 3I59A 4ZH4F 5F0CA 1OYYA 3WTSC 3KZYA 1YJWI 2V6CA 3C7JA 1BBYA 3ZMZA 1QVTA 3DEUA 1S3JA 3H9QA 2QBYA 4OINF 4ASNA 5F1JA 5GPCA 2KZGA 4PUSA 4AU7A 3FWEA 2DFEA 2HQNA 4F52A 2DA1A 1LE8A 3BR1A 1N25A 1N77A 3MZ8A 3GWZA 2CW8A 3LMMA 2NNYA 2ZC2A 4BJTA 4XLFA 1MJ9A 4IHWA 2KIMA 4KN4X 1GHCA 1V3FA 1X2MA 3HGGA 4EATA 5FRNA 2K3FA 3SQNA 1ZRCA 5GADJ 1FX7A 2QKLB 3GUDA 2F5DA 3VSLA 2GBYA 2MABA 1ONVA 4HNVA 1OCTC 1BI3A 3W2VA 1PVEA 5IP6A 2K4JA 1S7EA 5F27A 2JUGA 2EILH 3ABUA 4LG0A 2K85A 1ZK8A 5CQGA 1UB9A 4DNCA 3GTKJ 1CQTA 1K6YA 4BL0B 4PFOA 1IRZA 2XUBA 1GT0C 2GXBA 4KICA 1YIOA 3ZMDA 3CJNA 5LHGA 1YIJI 3RIRA 5HOOA 2B63J 1WVRA 2WAQA 3V7SA 3HG9A 4G12A 1ZREA 4LLNA 2IS1A 2HYFA 4E7SA 2VQLA 4X6AJ 1IXRC 2IGNA 2P6TA 2WTEA 4A0XA 3ISPA 2V79A 3KP4A 2XRNA 9ANTA 1V5GA 2RDPA 3CCYA 2L4AA 1R71A 1X4PA 4BHCA 5ILVA 1VQPI 1HW2A 2IA1A 3O3KA 4XL9A 3TMOA 3G6EI 5K5QA 3K4NA 3ZCOA 5DCMB 1YFHA 2A6TA 2M0MA 2R5YB 1FOXA 2H94A 4Q48A 1J09A 1ULYA 5ICGA 1IV8A 2W25A 1F43A 4EV0A 3P9IA 4LK1F 2LMDA 3HKZN 1DPUA 3L7WA 3ZP5A 3WU2C 1B4AA 1KQ9A 3HTUA 3CJRB 3DQVC 3E3VA 2V1NA 1TBXA 1STZA 4V2GA 4I0BA 4A5MA 5FKKA 3KETA 1T2KA 4BXFA 1OCRH 1TWGJ 4EM0B 4DJAA 4LB5A 1ZLJA 2K27A 5AIPA 2K3PA 1LFUP 4XK4A 2LR8A 1D0XA 3B73A 5ERIA 4YEJA 4B4CA 2M7AA 1FIAA 2P5LC 1DPRA 1T8IA 2M9HA 2OV7A 1J9IA 1XGNA 3VYTB 4J00A 3IKVA 2I10A 2EPFA 3HPGA 1X1BA 4XQFA 1KU2A 1JJ8C 3L9FA 2H1KA 4AIDA 4P96A 1SD5A 2X51A 1WH7A 2HWVA 3QWLA 2ZXHA 2ESHA 1U78A 4EJTA 5FKLA 5HLIA 2QUFA 3QAHA 3J80Z 3HTSB 1LPQA 4HYEA 4HF1A 5C44J 4NQWA 5LFAA 3ROUA 1SFOJ 4MEYF 1IF1A 3WE3A 2UXXA 3GZ5A 3HYIA 4U7DA 5JVGF 4C2UA 3CF2A 1BC7C 4A0ZA 3H1CA 4Y3OA 3KP5A 3LSHA 5BS6A 1HKTA 1ZARA 3GXOA 3BR3A 2ME0A 4Y33A 2DT6A 1EH6A 4CUGA 1T0FC 4BAYA 5K5OA 1T0FA 4E7ZA 3BR2A 2A5YB 1J2XA 2EZKA 2FRHA 2V9PA 4RB3C 4X0GA 2F5FA 2WAFA 1ZH5A 3COAC 2VJIA 1WJBA 2FEZA 3SYTA 1O3RA 5EGOA 5DM6F 3IH3A 1VQLI 3T1BA 2CQ7A 1ZN2A 4W97A 1WRJA 1R4MB 2VKVA 2ZXJA 3FX3A 5D5UB 1U8BA 4G7HF 1IG7A 4IKFA 4E7LA 3S2WA 3C2BA 2L54A 2JPCA 2JQ7A 3S32A 4DIQA 1J5YA 2JJ7A 2IT0A 3BROA 3E7LA 1FOKA 1WJDA 1QU3A 1ZQ3P 2E19A 2F4IA 2K86A 1MBEA 4HX7A 1LQ1A 3KP2A 1VQ6I 5KAIC 5E3OA 3GFJA 2Z99A 1YJ9I 1AOYA 4C2MJ 2PMHA 4HAMA 1Z9CA 5H2FC 1X2NA 2Q0OA 2DA6A 2AQFA 2OUMA 3A01A 1SFXA 2B7EA 3IRQA 3F22A 3FHZA 3HRUA 2H09A 1JTYA 3EUHA 5D5XB 5ILUA 4PJJA 2VB6A 2FD5A 2RAEA 5B3SH 2ZB9A 4OIOF 2A68F 3OY9A 2GXGA 2BY0A 5EYRA 3T8TA 1SC7A 3ABMH 1ZR2A 1Y0NA 3M1EA 5AIQA 2ZMEA 4RLFA 3IV5A 3R61A 2EH3A 3TO9A 3WTVC 1NK2P 4FCYA 4FT8A 1MW7A 5IYCJ 2LY9A 3RSNA 3TW7A 3OYBA 3LNQA 4CCLA 4M3FA 4AYBN 1TP4A 2Z3YA 4RLQA 1TNSA 3A0HC 2MH9A 4N4NB 1XMXA 2XB5A 2CS3A 4ZYAA 3V8LA 2QQBA 2N8GA 2O7OA 2R7SA 3KEQA 1XSDA 5L3CA 4D0PA 3D1NI 1A6IA 2GWRA 1I50J 4FX0A 4M72A 2D2WA 3QOPA 1MBFA 1UHWA 3H9JA 4KUMA 4HPQA 4CICA 5HLHA 3ABKH 1D1AA 5B1BH 2HYJA 3F9KA 2HVRA 2LTPA 1YG2A 2R7TA 3L09A 3ZQCA 2WAEA 2AXLA 1NK3P 2CUFA 4KJZA 1QVUA 1JT6A 3BR0A 2JTVA 2V6EA 3TDUC 3O2PE 3DCFA 2PQ8A 2XC7A 4FX4A 3CJQB 3M8FA 4U88A 2VKHA 4UUSB 2KDZA 2Y69H 1ZGAA 4BXXJ 3GFLA 4ZDLA 3FXJA 2GOMA 2XRLA 3K70D 2IGMA 4MGRA 3VYRB 2OAZA 3FZVA 4M6VA 2MC3A 4F91B 1V5EA 2BE5F 1VI0A 3BC8A 2WV0A 4HQEA 4QPOA 4FTHA 1MBJA 4ZYEA 3SJMA 3ECHA 3LSJA 3CJTB 3FDYA 4UV9A 1YITI 1VQ8I 3PO2J 5ICEA 2ZFWA 2X4HA 1W5TA 2JA2A 2WY8Q 1ETOA 3S3NA 1VZ0A 3E0JB 4RGXA 3GVAA 2HFHA 3HHGA 2IGKA 4NC6A 1ZRDA 2M87A 3EYYA 4F55A 1GDTA 4PJNA 1VTNC 1U9OA 3OOPA 3I9V2 2XPWA 4L9NA 1IN7A 2DPUA 5LD2C 3MQ0A 3PFYA 5H6QA 5KHDA 2PEXA 2Y0MA 2I8DA 1IN6A 4F93B 1GLNA 3W2WA 5L3BA 2DMPA 3LAPA 1A04A 2LK2A 2W48A 4O3MA 4GYGA 1LFBA 4PJ0C 4XKWA 2LYCA 1VQ5I 1BW5A 4PSWA 1CF7A 3QPSA 2IJLA 3DKXA 5E17F 1Q1VA 3V7CA 3OL4A 1AU7A 4HF0A 5E20A 4HOBA 2HYGD 2DBBA 4G7ZF 1D3YA 5DDGA 5CLSA 4XKCA 5ILSA 2Y9ZA 4F92B 2EV0A 2W1OA 3KZIC 3WGIA 3KLOA 2BY3A 2PX9A 3PQJA 1USSA 2DA5A 3C2HA 2M8GX 4LK0F 3OSGA 3L2QA 3BCBA 3D5LA 3SZGA 3ABTA 1JUMA 4L9JA 5K7ZA 5EDNA 1RUNA 4LLLA 3A02A 2EIJH 4A3BJ 1FMWA 3FM5A 2PJRB 1JUPA 2TCTA 4ANJA 1FTTA 3HC7A 1TWHJ 2BHYA 3ZPLA 5J8FA 1OYIA 1EF4A 3AG3H 1D5YA 2WB1N 1XB4A 2Y48A 2JA8J 3KCCA 2KL4A 4M71A 1YX3A 3LA7A 2QVOA 3E6MA 1YHQI 4A3DJ 2PFBA 1QZEA 2CQNA 3KP6A 2HGCA 1SFUA 3OIPA 4DGWB 3ZMUA 2QGUA 1R5ID 2IGOA 4L18B 1Z91A 1KZHA 3HM5A 2X0LA 3HRTA 4OOIA 4R8HA 5FFZA 2FE3A 1YX5A 1KU3A 3BR6A 1ZGWA 1MBGA 3DU6A 2DFFA 3UNGC 2MLKA 4E6KG 2BY2A 4HBLA 3E6BA 1XDUA 1JKOC 4DZJA 1P2FA 2B0LA 3I4NJ 1SFKA 2NYXA 1TT0A 1AKHB 3K70C 4CSWA 3G1LA 1VQOI 5M5XJ 3LA2A 2ETHA 1X58A 2FMYA 4RDUA 3GW2A 1XC5A 4IX7A 3S1NJ 2BHZA 1QNTA 4BDZA 4KITB 2JN6A 2D5VA 1LNWA 2HOEA 3HOWJ 3J80K 2DODA 3CC2I 3WU0A 2Y75A 2EFQA 4RB1A 2M4KA 1D8KA 3HSRA 1WWXA 1NHAA 2H27A 4XLNF 1W0UA 2KJBA 1IUFA 2DOEA 3T8RA 1KONA 4KDPA 1ZR4A 4N0BA 2F6CA 5E1ZB 4AVPA 1J0RA 3O6BB 2CH0A 3IRRA 4CYCB 1S29A 4BQOA 3IAS2 2L2OA 4II2A 4LD5A 3EUKL 1FWZA 2JRMA 3D0SA 5FKMA 1OKRA 4NC7A 1YYVA 1HSJA 3JSPA 3QYEA 2E1OA 2NOJB 4C2TA 2Q1ZB 2HXOA 2YPRA 4KT6A 2Z5UA 1AWCA 4W1UA 1UELB 1RETA 2E7WA 4E70A 1R23A 1FC3A 3TEDA 4P1WA 3A0BC 4XBFA 4DYRA 5ED4A 1IRXA 1TZLA 1X19A 3FK6A 3S2HJ 4Y52J 1WKMA 2K4BA 2Z16A 4P9UA 3GEZA 3S2DJ 1MKMA 3L2UA 1K79A 1WI3A 5J1UA 2DU9A 2EB7A 1V5FA 3SXYA 1PDNC 1D1CA 2JWTA 3QU6A 1YW9A 4NHJA 3CUQB 2WC2A 1H9TA 5IT3A 3OIOA 5KVRA 2IVMA 2NAZA 4B43A 1W7PD 2NVTJ 4KFCA 4LOCA 3CLOA 3E6CC 2VQCA 2CV0A 1OR7C 4RGSA 2E7XA 1IXSB 2FX0A 2FNPA 3TQNA 1KA8A 4GDFA 2CW7A 5E18F 2FU4A 5GTIC 3Q0UA 2H8WA 5E1XA 2DMNA 4AIKA 1I6XA 2KISA 3ULQB 3PSIA 5C3EJ 4P5OA 1T08B 2KMUA 3E6DA 5LHIA 2QA4I 5L3GA 4ZDOA 2HTSA 2HZTA 2DFIA 2FA5A 3H5AA 4B3XA 4IRIA 4EJVA 5JVTA 4DBRA 2R5ZB 1BC8C 1RNLA 2HU9A 1KU7A 3L2VA 2L7KA 4OIRF 2TDXA 3JR9A 4OMYA 3WTWC 1JT0A 1K4SA 5DUIA 3FXKA 3S1QJ 4BHPA 3CUQC 3U21A 3W3CA 2XAFA 3L2WA 3CUQA 1H88C 1XMAA 4C3HJ 3HUGB 2QKMB 3DPTA 3Q5FA 4XN3A 1AHDP 1ON1A 2YX4A 2E71A 3I54A 2QQ9A 5EEGA 3P9CA 4B09A 2P4WA 2XF5A 1UJ8A 1OMIA 2BEOA 4ENNA 1GV5A 5CVIA 3J81Z 4MLOA 2JSCA 3QOEA 2Z33A 1B8IA 3DWLE 3MD2A 3K2ZA 4G9YA 5GAEJ 5E3NA 3JW4A 2R92J 1QHHD 3PSFA 1I6HJ 5J3LA 3QP6A 5J4YA 3G1OA 3G71I 3QPHA 2DA4A 2VQGA 2BW3A 3CCSI 2R0QC 2VODA 2FXAA 2FBHA 2YU9J 4XLPF 4MEXF 3BQYA 3LSKA 4BKXA 2FQ3A 2J5OA 4M9SA 1LFPA 3P9KA 3OWTA 2OBPA 3HIFA 1SFEA 2KHMA 2NVYJ 3HOSA 2DDBA 2O9LA 4XNFA 1J59A 2NVQJ 2E35A 2M4GA 2K40A 3HUGA 3VB2A 1GVDA 2V1DA 4A5NA 4MHGA 3SEZA 3PQKA 2P6SA 3B02A 3W6KB 4GCVA 2DA3A 2ZSHB 1L3LA 1FPQA 2PMUA 5EG0B 5D8KB 1VFCA 3VODA 1IN5A 1U2WA 2CWEA 2LSOA 4M6YA 2L5QA 2JT1A 4BE0A 1HBXG 2QF7A 4ON0A 2GIVA 2VBYA 3WHCA 1LDDA 3GYHX 2XASA 5JFRA 4QSHA 4EM2A 1GVJA 2MC4A 2V7FA 2F5VA 2P5KA 1BR4A 1HQCA 5FLXZ 3CCJI 3CC7I 5E3LA 3DTEA 4P55A 5HDGA 4PJLA 3MKZA 1ZHFA 3LWFA
