1AKHA

Mat a1/alpha2/dna ternary complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
49
structure length
49
Chain Sequence
ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 19
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhA00
1BJZA 5IYCJ 1MSFC 2HOSA 3BR1A 1GUUA 2ME0A 4A3MJ 4M3BA 1F36A 2ID3A 4A3DJ 1VI0A 3JRFA 1FIPA 4IHWA 1VNDA 3M3YJ 3I4NJ 1TWCJ 2H1KA 3HDDA 2FD5A 2PMZN 2Y30A 3Q0VA 4C2MJ 5K7HA 5M5YJ 1B8IA 3GTMJ 5C4XJ 2LLKA 3OSGA 1P7IA 2X9DA 2NOGA 4X6AJ 1VFCA 2D5VA 4A3GJ 9ANTA 2EH3A 4BY7J 3HOXJ 1HLVA 1H88C 1E3OC 4DZJA 4C3HJ 4Y7NJ 1ZTRA 4A93J 3RKQA 3TP0A 2O7OA 3MKLA 3S1NJ 2CJJA 2DN0A 2E2JJ 1GV2A 5EZGA 1XG1A 1JGGA 3NARA 5EG0A 1TWHJ 1XS9A 4B4CA 3HGGA 1F43A 2R5ZB 4I6ZA 1IJWC 3PO2J 4IHXA 2B63J 2DA1A 4UUSA 2OF7A 1X2MA 4GFBA 2LTPA 1H89C 5FKMA 3S2HJ 1BA5A 5GPAA 1ENHA 5EYRA 1WCMJ 4HNVA 5J3LA 3FK7A 4JYKA 3JRDA 3Q3SA 1IG7A 3A02A 5M3FJ 4FCYA 3B6AA 3TEDA 3RQIA 3RZOJ 4A3FJ 1YRNB 3G1OA 1FTZA 1MNMC 3FKIJ 1Y1VJ 5EDNA 2K40A 3WHCA 2DA3A 4IEJA 4XRSG 1RKWA 1HF0A 3QPSA 2VKVA 4D5FA 1MH3A 2DJNA 2XGDA 3OOUA 3BTIA 5E3OA 3HOVJ 1SFOJ 4B3AA 1JT6A 4W97A 1IUFA 1ZK8A 2DTZA 3S1MJ 1GDTA 2IEKA 1JKQC 2NS8A 1X2NA 2L7FP 5IP7J 2CQXA 1TWAJ 2I10A 2DMUA 1ETWA 2WV1A 4A3KJ 1IGNA 4JX5A 2M9HA 5F04A 3B6CA 5IYBJ 3BR0A 1B8IB 2HXIA 4A3BJ 5DTDA 4A3CJ 2NVTJ 2E1OA 2MGQA 4LOCA 1BW5A 1JTXA 1WPKA 3BR6A 2Y31A 1LFBA 3GTOJ 3OIOA 4MLOA 4XRSA 1MBGA 1X58A 1W0TA 5JLWA 5IYDJ 3HOUJ 3ZQGA 5E3LA 2MG4A 4M3DA 2M2EA 3CCYA 3HB9A 2E2HJ 1B72A 4A3IJ 1A6IA 3BTJA 3FISA 2NS7A 3WHBA 5EG0B 2HI3A 1AHDP 2GLOA 2MW8A 1BW6A 3LSJA 1ZR4A 1D5YA 3Q0WA 3O8GA 2DA6A 3BR2A 3GTLJ 2Y2ZA 4UUSB 1GT0C 2JA7J 1SANA 3TW6A 4S0HB 4D5CA 3HM5A 4NDLA 4AUXA 1FJLA 3JRIA 5F0CA 3PM1A 1T56A 3HBLA 5M5XJ 1OCTC 2COBA 4MIMA 3D1NI 4A3EJ 4JX6A 3S15J 1O4XA 4MFEA 3A03A 2K9NA 2RAEA 4I76A 1APLC 1LE8A 4EEFG 5M3MJ 3JRGA 4B1RA 3S1QJ 2LY9A 1WH7A 2MSYA 3LSRA 3FK6A 1JUMA 3NAUA 4JX4A 1UMQA 4D7NA 4V2GA 3Q0UA 1QVTA 3IH4A 3E7LA 4AYBN 4MFDA 1JKOC 4FE4A 4XK4A 4DZPA 3GTJJ 5IPAA 1AKHA 3L1PA 3GBGA 4A69C 2JK3A 5EGOA 1I3QJ 5FKKA 2XB5A 1DU0A 1ETXA 1U8BA 3IH3A 5GPCA 4C3IJ 5EEAA 3JRCA 2M8GX 2LVSA 1Z0XA 4JP0A 2R92J 4BBRJ 1TWFJ 2L0KA 3LSGA 3GTQJ 3IV5A 2IBDA 3S17J 3BR5A 3IH2A 3G1LA 2JA5J 2CRGA 3JR9A 4DYCA 1G2HA 1ZQ3P 3TP3A 1JUPA 2L9RA 2XSDC 3ZQIA 1UG2A 3CQZJ 3UKGA 5IOYA 3BT9A 1H8AC 3LNQA 3DEWA 4M3FA 2ECCA 1B72B 2XPVA 5HODA 5J1RA 4FISA 3S2DJ 3HOWJ 1PUFA 4X1EA 4BBSJ 2OPTA 4UUTA 3C2BA 5F27A 4FE7A 4M6VA 4QSHA 1JKPC 3BG3A 2R0QC 4QIWN 1W0UA 4M3GA 2EQRA 2HYJA 1T33A 2CQQA 2P81A 5GP9A 1A5JA 1TWGJ 1WH5A 4L5EA 5C4JJ 1LE8B 2FQ4A 5F0FA 2E19A 3ZQLA 1ETQA 1MBFA 2WAQN 1JJ8C 3S14J 2AHQA 2LD5A 5FJ8J 1TC3C 2YUSA 3HKZN 2JA8J 2TCTA 2KT0A 4M3EA 2JJ7A 1MBKA 3BQZA 4Y52J 3SDGA 4J19A 2QCOA 3HOYJ 2DMTA 1AKHB 2K9SA 2EZKA 3W6VA 2ECBA 5EGOB 3I4MJ 2CUEA 1RKTA 4RDUA 1HCRA 2R93J 2L7MP 2DMQA 5EZHA 4D7MA 2XRLA 2M0CA 1I6HJ 5M5WJ 1ETVA 1JTYA 3K7AJ 5K7FA 4C3JJ 1ETOA 3ZOBA 1OCPA 2DA4A 4IHVA 1OFCX 5J1YA 3JREA 2G0EA 3S16J 5F1JA 3BTLA 2R5YA 3MN2A 3ZQCA 1XC5A 1ETYA 2FJ1A 3BTCA 5BNGA 1ETKA 3JRAA 2YS9A 3ZQHA 2LKXA 2LK2A 1RR7A 1GVDA 1S7EA 2JA6J 2R7ZJ 1OJLA 3K2AA 4W1UA 1POGA 1Q1VA 1U9NA 3DCFA 1MSEC 1NTCA 1ORKA 4BKXA 5FLMJ 2DA7A 1CQTA 4DYRA 3GTGJ 1WGXA 1PUFB 2TRTA 2W48A 4V2FA 2DMPA 2KDZA 3QPLA 2LP0A 3H3VK 1WI3A 5F0HA 5F08A 1JKRC 2DA5A 5JLXA 4ABZA 2HQ5A 3G1MA 3S1RJ 3RZDJ 3F0CA 1IC8A 3BR3A 1U9OA 3CMYA 1MH4A 2ID6A 2VI6A 1K83J 2LR8A 2VKEA 4XRMA 5C3EJ 1FTTA 1QVUA 5J1UA 4RBOA 2EBIA 4XIDA 1QRYA 1JUSA 1MBEA 2HOTA 3HOZJ 2JWTA 3ZQFA 1QPIA 1MBJA 3BG5A 2NVQJ 3LOCA 2DA2A 1UHSA 3M4OJ 2NVXJ 5IP9J 2DMNA 2EZIA 4DYQA 1U78A 1ZKGA 2H8RA 1JT0A 5FKNA 1GV5A 2JMWA 4FTHA 3JRHA 3BG9A 1NK3P 5DS9A 3PO3J 1P7JA 5FKOA 4MO7A 5IP6A 5C44J 5E3NA 5FLVA 4IHYA 1ZR2A 4CYCB 5E3MA 2GM4A 3LSPA 2XPWA 1IV6A 1BL0A 2ELKA 2Y9YA 1ITYA 4BY1J 4DW6A 1IDYA 2HXOA 2R5YB 2IAIA 2QF7A 3A01B 3SJMA 4QTRA 1HDPA 4BXXJ 1JJ6C 3GTPJ 1EF4A 1HDDC 4AC0A 2HOAA 5IOZA 1FIAA 1LFUP 2NVYJ 1FEXA 5EF6A 2VPRA 2JN6A 1RESA 2VUMJ 2XGCA 3BQYA 1Y1WJ 2Y0SN 3VPRA 2R5ZA 3JRBA 4A3JJ 1DU6A 4A3LJ 1AU7A 1RETA 1RPWA 2Y9ZA 2GBYA 3SFIA 3H0GJ 1ZGWA 1MBHA 2X48A 2ZB9A 1K61A 5K7ZA 3MVPA 2XGEA 2EZHA 2EZLA 2FX0A 3TW7A 3O8HA 2WB1N 3CDLA 2XB0X 1IDZA 3QQAA 2LFBA 3HGYA 5FKLA 1VF9A 1HOMA 4CYCA 2K9QA 3OSFA 2YU9J 2M34A 1R9TJ 1Z77A 1NK2P 1YRNA 3HEFA 3FIWA 1I50J 2CUFA 2CU7A 2XPUA 3A01A 2AO9A 4G12A 2X6OA 2L7ZA 2ME6A 2O9LA 2N8GA 2HDDA 1IRZA 2O8KA 4XICA 3GTKJ 2E2IJ
chains in the Genus database with same CATH superfamily
1BJZA 2EFNA 1H9TA 3WTTC 3TOBA 2ME0A 4IRHA 4A3MJ 3HRMA 4U0WA 2IS2A 1W5SA 2XRNA 4XBFA 1PJRA 4BHBA 1R7JA 1UCRA 1VNDA 3M3YJ 4M9SA 2H94A 4D9JA 5HNFA 2L02A 3HRUA 5LRSA 2FD5A 2Y30A 1B8IA 5C4XJ 4AIJA 2GXGA 1SFXA 5AIPA 3CMMA 1UZCA 3EYIA 2NOGA 3WGHA 3C2HA 1D8JA 1VFCA 5GAHJ 2D5VA 3ABKH 3F8MA 3S2WA 2ELHA 2HYGD 1HLVA 3GO5A 1BI3A 1P4WA 3ABUA 4C3HJ 4N0BA 4EVIA 3RKQA 3GLXA 3HTUA 3WG9A 3OYMA 3S1NJ 4HX7A 2E2JJ 4L9JA 2VPLA 2QQAA 2JA2A 5EZGA 1B4AA 3PQJA 4HF0A 4B8XA 3A0BC 2YSRA 3DU5A 4MQVA 3CC7I 3FWEA 3NARA 5EG0A 3PNVA 4B4CA 2XGXA 1JGSA 3HZJA 3PO2J 4I6ZA 3KYLA 1BN5A 4LLGF 2QQ8A 3OYLA 4UHTA 3V8KA 4IHXA 3PFYA 4UUSA 2OTLI 5FKMA 3C7JA 5B5EC 3S2HJ 2M4GA 4X0GA 1YE9A 5GPAA 3TKYA 2C6YA 2V1XA 1D0YA 5LGTA 1W36D 2HS5A 4HNVA 2HWVA 3FK7A 3V42A 2JPBA 4LIVA 3ZQQA 1IG7A 3A02A 4ANJA 4FCYA 2KL4A 3E6BA 4ESBA 4EGZA 1SVLA 4N4NB 3OL3A 4KMUX 4NQWB 3J80Z 3OS1A 3E5UA 4B09A 3EUKL 4IEJA 3MQ0A 3I71A 4XRSG 1RKWA 4WF2A 4IOCF 3CJRB 2DFIA 2EA2A 2OA4A 3HG9A 5FD5A 4BL0B 4WCGA 3TO9A 1MH3A 3F23A 3BTIA 4R79A 4DBQA 1V3FA 2K9MA 4BE0A 4W97A 2ZKZA 3S1MJ 3S3NA 2IEKA 3RSNA 4XSXF 3BWGA 2R7UA 4IHSA 1FP2A 2ESHA 2BY0A 5CVIA 2DMUA 4MNUA 4I02A 3BDDA 3MKYB 2VKHA 1R22A 1I27A 3U2RA 3P9CA 1FC3A 2L9SA 3FMQA 4G6TB 5ILSA 4MGRA 4BEHB 2E5ZA 5E8IA 1WJBA 1WFXA 3KPHA 3ZN0A 2VQHA 2CFOA 4LOCA 1BW5A 3BR6A 5BOXA 1AOYA 4PJNA 3OIOA 1X4PA 4MLOA 5HDNA 1XPXA 3BP8A 5IYDJ 3HSRA 4BAYA 2IW5A 3ZQGA 3HOUJ 3H9QA 4EATA 5HS9A 2W25A 1BIAA 4P5OA 4RB2C 1EH8A 3CC2I 2CUJA 2WAFA 1FT9A 4ENJA 2E2HJ 3ABTA 3FF5A 3BG6A 2IVMA 4GDFA 1A6IA 3RIRA 4M6XA 3LAPA 1AHDP 3OYFA 2MW8A 1BW6A 2OAZA 1TT0A 3W6KB 4S05A 3BR2A 4KIGA 2LY2A 1UFMA 2HKOA 1GT0C 2IGOA 2JA7J 4HX4A 3VB2A 3E6DA 3E6CC 3EUHC 5FFZA 3FXKA 2VXZA 1IN6A 1Z1DA 3R61A 4AUXA 5LHIA 3V7SA 1HW1A 1T56A 2COBA 1B59A 5L3GA 1J7KA 1WJDA 2DQLA 4QWQA 4A3EJ 4JX6A 1MGTA 3ZP5A 4MFEA 2L4MA 3A03A 2WY8Q 3FZVA 4I76A 3DKYA 1PDNC 2JRTA 3S1QJ 2MSYA 2BY3A 2LNBA 4G6QA 3FKJA 1TTYA 4JX4A 4A0XA 3AAFA 3WE2A 1W7PD 3Q0UA 4FT8A 2PX9A 3CJTB 1OYYA 4BHCA 4AYBN 2FOWA 4BYYA 3IKTA 1LPQA 4FE4A 2W57A 2STWA 2DK5A 3QODA 2MD0A 3L1PA 2HFHA 3A1YA 2DT7B 2BBYA 3EUAA 4UXNA 1Y8QB 4XN3A 1EA3A 1DU0A 1XMXA 1U8BA 2M0MA 2CGPA 5JHFA 5EEAA 2M8GX 4G7OF 4LB6B 2X6XA 3CJQB 3VODA 3FM3A 2D2WA 3D5SC 3ULQB 1X3UA 2VT2A 2L0KA 3LSGA 1BI0A 2VJ5A 3IV5A 3VWBA 1IN8A 3IH2A 1BM9A 2JA5J 4DYCA 3JTGA 1ZQ3P 2VJ4A 4II3A 1HSJA 4LMYA 5KCMA 4AIHA 2XSDC 4FX4A 1MMGA 3CQZJ 3M1EA 2XAGA 4ENKA 5IOYA 3GUDA 2CO5A 1H8AC 3LNQA 2FA5A 1B72B 2JVGA 5CVUA 5HODA 2A61A 2DFHA 3ZMZA 5LGUA 1TW2A 2CW8A 3DPUA 4CCJA 1A35A 1ZAOA 2NVUB 3DF8A 2VBZA 2VBWA 3K4MA 3ZRGA 2OPTA 3H5AA 4GYIA 1LKXA 4FE7A 1KONA 3WODF 1VQ9I 3D5RC 4QSHA 4MEXF 3BZ6A 5BS6A 4BH9A 4DGWB 1OKRA 4M3GA 4L9TA 2XF6A 3L00A 1TLHB 2HYJA 2P81A 1P4XA 2HQNA 1TWGJ 1WH5A 4I0AA 3DTKA 3HRSA 2P5VA 2BVLA 1J2XA 2LG4A 3RPUD 2A6EF 1ETQA 1BI2A 3DXJF 4JOMA 4GYGA 2LD5A 2NNNA 4HBLA 5FJ8J 2ELJA 2ZJPF 4M72A 4CUGA 4HOBA 4MTDA 2JA8J 2TCTA 2X6WA 3M8JA 5J4VA 3T8RA 3BQZA 2EFPA 2Z99A 1ERDA 2KZVA 2DCEA 2A69F 2F5VA 2FOKA 5KK1A 3F21A 1W4MA 3MFKA 3EYYA 3PJRA 1MMDA 1YS6A 2H1LA 1MZBA 2EZKA 3DPTA 3GEZA 1OCZH 3I4MJ 2ZFWA 4RS8A 2QBYA 2DPDA 1ZARA 2L7MP 2CW7A 4OIRF 2ZXWH 4Y15A 4D7MA 2RQQA 4CDGA 4S04A 5IT9Z 1I1GA 5J8CA 2E7WA 1ETVA 2BW3B 3DBLB 4C3JJ 4RGUA 1OFCX 2HTJA 1V5GA 3FXRA 2G0EA 3JREA 4ZTJA 3BTLA 4NC7A 4EJVA 2GQQA 2KIQA 2FJ1A 3HOTA 2ZFUA 2A68F 1ETKA 3JRAA 2YS9A 3H1CA 2LKXA 2LK2A 4HF2A 4XLAA 3V7RA 1U3EM 3RDIA 4HLYA 1S7EA 1ZLJA 2JA6J 5BPIA 2OU2A 2CFXA 1K6YA 2CSOA 3I4PA 3K2AA 3L2VA 3CDHA 2KP6A 1G3SA 1U9NA 5DDGA 3DCFA 2CV1A 5HVQC 1NTCA 4F91B 2RNJA 3PQKA 1CQTA 3L9FA 5BMZA 1XSDA 3F72A 1E0EA 1ZGAA 2ZNYA 1QHHD 3CCEI 4I2OA 1DUXC 4Q47A 2M1BA 2E1NA 1YHQI 2KDZA 3EPZA 2LP0A 2OZ6A 3FXLA 3I0TA 3H3VK 2KIMA 1TZLA 2KQRA 1MNEA 2NAZA 2WWYA 4N4OB 2OQRA 3TQNA 4EJUA 2HQ5A 2CQNA 3S1RJ 1WJFA 2DAOA 3F22A 2UWMA 1IC8A 3OYNA 3FMSA 4EJOA 3M07A 1XD7A 2EPFA 2X51A 4BU2A 2LR8A 4XRMA 3OL4A 1JUSA 3LQRA 2JZYA 2FBIA 3K2ZA 4ZZLA 1YOVB 2K86A 3HOZJ 1RNLA 1HW2A 1OR7A 3BG5A 3DWLE 4PGGA 2V79A 3N4MA 1DPRA 2ZCWA 3M4OJ 4M73A 4OMYA 5J40A 3GXOA 4PGHA 2DMNA 2EZIA 2PMZA 4N9IA 4UVCA 4F7ZA 2ZSIB 4AU7A 4KN4X 3DLLF 1JT0A 1YI2I 3K0LA 5TISC 5FB2A 4FTHA 1CF7A 4UV9A 