1AKHA

Mat a1/alpha2/dna ternary complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
49
structure length
49
Chain Sequence
ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*C
publication title Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 19
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1akhA00
5IYCJ 1W0TA 3S15J 2FX0A 2KT0A 3SFIA 1JKOC 4UUTA 1B8IA 3GTKJ 4UUSA 5EDNA 5EZHA 2GBYA 2CUFA 1OCPA 2IAIA 2M2EA 1TWCJ 2R5YB 1FTZA 5J1UA 5M5WJ 2LVSA 5C4JJ 1MBEA 4MLOA 2DA2A 3IH2A 2M0CA 3UKGA 2WV1A 5EGOA 2DMNA 2XGDA 5E3LA 4IHYA 1WPKA 2EBIA 1H88C 2D5VA 4RDUA 2JJ7A 4BBRJ 5EYRA 1WCMJ 2NVXJ 4AC0A 1DU6A 3S1RJ 1IV6A 1ORKA 2XB5A 1P7IA 2Y31A 5F0FA 4B3AA 2YS9A 1POGA 3BR0A 2E2JJ 1HDDC 3BQYA 5M5YJ 4FTHA 5F04A 3GBGA 1IRZA 3JRCA 4DYRA 3LOCA 3D1NI 4M3FA 1ETVA 1JUSA 4UUSB 3O8GA 2JMWA 1GVDA 3BTIA 1NK2P 4XRSG 2VI6A 1JUMA 3FK7A 2Y30A 3ZQGA 1ZR2A 5K7FA 2DMPA 3IH4A 2K40A 2DA3A 5EGOB 2JA7J 3CDLA 2HDDA 3BR3A 2HXIA 1K83J 3FIWA 5F1JA 4XIDA 2TRTA 3OIOA 5K7ZA 4L5EA 2OF7A 3C2BA 4A3JJ 1RKTA 2K9SA 4XICA 2ID6A 2FD5A 4G12A 2KDZA 1NTCA 3ZOBA 3GTQJ 2CU7A 5F27A 3S17J 1FEXA 4FE4A 4AYBN 2VUMJ 2M34A 4FE7A 3GTOJ 1JJ6C 3TW7A 2LTPA 2XGEA 1VI0A 3CCYA 4DW6A 1ZR4A 1OCTC 4D5FA 2ME6A 1RETA 1JJ8C 5IP6A 1U8BA 3G1MA 3MKLA 4MIMA 1SANA 2MG4A 5FKLA 3LSGA 3B6AA 3S2DJ 3GTGJ 4V2FA 4QTRA 3PM1A 4FISA 3JRGA 1HLVA 1RKWA 4DZJA 3RZDJ 2IBDA 2O7OA 4S0HB 1XS9A 4C3JJ 4M3DA 2XPVA 4QSHA 2JK3A 2DJNA 2E2IJ 2ID3A 1NK3P 4A69C 1TWFJ 2LP0A 5IOZA 2Y9ZA 2AHQA 5DTDA 1JKQC 4A3CJ 3LNQA 1TWHJ 2GM4A 5M3FJ 3IV5A 5E3NA 1FJLA 4IHVA 5JLXA 1K61A 3S14J 2XPUA 2EZHA 4ABZA 3B6CA 2O9LA 2P81A 2DTZA 2MSYA 2LK2A 3HEFA 4BXXJ 3FKIJ 5GPCA 1MSFC 3H3VK 1QVUA 4I76A 3BR6A 2W48A 2WB1N 5J1YA 3GTPJ 2XSDC 1IJWC 4MFDA 2ECCA 3HBLA 4B4CA 2LD5A 2AO9A 2X9DA 1GDTA 4MO7A 3RQIA 4IEJA 4HNVA 1ETQA 5IYBJ 3HOZJ 1U9OA 2L9RA 3WHBA 2LKXA 2Y9YA 1GV5A 1MBJA 4C3HJ 4C3IJ 1LFBA 2VKVA 5J3LA 2JA6J 3A02A 2R92J 3QQAA 2DMQA 1DU0A 3PO2J 3S1NJ 4I6ZA 3ZQFA 3HOYJ 1ZQ3P 2DA5A 4LOCA 1T56A 5EZGA 3BTLA 3TP0A 4A3MJ 2LFBA 3BT9A 4A3GJ 1TC3C 1MH4A 2NVTJ 1YRNA 3OSGA 4BBSJ 5IP9J 4FCYA 5F08A 3RKQA 1B8IB 3WHCA 1GUUA 3HDDA 2IEKA 4A3IJ 4BY1J 1OJLA 3OSFA 4M3GA 3K2AA 5C4XJ 1AKHA 