chains in the Genus database with same CATH topology
1MBKA 2XGDA 1ZQ3P 2XGCA 3HOXJ 2E19A 1BJZA 4BBSJ 1G2HA 1MBEA 3NAUA 3A03A 5E3OA 2YUSA 3TP0A 2MG4A 4C2MJ 1W0TA 4QIWN 1X2NA 4CYCA 2DA6A 3A01A 5EZHA 1JTYA 1K83J 3WHBA 3S14J 1BW6A 3PM1A 2IAIA 4A3IJ 5M5YJ 2FD5A 2RAEA 1HCRA 1P7JA 2GLOA 2ZB9A 4QTRA 3BG5A 2CU7A 3CQZJ 5EYRA 4A93J 3M3YJ 1FEXA 5EG0A 1ZR2A 1B72B 2YS9A 3IV5A 5FJ8J 2EH3A 2L7MP 1T56A 1MBHA 4D7MA 3TW6A 5M5WJ 5K7FA 1NK2P 4FCYA 2M2EA 3BQZA 5F08A 5IYCJ 2E2HJ 2LY9A 3TW7A 2MGQA 1MSFC 3K7AJ 2ME6A 3LNQA 1UG2A 4M3FA 4V2FA 4IHYA 4AYBN 2L0KA 2JK3A 2XB5A 1TC3C 4M3DA 2NS7A 5FLVA 1HDPA 2N8GA 2O7OA 5HODA 2JA6J 1IC8A 3Q3SA 4EEFG 3GBGA 3D1NI 2R7ZJ 1A6IA 1I50J 3M4OJ 1MBFA 3GTLJ 2WAQN 2KT0A 2HYJA 2L7FP 3JRIA 4D5CA 4S0HB 2LTPA 1H89C 3ZQCA 2R5YA 4JYKA 1NK3P 3HOZJ 5IYDJ 2EZHA 2CUFA 3B6CA 1QVUA 3S16J 1Z77A 1JT6A 3BR0A 5M3FJ 2Y31A 3HDDA 1WPKA 3DCFA 3F0CA 2FJ1A 4UUSB 2KDZA 1JTXA 2EZLA 2R5ZA 4BXXJ 1H8AC 2XRLA 3BG3A 1DU0A 1PUFB 4M6VA 1RESA 1VI0A 1UHSA 2DMUA 2CRGA 2HOAA 1BL0A 1YRNA 4FTHA 1MBJA 3S17J 3SJMA 2X6OA 3LSJA 4Y7NJ 1OCPA 4NDLA 2EZIA 2CQQA 2XB0X 2DJNA 2FQ4A 3PO2J 2IEKA 3HOVJ 1ETOA 3OOUA 2X9DA 1Y1VJ 5IP7J 1POGA 1MSEC 3LSGA 1T33A 2M0CA 2HXIA 3HGYA 4C3IJ 1IGNA 2DA7A 4A3LJ 2JA7J 1GDTA 5C4JJ 5IPAA 1U9OA 1JUSA 1RKWA 1Z0XA 2ECBA 3CMYA 1OJLA 2LVSA 2XPWA 5IOZA 4L5EA 1XS9A 4FISA 2CQXA 3FISA 4MFDA 3HOUJ 4MIMA 1QRYA 3RQIA 1FTZA 2DMPA 2W48A 2LK2A 3H0GJ 5F0FA 1NTCA 1MNMC 1WH5A 3ZQHA 3MVPA 2ID3A 3O8GA 1LFBA 3Q0VA 1IJWC 1JKRC 1IV6A 1ZKGA 3Q0WA 1BW5A 3BTIA 4BBRJ 3QPSA 2LD5A 5K7HA 2HDDA 3JRHA 1PUFA 1Q1VA 5BNGA 2ECCA 4C3JJ 3RZOJ 1AU7A 1UMQA 1VF9A 1QPIA 1HDDC 5FKOA 1RR7A 5DS9A 3JRGA 3B6AA 5IOYA 2Y9ZA 3HBLA 3H3VK 2OF7A 1HOMA 3LOCA 5EEAA 3JRFA 1ETWA 2DA5A 3OSGA 2DMQA 2M8GX 2MW8A 1Y1WJ 3HOYJ 1GUUA 1JUMA 5EDNA 5K7ZA 4IHXA 3S15J 2P81A 3A02A 3W6VA 4A3BJ 3ZOBA 1JUPA 2TCTA 4BY1J 5FKNA 4D7NA 1ZTRA 1FTTA 1ENHA 1TWHJ 3BTJA 3JRBA 2JMWA 3FKIJ 1EF4A 4XRMA 5FLMJ 1D5YA 2CUEA 1ETQA 2WB1N 2JA8J 3MN2A 1ETVA 2L7ZA 4DYCA 2NOGA 2COBA 3RZDJ 5EF6A 1B8IB 3JRAA 1SANA 3LSPA 2EQRA 4MO7A 5JLWA 1U9NA 4A3DJ 2HI3A 4JX6A 3ZQIA 1A5JA 3SDGA 4M3EA 2ELKA 3MKLA 1TWAJ 2CJJA 2TRTA 3ZQGA 3L1PA 3HM5A 3QQAA 4A3MJ 2O8KA 3HEFA 3GTMJ 3BR6A 3ZQFA 4UUTA 3S1RJ 1ZGWA 1MBGA 1LE8B 4FE7A 2DTZA 3IH2A 2EBIA 3JREA 4A69C 3TP3A 5DTDA 1ETYA 1F36A 2LLKA 3UKGA 1MH3A 4D5FA 1FIPA 1IDYA 1JKOC 1JKPC 4DZJA 1IDZA 3I4NJ 5EGOB 1AKHB 2LFBA 3G1LA 5M5XJ 4A3JJ 1B72A 1WGXA 1X58A 2HQ5A 4RDUA 3K2AA 1XC5A 1RKTA 3S1NJ 2JN6A 2K9QA 1GV2A 2D5VA 2K9NA 3QPLA 2XPUA 5C4XJ 5IYBJ 2DN0A 2LP0A 3HOWJ 5E3MA 1RPWA 2E2IJ 1MH4A 5F0CA 2VUMJ 1W0UA 1ETKA 1IUFA 1QVTA 2WV1A 2GM4A 2LKXA 2Y2ZA 5F1JA 5GPCA 1ZR4A 4DZPA 4CYCB 2VPRA 3A01B 3GTGJ 2DA1A 1LE8A 3BR1A 3HB9A 5F04A 1R9TJ 4MFEA 5FKMA 1I3QJ 4J19A 2E1OA 4I76A 4IHWA 2AHQA 4X1EA 2HXOA 1X2MA 3HGGA 4W1UA 1RETA 4XIDA 4UUSA 1P7IA 3TEDA 4DYRA 2GBYA 5M3MJ 4HNVA 1OCTC 3NARA 3GTJJ 5IP6A 1S7EA 5F27A 3FK6A 3S2HJ 4Y52J 1JJ6C 1ZK8A 3GTKJ 1CQTA 3S2DJ 3JRDA 1WI3A 2MSYA 1IRZA 1GT0C 5J1UA 2AO9A 2B63J 3OSFA 2JWTA 3S1MJ 3I4MJ 4G12A 3OIOA 5GP9A 2NVTJ 4X6AJ 4LOCA 4JX4A 4BY7J 5GPAA 9ANTA 2G0EA 2VI6A 2FX0A 4M3GA 1O4XA 3CCYA 4A3GJ 1E3OC 4A3FJ 2ID6A 1ETXA 4AC0A 2R93J 3Q0UA 5J1RA 2E2JJ 1WCMJ 2JA5J 2R5YB 2DMNA 3VPRA 3SFIA 1K61A 5C3EJ 2XSDC 4JP0A 1F43A 2Y9YA 3HKZN 3FIWA 2VKEA 3GTOJ 2HOSA 3O8HA 4ABZA 2R5ZB 4JX5A 1TWCJ 1OFCX 3BTLA 3DEWA 2QCOA 1ORKA 1YRNB 4V2GA 3JR9A 1HLVA 5FKKA 1HF0A 1TWGJ 3ZQLA 1JGGA 4IEJA 1JT0A 1LFUP 3GTQJ 4XK4A 3S1QJ 2LR8A 2XPVA 2K9SA 1H88C 4XRSA 4B4CA 4C3HJ 1FIAA 1ITYA 3IH4A 5EZGA 2M9HA 4A3KJ 1AHDP 2Y0SN 4DYQA 2I10A 3RKQA 5J1YA 4A3CJ 2OPTA 1BA5A 2H8RA 1JJ8C 2H1KA 1DU6A 1GV5A 2M34A 1WH7A 1JKQC 4MLOA 1U78A 5FKLA 4M3BA 3LSRA 1B8IA 4FE4A 5C44J 1FJLA 4AUXA 3G1MA 2L9RA 1SFOJ 5E3NA 2R92J 2IBDA 2NS8A 5J3LA 1I6HJ 1TWFJ 3G1OA 2DA4A 4B1RA 2R0QC 2NVXJ 2YU9J 3BT9A 4XRSG 3BQYA 4BKXA 1APLC 2DMTA 3BR3A 2ME0A 5JLXA 2Y30A 4IHVA 3CDLA 2HOTA 3BR2A 2NVYJ 2EZKA 1XG1A 4I6ZA 2O9LA 3FK7A 3BTCA 2NVQJ 2K40A 1VNDA 1GVDA 4A3EJ 3JRCA 2PMZN 2X48A 5EGOA 1AKHA 3PO3J 2DA3A 3IH3A 5EG0B 1VFCA 4B3AA 2QF7A 4W97A 3WHCA 2VKVA 4QSHA 5F0HA 5IP9J 2XGEA 4XICA 3GTPJ 1U8BA 4GFBA 3BG9A 1IG7A 3C2BA 2DA2A 4DW6A 4RBOA 3BR5A 2JJ7A 5E3LA 3E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBK A;  2XGD A;  1ZQ3 P;  2XGC A;  3HOX J;  2E19 A;  1BJZ A;  4BBS J;  1G2H A;  1MBE A;  3NAU A;  3A03 A;  5E3O A;  2YUS A;  3TP0 A;  2MG4 A;  4C2M J;  1W0T A;  4QIW N;  1X2N A;  4CYC A;  2DA6 A;  3A01 A;  5EZH A;  1JTY A;  1K83 J;  3WHB A;  3S14 J;  1BW6 A;  3PM1 A;  2IAI A;  4A3I J;  5M5Y J;  2FD5 A;  2RAE A;  1HCR A;  1P7J A;  2GLO A;  2ZB9 A;  4QTR A;  3BG5 A;  2CU7 A;  3CQZ J;  5EYR A;  4A93 J;  3M3Y J;  1FEX A;  5EG0 A;  1ZR2 A;  1B72 B;  2YS9 A;  3IV5 A;  5FJ8 J;  2EH3 A;  2L7M P;  1T56 A;  1MBH A;  4D7M A;  3TW6 A;  5M5W J;  5K7F A;  1NK2 P;  4FCY A;  2M2E A;  3BQZ A;  5F08 A;  5IYC J;  2E2H J;  2LY9 A;  3TW7 A;  2MGQ A;  1MSF C;  3K7A J;  2ME6 A;  3LNQ A;  1UG2 A;  4M3F A;  4V2F A;  4IHY A;  4AYB N;  2L0K A;  2JK3 A;  2XB5 A;  1TC3 C;  4M3D A;  2NS7 A;  5FLV A;  1HDP A;  2N8G A;  2O7O A;  5HOD A;  2JA6 J;  1IC8 A;  3Q3S A;  4EEF G;  3GBG A;  3D1N I;  2R7Z J;  1A6I A;  1I50 J;  3M4O J;  1MBF A;  3GTL J;  2WAQ N;  2KT0 A;  2HYJ A;  2L7F P;  3JRI A;  4D5C A;  4S0H B;  2LTP A;  1H89 C;  3ZQC A;  2R5Y A;  4JYK A;  1NK3 P;  3HOZ J;  5IYD J;  2EZH A;  2CUF A;  3B6C A;  1QVU A;  3S16 J;  1Z77 A;  1JT6 A;  3BR0 A;  5M3F J;  2Y31 A;  3HDD A;  1WPK A;  3DCF A;  3F0C A;  2FJ1 A;  4UUS B;  2KDZ A;  1JTX A;  2EZL A;  2R5Z A;  4BXX J;  1H8A C;  2XRL A;  3BG3 A;  1DU0 A;  1PUF B;  4M6V A;  1RES A;  1VI0 A;  1UHS A;  2DMU A;  2CRG A;  2HOA A;  1BL0 A;  1YRN A;  4FTH A;  1MBJ A;  3S17 J;  3SJM A;  2X6O A;  3LSJ A;  4Y7N J;  1OCP A;  4NDL A;  2EZI A;  2CQQ A;  2XB0 X;  2DJN A;  2FQ4 A;  3PO2 J;  2IEK A;  3HOV J;  1ETO A;  3OOU A;  2X9D A;  1Y1V J;  5IP7 J;  1POG A;  1MSE C;  3LSG A;  1T33 A;  2M0C A;  2HXI A;  3HGY A;  4C3I J;  1IGN A;  2DA7 A;  4A3L J;  2JA7 J;  1GDT A;  5C4J J;  5IPA A;  1U9O A;  1JUS A;  1RKW A;  1Z0X A;  2ECB A;  3CMY A;  1OJL A;  2LVS A;  2XPW A;  5IOZ A;  4L5E A;  1XS9 A;  4FIS A;  2CQX A;  3FIS A;  4MFD A;  3HOU J;  4MIM A;  1QRY A;  3RQI A;  1FTZ A;  2DMP A;  2W48 A;  2LK2 A;  3H0G J;  5F0F A;  1NTC A;  1MNM C;  1WH5 A;  3ZQH A;  3MVP A;  2ID3 A;  3O8G A;  1LFB A;  3Q0V A;  1IJW C;  1JKR C;  1IV6 A;  1ZKG A;  3Q0W A;  1BW5 A;  3BTI A;  4BBR J;  3QPS A;  2LD5 A;  