1NK3P 1X3WB 2OZUA 2PJRB 3ZMUA 2YU3A 2Z5UA 4MO7A 4HNUA 4NC8A 5D6FA 1T0FA 3ISPA 5HOOA 1IRXA 2A3SA 1ZG5A 3KLNA 2GIZA 2GM4A 4WXHA 2E1CA 1UAAA 1MJ9A 2ELKA 3MD2A 4PSXA 3JAMZ 1SFEA 1R71A 4L0YB 4OIQF 2IAIA 4LG0A 3L2UA 4BXXJ 2RGVA 1VQ4I 3GTPJ 1YQAA 1HDDC 5DUIA 2F4OB 1N77A 2J5PA 2PEXA 2YX4A 5IOZA 1LFUP 2CW0F 2P6SA 3CMEI 2VPRA 3E5QA 4NNJA 2IGKA 3ONQA 5DUKA 4A6EA 3BQYA 4EM2A 2OCEA 3OYGA 2HU9A 3HSFA 1Z21A 1K4TA 4XLCA 2MFZA 1EJ9A 4BDZA 1FNNA 5CVVA 4CICA 5ILVA 3BJAA 2DDBA 3OIQA 2KKOA 2XGEA 2EZHA 2FX0A 2GAUA 2JQ7A 2WB1N 3CDLA 1R1TA 5DD4A 3VOEA 3QQAA 5FKLA 2ACJA 4KNYA 1OR7C 1ZYRF 2EWNA 2Y69H 4IQ4A 4XR6A 3G3ZA 4YRVA 5CVJA 2LKSA 1Z3YA 2BOLA 2JVHA 1NK2P 1Y0NA 4CA0A 2DDAA 3QU6A 2XPUA 4EM0B 2OV7A 3H36A 2QM3A 2QLZA 2AS5F 2KZGA 3T8TA 4Y4RA 4UVBA 3FXJA 1OISA 4RM3A 1E3HA 1ZN2A 4DNCA 1IRZA 2EFQA 4RGSA 4GXOA 1Y6IA 5IYCJ 2R7TA 1DQUA 1L0OC 1S8NA 1UHMA 2EA4A 2DU9A 4Z6YA 1UELB 1VQ5I 2IS1A 1FBQA 5H6RA 3IL2A 1D0ZA 1F36A 2VC1A 3PIPF 4WXCA 4IHWA 2LY1A 2VQCA 1D1BA 4P1WA 5LEKA 3M7GA 3J7ZI 2DW4A 2JSCA 4LG3A 5M5YJ 3Q0VA 5K7HA 2ZJQF 1J0RA 2QZ8A 4L5IA 3LWFA 2LLKA 4ZYAA 1ZRDA 1N75A 1TNSA 2X9DA 4OOIA 3JSPA 4RA2A 2MC3A 2F48A 3OV8A 4L9VA 3J7AO 1YLFA 1F5TA 4HSRA 1Z7LA 4Y7NJ 1ZTRA 4RAGA 3BPXA 3HPGA 2FSWA 5D8LB 5LRRA 2DTRA 2AQEA 4XLEA 2DJIA 2W7NA 5L3CA 3MKLA 2CJJA 4XORA 4JBAA 1SD7A 4RB0A 3N05A 2VODA 5AIQA 2WBMA 2DT5A 4G6DA 3HXLA 2R7SA 1W5CC 1XS9A 3SXYA 2DFEA 1SAUA 3HGGA 5F64A 2R5ZB 3FHNA 4A12A 1XMAA 4NBQA 1UHWA 1X2MA 3QOPA 2DXIA 3KYDB 1H89C 1QZZA 3TMOA 1BA5A 3FBNB 4CHUA 1P9QC 3ZMVA 1ENHA 1MMAA 3OYDA 1PP8F 3MZHA 1UB9A 1VQ7I 1NG6A 5FO5A 4H4KC 1MMSA 3Q3SA 3BG7A 2UXXA 3OYHA 2E7XA 4ON0A 5KVRA 2RQPA 3TEDA 3RQIA 5D5XB 3OYBA 4A3FJ 3G1OA 3FKIJ 1Y1VJ 3H92A 2DT6A 1D1CA 2DA3A 2K40A 4UB8C 2E60A 3MMYB 2FE3A 1RUOA 1HF0A 3ZMDA 2VKVA 2XROA 2GA1A 4RMNA 2DJNA 3OOUA 2HYFA 3HOVJ 4QLCU 3MZ8A 1SFOJ 3HTSB 1JT6A 5FRMA 1G6NA 4ITVA 2DTZA 2DODA 1RR8C 1IN4A 1GDTA 4BQQA 2R3SA 2EFWA 2MLKA 1H0MA 1J75A 3G4SI 3KP5A 4H0EA 2CQXA 1TWAJ 1IRGA 2K3FA 2OTJI 1PUEE 4A3KJ 3R0AA 4JX5A 1WJCA 3CCMI 1A04A 2IJLA 1B8IB 3A4CA 5K5OA 5DTDA 1EH6A 3R4KA 3N97A 4ZDLA 1WZ2A 3LAJA 2E1OA 1I3AA 2F5EA 3KCCA 4BHPA 5D5WB 3GTOJ 4XQFA 3MZYA 4YG2F 1LNWA 4HZFA 1MBGA 1YIOA 5E79C 3CCLI 2NOJB 2OCCH 1SD6A 3OR1C 3E1SA 4M3DA 2BY1A 1K4SA 5CYVA 4RGRA 5JI6A 3KP4A 2EILH 3FISA 3P7NA 5EG0B 1Z6RA 2HI3A 5H20A 1ZR4A 4DBRA 2LREA 5FGMA 2DA6A 2Y2ZA 4UUSB 1SANA 3H35A 3LL7A 2WAQA 4FX0A 3CESA 5DCFA 4D5CA 4KISA 1R1UA 2V4JC 1FJLA 3DTIA 4KMFA 4PFPA 2FNPA 4P55A 1B9NA 3PM1A 1USSA 3HBLA 1G4DA 5M5XJ 5D5UB 1OCTC 2W4SA 3EDPA 3GFIA 1FYLA 1TT5B 1G3TA 3E5XA 3K4JA 4UVAA 3JRGA 2LY9A 1WH7A 3EETA 3LSRA 2QSGX 3C2GA 4I99C 1JUMA 3OOPA 2R7WA 3NAUA 3P9IA 3ML6A 4HW0A 5H2FC 2R7RA 4LLNA 1X4OA 2DO7A 2O61A 3KZYA 3KLOA 4RLFA 3FXOA 4MFDA 3KETA 2V1NA 4GO1A 3WTSC 1JXSA 4XK4A 4DZPA 4I98B 1R5HA 5IPAA 1HXDA 4HDVA 4XM3A 1VQOI 3GBGA 4A69C 5EGOA 5JR3A 1I3QJ 3AL0B 2EJRA 1BR1A 3CP8A 3AG4H 3AG1H 3IH3A 4C3IJ 1U5TA 2DBBA 3IHUA 3J7AY 4KJZA 1ZREA 1FOKA 1QPMA 2R92J 4BBRJ 1W7PA 1ZELA 3T5XA 2IBDA 3K1PA 4XKBA 4BS9A 3PFIA 5ILUA 1IN7A 3OWTA 4E7JA 1A36A 3JR9A 4A2UA 3TP3A 1J09A 4CCMA 3J81K 1HKTA 3I59A 3Q9SA 3UKGA 3WU0A 4ZDOA 2XV4S 3SYTA 1R58A 1YITI 2BVMA 4M3FA 2MH9A 4U7DA 3ECHA 3FDYA 1FPQA 2XPVA 5J1RA 2BHYA 1DP7P 2EV0A 1T8IA 4I09A 4X1EA 1L3LA 2JRMA 4HQMA 1BI1A 5KAIC 4RM2A 3VEPA 3C2BA 4AVPA 5F27A 4IRIA 1JHFA 2L4AA 3BG3A 4P9UA 3O3KA 1KYWA 2WADA 2JT1A 1W0UA 3KFWX 2CG4A 3LSKA 4PJLA 4ZH4F 1XGOA 3T1BA 4AVZA 2CQQA 2M7BA 2DYRH 4HG2A 2QKLB 3W2VA 4C2UA 3IAS2 3IP4B 5L3FA 1FZPB 2Z16A 5K5QA 3ZMTA 3OS0A 3CDIA 2E19A 1YIJI 4CGZA 1T08B 2AHQA 2CQ7A 2VB6A 2HDWA 3D5LA 4LIUA 3CO7C 3SZPA 4LGWA 3TDUC 1SEUA 2QCOA 3HOYJ 2LBFB 2BXZA 3JW4A 3FXQA 3D0SA 3W6VA 5E20A 4O5VA 4ENMA 2FBKA 1Z91A 1SMYF 1HCRA 1C0WA 1BOBA 2GOXB 5FROA 3VYRB 4DOZA 4B43A 1O57A 2QSHX 3RPUA 4BE2A 3PSFA 2GZWA 4ASNA 1I6HJ 2VE8A 5F6FA 5K7FA 4IHVA 1OCPA 1OYWA 3G73A 3S16J 1XTAA 3RTRA 2FXAA 3OYEA 3G2BA 3Q9VA 3PUFA 4Q5SF 1ETYA 2EIMH 2E5NA 2H09A 4BACA 4G8XA 1KQ0A 2Z1DA 5EEHA 2QVOA 4Y13A 4FHTA 1OYIA 1XGSA 4QPOA 2KMUA 1OJLA 4W1UA 3X2QH 2HNHA 1MSEC 2KRHA 2VJIA 2AXLA 1IXSB 2QUFA 1DDNA 2R7QA 3GTGJ 3H9GA 3AL0C 2W48A 3CJNA 4XLPF 3NRVA 4GGGA 1TQPA 2DMPA 2M7AA 2LBFA 3WU1B 1XX5A 3QPLA 2HZDA 4E4HA 3CCUI 1SMTA 5F0HA 2WAEA 5F08A 1O3QA 2DA5A 5FD6A 4WXDA 3BJOA 4B3XA 4CCLA 3FM5A 2HVSA 1U9OA 2VKEA 3DEUA 5C3EJ 4PK4A 2A5WA 1WJAA 1E17A 1YJWI 5J6XA 5D5VB 2P5LC 4BGDA 5AONA 4D1QA 1BR4A 3RKWA 3S32A 2WY7Q 4C30A 1QPIA 2MBFA 2MD5A 2NVQJ 3LOCA 4PZJA 4MHGA 1UHSA 3V8JA 1QZYA 2XAFA 1KQ8A 2DLLA 4DYQA 1Y0UA 1SAXA 5DM7F 2ZJ2A 3MKWB 2H8RA 3HUGB 4R1HA 5FKNA 1GV5A 4OIPF 1BBYA 4LD5A 3TDZC 2KIFA 3W2WA 3K70C 4A5NA 3BG9A 1XN7A 1J59A 1UG0A 1WI9A 4XOTA 2QBYB 5DS9A 1TL8A 1PP7U 2XDVA 1P7JA 3F9KA 4A0ZA 3CLOA 5FKOA 5IP6A 2IRFG 3H9JA 1TQMA 3CP2A 5FLVA 3QAHA 5HDKA 2XAUA 4CYCB 5E3MA 3LSPA 4D0PA 1PYVA 2EV6A 3ELKA 2VL8A 3DBRB 1OMIA 4DW6A 4YIIA 1IXCA 5ED4A 1B9MA 4IKFA 4PDKA 2QF7A 4QTRA 3B73A 1JJ6C 4XLFA 1NHAA 5A2QK 2F5CA 3S3OA 4AC0A 1O3SA 1IXRC 1DGRM 2Q0OA 1LEBA 1FEXA 2QYOA 2JN6A 4RAYA 3ABLH 5LLQA 2A6HF 2VUMJ 1FX7A 3J81Z 1QHGA 2F4MB 2KFDA 4WX9A 4ENNA 4PJMA 2Y0SN 4Y52J 2IA2A 3ZXSA 4BJ6C 3JRBA 3GZ5A 3HUGA 1XCBA 1DU6A 4YFNF 1RETA 3HL2A 3SFIA 2Y9ZA 3H0GJ 4WWCA 3ZGKA 1IV8A 3K6GA 3K1NA 1FYKA 2TDXA 1V55H 1OPCA 4CZZA 4BXFA 2EZLA 2VOOA 3TW7A 2LRDA 2L3DA 3O8HA 3KEOA 5GTIC 1Z67A 4N9HA 1IDZA 2LFBA 2R7DA 5TJJA 3HGYA 4IJAA 1RC9A 2ZXJA 2KISA 1T38A 1HOMA 4CYCA 5ERIA 4HX8A 3KIOA 2M34A 1R9TJ 1YRNA 3HEFA 4A5MA 3U9GA 4IHTA 2DFFA 2L9NA 2CU7A 4HLXA 2F5DA 2CWEA 2LDUA 1KA8A 4G12A 2PQ8A 2WA0A 2L7ZA 1V5FA 4CCNA 2ME6A 5E17F 1V5EA 2F2EA 3ESWB 4E7KA 1R5GA 2QQBA 4XICA 2E2IJ 2OUMA 2KLOA 3KP3A 4ZTFA 1LB2A 1CF7B 1MSFC 2HOSA 1VQNI 1GUUA 3WE3A 3CO6C 3CCQI 3PL8A 1OCCH 1VI0A 3JRFA 3LA7A 4IXAA 1TWCJ 4DJAA 4P96A 1VQLI 2BZTA 4U0VA 4F3QA 4E7IA 3HDDA 4L5JA 4C2MJ 2K9LA 3GTMJ 5J4YA 3OSGA 1P7IA 4X6AJ 2UZKA 3QRFF 2MH2A 3CUOA 4A3GJ 4LG0B 2IS6A 4HV6A 2O3FA 3R0JA 2EH3A 4BY7J 2V6EA 2V9KA 4CCKA 1H88C 3GW2A 2QA4I 4V19K 4CZCA 4A93J 1KU9A 3TP0A 2O7OA 3B02A 2CQKA 2DN0A 4C2TA 2RN7A 4I01A 1KZHA 4IZZA 1XGMA 1XGNA 1R6RA 1S7OA 1TWHJ 5GAEJ 3OYCA 1IJWC 1TQIA 2DA1A 5FLXK 2COMA 2BE5F 3GZ6A 2EFOA 3IWZA 2HQAA 3F8FA 1MDMB 5EYRA 5GTHC 1WCMJ 4PFOA 5L3DA 4AYBA 3JRDA 4CYDA 4YIRX 2AXTC 1VQ6I 5LGNA 1IO2A 1P92A 3HPHA 3BZKA 3NWTA 3B6AA 3RZOJ 1XB4A 1YX5A 1RI7A 4KICA 1FTZA 1R5ID 1MNMC 3LSHA 3WHCA 4GRIA 3H3ZA 3LSIA 2ZJRF 1R4MB 1TNTA 5LEJA 1K78A 2KRFA 2ZNZA 3IAM2 4D5FA 4L9NA 3CC4I 2E34A 5E3OA 3PNYA 4II2A 4HF1A 4B3AA 3JSOA 3OS2A 4CO8A 4J01A 1RRJA 1KU7A 2FMLA 3GCMA 1JKQC 2BXYA 2NS8A 3O6BB 5IP7J 4PJJA 2MA3A 1JHHA 2I10A 1ETWA 1FMVA 2WV1A 3LFUA 2HR3A 2J5OA 1IGNA 3MKZA 3C3WA 5F04A 3B6CA 5IYBJ 2QGUA 1VTNC 1X1DA 4ZYGA 4A3CJ 1MDMA 2R7VA 1HA8A 2MGQA 3KE2A 2H27A 2RVCA 3M1CA 2MABA 2MLGA 4G9YA 1WKMA 1WPKA 2Y31A 2XIGA 2KJCA 1X58A 1W0TA 2ISZA 4QPQA 4J00A 2RV8A 1FYMA 2O8XA 3TBIA 3S3MA 4RAZA 5E3LA 1FBUA 2M2EA 1VQKI 3FX3A 1FP1D 2V26A 3VYUB 4A3IJ 1ODDA 2CUZA 4BNCA 2VC0A 3C18A 5DYMA 1BC7C 3CTAA 3KP7A 2ZMEA 5E1ZB 3O8GA 1R23A 3OY9A 2ZSHB 3PSIA 4HRIA 3K9TA 2GOMA 5JHUA 1IF1A 2VBXA 3RYPA 4L18B 1N25A 1T0FC 3LQQA 5EEGA 3HM5A 4NDLA 3GFLA 2NRAC 3JRIA 5CQGA 3CZ6A 3DTEA 5LHHA 5LBQA 4E6KG 1JI8A 2K02A 3QYFA 4G7ZF 3D1NI 1QO0D 4OAYA 4EJTA 3S15J 1EKEA 2K9NA 2RAEA 3VDXA 2MYSA 1LE8A 4EEFG 4MEYF 5M3MJ 1LVKA 3ABMH 3A0HC 3E3VA 3UR3C 3FK6A 2WC2A 4KFCA 2E71A 1EV7A 1YJNI 4V2GA 2L7KA 3E7LA 4PUSA 1S29A 2CYYA 3GTJJ 2G7UA 3GLLA 3L2QA 1AKHA 3ZCOA 2JK3A 3GF2A 4BQNA 1ETXA 3DKWA 3J80K 3F6OA 4ZYEA 1QA6A 5CPRB 2X0LA 3K69A 4KITB 3CMAI 4YFKF 1ACIA 5K5RA 2P0WA 3HHGA 1R1VA 1X1CA 5HDGA 1S3JA 2VXDA 2PI0A 4R8HA 3BR5A 2A5YB 3G1LA 2CH0A 1D5VA 2CRGA 4U87A 4MQ9F 3CCVI 4GCVA 1I6XA 2L9RA 1UG2A 1IZ1A 3BT9A 3QPTA 2ECCA 2Q2EA 5J47A 3GVAA 1LVAA 1MKMA 2F6CA 3LFKA 2V6CA 4HDUA 4FISA 3S2DJ 5CKTA 1PUFA 3H3UA 5LHGA 3SDBA 4BJ5C 3NWSA 3FBIB 2P6TA 2IA1A 4RGXA 3W6JB 2AQFA 2PMHA 1MJAA 4M6VA 4IPAA 1JKPC 3ERED 2R0QC 2LH9A 4QIWN 2IT0A 2O03A 3PUBA 3M9AA 4EM1A 2L2OA 3NEUA 5CQEA 2EQRA 1IUYA 3EQLF 4XKVA 1T33A 2JPCA 1KU3A 3F8BA 2DK8A 1S5LC 3H5RA 5GP9A 1A5JA 5HNHA 2O6GE 2OBPA 2RNGA 1S72I 1J5YA 4U0YA 4L5EA 5C4JJ 2FQ4A 5F0FA 1P2FA 4UB6C 1GXPA 5LD2C 3RKYA 3ZQLA 1A31A 4M74A 2PMUA 4XSZF 3LA2A 1JJ8C 1A6QA 2EB7A 1TC3C 2YUSA 2HPIA 3HKZN 4K2EA 4LLLA 3V4GA 2KT0A 2JJ7A 2DOEA 4BXUA 1H9GA 1F9NA 2P4WA 2WTEA 4XOPA 4U7BA 5JVGF 2DQRA 4LB5A 4AIKA 3VYTB 4Y3OA 2CV2A 2H6CA 3WTVC 3WTZA 1JE8A 4EMSA 5EGOB 3S93A 1YYVA 1FMWA 2LSOA 1WHUA 4HA8A 3I55I 3GWZA 1N78A 2K4BA 5DCMB 5EZHA 1U5TB 2M0CA 3P9KA 2HVQA 2V9VA 4XKCA 1O3RA 1JTYA 3K7AJ 5KNLA 1F4KA 3RQ4A 3ZOBA 2DA4A 1I5ZA 1B1BA 3C1DA 1W7PB 5F1JA 5BQTA 3U1DA 