5HODA 2HOAA 3MVPA 3ZQCA 2NVQJ 5EF6A 2COBA 3BTJA 3JRBA 1P7JA 2DA7A 2HI3A 5EG0A 3BG3A 4DYQA 4EEFG 4W97A 3HB9A 2VPRA 4JP0A 1TWGJ 2XRLA 3G1LA 1RPWA 2MGQA 2QCOA 5IOYA 4A3KJ 4JX6A 1RESA 3HGYA 2PMZN 2O8KA 2H1KA 1QVTA 2HOTA 3GTLJ 1IGNA 5E3MA 2M9HA 1H89C 2DMTA 3PO3J 2LLKA 4C2MJ 2EH3A 1BL0A 4D7NA 3NARA 4A3DJ 3I4NJ 2LR8A 3FISA 1YRNB 1EF4A 2NVYJ 5IPAA 1VFCA 1B72A 3BG5A 3K7AJ 1H8AC 1ZK8A 1Y1VJ 3JRAA 1BJZA 1AKHB 3BR1A 1JGGA 1IDYA 2CJJA 4Y7NJ 1I50J 3FK6A 2G0EA 1FIAA 5EG0B 2Y0SN 2LY9A 1APLC 3ZQHA 2N8GA 3HKZN 3HM5A 2MW8A 2JA5J 3O8HA 1WH7A 4AUXA 4A3BJ 1VF9A 2XGCA 3JRHA 3JRDA 4JX4A 3W6VA 4A3LJ 1MBFA 3M3YJ 1OFCX 1Q1VA 2E1OA 3Q3SA 5DS9A 4JYKA 1IC8A 2VKEA 3LSJA 1ENHA 1MBGA 3BR2A 3Q0VA 4GFBA 2YU9J 1ETXA 2QF7A 2R0QC 1WI3A 3NAUA 3TEDA 1UMQA 2EZKA 3GTMJ 5FKKA 4QIWN 1QPIA 2R93J 3H0GJ 3QPSA 1ETKA 2K9QA 3BTCA 1JTXA 1TWAJ 2FQ4A 3ZQIA 2DA4A 1MSEC 5JLWA 4MFEA 3VPRA 1ETWA 3MN2A 3TW6A 1E3OC 1JUPA 2OPTA 1MBHA 2E19A 1X58A 3G1OA 5C44J 2DA1A 1ETOA 3HOVJ 1BW5A 1Z77A 3QPLA 1UG2A 1F36A 2ELKA 1I3QJ 1HCRA 1R9TJ 2E2HJ 2L7FP 1IUFA 1IG7A 2WAQN 4Y52J 4CYCA 2NOGA 2XPWA 1CQTA 1U9NA 1ZTRA 1ETYA 2NS7A 4DYCA 3JRIA 3HOWJ 2JN6A 3S16J 2ME0A 5EEAA 5GP9A 1HOMA 4X1EA 2DN0A 1U78A 3GTJJ 2HOSA 1FIPA 3S2HJ 1MH3A 2CQXA 3HOUJ 3A03A 5FKOA 4M6VA 1HF0A 4IHXA 1D5YA 3HOXJ 2H8RA 4BKXA 2EZLA 1F43A 2CQQA 1AU7A 3S1MJ 4XRMA 1A6IA 1JTYA 1GV2A 1X2MA 1WH5A 4V2GA 4NDLA 1IDZA 3IH3A 1ZGWA 1PUFA 5IP7J 4BY7J 2EQRA 1A5JA 3BQZA 3I4MJ 2FJ1A 2R5ZA 1I6HJ 1Z0XA 5K7HA 1G2HA 1ZKGA 2XB0X 2ZB9A 3JREA 4CYCB 3HGGA 1BW6A 4M3BA 5F0CA 4D5CA 2ECBA 1SFOJ 5M5XJ 2L7MP 1MBKA 2HXOA 3S1QJ 1X2NA 1BA5A 5FJ8J 4X6AJ 2Y2ZA 1ITYA 3SDGA 1O4XA 5BNGA 3BG9A 5M3MJ 1VNDA 4J19A 1GT0C 5FLMJ 4M3EA 5FKMA 3TP3A 2HQ5A 1WGXA 3A01A 1Y1WJ 4JX5A 5C3EJ 1RR7A 1W0UA 1JT0A 5FLVA 3Q0WA 2DMUA 5GPAA 1XC5A 2NS8A 5E3OA 3RZOJ 1PUFB 5IYDJ 4A3EJ 1LE8A 3SJMA 2RAEA 4XRSA 4IHWA 3LSPA 2R5ZB 2CRGA 4A3FJ 3Q0UA 1FTTA 4RBOA 1HDPA 4W1UA 5FKNA 2JWTA 2YUSA 5J1RA 2L7ZA 3CQZJ 2R5YA 2R7ZJ 1S7EA 3JRFA 2L0KA 4D7MA 2JA8J 3F0CA 1AHDP 1MNMC 3BR5A 2K9NA 1B72B 4DZPA 3LSRA 1UHSA 1XG1A 2DA6A 5F0HA 3JR9A 1JT6A 1QRYA 3L1PA 3A01B 2X48A 1LFUP 1T33A 2TCTA 3DEWA 3CMYA 3M4OJ 4B1RA 2EZIA 9ANTA 2M8GX 2CUEA 1JKRC 2X6OA 2B63J 1LE8B 3DCFA 1JKPC 2HYJA 4XK4A 2I10A 3E7LA 3OOUA 3ZQLA 2GLOA 4A93J