5K7H A;  2HDD A;  3JRH A;  1PUF A;  1Q1V A;  5BNG A;  2ECC A;  4C3J J;  3RZO J;  1AU7 A;  1UMQ A;  1VF9 A;  1QPI A;  1HDD C;  5FKO A;  1RR7 A;  5DS9 A;  3JRG A;  3B6A A;  5IOY A;  2Y9Z A;  3HBL A;  3H3V K;  2OF7 A;  1HOM A;  3LOC A;  5EEA A;  3JRF A;  1ETW A;  2DA5 A;  3OSG A;  2DMQ A;  2M8G X;  2MW8 A;  1Y1W J;  3HOY J;  1GUU A;  1JUM A;  5EDN A;  5K7Z A;  4IHX A;  3S15 J;  2P81 A;  3A02 A;  3W6V A;  4A3B J;  3ZOB A;  1JUP A;  2TCT A;  4BY1 J;  5FKN A;  4D7N A;  1ZTR A;  1FTT A;  1ENH A;  1TWH J;  3BTJ A;  3JRB A;  2JMW A;  3FKI J;  1EF4 A;  4XRM A;  5FLM J;  1D5Y A;  2CUE A;  1ETQ A;  2WB1 N;  2JA8 J;  3MN2 A;  1ETV A;  2L7Z A;  4DYC A;  2NOG A;  2COB A;  3RZD J;  5EF6 A;  1B8I B;  3JRA A;  1SAN A;  3LSP A;  2EQR A;  4MO7 A;  5JLW A;  1U9N A;  4A3D J;  2HI3 A;  4JX6 A;  3ZQI A;  1A5J A;  3SDG A;  4M3E A;  2ELK A;  3MKL A;  1TWA J;  2CJJ A;  2TRT A;  3ZQG A;  3L1P A;  3HM5 A;  3QQA A;  4A3M J;  2O8K A;  3HEF A;  3GTM J;  3BR6 A;  3ZQF A;  4UUT A;  3S1R J;  1ZGW A;  1MBG A;  1LE8 B;  4FE7 A;  2DTZ A;  3IH2 A;  2EBI A;  3JRE A;  4A69 C;  3TP3 A;  5DTD A;  1ETY A;  1F36 A;  2LLK A;  3UKG A;  1MH3 A;  4D5F A;  1FIP A;  1IDY A;  1JKO C;  1JKP C;  4DZJ A;  1IDZ A;  3I4N J;  5EGO B;  1AKH B;  2LFB A;  3G1L A;  5M5X J;  4A3J J;  1B72 A;  1WGX A;  1X58 A;  2HQ5 A;  4RDU A;  3K2A A;  1XC5 A;  1RKT A;  3S1N J;  2JN6 A;  2K9Q A;  1GV2 A;  2D5V A;  2K9N A;  3QPL A;  2XPU A;  5C4X J;  5IYB J;  2DN0 A;  2LP0 A;  3HOW J;  5E3M A;  1RPW A;  2E2I J;  1MH4 A;  5F0C A;  2VUM J;  1W0U A;  1ETK A;  1IUF A;  1QVT A;  2WV1 A;  2GM4 A;  2LKX A;  2Y2Z A;  5F1J A;  5GPC A;  1ZR4 A;  4DZP A;  4CYC B;  2VPR A;  3A01 B;  3GTG J;  2DA1 A;  1LE8 A;  3BR1 A;  3HB9 A;  5F04 A;  1R9T J;  4MFE A;  5FKM A;  1I3Q J;  4J19 A;  2E1O A;  4I76 A;  4IHW A;  2AHQ A;  4X1E A;  2HXO A;  1X2M A;  3HGG A;  4W1U A;  1RET A;  4XID A;  4UUS A;  1P7I A;  3TED A;  4DYR A;  2GBY A;  5M3M J;  4HNV A;  1OCT C;  3NAR A;  3GTJ J;  5IP6 A;  1S7E A;  5F27 A;  3FK6 A;  3S2H J;  4Y52 J;  1JJ6 C;  1ZK8 A;  3GTK J;  1CQT A;  3S2D J;  3JRD A;  1WI3 A;  2MSY A;  1IRZ A;  1GT0 C;  5J1U A;  2AO9 A;  2B63 J;  3OSF A;  2JWT A;  3S1M J;  3I4M J;  4G12 A;  3OIO A;  5GP9 A;  2NVT J;  4X6A J;  4LOC A;  4JX4 A;  4BY7 J;  5GPA A;  9ANT A;  2G0E A;  2VI6 A;  2FX0 A;  4M3G A;  1O4X A;  3CCY A;  4A3G J;  1E3O C;  4A3F J;  2ID6 A;  1ETX A;  4AC0 A;  2R93 J;  3Q0U A;  5J1R A;  2E2J J;  1WCM J;  2JA5 J;  2R5Y B;  2DMN A;  3VPR A;  3SFI A;  1K61 A;  5C3E J;  2XSD C;  4JP0 A;  1F43 A;  2Y9Y A;  3HKZ N;  3FIW A;  2VKE A;  3GTO J;  2HOS A;  3O8H A;  4ABZ A;  2R5Z B;  4JX5 A;  1TWC J;  1OFC X;  3BTL A;  3DEW A;  2QCO A;  1ORK A;  1YRN B;  4V2G A;  3JR9 A;  1HLV A;  5FKK A;  1HF0 A;  1TWG J;  3ZQL A;  1JGG A;  4IEJ A;  1JT0 A;  1LFU P;  3GTQ J;  4XK4 A;  3S1Q J;  2LR8 A;  2XPV A;  2K9S A;  1H88 C;  4XRS A;  4B4C A;  4C3H J;  1FIA A;  1ITY A;  3IH4 A;  5EZG A;  2M9H A;  4A3K J;  1AHD P;  2Y0S N;  4DYQ A;  2I10 A;  3RKQ A;  5J1Y A;  4A3C J;  2OPT A;  1BA5 A;  2H8R A;  1JJ8 C;  2H1K A;  1DU6 A;  1GV5 A;  2M34 A;  1WH7 A;  1JKQ C;  4MLO A;  1U78 A;  5FKL A;  4M3B A;  3LSR A;  1B8I A;  4FE4 A;  5C44 J;  1FJL A;  4AUX A;  3G1M A;  2L9R A;  1SFO J;  5E3N A;  2R92 J;  2IBD A;  2NS8 A;  5J3L A;  1I6H J;  1TWF J;  3G1O A;  2DA4 A;  4B1R A;  2R0Q C;  2NVX J;  2YU9 J;  3BT9 A;  4XRS G;  3BQY A;  4BKX A;  1APL C;  2DMT A;  3BR3 A;  2ME0 A;  5JLX A;  2Y30 A;  4IHV A;  3CDL A;  2HOT A;  3BR2 A;  2NVY J;  2EZK A;  1XG1 A;  4I6Z A;  2O9L A;  3FK7 A;  3BTC A;  2NVQ J;  2K40 A;  1VND A;  1GVD A;  4A3E J;  3JRC A;  2PMZ N;  2X48 A;  5EGO A;  1AKH A;  3PO3 J;  2DA3 A;  3IH3 A;  5EG0 B;  1VFC A;  4B3A A;  2QF7 A;  4W97 A;  3WHC A;  2VKV A;  4QSH A;  5F0H A;  5IP9 J;  2XGE A;  4XIC A;  3GTP J;  1U8B A;  4GFB A;  3BG9 A;  1IG7 A;  3C2B A;  2DA2 A;  4DW6 A;  4RBO A;  3BR5 A;  2JJ7 A;  5E3L A;  3E7L A; 
#chains in the Genus database with same CATH topology
 4LLG F;  1W7P A;  3RCO A;  3HOX J;  4BBS J;  2M8E A;  1F4K A;  3F8N A;  3OS0 A;  3ZMV A;  2PLY A;  3A03 A;  4A6D A;  5D8L B;  2MG4 A;  3FBI B;  4BAC A;  3H3Z A;  1P9Q C;  3I56 I;  3ESW B;  3KIO A;  3M1C A;  2XF6 A;  4NBQ A;  4IOC F;  1NH3 A;  2K7L A;  5HS9 A;  3PNT A;  1MGT A;  3H3U A;  3MFK A;  2LY2 A;  2OZ6 A;  5M5Y J;  5LEJ A;  2YSR A;  1P7J A;  5L3D A;  1RC9 A;  4QTR A;  5J8C A;  3KEO A;  1IZ1 A;  4IQ4 A;  5EG0 A;  2FUG 2;  3C3W A;  1B72 B;  4BQN A;  2MLG A;  2F4M B;  4RAZ A;  4D7M A;  1MBH A;  4UVB A;  2F5C A;  3DLA A;  5CVJ A;  2M2E A;  3SZT A;  5K7F A;  4BDY A;  1LKX A;  2E2H J;  2ME6 A;  4V2F A;  4EVI A;  1LUJ B;  1IRF A;  1WJE A;  2JK3 A;  5ICF A;  1MJB A;  1BR1 A;  2COM A;  4I02 A;  4N9I A;  1IN4 A;  3KYD B;  2NS7 A;  1PP7 U;  2VBW A;  1HDP A;  4XON A;  2W84 A;  2VXD A;  4BE1 A;  3OMY A;  2RQP A;  4EEF G;  3I3L A;  3GBG A;  3BZC A;  3FXR A;  4YFK F;  3K69 A;  5TGT A;  3M4O J;  4BU2 A;  2A6H F;  4M74 A;  4KNY A;  1IW7 F;  2QM3 A;  2X1E A;  1SD4 A;  2FF4 A;  2KT0 A;  3JRI A;  2EK5 A;  4BJ6 C;  4S0H B;  1H89 C;  2DT5 A;  3FXL A;  5DCM A;  2R5Y A;  1JGS A;  2VN2 A;  4HQM A;  3HOZ J;  1W36 D;  1Z77 A;  2RRE A;  4HA8 A;  5M3F J;  4KA4 A;  3HDD A;  3F21 A;  3X2Q H;  2ZJP F;  3V8J A;  3KZZ A;  1F5T A;  4IVN A;  1WQ2 A;  4U7B A;  2QSF X;  2XKP A;  2EZL A;  4I98 B;  2NNN A;  2L9S A;  3IWF A;  3BG3 A;  1DU0 A;  4L0Z B;  4AM3 A;  3F6O A;  1PUF B;  1RES A;  1B6A A;  3R0J A;  4NB5 A;  2DMU A;  2CRG A;  2HOA A;  1YQA A;  1MZB A;  3NRV A;  2QSG X;  2LBF B;  2LRD A;  4B8X A;  3T5X A;  1MMA A;  3OYC A;  2KQR A;  2WWY A;  1QO0 D;  2BXY A;  2ZFU A;  3TOA A;  3P7N A;  3MEX A;  1Q1H A;  1J75 A;  1BI1 A;  1KQ0 A;  1POG A;  2RGV A;  1R4N B;  3LSG A;  2JVG A;  2CUJ A;  2W00 A;  4BHB A;  4IO9 F;  4CCO A;  3HGY A;  4PCQ A;  5IT9 Z;  2DA7 A;  2E34 A;  2HPI A;  1K7A A;  2H1L A;  3QP5 A;  4ZZD A;  5C4J J;  3HKZ A;  1E3P A;  3CMY A;  3MZH A;  4EM1 A;  3GF2 A;  1X1D A;  1A31 A;  4E7J A;  2WY7 Q;  3P5J A;  4RGR A;  1P4X A;  1OCZ H;  1TTY A;  1XCB A;  5TRD A;  2VIX A;  3FBN B;  2LKP A;  4OAZ A;  1EKE A;  4BBR J;  4R79 A;  1XTA A;  2MA3 A;  4OMZ A;  4YIR X;  1PUF A;  2EJR A;  3WTT C;  2IA0 A;  4RGU A;  1ZRF A;  3I71 A;  4GO1 A;  1QPI A;  5TJJ A;  2HQA A;  1B59 A;  1QPM A;  2DI3 A;  1RR7 A;  4HV5 A;  5DS9 A;  1X3Z B;  3H9G A;  3CTA A;  3FF5 A;  2UXN A;  2VKD A;  5K1Y A;  2DT7 B;  2E60 A;  4MQV A;  5ICC A;  1FOW A;  