2R5YA 1HW5A 2K4JA 3K4KA 2GIVA 2FU4A 3K4NA 3OYJA 5BNGA 3S8PA 2QQ9A 4LFUA 3ZQHA 1YO5C 3I59B 4NB5A 5JFRA 3K10A 2VJJA 3L7WA 4HNTA 2QSFX 1HQCA 1Q1VA 4BUPA 1SD5A 2B7EA 5ICGA 4BKXA 2DA7A 2WB1A 2KJBA 3WTWC 1W36C 2X1CA 1WGXA 2V1UA 3ZPLA 2TRTA 2Z33A 2ZXHA 4B44A 4YELA 4V2FA 1YW7A 4NC6A 4OAZA 3PIOF 5B1AH 4ZYDA 3CF5F 1ZG1A 2UUZA 3R60A 1KGSA 4I0BA 3LSTA 4ZYHA 1KYZA 1T98A 2HOEA 3TO6A 3M8EA 1WI3A 3WTYC 4AM3A 1JKRC 2M3AA 2M45A 3E97A 4JK1X 2DOFA 5DCMA 3G1MA 3RZDJ 3F0CA 6PAXA 1STZA 1LDJA 1YTYA 2ID6A 2VI6A 1K83J 4AIDA 1FTTA 1QVUA 3ECOA 5CJ9A 1Z6TA 2HQRA 3MCZA 2MC4A 1VZ0A 3HRTA 1V54H 3HIFA 3ZQFA 1FOYA 3WU2C 1WVRA 4LK1F 2DA2A 1WRJA 5IP9J 2LYCA 4M9ZA 1QGPA 1FOWA 2HPMA 3IRRA 2Q1ZB 1T2KA 2JMWA 1E3PA 2E1MB 2KRCA 1FY7A 1YX3A 4KIFA 1D1AA 2ZC2A 4P9FA 5D8KB 4DQ2A 2HVRA 3HC7A 3AG2H 1WWXA 5E3NA 5D4SA 1E2XA 4IHYA 4CSWA 4KYWA 2JSPA 1X19A 3EUHA 2V7FA 3IUOA 3AFHA 1VQ8I 4F93B 2LF8A 1IV6A 4O6JA 1BL0A 1S6LA 1IDYA 3VYSB 4HQEA 3LMMA 1GVJA 1X1AA 1VQMI 3K4BA 1EF4A 1LQ1A 4DIQA 2DYSH 4AD9A 2F4IA 2VBYA 3WGGA 2XUBA 2HOAA 3DV8A 4I7HA 3VFZA 4Q48A 1FIAA 1P6RA 2X6YA 4EV0A 5IT9K 2NVYJ 5E1WA 2VLAA 5HLTA 3SEQA 1XCVA 1RESA 1LDDA 2XAQA 1XSVA 2KPMA 5CVRA 1Y1WJ 5HS7A 1X1BA 2LKPA 4U88A 2M4KA 3VPRA 1EH7A 2HEOA 2XVCA 3DU6A 4A3JJ 4A3LJ 3PNTA 1U2WA 2M87A 2NNYA 1AU7A 1RPWA 1BC8C 1ZGWA 1U5TC 2GBYA 1MBHA 3ZQ7A 5D4RA 4RLQA 1B6AA 2XB0X 3W2AA 5E18F 3RJPA 1CGPA 2DI3A 2STTA 5E1XA 1VF9A 1OCOH 5IY5H 2K9QA 5B3SH 2W1OA 3IWFA 4ETSA 2YU9J 1Z77A 3SZGA 1I50J 1SFKA 4NQWA 1R00A 2IXSA 3WGIA 3ZR8X 4G7HF 2ZBKA 2XSJC 4IVNA 2VONA 2XF5A 4L0ZB 2X6OA 1T95A 2O9LA 3WTUC 3KEYA 2N8GA 1BR2A 2HDDA 5L3EA 3VSLA 3CUQB 5GADJ 1O7LA 1USTA 1AA7A 3BR1A 4BDYA 4M3BA 2IGMA 2ID3A 3HKZA 4XL9A 4A3DJ 3F3XA 4PCQA 1FIPA 1REPC 4HYEA 3I4NJ 3V8LA 2IPQX 4HSTA 3TGNA 2D45A 2H1KA 4F55A 3OYAA 3QPHA 2PMZN 4KIBA 1ZH5A 1D3YA 5L3BA 5TGTA 2Q8KA 4BEHA 4IX7A 5B66C 1DPUA 2RDPA 1MD0A 2JTVA 9ANTA 2VE9A 5HS8A 2XF7A 1QZEA 3HOXJ 3ERMA 2V1DA 5FFXA 4ESJA 1E3OC 4DZJA 3BOQA 2D1HA 3ASOH 3V7CA 2PBIA 2IS4A 2G9WA 1GV2A 2W00A 2E1MC 3I64A 1XG1A 1WSUA 4XN0A 4OIOF 1JGGA 2L01A 3JTHA 4Q4ZF 2W85A 5D6EA 5KHDA 3DPLC 3WG7H 3JAMK 1F43A 1SVMA 1UJ8A 3CUQA 5ICCA 3L2WA 4FQGA 2OF7A 2EIKH 3KP6A 4WK8F 2LTPA 5TRDA 4GFBA 1QNTA 4XRFA 1P4AA 1XDSA 2IA0A 4B48A 1BIBA 3GMEA 3E0JB 2VIXA 3BCBA 2X1EA 1HC8A 2Y0MA 5J3LA 4JYKA 1S7AA 1FOXA 1ULYA 1GHCA 1YW9A 5M3FJ 2A07F 3CLQA 2OC6A 1MW7A 1ON2A 4UY8I 1YRNB 1IAWA 1SD4A 5EDNA 1MJBA 3IRQA 1TW3A 3KP2A 2B9SA 2W84A 1IN5A 4CCOA 2K5CA 4KT5C 2H8WA 3L09A 1QU3A 2FBHA 4BE1A 3BCAA 3SEZA 4C9YA 1Z3XA 3QPSA 2ETHA 3OMYA 2XGDA 2W82A 1K6OA 2LC2A 2FUG2 2BV6A 1WJEA 1Z05A 3FXMA 3BJ6A 4NUBA 4OWRB 4B47A 4RB1A 1ZRFA 1IUFA 1ZK8A 3CF2A 3Q5FA 3SQNA 2P7VB 1ZRCA 3NQOA 5DM6F 2XKOA 1X2NA 2BGCA 2ISYA 2L7FP 3QP5A 3FHZA 3HYIA 1XSXA 2VQLA 3K4LA 2XC7A 3BROA 2M9HA 2QENA 5LFAA 4ZC3A 2NS0A 3BR0A 5DEQA 2HXIA 4A3BJ 1U6GA 1U8RA 2HDCA 3W3CA 2BHZA 1RUNA 3K70D 2NVTJ 1W1WE 4IRGA 4IF4A 5EJCA 1LJ9A 1JTXA 1Z7UA 4OU0A 2PLYA 1LFBA 2X85A 2PG4A 4Y17A 4XRSA 4E70A 5JLWA 2K3PA 1HBXG 3HHHA 1HKSA 1ZGJA 2HKXA 2MG4A 2E36A 2KDOA 3CCYA 2LOOA 3HB9A 4YEJA 3CCJI 3CUQC 1B72A 2NYXA 3R6SA 3DQVC 2OQGA 3BTJA 2NS7A 3WHBA 2YX7A 2GLOA 3LSJA 4MTEA 1D5YA 4LITA 3Q0WA 5HLGA 3A2KA 5FRNA 3GTLJ 3REOA 3DBHB 4HPQA 3DFGA 1R49A 1D0XA 2PN6A 1LEAA 3FMRA 3TW6A 3MAJA 1GLNA 4S0HB 2I5UA 1TP4A 4ZJZA 2YR2A 5F0CA 2L5QA 3HOSA 2VASA 1U0JA 4MIMA 1ONVA 2CV0A 3MWMA 3I3LA 4Y33A 1I1SA 1O4XA 2K7LA 1BOAA 4HV5A 4F52A 1Y56A 1APLC 5K1YA 2P7CB 2BYVE 4B1RA 3TL4X 2QEXI 5J8FA 2LMDA 1DP3A 1VQPI 1TBXA 2BEOA 1UMQA 4D7NA 1K78B 1J9IA 1QVTA 1F1ZA 3IH4A 3F6VA 5BPDA 1I39A 1W5TA 2NXNB 1JKOC 3F8CA 4UNOA 3ASNH 1MNDA 4OMZA 5FKKA 2XB5A 1MIJA 1BJAA 2IGNA 2EINH 2Z3YA 4LK0F 3M8FA 3J7YJ 3G71I 4HAMA 3KZZA 5HLIA 5GPCA 3UNGC 4E7LA 3GX4X 3JRCA 4XNFA 2B63J 1NH3A 2F5FA 2BW3A 4ZDPA 2LVSA 3BZCA 1Z0XA 2ZO4A 3BLYA 4JP0A 3T0YA 4XKWA 2L54A 5B1BH 1TWFJ 3O2PE 3GTQJ 4CH7A 3S17J 3JCUC 1FBSA 4KT6A 4YFXF 1YG2A 1G2HA 2FRHA 1JUPA 4O3MA 3ZQIA 4NHJA 3L2RA 2VN2A 3RCOA 1OLTA 3DEWA 3CD6I 4AWXB 4ZZDA 2DPUA 3HJEA 1V4RA 2D1VA 4E7ZA 2M8EA 1WQ2A 4RAFA 2R7OA 3HOWJ 1QQIA 2ZMEB 1KQ9A 1GXQA 2PFBA 2QKMB 4BBSJ 3I54A 4UUTA 1O3TA 1FSEA 2OD5A 3KEQA 4JQFA 4M71A 5H6QA 2XKPA 2Z9OA 3KYCB 1O7FA 1YFHA 2X1DA 5DV5A 3I5UA 5CLSA 1Y8RB 5KAFC 3RPQA 1X3ZB 1YS7A 2ESNA 1X1PA 2PJPA 1LE8B 3DEEA 3OYKA 1MBFA 2WAQN 3QOEA 1OCRH 3VSKA 3S14J 3DLAA 4FETA 4XONA 4M3EA 4BJTA 2H6BA 3CCRI 1MBKA 2JUGA 2RKHA 5DD8A 2A05A 2VOPA 2VKDA 3SDGA 4FASD 4J19A 1FLIA 1DGWY 3LSMA 3KZIC 1WJ5A 3AKZA 2DMTA 3I58A 4KUMA 1AKHB 2K9SA 2ECBA 5A2QZ 2CUEA 2PJRA 4CXFA 1RKTA 3SFZA 3SHFA 4RDUA 2FNAA 2O5RA 2R93J 2DMQA 2ZXIA 3H5NA 2CMPA 1Q1HA 1G8XA 2XRLA 3I9V2 2K27A 2IP2A 3CCSI 5M5WJ 3BC8A 2YPRA 1ETOA 3I53A 5ICFA 4IL6C 5ICEA 5J1YA 2Y75A 5HLHA 1LDKB 4EJWA 3MN2A 2Y0SA 3ZQCA 2K85A 1XC5A 3QYEA 3QWLA 3BTCA 4LJZF 3GFMA 1RIOH 2VQGA 2EK5A 3MEXA 2FEZA 4A6DA 1XDUA 3GYHX 4BQOA 1RR7A 1ZLKA 1YJ9I 1GVDA 3COAC 2R7ZJ 1POGA 2Q2EB 1T39A 4IQJA 1ORKA 4M6YA 5E8GA 5FLMJ 1SVOA 4XMYA 4DYRA 1IRFA 1PUFB 2B0LA 2JUCA 4TV7A 4UV8A 1SFUA 1SC7A 1R4NB 2OJED 3OIPA 2GA2A 2KIUA 2UXNA 4KDPA 1NG7A 5JLXA 4ABZA 3OYIA 4BQAA 4EQQA 3GFJA 1Y39A 3BR3A 3CMYA 1PVEA 1MH4A 2Y48A 5J1UA 4RBOA 2EBIA 3F8NA 1QRYA 4XIDA 5GAGJ 1MBEA 4G94A 1IW7F 2V9PA 2GXBA 4E7HA 3GZNB 2HTSA 2HOTA 2JWTA 2GXAA 1MBJA 1M1EB 1S9HA 5IT3A 2R7XA 1R36A 4E7SA 2NVXJ 4EGYA 1FWZA 1U78A 1XMKA 1ZKGA 2ZMEC 3K1MA 3JRHA 4HEA2 2RC4A 1ON1A 3G6EI 2EIJH 3U21A 2DOAA 3PO3J 2Z2SB 3H0DA 4RB3C 2X4HA 5C44J 2UV1A 2XHKA 1YW8A 2BY2A 2LF7A 1ZR2A 4OINF 4F92B 1G3WA 2ADUA 1MMNA 2W24A 3HSEA 3P5JA 1HKQA 1T6SA 2XPWA 3IC7A 4ESFA 2QWWA 1ITYA 2Y9YA 3I56I 2R4GA 4BY1J 3QYBA 2EV5A 2HXOA 2R5YB 3RI4A 3SJMA 3A01B 5FLXZ 1HDPA 2FQ3A 3AG3H 2P8TA 1LUJB 2A6TA 2O0YA 3SZTA 3DKXA 4YIFA 3TOAA 3KX2A 2P5KA 2HZTA 1QBJA 4XLHA 5EF6A 3FXUA 3ZMSA 4IO9F 2L9VA 4IOAF 1K79A 3RYRA 5F1RA 2XASA 2XGCA 2GWRA 3K4CA 3BY6A 3WTXC 3QP6A 4Z2YA 1K7AA 3DP7A 2R5ZA 3IKVA 2R7FA 1Z9CA 3RKXA 4KA4A 2CS3A 2X48A 2ZB9A 1FSHA 1K61A 5K7ZA 3MVPA 3U1KA 3BPVA 1D8KA 3OR2C 2XAHA 3LA3A 1HSTA 4M9XA 1G59A 1KU2A 4A0YA 3L2CA 2G7HA 2FF4A 3OSFA 3ROUA 1OQYA 4UUVA 2VT3A 2XAJA 4PSWA 2KHMA 3FIWA 2CUFA 1ZG3A 2WV0A 3E6MA 1ZHFA 2M5WA 2RREA 3A01A 2FMYA 2AO9A 2M30A 2ICWG 1AWCA 2I8DA 2HGCA 4KN7X 4PJ0C 1RZ4A 1G3YA 3QU3A 4XLNF 2E35A 3TO7A 1LFPA 2O8KA 3GTKJ 3ZN1A 5JVTA
chains in the Genus database with same CATH topology
1BJZA 5IYCJ 1MSFC 2HOSA 3BR1A 1GUUA 2ME0A 4A3MJ 4M3BA 1F36A 2ID3A 4A3DJ 1VI0A 3JRFA 1FIPA 4IHWA 1VNDA 3M3YJ 3I4NJ 1TWCJ 2H1KA 3HDDA 2FD5A 2PMZN 2Y30A 3Q0VA 4C2MJ 5K7HA 5M5YJ 1B8IA 3GTMJ 5C4XJ 2LLKA 3OSGA 1P7IA 2X9DA 2NOGA 4X6AJ 1VFCA 2D5VA 4A3GJ 9ANTA 2EH3A 4BY7J 3HOXJ 1HLVA 1H88C 1E3OC 4DZJA 4C3HJ 4Y7NJ 1ZTRA 4A93J 3RKQA 3TP0A 2O7OA 3MKLA 3S1NJ 2CJJA 2DN0A 2E2JJ 1GV2A 5EZGA 1XG1A 1JGGA 3NARA 5EG0A 1TWHJ 1XS9A 4B4CA 3HGGA 1F43A 2R5ZB 4I6ZA 1IJWC 3PO2J 4IHXA 2B63J 2DA1A 4UUSA 2OF7A 1X2MA 4GFBA 2LTPA 1H89C 5FKMA 3S2HJ 1BA5A 5GPAA 1ENHA 5EYRA 1WCMJ 4HNVA 5J3LA 3FK7A 4JYKA 3JRDA 3Q3SA 1IG7A 3A02A 5M3FJ 4FCYA 3B6AA 3TEDA 3RQIA 3RZOJ 4A3FJ 1YRNB 3G1OA 1FTZA 1MNMC 3FKIJ 1Y1VJ 5EDNA 2K40A 3WHCA 2DA3A 4IEJA 4XRSG 1RKWA 1HF0A 3QPSA 2VKVA 4D5FA 1MH3A 2DJNA 2XGDA 3OOUA 3BTIA 5E3OA 3HOVJ 1SFOJ 4B3AA 1JT6A 4W97A 1IUFA 1ZK8A 2DTZA 3S1MJ 1GDTA 2IEKA 1JKQC 2NS8A 1X2NA 2L7FP 5IP7J 2CQXA 1TWAJ 2I10A 2DMUA 1ETWA 2WV1A 4A3KJ 1IGNA 4JX5A 2M9HA 5F04A 3B6CA 5IYBJ 3BR0A 1B8IB 2HXIA 4A3BJ 5DTDA 4A3CJ 2NVTJ 2E1OA 2MGQA 4LOCA 1BW5A 1JTXA 1WPKA 3BR6A 2Y31A 1LFBA 3GTOJ 3OIOA 4MLOA 4XRSA 1MBGA 1X58A 1W0TA 5JLWA 5IYDJ 3HOUJ 3ZQGA 5E3LA 2MG4A 4M3DA 2M2EA 3CCYA 3HB9A 2E2HJ 1B72A 4A3IJ 1A6IA 3BTJA 3FISA 2NS7A 3WHBA 5EG0B 2HI3A 1AHDP 2GLOA 2MW8A 1BW6A 3LSJA 1ZR4A 1D5YA 3Q0WA 3O8GA 2DA6A 3BR2A 3GTLJ 2Y2ZA 4UUSB 1GT0C 2JA7J 1SANA 3TW6A 4S0HB 4D5CA 3HM5A 4NDLA 4AUXA 1FJLA 3JRIA 5F0CA 3PM1A 1T56A 3HBLA 5M5XJ 1OCTC 2COBA 4MIMA 3D1NI 4A3EJ 4JX6A 3S15J 1O4XA 4MFEA 3A03A 2K9NA 2RAEA 4I76A 1APLC 1LE8A 4EEFG 5M3MJ 3JRGA 4B1RA 3S1QJ 2LY9A 1WH7A 2MSYA 3LSRA 3FK6A 1JUMA 3NAUA 4JX4A 1UMQA 4D7NA 4V2GA 3Q0UA 1QVTA 3IH4A 3E7LA 4AYBN 4MFDA 1JKOC 4FE4A 4XK4A 4DZPA 3GTJJ 5IPAA 1AKHA 3L1PA 3GBGA 4A69C 2JK3A 5EGOA 1I3QJ 5FKKA 2XB5A 1DU0A 1ETXA 1U8BA 3IH3A 5GPCA 4C3IJ 5EEAA 3JRCA 2M8GX 2LVSA 1Z0XA 4JP0A 2R92J 4BBRJ 1TWFJ 2L0KA 3LSGA 3GTQJ 3IV5A 2IBDA 3S17J 3BR5A 3IH2A 3G1LA 2JA5J 2CRGA 3JR9A 4DYCA 1G2HA 1ZQ3P 3TP3A 1JUPA 2L9RA 2XSDC 3ZQIA 1UG2A 3CQZJ 3UKGA 5IOYA 3BT9A 1H8AC 3LNQA 3DEWA 4M3FA 2ECCA 1B72B 2XPVA 5HODA 5J1RA 4FISA 3S2DJ 3HOWJ 1PUFA 4X1EA 4BBSJ 2OPTA 4UUTA 3C2BA 5F27A 4FE7A 4M6VA 4QSHA 1JKPC 3BG3A 2R0QC 4QIWN 1W0UA 4M3GA 2EQRA 2HYJA 1T33A 2CQQA 2P81A 5GP9A 1A5JA 1TWGJ 