chains in the Genus database with same CATH superfamily
2EV6A 3JW4A 1F5TA 1FOKA 5ILUA 2RV8A 2MD0A 3K4LA 2M30A 1JKOC 3S93A 3GTKJ 4UUSA 1V5FA 3H35A 5EZHA 5J4VA 4UXNA 1XSXA 1BIBA 2EA2A 5JHUA 1OCPA 2XAFA 4C2TA 3DP7A 1IRGA 5J1UA 4P5OA 5C4JJ 1MBEA 1F9NA 2JRTA 3F23A 1O3SA 2DMNA 3IL2A 3JSPA 1Z67A 2EBIA 2PFBA 1R4MB 3K4BA 4EM2A 2D5VA 2STTA 3NRVA 4Q4ZF 3MQ0A 3T0YA 3CCLI 2RQQA 3WTWC 1N25A 1JHFA 1Z21A 4II3A 1HC8A 4L18B 2L54A 2BE5F 2IVMA 4B3AA 3F8NA 5J8FA 1POGA 4O5VA 4MTDA 2RKHA 5FFZA 1K4SA 3K4JA 1MMGA 2DQRA 1IN8A 1NH3A 4EM0B 3OV8A 3CP2A 2YSRA 3I54A 2HKXA 3Q9SA 3ABMH 3LSTA 2K4BA 3L2RA 1DPUA 3OYKA 2OD5A 1PVEA 3O8GA 2VBYA 3VYSB 3ELKA 3GFJA 3P9CA 4DNCA 3CF5F 2KMUA 3HHHA 2DMPA 1V3FA 2K40A 4EJOA 4J00A 2DA3A 2D1HA 3ABKH 1IF1A 1QZYA 3V42A 3G4SI 3BR3A 2QQBA 4YFKF 3H36A 5F1JA 2EB7A 1ZLKA 1X4OA 3A4CA 3C2BA 4B43A 2O5RA 1K79A 4XICA 2ID6A 2FQ3A 3ZOBA 3GTQJ 5F27A 3DKYA 4AYBN 2VUMJ 1GHCA 1IW7F 1MKMA 2HU9A 1JJ6C 5DM6F 1YITI 1RIOH 1OYYA 2XGEA 2Z33A 5ICGA 5TJJA 4D0PA 3A2KA 2VXDA 1X3WB 4BJ5C 4GYGA 1IO2A 5F64A 2LBFB 2J5PA 3LSGA 3ZMVA 3SZPA 4V2FA 4QTRA 1HLVA 2VXZA 2O7OA 1XS9A 3LMMA 3CCJI 4YRVA 2Y69H 1D1CA 2VKHA 4HG2A 4WWCA 3OYEA 1BI2A 4AWXB 2Q0OA 4LLNA 4E7LA 1YS6A 1TWFJ 3FXOA 3JCUC 2AHQA 4O3MA 1S3JA 3KX2A 2GM4A 5M3FJ 4NQWA 4M9SA 1FJLA 4XKVA 1XGOA 3CUOA 1D0XA 3LA3A 4ABZA 4XSZF 3EETA 4XKWA 3HRUA 2QSFX 1XPXA 1OCZH 2FF4A 1YS7A 3BPVA 4XLPF 3H3VK 5H20A 4I76A 5J40A 4RM3A 2DT5A 1TP4A 2PN6A 1E2XA 2KFDA 2BGCA 3V4GA 4IX7A 2GAUA 2LD5A 1T0FA 4DGWB 4BJTA 4EMSA 3PFIA 4WX9A 3E6BA 2X9DA 1ZG1A 3I5UA 4IEJA 4CSWA 4WXCA 4YIRX 1KZHA 1U9OA 4HLYA 5BPDA 3OR2C 3PSFA 2H8WA 1QGPA 3DTKA 1K6YA 1YE9A 1HA8A 3ULQB 3K4MA 3K69A 2E1MC 2DYSH 3WODF 2VKVA 4A0XA 4C3IJ 4CCLA 1MZBA 3A02A 4AIJA 3E5QA 3S1NJ 3DPUA 1REPC 2VN2A 4I6ZA 3ZQFA 3HOYJ 3Q5FA 3A0BC 4LOCA 1ACIA 1LEAA 1BN5A 4PGHA 4KNYA 5EZGA 3BTLA 1YW9A 1ZELA 3OMYA 3GZ6A 4HF2A 2DAOA 1M1EB 3FXQA 1WI9A 4A3GJ 2WAQA 1TC3C 2RN7A 3I59B 2NVTJ 3ZQQA 5IP9J 5IY5H 3TDZC 3WHCA 2HGCA 1P6RA 2ZFWA 2Z3YA 3QYEA 2IEKA 1OJLA 1VQ4I 2P4WA 4KJZA 3OSFA 4HRIA 2VPLA 1AKHA 4FX4A 2BBYA 3BPXA 1FWZA 2HOAA 4N4NB 3ZQCA 