1D8J A;  2DK5 A;  1S72 I;  1G4D A;  2OF7 A;  3TGN A;  1HOM A;  5D5V B;  1E17 A;  2YX7 A;  4S04 A;  3JRF A;  2MW8 A;  3OR1 C;  2FBK A;  1GUU A;  1LDJ A;  2DPD A;  2ZSI B;  3K4B A;  2X6W A;  4IHX A;  4RMN A;  1FLI A;  2XGX A;  3VYS B;  2P81 A;  3W6V A;  3ZOB A;  5FKN A;  2CW0 F;  1ZTR A;  1YOV B;  4U0V A;  4HNU A;  3BTJ A;  3SFZ A;  4XR6 A;  4EQQ A;  5BOX A;  2OD5 A;  4XRM A;  4XOT A;  5FLM J;  5JI6 A;  1Y56 A;  1MMG A;  2BGC A;  4CCJ A;  2KZV A;  3NWT A;  3MN2 A;  1ETV A;  4G8X A;  3HOT A;  4DYC A;  3RQ4 A;  2COB A;  5FD5 A;  5EF6 A;  1SAN A;  4LIU A;  1G8X A;  1VQ7 I;  4CYD A;  1Z3Y A;  2DFH A;  2EQR A;  1K6O A;  5JLW A;  1U9N A;  3WTZ A;  2AS5 F;  1FMV A;  5KAF C;  1A5J A;  3GCM A;  2HVQ A;  1DGR M;  4M3E A;  1PP8 F;  1XDS A;  1U6G A;  2E1N A;  2DOF A;  2QYO A;  3BP8 A;  3WTY C;  3ZQG A;  4D1Q A;  3DKY A;  1TT5 B;  3WG9 A;  3QQA A;  2VLA A;  1Z7U A;  4A3M J;  3L2C A;  3G73 A;  3GTM J;  3CMM A;  3MZY A;  5D6E A;  1Z6T A;  2DYR H;  2K02 A;  3ASN H;  3AG4 H;  2EBI A;  3ONQ A;  1W36 C;  2ELH A;  2EFN A;  2UUZ A;  5CVU A;  5H20 A;  1ETY A;  4UNO A;  2HPM A;  4LMY A;  1I1S A;  3ZQQ A;  1BJA A;  1XMK A;  2G7H A;  2KFD A;  3JTH A;  3HRM A;  5DCF A;  5D4S A;  1WGX A;  1K78 B;  5HS8 A;  2HQ5 A;  3PNY A;  3MAJ A;  4QWQ A;  2JZY A;  1FY7 A;  1D0Y A;  1RKT A;  1TQM A;  5KK1 A;  5A2Q Z;  1EJ9 A;  1B9N A;  2K9Q A;  3QPL A;  2XPU A;  2DN0 A;  2LP0 A;  3KFW X;  3J81 K;  2EFP A;  4HRI A;  2RKH A;  5E3M A;  2CUZ A;  1G3T A;  2HVS A;  2A3S A;  3DPL C;  2DLL A;  4MQ9 F;  4EJO A;  4UV8 A;  4AIJ A;  1KQ8 A;  2F2E A;  1X3W B;  2KIU A;  1LVK A;  2VUM J;  1U5T B;  3BPX A;  1J7K A;  2GM4 A;  2A61 A;  5CYV A;  3QRF F;  2PG4 A;  1UST A;  2FOK A;  3BWG A;  5J4V A;  4RB2 C;  2DO7 A;  5LBQ A;  4WXC A;  4ZC3 A;  2ZNZ A;  2ZCW A;  1MND A;  1MD0 A;  5F04 A;  2HKX A;  4HSR A;  2XAJ A;  4MFE A;  2VC0 A;  2W82 A;  2ISY A;  4I76 A;  1R00 A;  1W5S A;  1G3S A;  2CO5 A;  1G3Y A;  2HDW A;  4XID A;  1IUY A;  2Q8K A;  4UUS A;  1P7I A;  4AYB A;  4XLC A;  1D5V A;  3EDP A;  3R6S A;  1VQ9 I;  2Z1D A;  1GXP A;  3CF5 F;  3V8K A;  3PUB A;  3CCU I;  2DW4 A;  1SD7 A;  2MSY A;  1R1V A;  2DJI A;  5FLX K;  1FBQ A;  5LHH A;  2A5W A;  3OSF A;  1WJ5 A;  1ZAO A;  3DBH B;  3OL3 A;  1U5T C;  3F6V A;  2DQL A;  1BN5 A;  5GP9 A;  3BCA A;  4BEH B;  2VON A;  3CES A;  2X85 A;  3SEQ A;  4JX4 A;  3CC4 I;  4DOZ A;  2ZNY A;  2ADU A;  2QEN A;  2VXZ A;  4M3G A;  1O4X A;  1REP C;  3R4K A;  1DP7 P;  4A3G J;  4A3F J;  2AXT C;  1T38 A;  1ETX A;  4IQJ A;  4AC0 A;  2R93 J;  4Y13 A;  2ZXW H;  4I09 A;  2H6B A;  5J1R A;  2E2J J;  1FSE A;  1WCM J;  3GLL A;  2JA5 J;  3BZ6 A;  1VQM I;  3VPR A;  1K61 A;  3SFI A;  2EV5 A;  2XSD C;  4IHS A;  3WOD F;  2Y9Y A;  3MKW B;  1S8N A;  3FIW A;  2VKE A;  3GTO J;  2HOS A;  4L5J A;  3N4M A;  5BPD A;  1P6R A;  1HKS A;  1HST A;  3O8H A;  4Z6Y A;  3K0L A;  4IRG A;  2BVL A;  2VL8 A;  1OFC X;  3BTL A;  1UFM A;  3E1S A;  2XVC A;  1ORK A;  2ZJQ F;  1I39 A;  1EV7 A;  3NWS A;  2ZJR F;  1YRN B;  4CGZ A;  1HF0 A;  5GTH C;  3ZQL A;  4IEJ A;  3FXU A;  3NEU A;  3RJP A;  3GTQ J;  4G7O F;  2WBM A;  3G4S I;  2XPV A;  2CGP A;  3S3M A;  2VJ5 A;  5F6F A;  2W57 A;  2XV4 S;  1R58 A;  4XRS A;  3KPH A;  5KNL A;  1KYW A;  3K1M A;  1XX5 A;  5EZG A;  1ACI A;  5B66 C;  4U87 A;  4A3K J;  2PJR A;  4XOR A;  4DYQ A;  4A3C J;  2VOP A;  4XRF A;  2OPT A;  1BA5 A;  4WXH A;  2H8R A;  2KLO A;  1PUE E;  3VOE A;  1GXQ A;  2M34 A;  3K1N A;  3I55 I;  5E79 C;  1FNN A;  2YU3 A;  2F48 A;  4FE4 A;  1X1A A;  2NRA C;  2GOX B;  1FJL A;  1G3W A;  2IPQ X;  4AUX A;  3JAM Z;  2L9R A;  1WI9 A;  4I7H A;  5D4R A;  1U3E M;  2IBD A;  2NS8 A;  2RV8 A;  5KCM A;  2C6Y A;  2RN7 A;  4DBQ A;  1YS6 A;  1O3T A;  3H5N A;  3K4L A;  2W4S A;  1R6R A;  2DMT A;  4YEL A;  4F3Q A;  3E5U A;  5JLX A;  2RNJ A;  1OIS A;  2Y30 A;  3HJE A;  1RUO A;  3LQR A;  3CDL A;  4A2U A;  1ODD A;  1OLT A;  4UB6 C;  2VJJ A;  1RZ4 A;  2CG4 A;  3FK7 A;  3BTC A;  3HRS A;  1VND A;  4A3E J;  2XSJ C;  2WB1 A;  3RDI A;  3JRC A;  2PMZ N;  2X48 A;  2ESN A;  1AKH A;  2L01 A;  4EGZ A;  3IHU A;  4HLY A;  1LEA A;  1FYM A;  4XSZ F;  5IT9 K;  3WTX C;  3J7A Y;  4ZYD A;  5DEQ A;  4N9H A;  5FGM A;  2EIM H;  4LG3 A;  1SVM A;  3OYI A;  4KIG A;  4Y17 A;  4P9F A;  4KIF A;  5F0H A;  2XGE A;  4XIC A;  3GTP J;  2L02 A;  1SMT A;  3Q9V A;  4UB8 C;  4XLA A;  2DA2 A;  3BR5 A;  3TO6 A;  4L0Y B;  2BVM A;  1R1U A;  1L0O C;  3PIO F;  2M3A A;  1MBK A;  1Y8R B;  4E7K A;  3U2R A;  5J40 A;  2XGC A;  2B9S A;  1G2H A;  3BZK A;  3OYH A;  2HTJ A;  3KEY A;  3ZRG A;  2DAO A;  2VE8 A;  3DU5 A;  1Z6R A;  2DOA A;  3NAU A;  4GXO A;  4ZYG A;  2YUS A;  2O5R A;  2GA2 A;  3OS2 A;  1U8R A;  4PSX A;  2XAU A;  4ZJZ A;  1FYK A;  4CYC A;  1OR7 A;  1SVL A;  2XDV A;  2IS6 A;  3GX4 X;  3DEE A;  3FMR A;  4C9Y A;  3H35 A;  1K83 J;  3S14 J;  3C1D A;  2VBX A;  5CJ9 A;  1O3Q A;  3PM1 A;  2IAI A;  2VT2 A;  4XM3 A;  4HW0 A;  1T6S A;  2ISZ A;  1HCR A;  2GLO A;  3T0Y A;  3DBL B;  3LAJ A;  3R60 A;  2OZU A;  3CQZ J;  3L2R A;  3F8B A;  3SZP A;  1EA3 A;  2UV1 A;  5DUK A;  4H0E A;  1FEX A;  5FD6 A;  4IPA A;  1E0E A;  4XN0 A;  1WFX A;  1XSX A;  2L9N A;  5FJ8 J;  3JTG A;  5HDN A;  1D1B A;  2LG4 A;  1T56 A;  4HEA 2;  5M5W J;  3W2A A;  1BI0 A;  2VPL A;  3BQZ A;  3EET A;  5F08 A;  2LNB A;  2JPB A;  1G59 A;  4IZZ A;  1XSV A;  2MGQ A;  1MMN A;  3HSE A;  3K7A J;  3MWM A;  4EGY A;  3EQL F;  3JSO A;  1BM9 A;  3CO6 C;  2JVH A;  5DD4 A;  3LST A;  1TW2 A;  1S7A A;  2O8X A;  3I59 B;  3KYC B;  4K2E A;  4L5I A;  4ESF A;  3OV8 A;  4RAF A;  5HOD A;  3V4G A;  1YS7 A;  1IC8 A;  2QBY B;  3ELK A;  3Q9S A;  2LOO A;  2ACJ A;  3WE2 A;  1PYV A;  2JRT A;  3H92 A;  1UCR A;  3HZJ A;  4JQF A;  3GTL J;  2WAQ N;  3CCL I;  2VQH A;  2MYS A;  4MTE A;  2CQK A;  4BYY A;  4JYK A;  1R22 A;  3G2B A;  2EZH A;  3OYG A;  3HSF A;  3S16 J;  4HZF A;  1QGP A;  1WPK A;  1BIB A;  3W6J B;  2FJ1 A;  3E5Q A;  4S05 A;  2M5W A;  4ZTJ A;  1JTX A;  1ZYR F;  2EV6 A;  2R5Z A;  4OIQ F;  3CUO A;  3PJR A;  2BZT A;  3DV8 A;  3TBI A;  5A2Q K;  5FB2 A;  1FYL A;  5HLG A;  2J5P A;  1UHS A;  3MCZ A;  4AIH A;  2X1D A;  3I0T A;  2X6O A;  5CPR B;  3I5U A;  4NDL A;  2BBY A;  2MD5 A;  2IW5 A;  3F8F A;  4YII A;  1RRJ A;  4J01 A;  1BOA A;  2EZI A;  2CQQ A;  2KRH A;  2Q2E B;  2DJN A;  2V26 A;  3G3Z A;  5JHF A;  3CCV I;  3AFH A;  3HOV J;  3OOU A;  4V19 K;  3ERE D;  5BQT A;  2XKO A;  1DQU A;  4FAS D;  1MSE C;  1T33 A;  