1WH5A 4L5EA 5C4JJ 1LE8B 2FQ4A 5F0FA 2E19A 3ZQLA 1ETQA 1MBFA 2WAQN 1JJ8C 3S14J 2AHQA 2LD5A 5FJ8J 1TC3C 2YUSA 3HKZN 2JA8J 2TCTA 2KT0A 4M3EA 2JJ7A 1MBKA 3BQZA 4Y52J 3SDGA 4J19A 2QCOA 3HOYJ 2DMTA 1AKHB 2K9SA 2EZKA 3W6VA 2ECBA 5EGOB 3I4MJ 2CUEA 1RKTA 4RDUA 1HCRA 2R93J 2L7MP 2DMQA 5EZHA 4D7MA 2XRLA 2M0CA 1I6HJ 5M5WJ 1ETVA 1JTYA 3K7AJ 5K7FA 4C3JJ 1ETOA 3ZOBA 1OCPA 2DA4A 4IHVA 1OFCX 5J1YA 3JREA 2G0EA 3S16J 5F1JA 3BTLA 2R5YA 3MN2A 3ZQCA 1XC5A 1ETYA 2FJ1A 3BTCA 5BNGA 1ETKA 3JRAA 2YS9A 3ZQHA 2LKXA 2LK2A 1RR7A 1GVDA 1S7EA 2JA6J 2R7ZJ 1OJLA 3K2AA 4W1UA 1POGA 1Q1VA 1U9NA 3DCFA 1MSEC 1NTCA 1ORKA 4BKXA 5FLMJ 2DA7A 1CQTA 4DYRA 3GTGJ 1WGXA 1PUFB 2TRTA 2W48A 4V2FA 2DMPA 2KDZA 3QPLA 2LP0A 3H3VK 1WI3A 5F0HA 5F08A 1JKRC 2DA5A 5JLXA 4ABZA 2HQ5A 3G1MA 3S1RJ 3RZDJ 3F0CA 1IC8A 3BR3A 1U9OA 3CMYA 1MH4A 2ID6A 2VI6A 1K83J 2LR8A 2VKEA 4XRMA 5C3EJ 1FTTA 1QVUA 5J1UA 4RBOA 2EBIA 4XIDA 1QRYA 1JUSA 1MBEA 2HOTA 3HOZJ 2JWTA 3ZQFA 1QPIA 1MBJA 3BG5A 2NVQJ 3LOCA 2DA2A 1UHSA 3M4OJ 2NVXJ 5IP9J 2DMNA 2EZIA 4DYQA 1U78A 1ZKGA 2H8RA 1JT0A 5FKNA 1GV5A 2JMWA 4FTHA 3JRHA 3BG9A 1NK3P 5DS9A 3PO3J 1P7JA 5FKOA 4MO7A 5IP6A 5C44J 5E3NA 5FLVA 4IHYA 1ZR2A 4CYCB 5E3MA 2GM4A 3LSPA 2XPWA 1IV6A 1BL0A 2ELKA 2Y9YA 1ITYA 4BY1J 4DW6A 1IDYA 2HXOA 2R5YB 2IAIA 2QF7A 3A01B 3SJMA 4QTRA 1HDPA 4BXXJ 1JJ6C 3GTPJ 1EF4A 1HDDC 4AC0A 2HOAA 5IOZA 1FIAA 1LFUP 2NVYJ 1FEXA 5EF6A 2VPRA 2JN6A 1RESA 2VUMJ 2XGCA 3BQYA 1Y1WJ 2Y0SN 3VPRA 2R5ZA 3JRBA 4A3JJ 1DU6A 4A3LJ 1AU7A 1RETA 1RPWA 2Y9ZA 2GBYA 3SFIA 3H0GJ 1ZGWA 1MBHA 2X48A 2ZB9A 1K61A 5K7ZA 3MVPA 2XGEA 2EZHA 2EZLA 2FX0A 3TW7A 3O8HA 2WB1N 3CDLA 2XB0X 1IDZA 3QQAA 2LFBA 3HGYA 5FKLA 1VF9A 1HOMA 4CYCA 2K9QA 3OSFA 2YU9J 2M34A 1R9TJ 1Z77A 1NK2P 1YRNA 3HEFA 3FIWA 1I50J 2CUFA 2CU7A 2XPUA 3A01A 2AO9A 4G12A 2X6OA 2L7ZA 2ME6A 2O9LA 2N8GA 2HDDA 1IRZA 2O8KA 4XICA 3GTKJ 2E2IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJZ A;  5IYC J;  1MSF C;  2HOS A;  3BR1 A;  1GUU A;  2ME0 A;  4A3M J;  4M3B A;  1F36 A;  2ID3 A;  4A3D J;  1VI0 A;  3JRF A;  1FIP A;  4IHW A;  1VND A;  3M3Y J;  3I4N J;  1TWC J;  2H1K A;  3HDD A;  2FD5 A;  2PMZ N;  2Y30 A;  3Q0V A;  4C2M J;  5K7H A;  5M5Y J;  1B8I A;  3GTM J;  5C4X J;  2LLK A;  3OSG A;  1P7I A;  2X9D A;  2NOG A;  4X6A J;  1VFC A;  2D5V A;  4A3G J;  9ANT A;  2EH3 A;  4BY7 J;  3HOX J;  1HLV A;  1H88 C;  1E3O C;  4DZJ A;  4C3H J;  4Y7N J;  1ZTR A;  4A93 J;  3RKQ A;  3TP0 A;  2O7O A;  3MKL A;  3S1N J;  2CJJ A;  2DN0 A;  2E2J J;  1GV2 A;  5EZG A;  1XG1 A;  1JGG A;  3NAR A;  5EG0 A;  1TWH J;  1XS9 A;  4B4C A;  3HGG A;  1F43 A;  2R5Z B;  4I6Z A;  1IJW C;  3PO2 J;  4IHX A;  2B63 J;  2DA1 A;  4UUS A;  2OF7 A;  1X2M A;  4GFB A;  2LTP A;  1H89 C;  5FKM A;  3S2H J;  1BA5 A;  5GPA A;  1ENH A;  5EYR A;  1WCM J;  4HNV A;  5J3L A;  3FK7 A;  4JYK A;  3JRD A;  3Q3S A;  1IG7 A;  3A02 A;  5M3F J;  4FCY A;  3B6A A;  3TED A;  3RQI A;  3RZO J;  4A3F J;  1YRN B;  3G1O A;  1FTZ A;  1MNM C;  3FKI J;  1Y1V J;  5EDN A;  2K40 A;  3WHC A;  2DA3 A;  4IEJ A;  4XRS G;  1RKW A;  1HF0 A;  3QPS A;  2VKV A;  4D5F A;  1MH3 A;  2DJN A;  2XGD A;  3OOU A;  3BTI A;  5E3O A;  3HOV J;  1SFO J;  4B3A A;  1JT6 A;  4W97 A;  1IUF A;  1ZK8 A;  2DTZ A;  3S1M J;  1GDT A;  2IEK A;  1JKQ C;  2NS8 A;  1X2N A;  2L7F P;  5IP7 J;  2CQX A;  1TWA J;  2I10 A;  2DMU A;  1ETW A;  2WV1 A;  4A3K J;  1IGN A;  4JX5 A;  2M9H A;  5F04 A;  3B6C A;  5IYB J;  3BR0 A;  1B8I B;  2HXI A;  4A3B J;  5DTD A;  4A3C J;  2NVT J;  2E1O A;  2MGQ A;  4LOC A;  1BW5 A;  1JTX A;  1WPK A;  3BR6 A;  2Y31 A;  1LFB A;  3GTO J;  3OIO A;  4MLO A;  4XRS A;  1MBG A;  1X58 A;  1W0T A;  5JLW A;  5IYD J;  3HOU J;  3ZQG A;  5E3L A;  2MG4 A;  4M3D A;  2M2E A;  3CCY A;  3HB9 A;  2E2H J;  1B72 A;  4A3I J;  1A6I A;  3BTJ A;  3FIS A;  2NS7 A;  3WHB A;  5EG0 B;  2HI3 A;  1AHD P;  2GLO A;  2MW8 A;  1BW6 A;  3LSJ A;  1ZR4 A;  1D5Y A;  3Q0W A;  3O8G A;  2DA6 A;  3BR2 A;  3GTL J;  2Y2Z A;  4UUS B;  1GT0 C;  2JA7 J;  1SAN A;  3TW6 A;  4S0H B;  4D5C A;  3HM5 A;  4NDL A;  4AUX A;  1FJL A;  3JRI A;  5F0C A;  3PM1 A;  1T56 A;  3HBL A;  5M5X J;  1OCT C;  2COB A;  4MIM A;  3D1N I;  4A3E J;  4JX6 A;  3S15 J;  1O4X A;  4MFE A;  3A03 A;  2K9N A;  2RAE A;  4I76 A;  1APL C;  1LE8 A;  4EEF G;  5M3M J;  3JRG A;  4B1R A;  3S1Q J;  2LY9 A;  1WH7 A;  2MSY A;  3LSR A;  3FK6 A;  1JUM A;  3NAU A;  4JX4 A;  1UMQ A;  4D7N A;  4V2G A;  3Q0U A;  1QVT A;  3IH4 A;  3E7L A;  4AYB N;  4MFD A;  1JKO C;  4FE4 A;  4XK4 A;  4DZP A;  3GTJ J;  5IPA A;  1AKH A;  3L1P A;  3GBG A;  4A69 C;  2JK3 A;  5EGO A;  1I3Q J;  5FKK A;  2XB5 A;  1DU0 A;  1ETX A;  1U8B A;  3IH3 A;  5GPC A;  4C3I J;  5EEA A;  3JRC A;  2M8G X;  2LVS A;  1Z0X A;  4JP0 A;  2R92 J;  4BBR J;  1TWF J;  2L0K A;  3LSG A;  3GTQ J;  3IV5 A;  2IBD A;  3S17 J;  3BR5 A;  3IH2 A;  3G1L A;  2JA5 J;  2CRG A;  3JR9 A;  4DYC A;  1G2H A;  1ZQ3 P;  3TP3 A;  1JUP A;  2L9R A;  2XSD C;  3ZQI A;  1UG2 A;  3CQZ J;  3UKG A;  5IOY A;  3BT9 A;  1H8A C;  3LNQ A;  3DEW A;  4M3F A;  2ECC A;  1B72 B;  2XPV A;  5HOD A;  5J1R A;  4FIS A;  3S2D J;  3HOW J;  1PUF A;  4X1E A;  4BBS J;  2OPT A;  4UUT A;  3C2B A;  5F27 A;  4FE7 A;  4M6V A;  4QSH A;  1JKP C;  3BG3 A;  2R0Q C;  4QIW N;  1W0U A;  4M3G A;  2EQR A;  2HYJ A;  1T33 A;  2CQQ A;  2P81 A;  5GP9 A;  1A5J A;  1TWG J;  1WH5 A;  4L5E A;  5C4J J;  1LE8 B;  2FQ4 A;  5F0F A;  2E19 A;  3ZQL A;  1ETQ A;  1MBF A;  2WAQ N;  1JJ8 C;  3S14 J;  2AHQ A;  2LD5 A;  5FJ8 J;  1TC3 C;  2YUS A;  3HKZ N;  2JA8 J;  2TCT A;  2KT0 A;  4M3E A;  2JJ7 A;  1MBK A;  3BQZ A;  4Y52 J;  3SDG A;  4J19 A;  2QCO A;  3HOY J;  2DMT A;  1AKH B;  2K9S A;  2EZK A;  3W6V A;  2ECB A;  5EGO B;  3I4M J;  2CUE A;  1RKT A;  4RDU A;  1HCR A;  2R93 J;  2L7M P;  2DMQ A;  5EZH A;  4D7M A;  2XRL A;  2M0C A;  1I6H J;  5M5W J;  1ETV A;  1JTY A;  3K7A J;  5K7F A;  4C3J J;  1ETO A;  3ZOB A;  1OCP A;  2DA4 A;  4IHV A;  1OFC X;  5J1Y A;  3JRE A;  2G0E A;  3S16 J;  5F1J A;  3BTL A;  2R5Y A;  3MN2 A;  3ZQC A;  1XC5 A;  1ETY A;  2FJ1 A;  3BTC A;  5BNG A;  1ETK A;  3JRA A;  2YS9 A;  3ZQH A;  2LKX A;  2LK2 A;  1RR7 A;  1GVD A;  1S7E A;  2JA6 J;  2R7Z J;  1OJL A;  3K2A A;  4W1U A;  1POG A;  1Q1V A;  1U9N A;  3DCF A;  1MSE C;  1NTC A;  1ORK A;  4BKX A;  5FLM J;  2DA7 A;  1CQT A;  4DYR A;  3GTG J;  1WGX A;  1PUF B;  2TRT A;  2W48 A;  4V2F A;  2DMP A;  2KDZ A;  3QPL A;  2LP0 A;  3H3V K;  1WI3 A;  5F0H A;  5F08 A;  1JKR C;  2DA5 A;  5JLX A;  4ABZ A;  2HQ5 A;  3G1M A;  3S1R J;  3RZD J;  3F0C A;  1IC8 A;  3BR3 A;  1U9O A;  3CMY A;  1MH4 A;  2ID6 A;  2VI6 A;  1K83 J;  2LR8 A;  2VKE A;  4XRM A;  5C3E J;  1FTT A;  1QVU A;  5J1U A;  4RBO A;  2EBI A;  4XID A;  1QRY A;  1JUS A;  1MBE A;  2HOT A;  3HOZ J;  2JWT A;  3ZQF A;  1QPI A;  1MBJ A;  3BG5 A;  2NVQ J;  3LOC A;  2DA2 A;  1UHS A;  3M4O J;  2NVX J;  5IP9 J;  2DMN A;  2EZI A;  4DYQ A;  1U78 A;  1ZKG A;  2H8R A;  1JT0 A;  5FKN A;  1GV5 A;  2JMW A;  4FTH A;  3JRH A;  3BG9 A;  1NK3 P;  5DS9 A;  3PO3 J;  1P7J A;  5FKO A;  4MO7 A;  5IP6 A;  5C44 J;  5E3N A;  5FLV A;  4IHY A;  1ZR2 A;  4CYC B;  5E3M A;  2GM4 A;  3LSP A;  2XPW A;  1IV6 A;  1BL0 A;  2ELK A;  2Y9Y A;  1ITY A;  4BY1 J;  4DW6 A;  1IDY A;  2HXO A;  2R5Y B;  2IAI A;  2QF7 A;  3A01 B;  3SJM A;  4QTR A;  1HDP A;  4BXX J;  1JJ6 C;  3GTP J;  1EF4 A;  1HDD C;  4AC0 A;  2HOA A;  5IOZ A;  1FIA A;  1LFU P;  2NVY J;  1FEX A;  5EF6 A;  2VPR A;  2JN6 A;  1RES A;  2VUM J;  2XGC A;  3BQY A;  1Y1W J;  2Y0S N;  3VPR A;  2R5Z A;  3JRB A;  4A3J J;  1DU6 A;  4A3L J;  1AU7 A;  1RET A;  1RPW A;  2Y9Z A;  2GBY A;  3SFI A;  3H0G J;  1ZGW A;  1MBH A;  2X48 A;  2ZB9 A;  1K61 A;  5K7Z A;  3MVP A;  2XGE A;  2EZH A;  2EZL A;  2FX0 A;  3TW7 A;  3O8H A;  2WB1 N;  3CDL A;  2XB0 X;  1IDZ A;  3QQA A;  2LFB A;  3HGY A;  5FKL A;  1VF9 A;  1HOM A;  4CYC A;  2K9Q A;  3OSF A;  2YU9 J;  2M34 A;  1R9T J;  1Z77 A;  1NK2 P;  1YRN A;  3HEF A;  3FIW A;  1I50 J;  2CUF A;  2CU7 A;  2XPU A;  3A01 A;  2AO9 A;  4G12 A;  2X6O A;  2L7Z A;  2ME6 A;  2O9L A;  2N8G A;  2HDD A;  1IRZ A;  2O8K A;  4XIC A;  3GTK J;  2E2I J; 
#chains in the Genus database with same CATH topology