4RAYA 4RGRA 1GLNA 2KIFA 2DA7A 3DU5A 2K7LA 5CVJA 2DFIA 5EG0A 4Z6YA 4DYQA 4W97A 1DDNA 1BI0A 2XRLA 1KQ8A 3LAPA 4ETSA 1RESA 2F5DA 3LL7A 2PMHA 4KT6A 2O8KA 1V4RA 2HOTA 1QVTA 2A6TA 2DTRA 1HW2A 1BC7C 3QYFA 1EV7A 2VQLA 2QSHX 2HTJA 4E6KG 2EH3A 2IS6A 3DV8A 3IAM2 2HVSA 4NNJA 3T8RA 4A3DJ 5B1AH 3I4NJ 2LR8A 4ANJA 2ICWG 1YRNB 2QBYA 2FSWA 4FETA 5IPAA 1PYVA 3BG5A 2E7WA 3PSIA 1ZGJA 3JRAA 1BJZA 5IT9K 5HVQC 3QOEA 1UJ8A 2R3SA 3N97A 3VWBA 2XF7A 1G8XA 4XL9A 1WJEA 3VFZA 4Y7NJ 3L2VA 1I6XA 2V6CA 3FK6A 2W1OA 2Y0SN 2N8GA 1G6NA 1YTYA 3M1CA 3T5XA 3H5AA 1WH7A 4AUXA 2HZTA 5K5QA 1SMTA 2GIZA 1VF9A 2XGCA 3W2AA 4XKBA 4H0EA 2VBZA 3CLOA 3HSFA 4BACA 1ODDA 3W6VA 3DLAA 1MBFA 2LG4A 1UFMA 2E1OA 2DFFA 3DFGA 1S72I 1LDDA 5DCMA 2DDBA 2LSOA 1TW2A 2K02A 4XOTA 1T38A 1XN7A 3BWGA 4RLFA 2OBPA 2Q2EA 5FRMA 4KIFA 3BR2A 4R1HA 3Q0VA 4F92B 4IVNA 1S29A 4KYWA 3FMRA 3CCEI 2J5OA 1ETXA 3R4KA 1UMQA 1ZN2A 5TGTA 5FKKA 3GTMJ 2D2WA 2C6YA 1VQNI 2R93J 2CFXA 1PJRA 2K9QA 1JTXA 1TWAJ 1A6QA 1D5VA 2QQAA 4BHBA 1XDUA 1RC9A 3AFHA 4YG2F 1ETWA 1KA8A 3TOAA 3E3VA 5K1YA 3VYUB 2LREA 4YFNF 5L3GA 3HRMA 5J4YA 2E19A 5DCFA 2W24A 4KIGA 2DA1A 3LA2A 4ZYHA 1BW5A 6PAXA 3E1SA 4I99C 2GOMA 3QPLA 1F36A 3DPTA 1I3QJ 4U0VA 1WJFA 1R9TJ 4NQWB 1R4NB 2XDVA 3K4KA 2L7FP 4PJLA 3DF8A 2G9WA 4BQOA 1U2WA 3TBIA 4CYCA 3TL4X 1YG2A 2DT7B 2MABA 4P9FA 3DBRB 4G7OF 2XPWA 2DPDA 2XF5A 3CMEI 4OAYA 4XLNF 1G3SA 2E36A 1BR4A 3JRIA 3HOWJ 2JN6A 2RNGA 3R6SA 2ME0A 4HA8A 1WJAA 4CICA 3MZ8A 1HOMA 2DOEA 4X1EA 3FMQA 4HEA2 3GTJJ 1TNSA 4PK4A 4KMUX 1XMAA 3H9QA 2CQXA 3A03A 1YYVA 4BUPA 1D5YA 2DOAA 1IZ1A 3KZZA 5HLTA 4BU2A 3WU1B 3HOXJ 1F43A 3LWFA 2LY1A 1AU7A 2FOKA 2E7XA 3ESWB 3RJPA 4FHTA 1A6IA 1X2MA 2OC6A 2QYOA 4V2GA 3SEZA 4AM3A 3DEEA 3IH3A 1PUFA 2ACJA 1KU2A 3BJAA 4OINF 3MMYB 2EQRA 4RB0A 2V9VA 1K78A 1A5JA 2QKMB 3IUOA 3OL3A 4Y15A 1SFXA 3ZP5A 2OQRA 2RREA 4F52A 5K7HA 1G2HA 2HQRA 2ZB9A 2R7OA 3K4NA 4OU0A 4D5CA 2XAJA 1Z6TA 5EEHA 1VQ7I 5HS9A 5BS6A 1T6SA 1MBKA 2HXOA 2W00A 3HPGA 3D5LA 4I0AA 3S1QJ 2Y0MA 3ZXSA 2Y2ZA 3L2QA 3SDGA 3DXJF 4LG0A 3BC8A 3ERMA 5M3MJ 3K4CA 3FXJA 3J80Z 2EIMH 5L3BA 4J19A 4BAYA 2KLOA 3DU6A 3CMAI 1GT0C 2HQ5A 2M1BA 3K70D 1Y1WJ 2O03A 2L01A 5C3EJ 1W0UA 1I39A 1JT0A 1KU9A 2P5KA 4MGRA 