2M0C A;  4UVA A;  4HNT A;  2HXI A;  4CH7 A;  4RAY A;  3FHN A;  4C3I J;  5HNF A;  2HDC A;  3REO A;  2LC2 A;  4ETS A;  5IPA A;  1SVO A;  3CME I;  2MFZ A;  1OJL A;  2LVS A;  5CQE A;  3CLQ A;  1JXS A;  1P4A A;  3IWZ A;  4I0A A;  5IOZ A;  1XS9 A;  4B48 A;  1MIJ A;  4WX9 A;  2CQX A;  2R7D A;  2OCE A;  3MMY B;  4MIM A;  1R7J A;  4MFD A;  4CZC A;  3HOU J;  1MDM B;  1F1Z A;  1XN7 A;  3DFG A;  4HV6 A;  1FTZ A;  2GXA A;  3ERM A;  5F0F A;  1NTC A;  2O3F A;  1WH5 A;  5LRR A;  4CDG A;  1TL8 A;  2ID3 A;  4BS9 A;  4MTD A;  1JKR C;  1TLH B;  3Q0W A;  3KX2 A;  2GQQ A;  3CO7 C;  4L9T A;  2HDD A;  3JRH A;  4AVZ A;  2ECC A;  2XAG A;  4RS8 A;  3RZO J;  1UMQ A;  4M9Z A;  2X6Y A;  1VF9 A;  2BV6 A;  4KIS A;  1K4T A;  1MJA A;  4UUV A;  5IOY A;  3CCM I;  2Q2E A;  3DP7 A;  3HBL A;  2RNG A;  3FMQ A;  4FET A;  3ASO H;  3K4M A;  2GA1 A;  4U0Y A;  2BY1 A;  2VC1 A;  3ZQ7 A;  3CP2 A;  2G7U A;  4XOP A;  1JE8 A;  3L00 A;  3LOC A;  4O5V A;  5EEA A;  4A12 A;  2CV1 A;  3U1D A;  2IP2 A;  3AAF A;  1Y1W J;  1SAX A;  2K5C A;  1QBJ A;  3S15 J;  4JBA A;  3QYB A;  5DM7 F;  2ZXI A;  3F8C A;  3IAM 2;  1FBS A;  1E3H A;  4IOA F;  4D7N A;  2OCC H;  2XAH A;  3QOD A;  2R7U A;  3FKI J;  4HST A;  3TOB A;  5B1A H;  3TKY A;  4JOM A;  3MKY B;  2STW A;  2CUE A;  1ETQ A;  3RKY A;  3OYF A;  1S5L C;  2IA2 A;  5FRO A;  2XRO A;  2BYV E;  4KMU X;  2L7Z A;  4II3 A;  1O7L A;  5DYM A;  3S93 A;  3CCE I;  2NOG A;  1IAW A;  4N4O B;  3RZD J;  1MDM A;  3KYL A;  3CZ6 A;  1LVA A;  4NQW B;  3LSP A;  2OU2 A;  4OAY A;  2R7Q A;  4JX6 A;  1KU9 A;  3ZQI A;  3SDG A;  5AON A;  2ELK A;  3MKL A;  1IRG A;  2L9V A;  1TWA J;  2CYY A;  2CJJ A;  2TRT A;  4XKB A;  5LLQ A;  3L1P A;  3FXQ A;  4E4H A;  2O8K A;  4RM2 A;  3ZQF A;  1SEU A;  4UUT A;  3R0A A;  2V9K A;  1BIA A;  4OU0 A;  3IH2 A;  3VSK A;  2EWN A;  3NQO A;  1S7O A;  3JRE A;  2IRF G;  1UG0 A;  2DTR A;  3A1Y A;  3TP3 A;  2LLK A;  3LSI A;  2Z9O A;  1MH3 A;  4D5F A;  1FIP A;  1IDY A;  1IDZ A;  4RM3 A;  5EGO B;  1FZP B;  1YW7 A;  2L3D A;  2QQA A;  4A3J J;  3I4P A;  3VWB A;  3HHH A;  3K9T A;  1B72 A;  1YLF A;  3ABL H;  3K2A A;  5H6R A;  2BXZ A;  2EFO A;  3OYJ A;  3F72 A;  1HKQ A;  2FOW A;  1Y39 A;  3SDB A;  2K9N A;  2NXN B;  2RQQ A;  5L3E A;  3WGH A;  5HLT A;  1RR8 C;  2EIK H;  4PGH A;  4GGG A;  4A0Y A;  3J7Y J;  3OR2 C;  1RPW A;  1ZEL A;  4FQG A;  1MH4 A;  2M45 A;  4UXN A;  3JAM K;  2ELJ A;  3N97 A;  4ZTF A;  2LDU A;  4G94 A;  2HNH A;  1UHM A;  1FP1 D;  1ETK A;  2EFW A;  4G6Q A;  1ZGJ A;  2WV1 A;  3WU1 B;  2LF7 A;  2LKX A;  1UAA A;  2Y2Z A;  3DBR B;  3F23 A;  5J47 A;  4DZP A;  3KP7 A;  3J7A O;  2VPR A;  3A01 B;  3GTG J;  1YO5 C;  3K10 A;  2OTJ I;  2KP6 A;  4WXD A;  3M8J A;  2VT3 A;  1C0W A;  3HB9 A;  2QLZ A;  4IXA A;  3BLY A;  1R9T J;  3RKX A;  5HVQ C;  5HDK A;  2NS0 A;  3K4J A;  1I3Q J;  5F1R A;  4J19 A;  1QHG A;  2OQG A;  3BDD A;  2E36 A;  1SD6 A;  1Z05 A;  2AHQ A;  4HLX A;  4X1E A;  4AWX B;  3GFI A;  2HQR A;  3FMS A;  2A07 F;  2O6G E;  2STT A;  2E5N A;  1LJ9 A;  2K9L A;  3WGG A;  2O03 A;  5M3M J;  2RVC A;  2ZME B;  2O0Y A;  3NAR A;  4R1H A;  4LB6 B;  3GTJ J;  1DUX C;  3ZN0 A;  1U0J A;  2YR2 A;  4LFU A;  2R7F A;  1JJ6 C;  1XPX A;  3GO5 A;  4BXU A;  3D5S C;  1UZC A;  2HR3 A;  2QQ8 A;  2ZO4 A;  2LBF A;  3JRD A;  2XIG A;  4OIP F;  2FBI A;  2RC4 A;  4NNJ A;  2AO9 A;  2DCE A;  1Z67 A;  3S1M J;  3I4M J;  1FBU A;  5E1W A;  5E8I A;  2EA2 A;  2GZW A;  2X6X A;  4ENM A;  3LQQ A;  4M9X A;  3EPZ A;  4F7Z A;  1R5G A;  3ZXS A;  1DP3 A;  2DXI A;  4BY7 J;  5GPA A;  2KIQ A;  2M1B A;  4ENJ A;  1IXC A;  1OCC H;  2G0E A;  3DTK A;  1TQP A;  2VI6 A;  3IUO A;  1E3O C;  5LRS A;  2ID6 A;  2FML A;  3M8E A;  3GZN B;  3EUH C;  1RIO H;  3WTU C;  1V54 H;  2VOO A;  3I58 A;  4PJM A;  5CVR A;  2M30 A;  5J6X A;  2VE9 A;  4XLH A;  3ZN1 A;  2PBI A;  4BUP A;  4HX4 A;  2M7B A;  3ZGK A;  2L4M A;  1YE9 A;  4JP0 A;  4HG2 A;  3RTR A;  3PNV A;  1FP2 A;  2ZME C;  2LF8 A;  4ABZ A;  5JHU A;  1WSU A;  5LGN A;  4JX5 A;  4M73 A;  2JSP A;  4GYI A;  1TWC J;  4B47 A;  3H0D A;  3DEW A;  3RPU D;  2QCO A;  4JK1 X;  3FXM A;  4KMF A;  2R7W A;  1HLV A;  1QQI A;  3QPT A;  1D0Z A;  1JGG A;  4YIF A;  4TV7 A;  4UVC A;  3ZR8 X;  2K9S A;  3RYR A;  1KGS A;  1NG6 A;  1Z7L A;  3DLL F;  4U0W A;  1ITY A;  5EJC A;  3IH4 A;  4QPQ A;  4HDU A;  2CV2 A;  1VQK I;  3AL0 B;  5GAG J;  1XCV A;  2LH9 A;  2OC6 A;  4IRH A;  1AA7 A;  3K6G A;  2Y0S N;  3KP3 A;  5J1Y A;  3M9A A;  4HX8 A;  3RKQ A;  1HXD A;  1G6N A;  1OYW A;  3JCU C;  5D6F A;  2V1U A;  1WJF A;  4BNC A;  2CMP A;  4UY8 I;  2OJE D;  1I27 A;  1DU6 A;  2HZD A;  3IC7 A;  1JKQ C;  1XGM A;  2LRE A;  3EUA A;  1RI7 A;  3F3X A;  4A6E A;  2QZ8 A;  4M3B A;  3LSR A;  3V7R A;  1WZ2 A;  2PN6 A;  2LY1 A;  3DKW A;  3G1M A;  4CCN A;  1Y0U A;  2V1X A;  4XLE A;  3K4K A;  1TWF J;  2LKS A;  3D5R C;  3DXJ F;  4I99 C;  4O6J A;  2XF7 A;  4B1R A;  3BOQ A;  2H6C A;  1CF7 B;  3FKJ A;  3PIP F;  1XGO A;  2NVX J;  3A2K A;  3BT9 A;  4I2O A;  4RA2 A;  4XRS G;  3OYL A;  2KKO A;  4LIT A;  5K5R A;  1APL C;  1H9G A;  4IF4 A;  4IHV A;  1W1W E;  2HOT A;  2IXS A;  3TO7 A;  1B9M A;  1XG1 A;  2KRF A;  4I6Z A;  3U1K A;  5DV5 A;  5CKT A;  1PJR A;  2ZKZ A;  1O7F A;  1YTY A;  3AL0 C;  1A35 A;  3V42 A;  3C18 A;  3PO3 J;  1R49 A;  1OCO H;  3VDX A;  1R1T A;  4ZYH A;  2VAS A;  1K78 A;  2K9M A;  2A05 A;  4B3A A;  1ZG5 A;  2D45 A;  4WWC A;  2W7N A;  4M6X A;  3GFM A;  3WG7 H;  1SMY F;  4NUB A;  5IP9 J;  2UWM A;  4GFB A;  3EYI A;  3BG9 A;  4IL6 C;  3F8M A;  3K1P A;  4DW6 A;  4RBO A;  2DYS H;  2CFX A;  1DGW Y;  2R4G A;  2D1V A;  1HW1 A;  1KYZ A;  3GZ6 A;  2R7X A;  2X1C A;  3H36 A;  2XGD A;  2V4J C;  1BJZ A;  2FNA A;  1HC8 A;  1U5T A;  1Y8Q B;  3J7Z I;  2P7C B;  2IS4 A;  1N78 A;  2EA4 A;  2V9V A;  3TP0 A;  2F5E A;  1W0T A;  4Q5S F;  5FRM A;  2R7V A;  4QIW N;  2PJP A;  2E5Z A;  4PFP A;  1JI8 A;  4G6T B;  4PGG A;  1TNT A;  5F64 A;  5EZH A;  2MBF A;  2Y0S A;  4EMS A;  3WHB A;  1BW6 A;  1Z3X A;  2A6E F;  4A3I J;  4RB0 A;  4I01 A;  3K4C A;  1T98 A;  4HDV A;  3OYD A;  1EH8 A;  1QZY A;  3BG5 A;  2CU7 A;  3DF8 A;  4MNU A;  2QEX I;  1CGP A;  4A93 J;  4YRV A;  1BR2 A;  3M3Y J;  4Q4Z F;  1WHU A;  2QSH X;  4KIB A;  2YS9 A;  3LL7 A;  3RPU A;  2L7M P;  3CDH A;  1OQY A;  3TW6 A;  4RAG A;  1QA6 A;  3DPU A;  5CVV A;  3CDI A;  1S9H A;  3IKT A;  1MSF C;  4IJA A;  2P7V B;  3S3O A;  4CZZ A;  1UG2 A;  4IHY A;  2E1C A;  1WJC A;  6PAX A;  3IP4 B;  2HEO A;  2L0K A;  