 1BJZ A;  2EFN A;  1H9T A;  3WTT C;  3TOB A;  2ME0 A;  4IRH A;  4A3M J;  3HRM A;  4U0W A;  2IS2 A;  1W5S A;  2XRN A;  4XBF A;  1PJR A;  4BHB A;  1R7J A;  1UCR A;  1VND A;  3M3Y J;  4M9S A;  2H94 A;  4D9J A;  5HNF A;  2L02 A;  3HRU A;  5LRS A;  2FD5 A;  2Y30 A;  1B8I A;  5C4X J;  4AIJ A;  2GXG A;  1SFX A;  5AIP A;  3CMM A;  1UZC A;  3EYI A;  2NOG A;  3WGH A;  3C2H A;  1D8J A;  1VFC A;  5GAH J;  2D5V A;  3ABK H;  3F8M A;  3S2W A;  2ELH A;  2HYG D;  1HLV A;  3GO5 A;  1BI3 A;  1P4W A;  3ABU A;  4C3H J;  4N0B A;  4EVI A;  3RKQ A;  3GLX A;  3HTU A;  3WG9 A;  3OYM A;  3S1N J;  4HX7 A;  2E2J J;  4L9J A;  2VPL A;  2QQA A;  2JA2 A;  5EZG A;  1B4A A;  3PQJ A;  4HF0 A;  4B8X A;  3A0B C;  2YSR A;  3DU5 A;  4MQV A;  3CC7 I;  3FWE A;  3NAR A;  5EG0 A;  3PNV A;  4B4C A;  2XGX A;  1JGS A;  3HZJ A;  3PO2 J;  4I6Z A;  3KYL A;  1BN5 A;  4LLG F;  2QQ8 A;  3OYL A;  4UHT A;  3V8K A;  4IHX A;  3PFY A;  4UUS A;  2OTL I;  5FKM A;  3C7J A;  5B5E C;  3S2H J;  2M4G A;  4X0G A;  1YE9 A;  5GPA A;  3TKY A;  2C6Y A;  2V1X A;  1D0Y A;  5LGT A;  1W36 D;  2HS5 A;  4HNV A;  2HWV A;  3FK7 A;  3V42 A;  2JPB A;  4LIV A;  3ZQQ A;  1IG7 A;  3A02 A;  4ANJ A;  4FCY A;  2KL4 A;  3E6B A;  4ESB A;  4EGZ A;  1SVL A;  4N4N B;  3OL3 A;  4KMU X;  4NQW B;  3J80 Z;  3OS1 A;  3E5U A;  4B09 A;  3EUK L;  4IEJ A;  3MQ0 A;  3I71 A;  4XRS G;  1RKW A;  4WF2 A;  4IOC F;  3CJR B;  2DFI A;  2EA2 A;  2OA4 A;  3HG9 A;  5FD5 A;  4BL0 B;  4WCG A;  3TO9 A;  1MH3 A;  3F23 A;  3BTI A;  4R79 A;  4DBQ A;  1V3F A;  2K9M A;  4BE0 A;  4W97 A;  2ZKZ A;  3S1M J;  3S3N A;  2IEK A;  3RSN A;  4XSX F;  3BWG A;  2R7U A;  4IHS A;  1FP2 A;  2ESH A;  2BY0 A;  5CVI A;  2DMU A;  4MNU A;  4I02 A;  3BDD A;  3MKY B;  2VKH A;  1R22 A;  1I27 A;  3U2R A;  3P9C A;  1FC3 A;  2L9S A;  3FMQ A;  4G6T B;  5ILS A;  4MGR A;  4BEH B;  2E5Z A;  5E8I A;  1WJB A;  1WFX A;  3KPH A;  3ZN0 A;  2VQH A;  2CFO A;  4LOC A;  1BW5 A;  3BR6 A;  5BOX A;  1AOY A;  4PJN A;  3OIO A;  1X4P A;  4MLO A;  5HDN A;  1XPX A;  3BP8 A;  5IYD J;  3HSR A;  4BAY A;  2IW5 A;  3ZQG A;  3HOU J;  3H9Q A;  4EAT A;  5HS9 A;  2W25 A;  1BIA A;  4P5O A;  4RB2 C;  1EH8 A;  3CC2 I;  2CUJ A;  2WAF A;  1FT9 A;  4ENJ A;  2E2H J;  3ABT A;  3FF5 A;  3BG6 A;  2IVM A;  4GDF A;  1A6I A;  3RIR A;  4M6X A;  3LAP A;  1AHD P;  3OYF A;  2MW8 A;  1BW6 A;  2OAZ A;  1TT0 A;  3W6K B;  4S05 A;  3BR2 A;  4KIG A;  2LY2 A;  1UFM A;  2HKO A;  1GT0 C;  2IGO A;  2JA7 J;  4HX4 A;  3VB2 A;  3E6D A;  3E6C C;  3EUH C;  5FFZ A;  3FXK A;  2VXZ A;  1IN6 A;  1Z1D A;  3R61 A;  4AUX A;  5LHI A;  3V7S A;  1HW1 A;  1T56 A;  2COB A;  1B59 A;  5L3G A;  1J7K A;  1WJD A;  2DQL A;  4QWQ A;  4A3E J;  4JX6 A;  1MGT A;  3ZP5 A;  4MFE A;  2L4M A;  3A03 A;  2WY8 Q;  3FZV A;  4I76 A;  3DKY A;  1PDN C;  2JRT A;  3S1Q J;  2MSY A;  2BY3 A;  2LNB A;  4G6Q A;  3FKJ A;  1TTY A;  4JX4 A;  4A0X A;  3AAF A;  3WE2 A;  1W7P D;  3Q0U A;  4FT8 A;  2PX9 A;  3CJT B;  1OYY A;  4BHC A;  4AYB N;  2FOW A;  4BYY A;  3IKT A;  1LPQ A;  4FE4 A;  2W57 A;  2STW A;  2DK5 A;  3QOD A;  2MD0 A;  3L1P A;  2HFH A;  3A1Y A;  2DT7 B;  2BBY A;  3EUA A;  4UXN A;  1Y8Q B;  4XN3 A;  1EA3 A;  1DU0 A;  1XMX A;  1U8B A;  2M0M A;  2CGP A;  5JHF A;  5EEA A;  2M8G X;  4G7O F;  4LB6 B;  2X6X A;  3CJQ B;  3VOD A;  3FM3 A;  2D2W A;  3D5S C;  3ULQ B;  1X3U A;  2VT2 A;  2L0K A;  3LSG A;  1BI0 A;  2VJ5 A;  3IV5 A;  3VWB A;  1IN8 A;  3IH2 A;  1BM9 A;  2JA5 J;  4DYC A;  3JTG A;  1ZQ3 P;  2VJ4 A;  4II3 A;  1HSJ A;  4LMY A;  5KCM A;  4AIH A;  2XSD C;  4FX4 A;  1MMG A;  3CQZ J;  3M1E A;  2XAG A;  4ENK A;  5IOY A;  3GUD A;  2CO5 A;  1H8A C;  3LNQ A;  2FA5 A;  1B72 B;  2JVG A;  5CVU A;  5HOD A;  2A61 A;  2DFH A;  3ZMZ A;  5LGU A;  1TW2 A;  2CW8 A;  3DPU A;  4CCJ A;  1A35 A;  1ZAO A;  2NVU B;  3DF8 A;  2VBZ A;  2VBW A;  3K4M A;  3ZRG A;  2OPT A;  3H5A A;  4GYI A;  1LKX A;  4FE7 A;  1KON A;  3WOD F;  1VQ9 I;  3D5R C;  4QSH A;  4MEX F;  3BZ6 A;  5BS6 A;  4BH9 A;  4DGW B;  1OKR A;  4M3G A;  4L9T A;  2XF6 A;  3L00 A;  1TLH B;  2HYJ A;  2P81 A;  1P4X A;  2HQN A;  1TWG J;  1WH5 A;  4I0A A;  3DTK A;  3HRS A;  2P5V A;  2BVL A;  1J2X A;  2LG4 A;  3RPU D;  2A6E F;  1ETQ A;  1BI2 A;  3DXJ F;  4JOM A;  4GYG A;  2LD5 A;  2NNN A;  4HBL A;  5FJ8 J;  2ELJ A;  2ZJP F;  4M72 A;  4CUG A;  4HOB A;  4MTD A;  2JA8 J;  2TCT A;  2X6W A;  3M8J A;  5J4V A;  3T8R A;  3BQZ A;  2EFP A;  2Z99 A;  1ERD A;  2KZV A;  2DCE A;  2A69 F;  2F5V A;  2FOK A;  5KK1 A;  3F21 A;  1W4M A;  3MFK A;  3EYY A;  3PJR A;  1MMD A;  1YS6 A;  2H1L A;  1MZB A;  2EZK A;  3DPT A;  3GEZ A;  1OCZ H;  3I4M J;  2ZFW A;  4RS8 A;  2QBY A;  2DPD A;  1ZAR A;  2L7M P;  2CW7 A;  4OIR F;  2ZXW H;  4Y15 A;  4D7M A;  2RQQ A;  4CDG A;  4S04 A;  5IT9 Z;  1I1G A;  5J8C A;  2E7W A;  1ETV A;  2BW3 B;  3DBL B;  4C3J J;  4RGU A;  1OFC X;  2HTJ A;  1V5G A;  3FXR A;  2G0E A;  3JRE A;  4ZTJ A;  3BTL A;  4NC7 A;  4EJV A;  2GQQ A;  2KIQ A;  2FJ1 A;  3HOT A;  2ZFU A;  2A68 F;  1ETK A;  3JRA A;  2YS9 A;  3H1C A;  2LKX A;  2LK2 A;  4HF2 A;  4XLA A;  3V7R A;  1U3E M;  3RDI A;  4HLY A;  1S7E A;  1ZLJ A;  2JA6 J;  5BPI A;  2OU2 A;  2CFX A;  1K6Y A;  2CSO A;  3I4P A;  3K2A A;  3L2V A;  3CDH A;  2KP6 A;  1G3S A;  1U9N A;  5DDG A;  3DCF A;  2CV1 A;  5HVQ C;  1NTC A;  4F91 B;  2RNJ A;  3PQK A;  1CQT A;  3L9F A;  5BMZ A;  1XSD A;  3F72 A;  1E0E A;  1ZGA A;  2ZNY A;  1QHH D;  3CCE I;  4I2O A;  1DUX C;  4Q47 A;  2M1B A;  2E1N A;  1YHQ I;  2KDZ A;  3EPZ A;  2LP0 A;  2OZ6 A;  3FXL A;  3I0T A;  3H3V K;  2KIM A;  1TZL A;  2KQR A;  1MNE A;  2NAZ A;  2WWY A;  4N4O B;  2OQR A;  3TQN A;  4EJU A;  2HQ5 A;  2CQN A;  3S1R J;  1WJF A;  2DAO A;  3F22 A;  2UWM A;  1IC8 A;  3OYN A;  3FMS A;  4EJO A;  3M07 A;  1XD7 A;  2EPF A;  2X51 A;  4BU2 A;  2LR8 A;  4XRM A;  3OL4 A;  1JUS A;  3LQR A;  2JZY A;  2FBI A;  3K2Z A;  4ZZL A;  1YOV B;  2K86 A;  3HOZ J;  1RNL A;  1HW2 A;  1OR7 A;  3BG5 A;  3DWL E;  4PGG A;  2V79 A;  3N4M A;  1DPR A;  2ZCW A;  3M4O J;  4M73 A;  4OMY A;  5J40 A;  3GXO A;  4PGH A;  2DMN A;  2EZI A;  2PMZ A;  4N9I A;  4UVC A;  4F7Z A;  2ZSI B;  4AU7 A;  4KN4 X;  3DLL F;  1JT0 A;  1YI2 I;  3K0L A;  5TIS C;  5FB2 A;  4FTH A;  1CF7 A;  4UV9 A;  1NK3 P;  1X3W B;  2OZU A;  2PJR B;  3ZMU A;  2YU3 A;  2Z5U A;  4MO7 A;  4HNU A;  4NC8 A;  5D6F A;  1T0F A;  3ISP A;  5HOO A;  1IRX A;  2A3S A;  1ZG5 A;  3KLN A;  2GIZ A;  2GM4 A;  4WXH A;  2E1C A;  1UAA A;  1MJ9 A;  2ELK A;  3MD2 A;  4PSX A;  3JAM Z;  1SFE A;  1R71 A;  4L0Y B;  4OIQ F;  2IAI A;  4LG0 A;  3L2U A;  4BXX J;  2RGV A;  1VQ4 I;  3GTP J;  1YQA A;  1HDD C;  5DUI A;  2F4O B;  1N77 A;  2J5P A;  2PEX A;  2YX4 A;  5IOZ A;  1LFU P;  2CW0 F;  2P6S A;  3CME I;  2VPR A;  3E5Q A;  4NNJ A;  2IGK A;  3ONQ A;  5DUK A;  4A6E A;  3BQY A;  4EM2 A;  2OCE A;  3OYG A;  2HU9 A;  3HSF A;  1Z21 A;  1K4T A;  4XLC A;  2MFZ A;  1EJ9 A;  4BDZ A;  1FNN A;  5CVV A;  4CIC A;  5ILV A;  3BJA A;  2DDB A;  3OIQ A;  2KKO A;  2XGE A;  2EZH A;  2FX0 A;  2GAU A;  2JQ7 A;  2WB1 N;  3CDL A;  1R1T A;  5DD4 A;  3VOE A;  3QQA A;  5FKL A;  2ACJ A;  4KNY A;  1OR7 C;  1ZYR F;  2EWN A;  2Y69 H;  4IQ4 A;  4XR6 A;  3G3Z A;  4YRV A;  5CVJ A;  2LKS A;  1Z3Y A;  2BOL A;  2JVH A;  1NK2 P;  1Y0N A;  4CA0 A;  2DDA A;  3QU6 A;  2XPU A;  4EM0 B;  2OV7 A;  3H36 A;  2QM3 A;  2QLZ A;  2AS5 F;  2KZG A;  3T8T A;  4Y4R A;  4UVB A;  3FXJ A;  1OIS A;  4RM3 A;  1E3H A;  1ZN2 A;  4DNC A;  1IRZ A;  2EFQ A;  4RGS A;  4GXO A;  1Y6I A;  5IYC J;  2R7T A;  1DQU A;  1L0O C;  1S8N A;  1UHM A;  2EA4 A;  2DU9 A;  4Z6Y A;  1UEL B;  1VQ5 I;  2IS1 A;  1FBQ A;  5H6R A;  3IL2 A;  1D0Z A;  1F36 A;  2VC1 A;  3PIP F;  4WXC A;  4IHW A;  2LY1 A;  2VQC A;  1D1B A;  4P1W A;  5LEK A;  3M7G A;  3J7Z I;  2DW4 A;  2JSC A;  4LG3 A;  5M5Y J;  3Q0V A;  5K7H A;  2ZJQ F;  1J0R A;  2QZ8 A;  4L5I A;  3LWF A;  2LLK A;  4ZYA A;  1ZRD A;  1N75 A;  1TNS A;  2X9D A;  4OOI A;  3JSP A;  4RA2 A;  2MC3 A;  2F48 A;  3OV8 A;  4L9V A;  3J7A O;  1YLF A;  1F5T A;  4HSR A;  1Z7L A;  4Y7N J;  1ZTR A;  4RAG A;  3BPX A;  3HPG A;  2FSW A;  5D8L B;  5LRR A;  2DTR A;  2AQE A;  4XLE A;  2DJI A;  2W7N A;  5L3C A;  3MKL A;  2CJJ A;  4XOR A;  4JBA A;  1SD7 A;  4RB0 A;  3N05 A;  2VOD A;  5AIQ A;  2WBM A;  2DT5 A;  4G6D A;  3HXL A;  2R7S A;  1W5C C;  1XS9 A;  3SXY A;  2DFE A;  1SAU A;  3HGG A;  5F64 A;  2R5Z B;  3FHN A;  4A12 A;  1XMA A;  4NBQ A;  1UHW A;  1X2M A;  3QOP A;  2DXI A;  3KYD B;  1H89 C;  1QZZ A;  3TMO A;  1BA5 A;  3FBN B;  4CHU A;  1P9Q C;  3ZMV A;  1ENH A;  1MMA A;  3OYD A;  1PP8 F;  3MZH A;  1UB9 A;  1VQ7 I;  1NG6 A;  5FO5 A;  4H4K C;  1MMS A;  3Q3S A;  3BG7 A;  2UXX A;  3OYH A;  2E7X A;  4ON0 A;  5KVR A;  2RQP A;  3TED A;  3RQI A;  5D5X B;  3OYB A;  4A3F J;  3G1O A;  3FKI J;  1Y1V J;  3H92 A;  2DT6 A;  1D1C A;  2DA3 A;  2K40 A;  4UB8 C;  2E60 A;  3MMY B;  2FE3 A;  1RUO A;  1HF0 A;  3ZMD A;  2VKV A;  2XRO A;  2GA1 A;  4RMN A;  2DJN A;  3OOU A;  2HYF A;  3HOV J;  4QLC U;  3MZ8 A;  1SFO J;  3HTS B;  1JT6 A;  5FRM A;  1G6N