1USTA 5GPAA 1XC5A 4A6DA 1F4KA 1YFHA 3DWLE 1HKSA 3QOPA 4RS8A 3U21A 4LLGF 3VB2A 4EV0A 3FBIB 3I9V2 3S32A 2ZMEB 2G7UA 1X1AA 2KJBA 1FP1D 1P4AA 2R7RA 2LF7A 3HUGB 3LSPA 2R5ZB 2CRGA 3IP4B 3UNGC 4EJVA 1XD7A 3O3KA 1MJ9A 3IWZA 3AKZA 4ITVA 2DPUA 3JTGA 5JFRA 5FKNA 4CZZA 1YO5C 2NAZA 5LGNA 3ZN0A 4MQVA 5HLHA 5J1RA 1FYLA 3CQZJ 1YI2I 5E8IA 1XGNA 3CC7I 1FLIA 2EK5A 1S7EA 2L0KA 3F0CA 1AHDP 2QBYB 3CC4I 3SDBA 4KFCA 2K9NA 3FHNA 2H6BA 1UHSA 3LSRA 2OUMA 3QYBA 1D3YA 1JT6A 4ENKA 1QRYA 4EGYA 2WAEA 4ZJZA 2RQPA 3C2GA 2Z2SB 4E7HA 2KZGA 1B9NA 2DJIA 2FBIA 1T33A 4ZTJA 3DEWA 3PNYA 2PJRB 2R7TA 5KK1A 1JKRC 2X6OA 5B66C 4L0ZB 1SAXA 2B63J 1LE8B 3H3ZA 4I2OA 1IRFA 2UWMA 2KIQA 2E34A 1D1BA 1WHUA 3OY9A 3PJRA 1R36A 2IXSA 4U88A 4UV8A 4LIVA 4KDPA 1W0TA 3RKXA 4UUVA 2KT0A 3CTAA 3SFIA 2TDXA 1QHGA 5EDNA 3PNVA 2CUFA 2IAIA 4I0BA 1TWCJ 4CGZA 5H2FC 1FBSA 1A04A 2CQ7A 2HR3A 1W7PB 3BJOA 1Z3XA 2VIXA 2XIGA 2M0CA 3UKGA 3OYJA 1TLHB 1YX5A 3QODA 4LFUA 4IHYA 1X1BA 4CO8A 2VJJA 1G3YA 4CUGA 3DPLC 4L9VA 1R00A 3OYIA 3HYIA 4A6EA 2JJ7A 3VOEA 2IGKA 5EYRA 2A3SA 3L7WA 2A6EF 1Y39A 4AC0A 4BS9A 1DU6A 1USSA 3FXUA 1IV6A 4KA4A 3AL0B 1ORKA 3N4MA 2A05A 3T1BA 2Y31A 4BEHB 5ERIA 2BV6A 2A69F 2E2JJ 1UAAA 1PP7U 2HVQA 4IJAA 4LB6B 4MEXF 1D8JA 3PIPF 5F04A 5KVRA 4KT5C 1IRZA 4L5IA 4DYRA 3ASOH 3D1NI 4M3FA 1PP8F 5FLXZ 3WGIA 1JUSA 2NNNA 2JMWA 1N77A 4UY8I 2JSPA 3BTIA 2M87A 2EFNA 3H9GA 4C30A 1MNEA 3IAS2 4OIRF 4MNUA 4QWQA 1ZR2A 1S9HA 4G8XA 4PSWA 3LSIA 1BR2A 5EGOB 2EV0A 2HDDA 1IN5A 1OCOH 1JHHA 3FIWA 4C2UA 3BZCA 3E6MA 2WC2A 5K7ZA 1O7LA 2FMYA 4L5EA 3M8EA 1RKTA 2K9SA 3S17J 3EYYA 4G12A 2KDZA 1FEXA 3ML6A 2CW7A 4FE4A 2M34A 3CF2A 3DBHB 4X0GA 4CZCA 2DT6A 2P5LC 2LTPA 4ESJA 2HNHA 1W5CC 4DW6A 2NS0A 4LG3A 1OCTC 4D5FA 1T0FC 2PMZA 3VDXA 4LK1F 4BE0A 3MKLA 3KLNA 1SANA 5KHDA 4WXDA 4CYDA 1FPQA 3GTGJ 2CUJA 3HZJA 3S8PA 4D9JA 5GAHJ 1IUYA 1BOAA 2ISYA 2JPCA 1SD6A 3JRGA 2W7NA 4F91B 1QZEA 3W6JB 2IBDA 5AIPA 4S0HB 5GAEJ 3RZDJ 1FBUA 2K9MA 4M3DA 4F55A 1STZA 4MQ9F 3RPQA 1LPQA 2DJNA 3EUHA 4LG0B 3GF2A 4PUSA 4A69C 2ZCWA 3WG7H 4AIKA 3FXLA 5D4SA 2V6EA 3I58A 2W57A 2Y9ZA 2MC4A 2PG4A 5DTDA 3TKYA 3C2HA 1BC8C 1NG6A 3IV5A 2Z99A 3KCCA 1W4MA 3OS2A 1Y8RB 4IHVA 2HDWA 4ZYDA 2DDAA 4U0YA 