4HF2 A;  4BQA A;  2P5V A;  3BY6 A;  4WF2 A;  2BOL A;  1TC3 C;  4M3D A;  4BEH A;  3OYK A;  5FLV A;  3CMA I;  2JA6 J;  4Y15 A;  3E5X A;  3Q3S A;  3RKW A;  1P4W A;  2DDA A;  3FXO A;  4ESJ A;  2R7Z J;  1MMD A;  1P92 A;  3LSM A;  5EEH A;  4LJZ F;  1S6L A;  2L7F P;  1V4R A;  1XGS A;  4D5C A;  3LA3 A;  3ML6 A;  4WK8 F;  1ERD A;  3ZMT A;  1YJN I;  4ZZL A;  5IYD J;  4AD9 A;  3B6C A;  3E97 A;  3A4C A;  2E1M B;  2QWW A;  3LFK A;  2Y31 A;  1F9N A;  3S8P A;  3F0C A;  4NC8 A;  5D5W B;  4QLC U;  4PDK A;  1M1E B;  3TL4 X;  1H8A C;  4XSX F;  1Y6I A;  3N05 A;  2ZBK A;  1MMS A;  1DDN A;  1W5C C;  1BL0 A;  4XKV A;  1YRN A;  1YI2 I;  2OTL I;  3S17 J;  1O57 A;  4ESB A;  5GAH J;  2EIN H;  4Y7N J;  5DD8 A;  1OCP A;  2O61 A;  1B1B A;  2R7O A;  2XB0 X;  2KIF A;  2KRC A;  2FQ4 A;  3KLN A;  2IEK A;  3M7G A;  2IS2 A;  1WJA A;  3HXL A;  2W24 A;  3OYE A;  3BG6 A;  3HL2 A;  2CSO A;  2X9D A;  1Y1V J;  5IP7 J;  4KN7 X;  1HA8 A;  1JHH A;  3RI4 A;  1XD7 A;  4Z2Y A;  1IGN A;  4KYW A;  3VEP A;  4WCG A;  4A3L J;  3AG2 H;  2JA7 J;  4PZJ A;  2WA0 A;  4CO8 A;  2ECB A;  1JUS A;  1RKW A;  1I5Z A;  1Z0X A;  3H5R A;  3OYN A;  4OWR B;  4YFN F;  3M07 A;  3I64 A;  4L5E A;  4UHT A;  5LGU A;  3CCQ I;  4FIS A;  1R36 A;  2GIZ A;  3FIS A;  2R3S A;  4BE2 A;  4FHT A;  2G9W A;  3RPQ A;  4BQQ A;  1QRY A;  2E1M C;  3RQI A;  4CHU A;  3H0G J;  2XAQ A;  1ZG1 A;  1MNM C;  2PI0 A;  1R5H A;  3MVP A;  3ZQH A;  2UZK A;  3O8G A;  3Q0V A;  1IV6 A;  1IJW C;  3KE2 A;  1ZKG A;  3QYF A;  4CXF A;  4E7H A;  3BTI A;  1FOY A;  3LFU A;  2LD5 A;  2R7R A;  5K7H A;  4ENK A;  4KT5 C;  5BNG A;  1SAU A;  4C3J J;  1VQ4 I;  3BJO A;  5L3F A;  4YG2 F;  1VQN I;  1X1C A;  1OPC A;  1Z21 A;  1HDD C;  3DTI A;  2DQR A;  5FKO A;  4Q47 A;  3OYA A;  3B6A A;  3JRG A;  2P0W A;  1EH7 A;  1T95 A;  5TIS C;  5BMZ A;  3FM3 A;  3H3V K;  1V55 H;  2P8T A;  4B44 A;  3IL2 A;  2Z2S B;  1X3U A;  3AG1 H;  1ZLK A;  2JUC A;  1ETW A;  2DMQ A;  1JHF A;  4EJU A;  3HOY J;  1LEB A;  3C2G A;  2XHK A;  4BH9 A;  3UR3 C;  1X4O A;  1QZZ A;  2HS5 A;  1I3A A;  4BY1 J;  2CFO A;  2AQE A;  4CCM A;  1E2X A;  1ENH A;  3JRB A;  3GLX A;  4LIV A;  2JMW A;  4Y4R A;  5JR3 A;  1H0M A;  3HPH A;  2MH2 A;  1YW8 A;  4BJ5 C;  2WAD A;  1MNE A;  1LDK B;  1N75 A;  1B8I B;  3JRA A;  1IO2 A;  2MD0 A;  3PL8 A;  2OQR A;  1NG7 A;  2KPM A;  5E8G A;  1ON2 A;  1IN8 A;  3PUF A;  4MO7 A;  3TDZ C;  3VFZ A;  5FFX A;  2HI3 A;  3GME A;  3BJ6 A;  5B5E C;  2VBZ A;  3BG7 A;  2FSW A;  1LB2 A;  4DQ2 A;  4PK4 A;  5LGT A;  2BW3 B;  3OS1 A;  2VJ4 A;  4BGD A;  4CCK A;  2ICW G;  1BOB A;  3CP8 A;  4G6D A;  2KJC A;  4XMY A;  2PMZ A;  3HEF A;  2I5U A;  1A36 A;  3S1R J;  2KDO A;  1LE8 B;  4FE7 A;  3CD6 I;  2DTZ A;  1BI2 A;  3I53 A;  5HS7 A;  2NVU B;  4IHT A;  4A69 C;  5DTD A;  1F36 A;  3BJA A;  1X1P A;  3QU3 A;  3UKG A;  3OIQ A;  3AKZ A;  3VYU B;  1JKP C;  2GAU A;  2LFB A;  4EJW A;  1TQI A;  4GRI A;  2OA4 A;  2DK8 A;  1ZG3 A;  5FO5 A;  3SHF A;  1A6Q A;  4D9J A;  1I1G A;  1W4M A;  2D1H A;  3CCR I;  1FSH A;  1TW3 A;  2F4O B;  3ZMS A;  4CA0 A;  4YFX F;  1Z1D A;  5LEK A;  4LG0 B;  3OYM A;  3U9G A;  4E7I A;  1GV2 A;  3BPV A;  5BPI A;  1T39 A;  5C4X J;  5IYB J;  2A69 F;  1FT9 A;  2HKO A;  5IY5 H;  4ITV A;  4LGW A;  4C30 A;  3ECO A;  4ZDP A;  2ZJ2 A;  2E2I J;  2W85 A;  1HW5 A;  3PFI A;  4L9V A;  3RYP A;  1O3S A;  1W7P B;  5HNH A;  4H4K C;  3I59 A;  4ZH4 F;  5F0C A;  1OYY A;  3WTS C;  3KZY A;  1YJW I;  2V6C A;  3C7J A;  1BBY A;  3ZMZ A;  1QVT A;  3DEU A;  1S3J A;  3H9Q A;  2QBY A;  4OIN F;  4ASN A;  5F1J A;  5GPC A;  2KZG A;  4PUS A;  4AU7 A;  3FWE A;  2DFE A;  2HQN A;  4F52 A;  2DA1 A;  1LE8 A;  3BR1 A;  1N25 A;  1N77 A;  3MZ8 A;  3GWZ A;  2CW8 A;  3LMM A;  2NNY A;  2ZC2 A;  4BJT A;  4XLF A;  1MJ9 A;  4IHW A;  2KIM A;  4KN4 X;  1GHC A;  1V3F A;  1X2M A;  3HGG A;  4EAT A;  5FRN A;  2K3F A;  3SQN A;  1ZRC A;  5GAD J;  1FX7 A;  2QKL B;  3GUD A;  2F5D A;  3VSL A;  2GBY A;  2MAB A;  1ONV A;  4HNV A;  1OCT C;  1BI3 A;  3W2V A;  1PVE A;  5IP6 A;  2K4J A;  1S7E A;  5F27 A;  2JUG A;  2EIL H;  3ABU A;  4LG0 A;  2K85 A;  1ZK8 A;  5CQG A;  1UB9 A;  4DNC A;  3GTK J;  1CQT A;  1K6Y A;  4BL0 B;  4PFO A;  1IRZ A;  2XUB A;  1GT0 C;  2GXB A;  4KIC A;  1YIO A;  3ZMD A;  3CJN A;  5LHG A;  1YIJ I;  3RIR A;  5HOO A;  2B63 J;  1WVR A;  2WAQ A;  3V7S A;  3HG9 A;  4G12 A;  1ZRE A;  4LLN A;  2IS1 A;  2HYF A;  4E7S A;  2VQL A;  4X6A J;  1IXR C;  2IGN A;  2P6T A;  2WTE A;  4A0X A;  3ISP A;  2V79 A;  3KP4 A;  2XRN A;  9ANT A;  1V5G A;  2RDP A;  3CCY A;  2L4A A;  1R71 A;  1X4P A;  4BHC A;  5ILV A;  1VQP I;  1HW2 A;  2IA1 A;  3O3K A;  4XL9 A;  3TMO A;  3G6E I;  5K5Q A;  3K4N A;  3ZCO A;  5DCM B;  1YFH A;  2A6T A;  2M0M A;  2R5Y B;  1FOX A;  2H94 A;  4Q48 A;  1J09 A;  1ULY A;  5ICG A;  1IV8 A;  2W25 A;  1F43 A;  4EV0 A;  3P9I A;  4LK1 F;  2LMD A;  3HKZ N;  1DPU A;  3L7W A;  3ZP5 A;  3WU2 C;  1B4A A;  1KQ9 A;  3HTU A;  3CJR B;  3DQV C;  3E3V A;  2V1N A;  1TBX A;  1STZ A;  4V2G A;  4I0B A;  4A5M A;  5FKK A;  3KET A;  1T2K A;  4BXF A;  1OCR H;  1TWG J;  4EM0 B;  4DJA A;  4LB5 A;  1ZLJ A;  2K27 A;  5AIP A;  2K3P A;  1LFU P;  4XK4 A;  2LR8 A;  1D0X A;  3B73 A;  5ERI A;  4YEJ A;  4B4C A;  2M7A A;  1FIA A;  2P5L C;  1DPR A;  1T8I A;  2M9H A;  2OV7 A;  1J9I A;  1XGN A;  3VYT B;  4J00 A;  3IKV A;  2I10 A;  2EPF A;  3HPG A;  1X1B A;  4XQF A;  1KU2 A;  1JJ8 C;  3L9F A;  2H1K A;  4AID A;  4P96 A;  1SD5 A;  2X51 A;  1WH7 A;  2HWV A;  3QWL A;  2ZXH A;  2ESH A;  1U78 A;  4EJT A;  5FKL A;  5HLI A;  2QUF A;  3QAH A;  3J80 Z;  3HTS B;  1LPQ A;  4HYE A;  4HF1 A;  5C44 J;  4NQW A;  5LFA A;  3ROU A;  1SFO J;  4MEY F;  1IF1 A;  3WE3 A;  2UXX A;  3GZ5 A;  3HYI A;  4U7D A;  5JVG F;  4C2U A;  3CF2 A;  1BC7 C;  4A0Z A;  3H1C A;  4Y3O A;  3KP5 A;  3LSH A;  5BS6 A;  1HKT A;  1ZAR A;  3GXO A;  3BR3 A;  2ME0 A;  4Y33 A;  2DT6 A;  1EH6 A;  4CUG A;  1T0F C;  4BAY A;  5K5O A;  1T0F A;  4E7Z A;  3BR2 A;  2A5Y B;  1J2X A;  2EZK A;  2FRH A;  2V9P A;  4RB3 C;  4X0G A;  2F5F A;  2WAF A;  1ZH5 A;  3COA C;  2VJI A;  1WJB A;  2FEZ A;  3SYT A;  1O3R A;  5EGO A;  5DM6 F;  3IH3 A;  1VQL I;  3T1B A;  2CQ7 A;  1ZN2 A;  4W97 A;  1WRJ A;  1R4M B;  2VKV A;  2ZXJ A;  3FX3 A;  5D5U B;  1U8B A;  4G7H F;  1IG7 A;  4IKF A;  4E7L A;  3S2W A;  3C2B A;  2L54 A;  2JPC A;  2JQ7 A;  3S32 A;  4DIQ A;  1J5Y A;  2JJ7 A;  2IT0 A;  3BRO A;  3E7L A;  1FOK A;  1WJD A;  1QU3 A;  1ZQ3 P;  2E19 A;  2F4I