A;  4ITV A;  2DTZ A;  2DOD A;  1RR8 C;  1IN4 A;  1GDT A;  4BQQ A;  2R3S A;  2EFW A;  2MLK A;  1H0M A;  1J75 A;  3G4S I;  3KP5 A;  4H0E A;  2CQX A;  1TWA J;  1IRG A;  2K3F A;  2OTJ I;  1PUE E;  4A3K J;  3R0A A;  4JX5 A;  1WJC A;  3CCM I;  1A04 A;  2IJL A;  1B8I B;  3A4C A;  5K5O A;  5DTD A;  1EH6 A;  3R4K A;  3N97 A;  4ZDL A;  1WZ2 A;  3LAJ A;  2E1O A;  1I3A A;  2F5E A;  3KCC A;  4BHP A;  5D5W B;  3GTO J;  4XQF A;  3MZY A;  4YG2 F;  1LNW A;  4HZF A;  1MBG A;  1YIO A;  5E79 C;  3CCL I;  2NOJ B;  2OCC H;  1SD6 A;  3OR1 C;  3E1S A;  4M3D A;  2BY1 A;  1K4S A;  5CYV A;  4RGR A;  5JI6 A;  3KP4 A;  2EIL H;  3FIS A;  3P7N A;  5EG0 B;  1Z6R A;  2HI3 A;  5H20 A;  1ZR4 A;  4DBR A;  2LRE A;  5FGM A;  2DA6 A;  2Y2Z A;  4UUS B;  1SAN A;  3H35 A;  3LL7 A;  2WAQ A;  4FX0 A;  3CES A;  5DCF A;  4D5C A;  4KIS A;  1R1U A;  2V4J C;  1FJL A;  3DTI A;  4KMF A;  4PFP A;  2FNP A;  4P55 A;  1B9N A;  3PM1 A;  1USS A;  3HBL A;  1G4D A;  5M5X J;  5D5U B;  1OCT C;  2W4S A;  3EDP A;  3GFI A;  1FYL A;  1TT5 B;  1G3T A;  3E5X A;  3K4J A;  4UVA A;  3JRG A;  2LY9 A;  1WH7 A;  3EET A;  3LSR A;  2QSG X;  3C2G A;  4I99 C;  1JUM A;  3OOP A;  2R7W A;  3NAU A;  3P9I A;  3ML6 A;  4HW0 A;  5H2F C;  2R7R A;  4LLN A;  1X4O A;  2DO7 A;  2O61 A;  3KZY A;  3KLO A;  4RLF A;  3FXO A;  4MFD A;  3KET A;  2V1N A;  4GO1 A;  3WTS C;  1JXS A;  4XK4 A;  4DZP A;  4I98 B;  1R5H A;  5IPA A;  1HXD A;  4HDV A;  4XM3 A;  1VQO I;  3GBG A;  4A69 C;  5EGO A;  5JR3 A;  1I3Q J;  3AL0 B;  2EJR A;  1BR1 A;  3CP8 A;  3AG4 H;  3AG1 H;  3IH3 A;  4C3I J;  1U5T A;  2DBB A;  3IHU A;  3J7A Y;  4KJZ A;  1ZRE A;  1FOK A;  1QPM A;  2R92 J;  4BBR J;  1W7P A;  1ZEL A;  3T5X A;  2IBD A;  3K1P A;  4XKB A;  4BS9 A;  3PFI A;  5ILU A;  1IN7 A;  3OWT A;  4E7J A;  1A36 A;  3JR9 A;  4A2U A;  3TP3 A;  1J09 A;  4CCM A;  3J81 K;  1HKT A;  3I59 A;  3Q9S A;  3UKG A;  3WU0 A;  4ZDO A;  2XV4 S;  3SYT A;  1R58 A;  1YIT I;  2BVM A;  4M3F A;  2MH9 A;  4U7D A;  3ECH A;  3FDY A;  1FPQ A;  2XPV A;  5J1R A;  2BHY A;  1DP7 P;  2EV0 A;  1T8I A;  4I09 A;  4X1E A;  1L3L A;  2JRM A;  4HQM A;  1BI1 A;  5KAI C;  4RM2 A;  3VEP A;  3C2B A;  4AVP A;  5F27 A;  4IRI A;  1JHF A;  2L4A A;  3BG3 A;  4P9U A;  3O3K A;  1KYW A;  2WAD A;  2JT1 A;  1W0U A;  3KFW X;  2CG4 A;  3LSK A;  4PJL A;  4ZH4 F;  1XGO A;  3T1B A;  4AVZ A;  2CQQ A;  2M7B A;  2DYR H;  4HG2 A;  2QKL B;  3W2V A;  4C2U A;  3IAS 2;  3IP4 B;  5L3F A;  1FZP B;  2Z16 A;  5K5Q A;  3ZMT A;  3OS0 A;  3CDI A;  2E19 A;  1YIJ I;  4CGZ A;  1T08 B;  2AHQ A;  2CQ7 A;  2VB6 A;  2HDW A;  3D5L A;  4LIU A;  3CO7 C;  3SZP A;  4LGW A;  3TDU C;  1SEU A;  2QCO A;  3HOY J;  2LBF B;  2BXZ A;  3JW4 A;  3FXQ A;  3D0S A;  3W6V A;  5E20 A;  4O5V A;  4ENM A;  2FBK A;  1Z91 A;  1SMY F;  1HCR A;  1C0W A;  1BOB A;  2GOX B;  5FRO A;  3VYR B;  4DOZ A;  4B43 A;  1O57 A;  2QSH X;  3RPU A;  4BE2 A;  3PSF A;  2GZW A;  4ASN A;  1I6H J;  2VE8 A;  5F6F A;  5K7F A;  4IHV A;  1OCP A;  1OYW A;  3G73 A;  3S16 J;  1XTA A;  3RTR A;  2FXA A;  3OYE A;  3G2B A;  3Q9V A;  3PUF A;  4Q5S F;  1ETY A;  2EIM H;  2E5N A;  2H09 A;  4BAC A;  4G8X A;  1KQ0 A;  2Z1D A;  5EEH A;  2QVO A;  4Y13 A;  4FHT A;  1OYI A;  1XGS A;  4QPO A;  2KMU A;  1OJL A;  4W1U A;  3X2Q H;  2HNH A;  1MSE C;  2KRH A;  2VJI A;  2AXL A;  1IXS B;  2QUF A;  1DDN A;  2R7Q A;  3GTG J;  3H9G A;  3AL0 C;  2W48 A;  3CJN A;  4XLP F;  3NRV A;  4GGG A;  1TQP A;  2DMP A;  2M7A A;  2LBF A;  3WU1 B;  1XX5 A;  3QPL A;  2HZD A;  4E4H A;  3CCU I;  1SMT A;  5F0H A;  2WAE A;  5F08 A;  1O3Q A;  2DA5 A;  5FD6 A;  4WXD A;  3BJO A;  4B3X A;  4CCL A;  3FM5 A;  2HVS A;  1U9O A;  2VKE A;  3DEU A;  5C3E J;  4PK4 A;  2A5W A;  1WJA A;  1E17 A;  1YJW I;  5J6X A;  5D5V B;  2P5L C;  4BGD A;  5AON A;  4D1Q A;  1BR4 A;  3RKW A;  3S32 A;  2WY7 Q;  4C30 A;  1QPI A;  2MBF A;  2MD5 A;  2NVQ J;  3LOC A;  4PZJ A;  4MHG A;  1UHS A;  3V8J A;  1QZY A;  2XAF A;  1KQ8 A;  2DLL A;  4DYQ A;  1Y0U A;  1SAX A;  5DM7 F;  2ZJ2 A;  3MKW B;  2H8R A;  3HUG B;  4R1H A;  5FKN A;  1GV5 A;  4OIP F;  1BBY A;  4LD5 A;  3TDZ C;  2KIF A;  3W2W A;  3K70 C;  4A5N A;  3BG9 A;  1XN7 A;  1J59 A;  1UG0 A;  1WI9 A;  4XOT A;  2QBY B;  5DS9 A;  1TL8 A;  1PP7 U;  2XDV A;  1P7J A;  3F9K A;  4A0Z A;  3CLO A;  5FKO A;  5IP6 A;  2IRF G;  3H9J A;  1TQM A;  3CP2 A;  5FLV A;  3QAH A;  5HDK A;  2XAU A;  4CYC B;  5E3M A;  3LSP A;  4D0P A;  1PYV A;  2EV6 A;  3ELK A;  2VL8 A;  3DBR B;  1OMI A;  4DW6 A;  4YII A;  1IXC A;  5ED4 A;  1B9M A;  4IKF A;  4PDK A;  2QF7 A;  4QTR A;  3B73 A;  1JJ6 C;  4XLF A;  1NHA A;  5A2Q K;  2F5C A;  3S3O A;  4AC0 A;  1O3S A;  1IXR C;  1DGR M;  2Q0O A;  1LEB A;  1FEX A;  2QYO A;  2JN6 A;  4RAY A;  3ABL H;  5LLQ A;  2A6H F;  2VUM J;  1FX7 A;  3J81 Z;  1QHG A;  2F4M B;  2KFD A;  4WX9 A;  4ENN A;  4PJM A;  2Y0S N;  4Y52 J;  2IA2 A;  3ZXS A;  4BJ6 C;  3JRB A;  3GZ5 A;  3HUG A;  1XCB A;  1DU6 A;  4YFN F;  1RET A;  3HL2 A;  3SFI A;  2Y9Z A;  3H0G J;  4WWC A;  3ZGK A;  1IV8 A;  3K6G A;  3K1N A;  1FYK A;  2TDX A;  1V55 H;  1OPC A;  4CZZ A;  4BXF A;  2EZL A;  2VOO A;  3TW7 A;  2LRD A;  2L3D A;  3O8H A;  3KEO A;  5GTI C;  1Z67 A;  4N9H A;  1IDZ A;  2LFB A;  2R7D A;  5TJJ A;  3HGY A;  4IJA A;  1RC9 A;  2ZXJ A;  2KIS A;  1T38 A;  1HOM A;  4CYC A;  5ERI A;  4HX8 A;  3KIO A;  2M34 A;  1R9T J;  1YRN A;  3HEF A;  4A5M A;  3U9G A;  4IHT A;  2DFF A;  2L9N A;  2CU7 A;  4HLX A;  2F5D A;  2CWE A;  2LDU A;  1KA8 A;  4G12 A;  2PQ8 A;  2WA0 A;  2L7Z A;  1V5F A;  4CCN A;  2ME6 A;  5E17 F;  1V5E A;  2F2E A;  3ESW B;  4E7K A;  1R5G A;  2QQB A;  4XIC A;  2E2I J;  2OUM A;  2KLO A;  3KP3 A;  4ZTF A;  1LB2 A;  1CF7 B;  1MSF C;  2HOS A;  1VQN I;  1GUU A;  3WE3 A;  3CO6 C;  3CCQ I;  3PL8 A;  1OCC H;  1VI0 A;  3JRF A;  3LA7 A;  4IXA A;  1TWC J;  4DJA A;  4P96 A;  1VQL I;  2BZT A;  4U0V A;  4F3Q A;  4E7I A;  3HDD A;  4L5J A;  4C2M J;  2K9L A;  3GTM J;  5J4Y A;  3OSG A;  1P7I A;  4X6A J;  2UZK A;  3QRF F;  2MH2 A;  3CUO A;  4A3G J;  4LG0 B;  2IS6 A;  4HV6 A;  2O3F A;  3R0J A;  2EH3 A;  4BY7 J;  2V6E A;  2V9K A;  4CCK A;  1H88 C;  3GW2 A;  2QA4 I;  4V19 K;  4CZC A;  4A93 J;  1KU9 A;  3TP0 A;  2O7O A;  3B02 A;  2CQK A;  2DN0 A;  4C2T A;  2RN7 A;  4I01 A;  1KZH A;  4IZZ A;  1XGM A;  1XGN A;  1R6R A;  1S7O A;  1TWH J;  5GAE J;  3OYC A;  1IJW C;  1TQI A;  2DA1 A;  5FLX K;  2COM A;  2BE5 F;  3GZ6 A;  2EFO A;  3IWZ A;  2HQA A;  3F8F A;  1MDM B;  5EYR A;  5GTH C;  1WCM J;  4PFO A;  5L3D A;  4AYB A;  3JRD A;  4CYD A;  4YIR X;  2AXT C;  1VQ6 I;  5LGN A;  1IO2 A;  1P92 A;  3HPH A;  3BZK A;  3NWT A;  3B6A A;  3RZO J;  1XB4 A;  1YX5 A;  1RI7 A;  4KIC A;  1FTZ A;  1R5I D;  1MNM C;  3LSH A;  3WHC A;  4GRI A;  3H3Z A;  3LSI A;  2ZJR F;  1R4M B;  1TNT A;  5LEJ A;  1K78 A;  2KRF A;  2ZNZ A;  3IAM 2;  4D5F A;  4L9N A;  3CC4 I;  2E34 A;  5E3O A;  3PNY A;  4II2 A;  4HF1 A;  4B3A A;  3JSO A;  3OS2 A;  4CO8 A;  4J01 A;  1RRJ A;  1KU7 A;  2FML A;  3GCM A;  1JKQ C;  2BXY A;  2NS8 A;  3O6B B;  5IP7 J;  4PJJ A;  2MA3 A;  1JHH A;  2I10 A;  1ETW A;  1FMV A;  2WV1 A;  3LFU A;  2HR3 A;  2J5O A;  1IGN A;  3MKZ A;  3C3W A;  5F04 A;  3B6C A;  5IYB J;  2QGU A;  1VTN C;  1X1D A;  4ZYG A;  4A3C J;  1MDM A;  2R7V A;  1HA8 A;  2MGQ A;  3KE2 A;  2H27 A;  2RVC A;  3M1C A;  2MAB A;  2MLG A;  4G9Y A;  1WKM A;  1WPK A;  2Y31 A;  2XIG A;  2KJC A;  1X58 A;  1W0T A;  2ISZ A;  4QPQ A;  4J00 A;  2RV8 A;  1FYM A;  2O8X A;  3TBI A;  3S3M A;  4RAZ A;  5E3L A;  1FBU A;  2M2E A;  1VQK I;  3FX3 A;  1FP1 D;  2V26 A;  3VYU B;  4A3I J;  1ODD A;  2CUZ A;  4BNC A;  2VC0 A;  3C18 A;  5DYM A;  1BC7 C;  3CTA A;  3KP7 A;  2ZME A;  5E1Z B;  3O8G A;  1R23 A;  3OY9 A;  2ZSH B;  3PSI A;  4HRI A;  3K9T A;  2GOM A;  5JHU A;  1IF1 A;  2VBX A;  3RYP A;  4L18 B;  1N25 A;  1T0F C;  3LQQ A;  5EEG A;  3HM5 A;  4NDL A;  3GFL A;  2NRA C;  3JRI A;  5CQG A;  3CZ6 A;  3DTE A;  5LHH A;  5LBQ A;  4E6K G;  1JI8 A;  2K02 A;  3QYF A;  4G7Z F;  3D1N I;  1QO0 D;  4OAY A;  4EJT A;  3S15 J;  1EKE A;  2K9N A;  2RAE A;  3VDX A;  2MYS A;  1LE8 A;  4EEF G;  4MEY F;  5M3M J;  1LVK A;  3ABM H;  3A0H C;  3E3V A;  3UR3 C;  3FK6 A;  2WC2 A;  4KFC A;  2E71 A;  1EV7 A;  1YJN I;  4V2G A;  2L7K A;  3E7L A;  4PUS A;  1S29 A;  2CYY A;  3GTJ J;  2G7U A;  3GLL A;  3L2Q A;  1AKH A;  3ZCO A;  2JK3 A;  3GF2 A;  4BQN A;  1ETX A;  3DKW A;  3J80 K;  3F6O A;  4ZYE A;  1QA6 A;  5CPR B;  2X0L A;  3K69 A;  4KIT B;  3CMA I;  4YFK F;  1ACI A;  5K5R A;  2P0W A;  3HHG A;  1R1V A;  1X1C A;  5HDG A;  1S3J A;  2VXD A;  2PI0 A;  4R8H A;  3BR5 A;  2A5Y B;  