1A31A 3S14J 2XHKA 2XPUA 4HQMA 1IN4A 1P2FA 4K2EA 2MSYA 4ON0A 5K5OA 3HEFA 3SZTA 3Q9VA 3FKIJ 3BR6A 1N75A 4B8XA 5HOOA 3MKZA 3CCUI 3WU0A 4IO9F 4MFDA 1MJAA 3HJEA 1T98A 3I59A 1BM9A 2IGMA 3HBLA 2BZTA 3H92A 4UV9A 3FMSA 2ZMEC 2E1CA 3ABUA 2ISZA 3G71I 3RI4A 1R23A 2QZ8A 2Z5UA 3ASNH 1GDTA 1KGSA 2VLAA 3RQIA 2JQ7A 2CYYA 5FGMA 3RPUD 1SFEA 5A2QK 3SHFA 4E7IA 1YX3A 4P55A 2L9RA 2V9KA 3WHBA 4BE1A 2LKXA 2BY2A 3GWZA 4C3HJ 3CO7C 1LFBA 4IOAF 5JVTA 3QQAA 1OKRA 4ZZDA 1J7KA 1LB2A 5ILVA 5L3DA 2LNBA 1R1VA 3V8LA 2E5ZA 4UVAA 4RB3C 2BOLA 2EA4A 4A3MJ 4AIHA 1IV8A 4HX8A 4ESFA 4G7HF 4CCKA 1EA3A 1WWXA 1YRNA 3OSGA 1BI1A 3GZ5A 5F08A 5DUIA 3I64A 1PDNC 1LDKB 5HLIA 2O0YA 4HNTA 5DD4A 4AD9A 5D8KB 5JHFA 1BIAA 3MVPA 2ELHA 1O3TA 1ZGAA 2DCEA 2FBHA 2NVQJ 3U1DA 2IT0A 2OU2A 1P7JA 2EPFA 4LGWA 1H9TA 1Z3YA 3BG3A 4B09A 2VKDA 3HB9A 2L02A 3P9IA 4CDGA 1TWGJ 2KRHA 4JX6A 3HGYA 4WF2A 4NC8A 4HAMA 3VYRB 4XLCA 2M9HA 2RDPA 3DLLF 1TW3A 1H89C 1FMWA 3RKWA 1WJ5A 2LLKA 5DDGA 4C2MJ 3HC7A 1BL0A 3QU6A 3K2ZA 1W36D 1ON1A 2CGPA 3NARA 3PUFA 4J01A 3AL0C 3K7AJ 3CJQB 1JGGA 1IDYA 3DBLB 4OMYA 5D6FA 1I1GA 4L5JA 1WVRA 2DYRH 2GQQA 3MAJA 2K3FA 3OIQA 4F93B 2MLKA 2UZKA 2ZO4A 3S2WA 2STWA 1MD0A 3E5UA 3GEZA 2QENA 2K86A 1YIOA 3HKZN 1L0OC 1J75A 2MW8A 3TO6A 3O8HA 4YIFA 5E17F 1YW8A 2LRDA 4RA2A 2CMPA 1IXRC 4A3LJ 2QEXI 3FDYA 5DS9A 4NBQA 2L7KA 4JYKA 1R22A 1WFXA 3V8KA 3RIRA 4RMNA 2A61A 3MCZA 2L5QA 2VKEA 2P6TA 1KQ9A 1ENHA 2P6SA 4IQJA 2ZXHA 1LQ1A 4PJJA 2YU9J 1TZLA 2QF7A 3TEDA 4JBAA 3OOPA 2WY7Q 1ETKA 2X1CA 3H3UA 2DU9A 2M8EA 3I55I 1EH8A 4U0WA 3ZMZA 5LLQA 2VQCA 2FU4A 3PQJA 2DA4A 3RYPA 5JLWA 4MFEA 2MYSA 2GA1A 2FMLA 4KISA 2IJLA 5AONA 1FYKA 4N9IA 3I4PA 2L9NA 1UHMA 5K5RA 1UCRA 2ZSHB 2VJ4A 4HX4A 3G1OA 4ZYAA 2HYFA 2UUZA 4IL6C 2K3PA 3HOVJ 3QPTA 1WQ2A 1Z77A 2COMA 5ED4A 4IOCF 2M0MA 4G6QA 2A5WA 3L9FA 5FB2A 1IUFA 1IXSB 3KE2A 1V55H 1IG7A 2CQNA 2GIVA 3U9GA 1TTYA 3K6GA 1MDMB 3F6OA 4BH9A 2ZBKA 2D1VA 4MHGA 2CW8A 1U9NA 1ZTRA 1Z6RA 3W3CA 1ETYA 2NS7A 4GGGA 3HG9A 2AS5F 3O2PE 1LEBA 4N9HA 4IHTA 3BJ6A 2GXBA 3FXMA 2HOSA 1FIPA 4CCMA 3PFYA 3S2HJ 4EJTA 3HOUJ 4M6VA 4BE2A 1MJBA 1GVJA 5KNLA 3WGHA 3GW2A 3UR3C 3E5XA 2JUGA 3BLYA 4XRMA 3VEPA 1WH5A 3BOQA 2UV1A 4L9JA 1B1BA 1IDZA 4BXFA 