A;  2K86 A;  1MBE A;  4HX7 A;  1LQ1 A;  3KP2 A;  1VQ6 I;  5KAI C;  5E3O A;  3GFJ A;  2Z99 A;  1YJ9 I;  1AOY A;  4C2M J;  2PMH A;  4HAM A;  1Z9C A;  5H2F C;  1X2N A;  2Q0O A;  2DA6 A;  2AQF A;  2OUM A;  3A01 A;  1SFX A;  2B7E A;  3IRQ A;  3F22 A;  3FHZ A;  3HRU A;  2H09 A;  1JTY A;  3EUH A;  5D5X B;  5ILU A;  4PJJ A;  2VB6 A;  2FD5 A;  2RAE A;  5B3S H;  2ZB9 A;  4OIO F;  2A68 F;  3OY9 A;  2GXG A;  2BY0 A;  5EYR A;  3T8T A;  1SC7 A;  3ABM H;  1ZR2 A;  1Y0N A;  3M1E A;  5AIQ A;  2ZME A;  4RLF A;  3IV5 A;  3R61 A;  2EH3 A;  3TO9 A;  3WTV C;  1NK2 P;  4FCY A;  4FT8 A;  1MW7 A;  5IYC J;  2LY9 A;  3RSN A;  3TW7 A;  3OYB A;  3LNQ A;  4CCL A;  4M3F A;  4AYB N;  1TP4 A;  2Z3Y A;  4RLQ A;  1TNS A;  3A0H C;  2MH9 A;  4N4N B;  1XMX A;  2XB5 A;  2CS3 A;  4ZYA A;  3V8L A;  2QQB A;  2N8G A;  2O7O A;  2R7S A;  3KEQ A;  1XSD A;  5L3C A;  4D0P A;  3D1N I;  1A6I A;  2GWR A;  1I50 J;  4FX0 A;  4M72 A;  2D2W A;  3QOP A;  1MBF A;  1UHW A;  3H9J A;  4KUM A;  4HPQ A;  4CIC A;  5HLH A;  3ABK H;  1D1A A;  5B1B H;  2HYJ A;  3F9K A;  2HVR A;  2LTP A;  1YG2 A;  2R7T A;  3L09 A;  3ZQC A;  2WAE A;  2AXL A;  1NK3 P;  2CUF A;  4KJZ A;  1QVU A;  1JT6 A;  3BR0 A;  2JTV A;  2V6E A;  3TDU C;  3O2P E;  3DCF A;  2PQ8 A;  2XC7 A;  4FX4 A;  3CJQ B;  3M8F A;  4U88 A;  2VKH A;  4UUS B;  2KDZ A;  2Y69 H;  1ZGA A;  4BXX J;  3GFL A;  4ZDL A;  3FXJ A;  2GOM A;  2XRL A;  3K70 D;  2IGM A;  4MGR A;  3VYR B;  2OAZ A;  3FZV A;  4M6V A;  2MC3 A;  4F91 B;  1V5E A;  2BE5 F;  1VI0 A;  3BC8 A;  2WV0 A;  4HQE A;  4QPO A;  4FTH A;  1MBJ A;  4ZYE A;  3SJM A;  3ECH A;  3LSJ A;  3CJT B;  3FDY A;  4UV9 A;  1YIT I;  1VQ8 I;  3PO2 J;  5ICE A;  2ZFW A;  2X4H A;  1W5T A;  2JA2 A;  2WY8 Q;  1ETO A;  3S3N A;  1VZ0 A;  3E0J B;  4RGX A;  3GVA A;  2HFH A;  3HHG A;  2IGK A;  4NC6 A;  1ZRD A;  2M87 A;  3EYY A;  4F55 A;  1GDT A;  4PJN A;  1VTN C;  1U9O A;  3OOP A;  3I9V 2;  2XPW A;  4L9N A;  1IN7 A;  2DPU A;  5LD2 C;  3MQ0 A;  3PFY A;  5H6Q A;  5KHD A;  2PEX A;  2Y0M A;  2I8D A;  1IN6 A;  4F93 B;  1GLN A;  3W2W A;  5L3B A;  2DMP A;  3LAP A;  1A04 A;  2LK2 A;  2W48 A;  4O3M A;  4GYG A;  1LFB A;  4PJ0 C;  4XKW A;  2LYC A;  1VQ5 I;  1BW5 A;  4PSW A;  1CF7 A;  3QPS A;  2IJL A;  3DKX A;  5E17 F;  1Q1V A;  3V7C A;  3OL4 A;  1AU7 A;  4HF0 A;  5E20 A;  4HOB A;  2HYG D;  2DBB A;  4G7Z F;  1D3Y A;  5DDG A;  5CLS A;  4XKC A;  5ILS A;  2Y9Z A;  4F92 B;  2EV0 A;  2W1O A;  3KZI C;  3WGI A;  3KLO A;  2BY3 A;  2PX9 A;  3PQJ A;  1USS A;  2DA5 A;  3C2H A;  2M8G X;  4LK0 F;  3OSG A;  3L2Q A;  3BCB A;  3D5L A;  3SZG A;  3ABT A;  1JUM A;  4L9J A;  5K7Z A;  5EDN A;  1RUN A;  4LLL A;  3A02 A;  2EIJ H;  4A3B J;  1FMW A;  3FM5 A;  2PJR B;  1JUP A;  2TCT A;  4ANJ A;  1FTT A;  3HC7 A;  1TWH J;  2BHY A;  3ZPL A;  5J8F A;  1OYI A;  1EF4 A;  3AG3 H;  1D5Y A;  2WB1 N;  1XB4 A;  2Y48 A;  2JA8 J;  3KCC A;  2KL4 A;  4M71 A;  1YX3 A;  3LA7 A;  2QVO A;  3E6M A;  1YHQ I;  4A3D J;  2PFB A;  1QZE A;  2CQN A;  3KP6 A;  2HGC A;  1SFU A;  3OIP A;  4DGW B;  3ZMU A;  2QGU A;  1R5I D;  2IGO A;  4L18 B;  1Z91 A;  1KZH A;  3HM5 A;  2X0L A;  3HRT A;  4OOI A;  4R8H A;  5FFZ A;  2FE3 A;  1YX5 A;  1KU3 A;  3BR6 A;  1ZGW A;  1MBG A;  3DU6 A;  2DFF A;  3UNG C;  2MLK A;  4E6K G;  2BY2 A;  4HBL A;  3E6B A;  1XDU A;  1JKO C;  4DZJ A;  1P2F A;  2B0L A;  3I4N J;  1SFK A;  2NYX A;  1TT0 A;  1AKH B;  3K70 C;  4CSW A;  3G1L A;  1VQO I;  5M5X J;  3LA2 A;  2ETH A;  1X58 A;  2FMY A;  4RDU A;  3GW2 A;  1XC5 A;  4IX7 A;  3S1N J;  2BHZ A;  1QNT A;  4BDZ A;  4KIT B;  2JN6 A;  2D5V A;  1LNW A;  2HOE A;  3HOW J;  3J80 K;  2DOD A;  3CC2 I;  3WU0 A;  2Y75 A;  2EFQ A;  4RB1 A;  2M4K A;  1D8K A;  3HSR A;  1WWX A;  1NHA A;  2H27 A;  4XLN F;  1W0U A;  2KJB A;  1IUF A;  2DOE A;  3T8R A;  1KON A;  4KDP A;  1ZR4 A;  4N0B A;  2F6C A;  5E1Z B;  4AVP A;  1J0R A;  3O6B B;  2CH0 A;  3IRR A;  4CYC B;  1S29 A;  4BQO A;  3IAS 2;  2L2O A;  4II2 A;  4LD5 A;  3EUK L;  1FWZ A;  2JRM A;  3D0S A;  5FKM A;  1OKR A;  4NC7 A;  1YYV A;  1HSJ A;  3JSP A;  3QYE A;  2E1O A;  2NOJ B;  4C2T A;  2Q1Z B;  2HXO A;  2YPR A;  4KT6 A;  2Z5U A;  1AWC A;  4W1U A;  1UEL B;  1RET A;  2E7W A;  4E70 A;  1R23 A;  1FC3 A;  3TED A;  4P1W A;  3A0B C;  4XBF A;  4DYR A;  5ED4 A;  1IRX A;  1TZL A;  1X19 A;  3FK6 A;  3S2H J;  4Y52 J;  1WKM A;  2K4B A;  2Z16 A;  4P9U A;  3GEZ A;  3S2D J;  1MKM A;  3L2U A;  1K79 A;  1WI3 A;  5J1U A;  2DU9 A;  2EB7 A;  1V5F A;  3SXY A;  1PDN C;  1D1C A;  2JWT A;  3QU6 A;  1YW9 A;  4NHJ A;  3CUQ B;  2WC2 A;  1H9T A;  5IT3 A;  3OIO A;  5KVR A;  2IVM A;  2NAZ A;  4B43 A;  1W7P D;  2NVT J;  4KFC A;  4LOC A;  3CLO A;  3E6C C;  2VQC A;  2CV0 A;  1OR7 C;  4RGS A;  2E7X A;  1IXS B;  2FX0 A;  2FNP A;  3TQN A;  1KA8 A;  4GDF A;  2CW7 A;  5E18 F;  2FU4 A;  5GTI C;  3Q0U A;  2H8W A;  5E1X A;  2DMN A;  4AIK A;  1I6X A;  2KIS A;  3ULQ B;  3PSI A;  5C3E J;  4P5O A;  1T08 B;  2KMU A;  3E6D A;  5LHI A;  2QA4 I;  5L3G A;  4ZDO A;  2HTS A;  2HZT A;  2DFI A;  2FA5 A;  3H5A A;  4B3X A;  4IRI A;  4EJV A;  5JVT A;  4DBR A;  2R5Z B;  1BC8 C;  1RNL A;  2HU9 A;  1KU7 A;  3L2V A;  2L7K A;  4OIR F;  2TDX A;  3JR9 A;  4OMY A;  3WTW C;  1JT0 A;  1K4S A;  5DUI A;  3FXK A;  3S1Q J;  4BHP A;  3CUQ C;  3U21 A;  3W3C A;  2XAF A;  3L2W A;  3CUQ A;  1H88 C;  1XMA A;  4C3H J;  3HUG B;  2QKM B;  3DPT A;  3Q5F A;  4XN3 A;  1AHD P;  1ON1 A;  2YX4 A;  2E71 A;  3I54 A;  2QQ9 A;  5EEG A;  3P9C A;  4B09 A;  2P4W A;  2XF5 A;  1UJ8 A;  1OMI A;  2BEO A;  4ENN A;  1GV5 A;  5CVI A;  3J81 Z;  4MLO A;  2JSC A;  3QOE A;  2Z33 A;  1B8I A;  3DWL E;  3MD2 A;  3K2Z A;  4G9Y A;  5GAE J;  5E3N A;  3JW4 A;  2R92 J;  1QHH D;  3PSF A;  1I6H J;  5J3L A;  3QP6 A;  5J4Y A;  3G1O A;  3G71 I;  3QPH A;  2DA4 A;  2VQG A;  2BW3 A;  3CCS I;  2R0Q C;  2VOD A;  2FXA A;  2FBH A;  2YU9 J;  4XLP F;  4MEX F;  3BQY A;  3LSK A;  4BKX A;  2FQ3 A;  2J5O A;  4M9S A;  1LFP A;  3P9K A;  3OWT A;  2OBP A;  3HIF A;  1SFE A;  2KHM A;  2NVY J;  3HOS A;  2DDB A;  2O9L A;  4XNF A;  1J59 A;  2NVQ J;  2E35 A;  2M4G A;  2K40 A;  3HUG A;  3VB2 A;  1GVD A;  2V1D A;  4A5N A;  4MHG A;  3SEZ A;  3PQK A;  2P6S A;  3B02 A;  3W6K B;  4GCV A;  2DA3 A;  2ZSH B;  1L3L A;  1FPQ A;  2PMU A;  5EG0 B;  5D8K B;  1VFC A;  3VOD A;  1IN5 A;  1U2W A;  2CWE A;  2LSO A;  4M6Y A;  2L5Q A;  2JT1 A;  4BE0 A;  1HBX G;  2QF7 A;  4ON0 A;  2GIV A;  2VBY A;  3WHC A;  1LDD A;  3GYH X;  2XAS A;  5JFR A;  4QSH A;  4EM2 A;  1GVJ A;  2MC4 A;  2V7F A;  2F5V A;  2P5K A;  1BR4 A;  1HQC A;  5FLX Z;  3CCJ I;  3CC7 I;  5E3L A;  3DTE A;  4P55 A;  5HDG A;  4PJL A;  3MKZ A;  1ZHF A;  3LWF A; 