3G1L A;  2CH0 A;  1D5V A;  2CRG A;  4U87 A;  4MQ9 F;  3CCV I;  4GCV A;  1I6X A;  2L9R A;  1UG2 A;  1IZ1 A;  3BT9 A;  3QPT A;  2ECC A;  2Q2E A;  5J47 A;  3GVA A;  1LVA A;  1MKM A;  2F6C A;  3LFK A;  2V6C A;  4HDU A;  4FIS A;  3S2D J;  5CKT A;  1PUF A;  3H3U A;  5LHG A;  3SDB A;  4BJ5 C;  3NWS A;  3FBI B;  2P6T A;  2IA1 A;  4RGX A;  3W6J B;  2AQF A;  2PMH A;  1MJA A;  4M6V A;  4IPA A;  1JKP C;  3ERE D;  2R0Q C;  2LH9 A;  4QIW N;  2IT0 A;  2O03 A;  3PUB A;  3M9A A;  4EM1 A;  2L2O A;  3NEU A;  5CQE A;  2EQR A;  1IUY A;  3EQL F;  4XKV A;  1T33 A;  2JPC A;  1KU3 A;  3F8B A;  2DK8 A;  1S5L C;  3H5R A;  5GP9 A;  1A5J A;  5HNH A;  2O6G E;  2OBP A;  2RNG A;  1S72 I;  1J5Y A;  4U0Y A;  4L5E A;  5C4J J;  2FQ4 A;  5F0F A;  1P2F A;  4UB6 C;  1GXP A;  5LD2 C;  3RKY A;  3ZQL A;  1A31 A;  4M74 A;  2PMU A;  4XSZ F;  3LA2 A;  1JJ8 C;  1A6Q A;  2EB7 A;  1TC3 C;  2YUS A;  2HPI A;  3HKZ N;  4K2E A;  4LLL A;  3V4G A;  2KT0 A;  2JJ7 A;  2DOE A;  4BXU A;  1H9G A;  1F9N A;  2P4W A;  2WTE A;  4XOP A;  4U7B A;  5JVG F;  2DQR A;  4LB5 A;  4AIK A;  3VYT B;  4Y3O A;  2CV2 A;  2H6C A;  3WTV C;  3WTZ A;  1JE8 A;  4EMS A;  5EGO B;  3S93 A;  1YYV A;  1FMW A;  2LSO A;  1WHU A;  4HA8 A;  3I55 I;  3GWZ A;  1N78 A;  2K4B A;  5DCM B;  5EZH A;  1U5T B;  2M0C A;  3P9K A;  2HVQ A;  2V9V A;  4XKC A;  1O3R A;  1JTY A;  3K7A J;  5KNL A;  1F4K A;  3RQ4 A;  3ZOB A;  2DA4 A;  1I5Z A;  1B1B A;  3C1D A;  1W7P B;  5F1J A;  5BQT A;  3U1D A;  2R5Y A;  1HW5 A;  2K4J A;  3K4K A;  2GIV A;  2FU4 A;  3K4N A;  3OYJ A;  5BNG A;  3S8P A;  2QQ9 A;  4LFU A;  3ZQH A;  1YO5 C;  3I59 B;  4NB5 A;  5JFR A;  3K10 A;  2VJJ A;  3L7W A;  4HNT A;  2QSF X;  1HQC A;  1Q1V A;  4BUP A;  1SD5 A;  2B7E A;  5ICG A;  4BKX A;  2DA7 A;  2WB1 A;  2KJB A;  3WTW C;  1W36 C;  2X1C A;  1WGX A;  2V1U A;  3ZPL A;  2TRT A;  2Z33 A;  2ZXH A;  4B44 A;  4YEL A;  4V2F A;  1YW7 A;  4NC6 A;  4OAZ A;  3PIO F;  5B1A H;  4ZYD A;  3CF5 F;  1ZG1 A;  2UUZ A;  3R60 A;  1KGS A;  4I0B A;  3LST A;  4ZYH A;  1KYZ A;  1T98 A;  2HOE A;  3TO6 A;  3M8E A;  1WI3 A;  3WTY C;  4AM3 A;  1JKR C;  2M3A A;  2M45 A;  3E97 A;  4JK1 X;  2DOF A;  5DCM A;  3G1M A;  3RZD J;  3F0C A;  6PAX A;  1STZ A;  1LDJ A;  1YTY A;  2ID6 A;  2VI6 A;  1K83 J;  4AID A;  1FTT A;  1QVU A;  3ECO A;  5CJ9 A;  1Z6T A;  2HQR A;  3MCZ A;  2MC4 A;  1VZ0 A;  3HRT A;  1V54 H;  3HIF A;  3ZQF A;  1FOY A;  3WU2 C;  1WVR A;  4LK1 F;  2DA2 A;  1WRJ A;  5IP9 J;  2LYC A;  4M9Z A;  1QGP A;  1FOW A;  2HPM A;  3IRR A;  2Q1Z B;  1T2K A;  2JMW A;  1E3P A;  2E1M B;  2KRC A;  1FY7 A;  1YX3 A;  4KIF A;  1D1A A;  2ZC2 A;  4P9F A;  5D8K B;  4DQ2 A;  2HVR A;  3HC7 A;  3AG2 H;  1WWX A;  5E3N A;  5D4S A;  1E2X A;  4IHY A;  4CSW A;  4KYW A;  2JSP A;  1X19 A;  3EUH A;  2V7F A;  3IUO A;  3AFH A;  1VQ8 I;  4F93 B;  2LF8 A;  1IV6 A;  4O6J A;  1BL0 A;  1S6L A;  1IDY A;  3VYS B;  4HQE A;  3LMM A;  1GVJ A;  1X1A A;  1VQM I;  3K4B A;  1EF4 A;  1LQ1 A;  4DIQ A;  2DYS H;  4AD9 A;  2F4I A;  2VBY A;  3WGG A;  2XUB A;  2HOA A;  3DV8 A;  4I7H A;  3VFZ A;  4Q48 A;  1FIA A;  1P6R A;  2X6Y A;  4EV0 A;  5IT9 K;  2NVY J;  5E1W A;  2VLA A;  5HLT A;  3SEQ A;  1XCV A;  1RES A;  1LDD A;  2XAQ A;  1XSV A;  2KPM A;  5CVR A;  1Y1W J;  5HS7 A;  1X1B A;  2LKP A;  4U88 A;  2M4K A;  3VPR A;  1EH7 A;  2HEO A;  2XVC A;  3DU6 A;  4A3J J;  4A3L J;  3PNT A;  1U2W A;  2M87 A;  2NNY A;  1AU7 A;  1RPW A;  1BC8 C;  1ZGW A;  1U5T C;  2GBY A;  1MBH A;  3ZQ7 A;  5D4R A;  4RLQ A;  1B6A A;  2XB0 X;  3W2A A;  5E18 F;  3RJP A;  1CGP A;  2DI3 A;  2STT A;  5E1X A;  1VF9 A;  1OCO H;  5IY5 H;  2K9Q A;  5B3S H;  2W1O A;  3IWF A;  4ETS A;  2YU9 J;  1Z77 A;  3SZG A;  1I50 J;  1SFK A;  4NQW A;  1R00 A;  2IXS A;  3WGI A;  3ZR8 X;  4G7H F;  2ZBK A;  2XSJ C;  4IVN A;  2VON A;  2XF5 A;  4L0Z B;  2X6O A;  1T95 A;  2O9L A;  3WTU C;  3KEY A;  2N8G A;  1BR2 A;  2HDD A;  5L3E A;  3VSL A;  3CUQ B;  5GAD J;  1O7L A;  1UST A;  1AA7 A;  3BR1 A;  4BDY A;  4M3B A;  2IGM A;  2ID3 A;  3HKZ A;  4XL9 A;  4A3D J;  3F3X A;  4PCQ A;  1FIP A;  1REP C;  4HYE A;  3I4N J;  3V8L A;  2IPQ X;  4HST A;  3TGN A;  2D45 A;  2H1K A;  4F55 A;  3OYA A;  3QPH A;  2PMZ N;  4KIB A;  1ZH5 A;  1D3Y A;  5L3B A;  5TGT A;  2Q8K A;  4BEH A;  4IX7 A;  5B66 C;  1DPU A;  2RDP A;  1MD0 A;  2JTV A;  9ANT A;  2VE9 A;  5HS8 A;  2XF7 A;  1QZE A;  3HOX J;  3ERM A;  2V1D A;  5FFX A;  4ESJ A;  1E3O C;  4DZJ A;  3BOQ A;  2D1H A;  3ASO H;  3V7C A;  2PBI A;  2IS4 A;  2G9W A;  1GV2 A;  2W00 A;  2E1M C;  3I64 A;  1XG1 A;  1WSU A;  4XN0 A;  4OIO F;  1JGG A;  2L01 A;  3JTH A;  4Q4Z F;  2W85 A;  5D6E A;  5KHD A;  3DPL C;  3WG7 H;  3JAM K;  1F43 A;  1SVM A;  1UJ8 A;  3CUQ A;  5ICC A;  3L2W A;  4FQG A;  2OF7 A;  2EIK H;  3KP6 A;  4WK8 F;  2LTP A;  5TRD A;  4GFB A;  1QNT A;  4XRF A;  1P4A A;  1XDS A;  2IA0 A;  4B48 A;  1BIB A;  3GME A;  3E0J B;  2VIX A;  3BCB A;  2X1E A;  1HC8 A;  2Y0M A;  5J3L A;  4JYK A;  1S7A A;  1FOX A;  1ULY A;  1GHC A;  1YW9 A;  5M3F J;  2A07 F;  3CLQ A;  2OC6 A;  1MW7 A;  1ON2 A;  4UY8 I;  1YRN B;  1IAW A;  1SD4 A;  5EDN A;  1MJB A;  3IRQ A;  1TW3 A;  3KP2 A;  2B9S A;  2W84 A;  1IN5 A;  4CCO A;  2K5C A;  4KT5 C;  2H8W A;  3L09 A;  1QU3 A;  2FBH A;  4BE1 A;  3BCA A;  3SEZ A;  4C9Y A;  1Z3X A;  3QPS A;  2ETH A;  3OMY A;  2XGD A;  2W82 A;  1K6O A;  2LC2 A;  2FUG 2;  2BV6 A;  1WJE A;  1Z05 A;  3FXM A;  3BJ6 A;  4NUB A;  4OWR B;  4B47 A;  4RB1 A;  1ZRF A;  1IUF A;  1ZK8 A;  3CF2 A;  3Q5F A;  3SQN A;  2P7V B;  1ZRC A;  3NQO A;  5DM6 F;  2XKO A;  1X2N A;  2BGC A;  2ISY A;  2L7F P;  3QP5 A;  3FHZ A;  3HYI A;  1XSX A;  2VQL A;  3K4L A;  2XC7 A;  3BRO A;  2M9H A;  2QEN A;  5LFA A;  4ZC3 A;  2NS0 A;  3BR0 A;  5DEQ A;  2HXI A;  4A3B J;  1U6G A;  1U8R A;  2HDC A;  3W3C A;  2BHZ A;  1RUN A;  3K70 D;  2NVT J;  1W1W E;  4IRG A;  4IF4 A;  5EJC A;  1LJ9 A;  1JTX A;  1Z7U A;  4OU0 A;  2PLY A;  1LFB A;  2X85 A;  2PG4 A;  4Y17 A;  4XRS A;  4E70 A;  5JLW A;  2K3P A;  1HBX G;  3HHH A;  1HKS A;  1ZGJ A;  2HKX A;  2MG4 A;  2E36 A;  2KDO A;  3CCY A;  2LOO A;  3HB9 A;  4YEJ A;  3CCJ I;  3CUQ C;  1B72 A;  2NYX A;  3R6S A;  3DQV C;  2OQG A;  3BTJ A;  2NS7 A;  3WHB A;  2YX7 A;  2GLO A;  3LSJ A;  4MTE A;  1D5Y A;  4LIT A;  3Q0W A;  5HLG A;  3A2K A;  5FRN A;  3GTL J;  3REO A;  3DBH B;  4HPQ A;  3DFG A;  1R49 A;  1D0X A;  2PN6 A;  1LEA A;  3FMR A;  3TW6 A;  3MAJ A;  1GLN A;  4S0H B;  2I5U A;  1TP4 A;  4ZJZ A;  2YR2 A;  5F0C A;  2L5Q A;  3HOS A;  2VAS A;  1U0J A;  4MIM A;  1ONV A;  2CV0 A;  3MWM A;  3I3L A;  4Y33 A;  1I1S A;  1O4X A;  2K7L A;  1BOA A;  4HV5 A;  4F52 A;  1Y56 A;  1APL C;  5K1Y A;  2P7C B;  2BYV E;  4B1R A;  3TL4 X;  2QEX I;  5J8F A;  2LMD A;  1DP3 A;  1VQP I;  1TBX A;  2BEO A;  1UMQ A;  4D7N A;  1K78 B;  1J9I A;  1QVT A;  1F1Z A;  3IH4 A;  3F6V A;  5BPD A;  1I39 A;  1W5T A;  2NXN B;  1JKO C;  3F8C A;  4UNO A;  3ASN H;  1MND A;  4OMZ A;  5FKK A;  2XB5 A;  1MIJ A;  1BJA A;  2IGN A;  2EIN H;  2Z3Y A;  4LK0 F;  3M8F A;  3J7Y J;  3G71 I;  4HAM A;  3KZZ A;  5HLI A;  5GPC A;  3UNG C;  4E7L A;  3GX4 X;  3JRC A;  4XNF A;  2B63 J;  1NH3 A;  2F5F A;  2BW3 A;  4ZDP A;  2LVS A;  3BZC A;  1Z0X A;  2ZO4 A;  3BLY A;  4JP0 A;  3T0Y A;  4XKW A;  2L54 A;  5B1B H;  1TWF J;  3O2P E;  3GTQ J;  4CH7 A;  3S17 J;  3JCU C;  1FBS A;  4KT6 A;  4YFX F;  1YG2 A;  1G2H A;  2FRH A;  1JUP A;  4O3M A;  3ZQI A;  4NHJ A;  3L2R A;  2VN2 A;  3RCO A;  1OLT A;  3DEW A;  3CD6 I;  4AWX B;  4ZZD A;  2DPU A;  3HJE A;  1V4R A;  2D1V A;  4E7Z A;  2M8E A;  1WQ2 A;  4RAF A;  2R7O A;  3HOW J;  1QQI A;  2ZME B;  1KQ9 A;  1GXQ A;  2PFB A;  2QKM B;  4BBS J;  3I54 A;  4UUT A;  1O3T A;  1FSE A;  2OD5 A;  3KEQ A;  4JQF A;  4M71 A;  5H6Q A;  2XKP A;  2Z9O A;  3KYC B;  1O7F A;  1YFH A;  2X1D A;  5DV5 A;  3I5U A;  5CLS A;  1Y8R B;  5KAF C;  3RPQ A;  1X3Z B;  1YS7 A;  2ESN A;  1X1P A;  2PJP A;  1LE8 B;  3DEE A;  3OYK A;  1MBF A;  2WAQ N;  3QOE A;  1OCR H;  3VSK A;  3S14 J;  3DLA A;  4FET A;  4XON A;  4M3E A;  4BJT A;  2H6B A;  3CCR I;  1MBK A;  2JUG A;  2RKH A;  5DD8 A;  2A05 A;  2VOP A;  2VKD A;  3SDG A;  4FAS D;  4J19 A;  1FLI A;  1DGW Y;  3LSM A;  3KZI C;  1WJ5 A;  3AKZ A;  2DMT A;  3I58 A;  4KUM A;  1AKH B;  2K9S A;  2ECB A;  5A2Q Z;  2CUE A;  2PJR A;  4CXF A;  1RKT A;  3SFZ A;  3SHF A;  4RDU A;  2FNA A;  2O5R A;  2R93 J;  2DMQ A;  2ZXI A;  3H5N A;  2CMP A;  1Q1H A;  1G8X A;  2XRL A;  3I9V 2;  2K27 A;  2IP2 A;  3CCS I;  5M5W J;  3BC8 A;  2YPR A;  1ETO A;  3I53 A;  5ICF A;  4IL6 C;  5ICE A;  5J1Y A;  2Y75 A;  5HLH A;  1LDK B;  4EJW A;  3MN2 A;  