2ZMEA 5HS7A 1IAWA 4CHUA 3WTVC 3GLXA 3GMEA 3HUGA 2R5ZA 4Y3OA 1FX7A 4Z2YA 3CP8A 1AA7A 2NOJB 1FOYA 2XB0X 1U5TB 3NWTA 2WV0A 4AVPA 3HGGA 4M3BA 3WTXC 3L2WA 4E7JA 5IT9Z 2IA2A 2HS5A 2ZC2A 1B9MA 4WXHA 2BY1A 4R8HA 1MIJA 1BA5A 3PIOF 5D5UB 1FBQA 1BJAA 3KEOA 4X6AJ 3ZR8X 1O4XA 3BG9A 1XB4A 2JSCA 3CCRI 2ZJRF 2VOPA 2X1DA 3T8TA 2M45A 1G4DA 2XASA 3M1EA 5FLMJ 2P7VB 3FHZA 3K0LA 3ROUA 4M3EA 3TP3A 2ADUA 4JX5A 2QKLB 4XLHA 2JTVA 1D1AA 5CPRB 5GTIC 4YIIA 5FROA 3KP5A 3HL2A 2A6HF 2H09A 5E3OA 1U8RA 2PJRA 3RZOJ 3CCVI 1VQMI 1LE8A 1V54H 3QRFF 4S04A 1OPCA 4AYBA 3LA7A 4XRSA 2W85A 3I0TA 2L9SA 4A3FJ 5HLGA 3TOBA 3F22A 3F6VA 4LLLA 2VC0A 3KFWX 4PGGA 4TV7A 2JPBA 4RBOA 4L9TA 1KU7A 1HDPA 4W1UA 5EJCA 1Y56A 4HBLA 2IGNA 1HW5A 4EJUA 2L7ZA 3LSHA 2EFWA 3ZRGA 2R7ZJ 2DQLA 1W7PA 1OR7A 3NQOA 2BXZA 4PZJA 5D8LB 3I56I 2JVGA 2IRFG 3N05A 4DZPA 5F0HA 1FOXA 2A5YB 2DA6A 4IPAA 1J09A 2CV2A 3LSKA 3L1PA 3COAC 2YX7A 2V9PA 2VE8A 2OV7A 4EM1A 1LFUP 5HDGA 2GWRA 4HDUA 3CMYA 3M4OJ 3I53A 3HSEA 9ANTA 2M8GX 5GAGJ 3JAMK 2CUEA 2X1EA 3F72A 1RI7A 3DCFA 4XRFA 2KP6A 4BEHA 2OCEA 2I10A 3E97A 4DJAA 3OWTA 2O8XA 4BDYA 5CVUA 4A93J 3HIFA 4PFPA 1DP7P 2EFOA 3S15J 3QWLA 4GO1A 4IRHA 3J7AY 2EWNA 3KYCB 1B8IA 2DXIA 2PQ8A 3CC2I 4CCNA 3KP6A 2GBYA 3FF5A 5L3FA 5FD5A 2R5YB 1FTZA 3R0JA 4DIQA 1P4WA 1TQIA 2VE9A 5M5WJ 2LVSA 2DA2A 3L2CA 4E70A 2VL8A 3CCMI 5EGOA 4LK0F 3HOTA 4HPQA 5E3LA 2QA4I 4OOIA 1VQ5I 1FP2A 2NNYA 3J81K 2MD5A 1DGWY 3B02A 1GXQA 3WTZA 2XAUA 2PEXA 1ERDA 3S1RJ 4F7ZA 3CUQB 3AG3H 1P7IA 4XNFA 5F0FA 1X1CA 2RNJA 3EUKL 4LD5A 1SVMA 2YS9A 3AAFA 1LKXA 2B0LA 4M74A 4DOZA 3M7GA 3BQYA 2OTLI 5M5YJ 1N78A 4MTEA 5HDKA 5LD2C 4RAZA 3GBGA 3JRCA 5BQTA 3C7JA 3EUHC 1HW1A 1GVDA 3GYHX 3C18A 1BI3A 4XRSG 5TRDA 2VI6A 3HXLA 3ZQGA 5LGTA 4NC6A 3IH4A 3HTSB 2X0LA 1R5ID 2HXIA 2DFEA 1K83J 3KIOA 4XIDA 3OIOA 1LVKA 2CUZA 2O6GE 4HDVA 1P4XA 4A3JJ 2FEZA 4CXFA 3KETA 4OWRB 3JSOA 2HKOA 2X6XA 4N4OB 4S05A 2FD5A 2QVOA 2W82A 1E0EA 2KQRA 2F4OB 3ZCOA 4ASNA 5E1XA 3GTOJ 3TW7A 1VI0A 3OYFA 5E1WA 1TQMA 1W1WE 1ON2A 3KYDB 3OL4A 1YOVB 4ZC3A 2BXYA 1AWCA 1JJ8C 5IP6A 2ESHA 5L3CA 2R7VA 2G7HA 2ZFUA 3G1MA 2ZJ2A 1U8BA 1R49A 1B6AA 2WY8Q 2KL4A 4GCVA 3B73A 3S2DJ 2AXLA 3BG6A 2IP2A 1SC7A 2KDOA 4FISA 4JQFA 