#chains in the Genus database with same CATH homology
 1MBK A;  2XGD A;  1ZQ3 P;  2XGC A;  3HOX J;  2E19 A;  1BJZ A;  4BBS J;  1G2H A;  1MBE A;  3NAU A;  3A03 A;  5E3O A;  2YUS A;  3TP0 A;  2MG4 A;  4C2M J;  1W0T A;  4QIW N;  1X2N A;  4CYC A;  2DA6 A;  3A01 A;  5EZH A;  1JTY A;  1K83 J;  3WHB A;  3S14 J;  1BW6 A;  3PM1 A;  2IAI A;  4A3I J;  5M5Y J;  2FD5 A;  2RAE A;  1HCR A;  1P7J A;  2GLO A;  2ZB9 A;  4QTR A;  3BG5 A;  2CU7 A;  3CQZ J;  5EYR A;  4A93 J;  3M3Y J;  1FEX A;  5EG0 A;  1ZR2 A;  1B72 B;  2YS9 A;  3IV5 A;  5FJ8 J;  2EH3 A;  2L7M P;  1T56 A;  1MBH A;  4D7M A;  3TW6 A;  5M5W J;  5K7F A;  1NK2 P;  4FCY A;  2M2E A;  3BQZ A;  5F08 A;  5IYC J;  2E2H J;  2LY9 A;  3TW7 A;  2MGQ A;  1MSF C;  3K7A J;  2ME6 A;  3LNQ A;  1UG2 A;  4M3F A;  4V2F A;  4IHY A;  4AYB N;  2L0K A;  2JK3 A;  2XB5 A;  1TC3 C;  4M3D A;  2NS7 A;  5FLV A;  1HDP A;  2N8G A;  2O7O A;  5HOD A;  2JA6 J;  1IC8 A;  3Q3S A;  4EEF G;  3GBG A;  3D1N I;  2R7Z J;  1A6I A;  1I50 J;  3M4O J;  1MBF A;  3GTL J;  2WAQ N;  2KT0 A;  2HYJ A;  2L7F P;  3JRI A;  4D5C A;  4S0H B;  2LTP A;  1H89 C;  3ZQC A;  2R5Y A;  4JYK A;  1NK3 P;  3HOZ J;  5IYD J;  2EZH A;  2CUF A;  3B6C A;  1QVU A;  3S16 J;  1Z77 A;  1JT6 A;  3BR0 A;  5M3F J;  2Y31 A;  3HDD A;  1WPK A;  3DCF A;  3F0C A;  2FJ1 A;  4UUS B;  2KDZ A;  1JTX A;  2EZL A;  2R5Z A;  4BXX J;  1H8A C;  2XRL A;  3BG3 A;  1DU0 A;  1PUF B;  4M6V A;  1RES A;  1VI0 A;  1UHS A;  2DMU A;  2CRG A;  2HOA A;  1BL0 A;  1YRN A;  4FTH A;  1MBJ A;  3S17 J;  3SJM A;  2X6O A;  3LSJ A;  4Y7N J;  1OCP A;  4NDL A;  2EZI A;  2CQQ A;  2XB0 X;  2DJN A;  2FQ4 A;  3PO2 J;  2IEK A;  3HOV J;  1ETO A;  3OOU A;  2X9D A;  1Y1V J;  5IP7 J;  1POG A;  1MSE C;  3LSG A;  1T33 A;  2M0C A;  2HXI A;  3HGY A;  4C3I J;  1IGN A;  2DA7 A;  4A3L J;  2JA7 J;  1GDT A;  5C4J J;  5IPA A;  1U9O A;  1JUS A;  1RKW A;  1Z0X A;  2ECB A;  3CMY A;  1OJL A;  2LVS A;  2XPW A;  5IOZ A;  4L5E A;  1XS9 A;  4FIS A;  2CQX A;  3FIS A;  4MFD A;  3HOU J;  4MIM A;  1QRY A;  3RQI A;  1FTZ A;  2DMP A;  2W48 A;  2LK2 A;  3H0G J;  5F0F A;  1NTC A;  1MNM C;  1WH5 A;  3ZQH A;  3MVP A;  2ID3 A;  3O8G A;  1LFB A;  3Q0V A;  1IJW C;  1JKR C;  1IV6 A;  1ZKG A;  3Q0W A;  1BW5 A;  3BTI A;  4BBR J;  3QPS A;  2LD5 A;  5K7H A;  2HDD A;  3JRH A;  1PUF A;  1Q1V A;  5BNG A;  2ECC A;  4C3J J;  3RZO J;  1AU7 A;  1UMQ A;  1VF9 A;  1QPI A;  1HDD C;  5FKO A;  1RR7 A;  5DS9 A;  3JRG A;  3B6A A;  5IOY A;  2Y9Z A;  3HBL A;  3H3V K;  2OF7 A;  1HOM A;  3LOC A;  5EEA A;  3JRF A;  1ETW A;  2DA5 A;  3OSG A;  2DMQ A;  2M8G X;  2MW8 A;  1Y1W J;  3HOY J;  1GUU A;  1JUM A;  5EDN A;  5K7Z A;  4IHX A;  3S15 J;  2P81 A;  3A02 A;  3W6V A;  4A3B J;  3ZOB A;  1JUP A;  2TCT A;  4BY1 J;  5FKN A;  4D7N A;  1ZTR A;  1FTT A;  1ENH A;  1TWH J;  3BTJ A;  3JRB A;  2JMW A;  3FKI J;  1EF4 A;  4XRM A;  5FLM J;  1D5Y A;  2CUE A;  1ETQ A;  2WB1 N;  2JA8 J;  3MN2 A;  1ETV A;  2L7Z A;  4DYC A;  2NOG A;  2COB A;  3RZD J;  5EF6 A;  1B8I B;  3JRA A;  1SAN A;  3LSP A;  2EQR A;  4MO7 A;  5JLW A;  1U9N A;  4A3D J;  2HI3 A;  4JX6 A;  3ZQI A;  1A5J A;  3SDG A;  4M3E A;  2ELK A;  3MKL A;  1TWA J;  2CJJ A;  2TRT A;  3ZQG A;  3L1P A;  3HM5 A;  3QQA A;  4A3M J;  2O8K A;  3HEF A;  3GTM J;  3BR6 A;  3ZQF A;  4UUT A;  3S1R J;  1ZGW A;  1MBG A;  1LE8 B;  4FE7 A;  2DTZ A;  3IH2 A;  2EBI A;  3JRE A;  4A69 C;  3TP3 A;  5DTD A;  1ETY A;  1F36 A;  2LLK A;  3UKG A;  1MH3 A;  4D5F A;  1FIP A;  1IDY A;  1JKO C;  1JKP C;  4DZJ A;  1IDZ A;  3I4N J;  5EGO B;  1AKH B;  2LFB A;  3G1L A;  5M5X J;  4A3J J;  1B72 A;  1WGX A;  1X58 A;  2HQ5 A;  4RDU A;  3K2A A;  1XC5 A;  1RKT A;  3S1N J;  2JN6 A;  2K9Q A;  1GV2 A;  2D5V A;  2K9N A;  3QPL A;  2XPU A;  5C4X J;  5IYB J;  2DN0 A;  2LP0 A;  3HOW J;  5E3M A;  1RPW A;  2E2I J;  1MH4 A;  5F0C A;  2VUM J;  1W0U A;  1ETK A;  1IUF A;  1QVT A;  2WV1 A;  2GM4 A;  2LKX A;  2Y2Z A;  5F1J A;  5GPC A;  1ZR4 A;  4DZP A;  4CYC B;  2VPR A;  3A01 B;  3GTG J;  2DA1 A;  1LE8 A;  3BR1 A;  3HB9 A;  5F04 A;  1R9T J;  4MFE A;  5FKM A;  1I3Q J;  4J19 A;  2E1O A;  4I76 A;  4IHW A;  2AHQ A;  4X1E A;  2HXO A;  1X2M A;  3HGG A;  4W1U A;  1RET A;  4XID A;  4UUS A;  1P7I A;  3TED A;  4DYR A;  2GBY A;  5M3M J;  4HNV A;  1OCT C;  3NAR A;  3GTJ J;  5IP6 A;  1S7E A;  5F27 A;  3FK6 A;  3S2H J;  4Y52 J;  1JJ6 C;  1ZK8 A;  3GTK J;  1CQT A;  3S2D J;  3JRD A;  1WI3 A;  2MSY A;  1IRZ A;  1GT0 C;  5J1U A;  2AO9 A;  2B63 J;  3OSF A;  2JWT A;  3S1M J;  3I4M J;  4G12 A;  3OIO A;  5GP9 A;  2NVT J;  4X6A J;  4LOC A;  4JX4 A;  4BY7 J;  5GPA A;  9ANT A;  2G0E A;  2VI6 A;  2FX0 A;  4M3G A;  1O4X A;  3CCY A;  4A3G J;  1E3O C;  4A3F J;  2ID6 A;  1ETX A;  4AC0 A;  2R93 J;  3Q0U A;  5J1R A;  2E2J J;  1WCM J;  2JA5 J;  2R5Y B;  2DMN A;  3VPR A;  3SFI A;  1K61 A;  5C3E J;  2XSD C;  4JP0 A;  1F43 A;  2Y9Y A;  3HKZ N;  3FIW A;  2VKE A;  3GTO J;  2HOS A;  3O8H A;  4ABZ A;  2R5Z B;  4JX5 A;  1TWC J;  1OFC X;  3BTL A;  3DEW A;  2QCO A;  1ORK A;  1YRN B;  4V2G A;  3JR9 A;  1HLV A;  5FKK A;  1HF0 A;  1TWG J;  3ZQL A;  1JGG A;  4IEJ A;  1JT0 A;  1LFU P;  3GTQ J;  4XK4 A;  3S1Q J;  2LR8 A;  2XPV A;  2K9S A;  1H88 C;  4XRS A;  4B4C A;  4C3H J;  1FIA A;  1ITY A;  3IH4 A;  5EZG A;  2M9H A;  4A3K J;  1AHD P;  2Y0S N;  4DYQ A;  2I10 A;  3RKQ A;  5J1Y A;  4A3C J;  2OPT A;  1BA5 A;  2H8R A;  1JJ8 C;  2H1K A;  1DU6 A;  1GV5 A;  2M34 A;  1WH7 A;  1JKQ C;  4MLO A;  1U78 A;  5FKL A;  4M3B A;  3LSR A;  1B8I A;  4FE4 A;  5C44 J;  1FJL A;  4AUX A;  3G1M A;  2L9R A;  1SFO J;  5E3N A;  2R92 J;  2IBD A;  2NS8 A;  5J3L A;  1I6H J;  1TWF J;  3G1O A;  2DA4 A;  4B1R A;  2R0Q C;  2NVX J;  2YU9 J;  3BT9 A;  4XRS G;  3BQY A;  4BKX A;  1APL C;  2DMT A;  3BR3 A;  2ME0 A;  5JLX A;  2Y30 A;  4IHV A;  3CDL A;  2HOT A;  3BR2 A;  2NVY J;  2EZK A;  1XG1 A;  4I6Z A;  2O9L A;  3FK7 A;  3BTC A;  2NVQ J;  2K40 A;  1VND A;  1GVD A;  4A3E J;  3JRC A;  2PMZ N;  2X48 A;  5EGO A;  1AKH A;  3PO3 J;  2DA3 A;  3IH3 A;  5EG0 B;  1VFC A;  4B3A A;  2QF7 A;  4W97 A;  3WHC A;  2VKV A;  4QSH A;  5F0H A;  5IP9 J;  2XGE A;  4XIC A;  3GTP J;  1U8B A;  4GFB A;  3BG9 A;  1IG7 A;  3C2B A;  2DA2 A;  4DW6 A;  4RBO A;  3BR5 A;  2JJ7 A;  5E3L A;  3E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...