2Y0S A;  3ZQC A;  2K85 A;  1XC5 A;  3QYE A;  3QWL A;  3BTC A;  4LJZ F;  3GFM A;  1RIO H;  2VQG A;  2EK5 A;  3MEX A;  2FEZ A;  4A6D A;  1XDU A;  3GYH X;  4BQO A;  1RR7 A;  1ZLK A;  1YJ9 I;  1GVD A;  3COA C;  2R7Z J;  1POG A;  2Q2E B;  1T39 A;  4IQJ A;  1ORK A;  4M6Y A;  5E8G A;  5FLM J;  1SVO A;  4XMY A;  4DYR A;  1IRF A;  1PUF B;  2B0L A;  2JUC A;  4TV7 A;  4UV8 A;  1SFU A;  1SC7 A;  1R4N B;  2OJE D;  3OIP A;  2GA2 A;  2KIU A;  2UXN A;  4KDP A;  1NG7 A;  5JLX A;  4ABZ A;  3OYI A;  4BQA A;  4EQQ A;  3GFJ A;  1Y39 A;  3BR3 A;  3CMY A;  1PVE A;  1MH4 A;  2Y48 A;  5J1U A;  4RBO A;  2EBI A;  3F8N A;  1QRY A;  4XID A;  5GAG J;  1MBE A;  4G94 A;  1IW7 F;  2V9P A;  2GXB A;  4E7H A;  3GZN B;  2HTS A;  2HOT A;  2JWT A;  2GXA A;  1MBJ A;  1M1E B;  1S9H A;  5IT3 A;  2R7X A;  1R36 A;  4E7S A;  2NVX J;  4EGY A;  1FWZ A;  1U78 A;  1XMK A;  1ZKG A;  2ZME C;  3K1M A;  3JRH A;  4HEA 2;  2RC4 A;  1ON1 A;  3G6E I;  2EIJ H;  3U21 A;  2DOA A;  3PO3 J;  2Z2S B;  3H0D A;  4RB3 C;  2X4H A;  5C44 J;  2UV1 A;  2XHK A;  1YW8 A;  2BY2 A;  2LF7 A;  1ZR2 A;  4OIN F;  4F92 B;  1G3W A;  2ADU A;  1MMN A;  2W24 A;  3HSE A;  3P5J A;  1HKQ A;  1T6S A;  2XPW A;  3IC7 A;  4ESF A;  2QWW A;  1ITY A;  2Y9Y A;  3I56 I;  2R4G A;  4BY1 J;  3QYB A;  2EV5 A;  2HXO A;  2R5Y B;  3RI4 A;  3SJM A;  3A01 B;  5FLX Z;  1HDP A;  2FQ3 A;  3AG3 H;  2P8T A;  1LUJ B;  2A6T A;  2O0Y A;  3SZT A;  3DKX A;  4YIF A;  3TOA A;  3KX2 A;  2P5K A;  2HZT A;  1QBJ A;  4XLH A;  5EF6 A;  3FXU A;  3ZMS A;  4IO9 F;  2L9V A;  4IOA F;  1K79 A;  3RYR A;  5F1R A;  2XAS A;  2XGC A;  2GWR A;  3K4C A;  3BY6 A;  3WTX C;  3QP6 A;  4Z2Y A;  1K7A A;  3DP7 A;  2R5Z A;  3IKV A;  2R7F A;  1Z9C A;  3RKX A;  4KA4 A;  2CS3 A;  2X48 A;  2ZB9 A;  1FSH A;  1K61 A;  5K7Z A;  3MVP A;  3U1K A;  3BPV A;  1D8K A;  3OR2 C;  2XAH A;  3LA3 A;  1HST A;  4M9X A;  1G59 A;  1KU2 A;  4A0Y A;  3L2C A;  2G7H A;  2FF4 A;  3OSF A;  3ROU A;  1OQY A;  4UUV A;  2VT3 A;  2XAJ A;  4PSW A;  2KHM A;  3FIW A;  2CUF A;  1ZG3 A;  2WV0 A;  3E6M A;  1ZHF A;  2M5W A;  2RRE A;  3A01 A;  2FMY A;  2AO9 A;  2M30 A;  2ICW G;  1AWC A;  2I8D A;  2HGC A;  4KN7 X;  4PJ0 C;  1RZ4 A;  1G3Y A;  3QU3 A;  4XLN F;  2E35 A;  3TO7 A;  1LFP A;  2O8K A;  3GTK J;  3ZN1 A;  5JVT A; 
#chains in the Genus database with same CATH homology
 1BJZ A;  5IYC J;  1MSF C;  2HOS A;  3BR1 A;  1GUU A;  2ME0 A;  4A3M J;  4M3B A;  1F36 A;  2ID3 A;  4A3D J;  1VI0 A;  3JRF A;  1FIP A;  4IHW A;  1VND A;  3M3Y J;  3I4N J;  1TWC J;  2H1K A;  3HDD A;  2FD5 A;  2PMZ N;  2Y30 A;  3Q0V A;  4C2M J;  5K7H A;  5M5Y J;  1B8I A;  3GTM J;  5C4X J;  2LLK A;  3OSG A;  1P7I A;  2X9D A;  2NOG A;  4X6A J;  1VFC A;  2D5V A;  4A3G J;  9ANT A;  2EH3 A;  4BY7 J;  3HOX J;  1HLV A;  1H88 C;  1E3O C;  4DZJ A;  4C3H J;  4Y7N J;  1ZTR A;  4A93 J;  3RKQ A;  3TP0 A;  2O7O A;  3MKL A;  3S1N J;  2CJJ A;  2DN0 A;  2E2J J;  1GV2 A;  5EZG A;  1XG1 A;  1JGG A;  3NAR A;  5EG0 A;  1TWH J;  1XS9 A;  4B4C A;  3HGG A;  1F43 A;  2R5Z B;  4I6Z A;  1IJW C;  3PO2 J;  4IHX A;  2B63 J;  2DA1 A;  4UUS A;  2OF7 A;  1X2M A;  4GFB A;  2LTP A;  1H89 C;  5FKM A;  3S2H J;  1BA5 A;  5GPA A;  1ENH A;  5EYR A;  1WCM J;  4HNV A;  5J3L A;  3FK7 A;  4JYK A;  3JRD A;  3Q3S A;  1IG7 A;  3A02 A;  5M3F J;  4FCY A;  3B6A A;  3TED A;  3RQI A;  3RZO J;  4A3F J;  1YRN B;  3G1O A;  1FTZ A;  1MNM C;  3FKI J;  1Y1V J;  5EDN A;  2K40 A;  3WHC A;  2DA3 A;  4IEJ A;  4XRS G;  1RKW A;  1HF0 A;  3QPS A;  2VKV A;  4D5F A;  1MH3 A;  2DJN A;  2XGD A;  3OOU A;  3BTI A;  5E3O A;  3HOV J;  1SFO J;  4B3A A;  1JT6 A;  4W97 A;  1IUF A;  1ZK8 A;  2DTZ A;  3S1M J;  1GDT A;  2IEK A;  1JKQ C;  2NS8 A;  1X2N A;  2L7F P;  5IP7 J;  2CQX A;  1TWA J;  2I10 A;  2DMU A;  1ETW A;  2WV1 A;  4A3K J;  1IGN A;  4JX5 A;  2M9H A;  5F04 A;  3B6C A;  5IYB J;  3BR0 A;  1B8I B;  2HXI A;  4A3B J;  5DTD A;  4A3C J;  2NVT J;  2E1O A;  2MGQ A;  4LOC A;  1BW5 A;  1JTX A;  1WPK A;  3BR6 A;  2Y31 A;  1LFB A;  3GTO J;  3OIO A;  4MLO A;  4XRS A;  1MBG A;  1X58 A;  1W0T A;  5JLW A;  5IYD J;  3HOU J;  3ZQG A;  5E3L A;  2MG4 A;  4M3D A;  2M2E A;  3CCY A;  3HB9 A;  2E2H J;  1B72 A;  4A3I J;  1A6I A;  3BTJ A;  3FIS A;  2NS7 A;  3WHB A;  5EG0 B;  2HI3 A;  1AHD P;  2GLO A;  2MW8 A;  1BW6 A;  3LSJ A;  1ZR4 A;  1D5Y A;  3Q0W A;  3O8G A;  2DA6 A;  3BR2 A;  3GTL J;  2Y2Z A;  4UUS B;  1GT0 C;  2JA7 J;  1SAN A;  3TW6 A;  4S0H B;  4D5C A;  3HM5 A;  4NDL A;  4AUX A;  1FJL A;  3JRI A;  5F0C A;  3PM1 A;  1T56 A;  3HBL A;  5M5X J;  1OCT C;  2COB A;  4MIM A;  3D1N I;  4A3E J;  4JX6 A;  3S15 J;  1O4X A;  4MFE A;  3A03 A;  2K9N A;  2RAE A;  4I76 A;  1APL C;  1LE8 A;  4EEF G;  5M3M J;  3JRG A;  4B1R A;  3S1Q J;  2LY9 A;  1WH7 A;  2MSY A;  3LSR A;  3FK6 A;  1JUM A;  3NAU A;  4JX4 A;  1UMQ A;  4D7N A;  4V2G A;  3Q0U A;  1QVT A;  3IH4 A;  3E7L A;  4AYB N;  4MFD A;  1JKO C;  4FE4 A;  4XK4 A;  4DZP A;  3GTJ J;  5IPA A;  1AKH A;  3L1P A;  3GBG A;  4A69 C;  2JK3 A;  5EGO A;  1I3Q J;  5FKK A;  2XB5 A;  1DU0 A;  1ETX A;  1U8B A;  3IH3 A;  5GPC A;  4C3I J;  5EEA A;  3JRC A;  2M8G X;  2LVS A;  1Z0X A;  4JP0 A;  2R92 J;  4BBR J;  1TWF J;  2L0K A;  3LSG A;  3GTQ J;  3IV5 A;  2IBD A;  3S17 J;  3BR5 A;  3IH2 A;  3G1L A;  2JA5 J;  2CRG A;  3JR9 A;  4DYC A;  1G2H A;  1ZQ3 P;  3TP3 A;  1JUP A;  2L9R A;  2XSD C;  3ZQI A;  1UG2 A;  3CQZ J;  3UKG A;  5IOY A;  3BT9 A;  1H8A C;  3LNQ A;  3DEW A;  4M3F A;  2ECC A;  1B72 B;  2XPV A;  5HOD A;  5J1R A;  4FIS A;  3S2D J;  3HOW J;  1PUF A;  4X1E A;  4BBS J;  2OPT A;  4UUT A;  3C2B A;  5F27 A;  4FE7 A;  4M6V A;  4QSH A;  1JKP C;  3BG3 A;  2R0Q C;  4QIW N;  1W0U A;  4M3G A;  2EQR A;  2HYJ A;  1T33 A;  2CQQ A;  2P81 A;  5GP9 A;  1A5J A;  1TWG J;  1WH5 A;  4L5E A;  5C4J J;  1LE8 B;  2FQ4 A;  5F0F A;  2E19 A;  3ZQL A;  1ETQ A;  1MBF A;  2WAQ N;  1JJ8 C;  3S14 J;  2AHQ A;  2LD5 A;  5FJ8 J;  1TC3 C;  2YUS A;  3HKZ N;  2JA8 J;  2TCT A;  2KT0 A;  4M3E A;  2JJ7 A;  1MBK A;  3BQZ A;  4Y52 J;  3SDG A;  4J19 A;  2QCO A;  3HOY J;  2DMT A;  1AKH B;  2K9S A;  2EZK A;  3W6V A;  2ECB A;  5EGO B;  3I4M J;  2CUE A;  1RKT A;  4RDU A;  1HCR A;  2R93 J;  2L7M P;  2DMQ A;  5EZH A;  4D7M A;  2XRL A;  2M0C A;  1I6H J;  5M5W J;  1ETV A;  1JTY A;  3K7A J;  5K7F A;  4C3J J;  1ETO A;  3ZOB A;  1OCP A;  2DA4 A;  4IHV A;  1OFC X;  5J1Y A;  3JRE A;  2G0E A;  3S16 J;  5F1J A;  3BTL A;  2R5Y A;  3MN2 A;  3ZQC A;  1XC5 A;  1ETY A;  2FJ1 A;  3BTC A;  5BNG A;  1ETK A;  3JRA A;  2YS9 A;  3ZQH A;  2LKX A;  2LK2 A;  1RR7 A;  1GVD A;  1S7E A;  2JA6 J;  2R7Z J;  1OJL A;  3K2A A;  4W1U A;  1POG A;  1Q1V A;  1U9N A;  3DCF A;  1MSE C;  1NTC A;  1ORK A;  4BKX A;  5FLM J;  2DA7 A;  1CQT A;  4DYR A;  3GTG J;  1WGX A;  1PUF B;  2TRT A;  2W48 A;  4V2F A;  2DMP A;  2KDZ A;  3QPL A;  2LP0 A;  3H3V K;  1WI3 A;  5F0H A;  5F08 A;  1JKR C;  2DA5 A;  5JLX A;  4ABZ A;  2HQ5 A;  3G1M A;  3S1R J;  3RZD J;  3F0C A;  1IC8 A;  3BR3 A;  1U9O A;  3CMY A;  1MH4 A;  2ID6 A;  2VI6 A;  1K83 J;  2LR8 A;  2VKE A;  4XRM A;  5C3E J;  1FTT A;  1QVU A;  5J1U A;  4RBO A;  2EBI A;  4XID A;  1QRY A;  1JUS A;  1MBE A;  2HOT A;  3HOZ J;  2JWT A;  3ZQF A;  1QPI A;  1MBJ A;  3BG5 A;  2NVQ J;  3LOC A;  2DA2 A;  1UHS A;  3M4O J;  2NVX J;  5IP9 J;  2DMN A;  2EZI A;  4DYQ A;  1U78 A;  1ZKG A;  2H8R A;  1JT0 A;  5FKN A;  1GV5 A;  2JMW A;  4FTH A;  3JRH A;  3BG9 A;  1NK3 P;  5DS9 A;  3PO3 J;  1P7J A;  5FKO A;  4MO7 A;  5IP6 A;  5C44 J;  5E3N A;  5FLV A;  4IHY A;  1ZR2 A;  4CYC B;  5E3M A;  2GM4 A;  3LSP A;  2XPW A;  1IV6 A;  1BL0 A;  2ELK A;  2Y9Y A;  1ITY A;  4BY1 J;  4DW6 A;  1IDY A;  2HXO A;  2R5Y B;  2IAI A;  2QF7 A;  3A01 B;  3SJM A;  4QTR A;  1HDP A;  4BXX J;  1JJ6 C;  3GTP J;  1EF4 A;  1HDD C;  4AC0 A;  2HOA A;  5IOZ A;  1FIA A;  1LFU P;  2NVY J;  1FEX A;  5EF6 A;  2VPR A;  2JN6 A;  1RES A;  2VUM J;  2XGC A;  3BQY A;  1Y1W J;  2Y0S N;  3VPR A;  2R5Z A;  3JRB A;  4A3J J;  1DU6 A;  4A3L J;  1AU7 A;  1RET A;  1RPW A;  2Y9Z A;  2GBY A;  3SFI A;  3H0G J;  1ZGW A;  1MBH A;  2X48 A;  2ZB9 A;  1K61 A;  5K7Z A;  3MVP A;  2XGE A;  2EZH A;  2EZL A;  2FX0 A;  3TW7 A;  3O8H A;  2WB1 N;  3CDL A;  2XB0 X;  1IDZ A;  3QQA A;  2LFB A;  3HGY A;  5FKL A;  1VF9 A;  1HOM A;  4CYC A;  2K9Q A;  3OSF A;  2YU9 J;  2M34 A;  1R9T J;  1Z77 A;  1NK2 P;  1YRN A;  3HEF A;  3FIW A;  1I50 J;  2CUF A;  2CU7 A;  2XPU A;  3A01 A;  2AO9 A;  4G12 A;  2X6O A;  2L7Z A;  2ME6 A;  2O9L A;  2N8G A;  2HDD A;  1IRZ A;  2O8K A;  4XIC A;  3GTK J;  2E2I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...