2RC4A 4ZYEA 3RCOA 1I5ZA 3EUAA 2EINH 2CFOA 2I8DA 2R7FA 2XPVA 4QSHA 5KCMA 3V8JA 2JK3A 1Y0UA 1XX5A 2XKOA 2ZSIB 1HKQA 2O3FA 3V7RA 4I98B 2XV4S 5B3SH 1U5TC 1XCBA 1HBXG 2LP0A 4A5NA 2JUCA 1LJ9A 2PX9A 1FZPB 1JKQC 4A3CJ 3LNQA 2VQHA 3HSRA 2QWWA 2Y0SA 4IRGA 1TWHJ 3OIPA 5E3NA 2K5CA 3L00A 4CCJA 1U0JA 4ZH4F 4XSXF 2EZHA 5ILSA 1H0MA 2H27A 3B6CA 3W2WA 2O9LA 2FE3A 4BXXJ 3EPZA 5GPCA 1T95A 1ZG3A 2DOFA 1QVUA 4G7ZF 2XRNA 3GTPJ 2LKPA 2XSDC 3M8JA 2DK5A 2XGXA 2M4KA 2NXNB 3WE2A 2XAHA 4XN3A 2AO9A 3MFKA 2MH2A 2P5VA 1FSHA 3WTSC 4MO7A 1QO0D 2X6YA 4NB5A 3H5RA 2ZJQF 1YJNI 1QBJA 2L2OA 4Q47A 1RZ4A 5J8CA 3ZPLA 4M73A 5BPIA 3S3NA 3RDIA 5J3LA 1VTNC 2JA6J 3LQQA 3PO2J 1MNDA 1HXDA 3GFIA 3FWEA 1B4AA 2DA5A 1U3EM 2EFPA 4HYEA 2V1NA 3KLOA 1IXCA 2BY3A 4A12A 4EVIA 3TP0A 1ZG5A 2VT3A 1D0YA 2LFBA 3QAHA 2XC7A 3BT9A 5F6FA 4G6DA 3IRRA 1DP3A 3I3LA 5KAIC 4BBSJ 4FCYA 2ZJPF 3RKQA 1B8IB 3IHUA 5DYMA 4KN7X 1GUUA 5CJ9A 4A3IJ 1UHWA 1QNTA 3PL8A 4PDKA 4BDZA 4BY1J 2MC3A 2Y75A 1SVOA 3KP2A 4BQAA 5EF6A 3BTJA 3JRBA 3OS1A 2Y48A 3K1MA 3VODA 2IA1A 3HRTA 3KEYA 3GLLA 1C0WA 1HKTA 2R4GA 3BCBA 2VPRA 1QU3A 4JP0A 3KEQA 1YQAA 2MGQA 2QCOA 3FZVA 5IOYA 2CW0F 4HW0A 2UXNA 2M7BA 2H1KA 3GTLJ 2WWYA 5HS8A 1IGNA 3LSMA 2V1DA 3DTEA 2K9LA 4UVBA 3PNTA 4UB8C 2JA2A 2QGUA 3GZNB 5CQGA 3FISA 4QPQA 3G73A 2OZUA 2OZ6A 3CUQC 1S5LC 2E35A 1MMAA 3R61A 1ZK8A 3IRQA 4ZYGA 2PI0A 2KISA 4HF1A 1FOWA 4XONA 3BZKA 4L0YB 1V5GA 1TNTA 5H6QA 1FIAA 2R7SA 3FXKA 2LY9A 1ZRFA 1TQPA 1WKMA 3HM5A 3LAJA 4I7HA 3O6BB 2JA5J 1XMXA 4KUMA 2PJPA 3L2UA 2VBXA 3GFMA 1O57A 3KP7A 2A68F 3JRDA 1QQIA 3JRHA 2DODA 4OIQF 4M6YA 2BYVE 4UVCA 1X3UA 2L3DA 4HV5A 1J9IA 2K4JA 1MDMA 1IC8A 1R5GA 2BHYA 5A2QZ 1R7JA 4XLFA 1RRJA 2VQGA 2AXTC 4HNUA 4CH7A 1QPMA 1Y8QB 3AG1H 4AU7A 1I27A 2R0QC 2EZKA 5E79C 3CZ6A 4QIWN 1QPIA 3H0GJ 4RB1A 3WG9A 2F5FA 3FM5A 4ESBA 4OMZA 1XDSA 2FQ4A 1KQ0A 2E1NA 2ZKZA 1MSEC 3RPUA 2WTEA 2IGOA 2XUBA 4E4HA 2HVRA 1WSUA 4XBFA 1SVLA 3TW6A 5B5EC 3OYMA 4XMYA 3OYCA 1DGRM 2OPTA 1ZH5A 1X58A 2P0WA 1QZZA 1IN7A 2WADA 4EJWA 3OYLA 3ISPA 2RVCA 3RKYA 3RQ4A 1WJDA 1UG2A 2ELKA 3E6CC 5CVVA 1UZCA 2YX4A 2OAZA 2B9SA 1S7AA 4PJMA 1ZHFA 1U5TA 2WAQN 1YJWI 2W25A 2NOGA 1T39A 1XGSA 2X6WA 4ENMA 2DI3A 5E20A 3RYRA 1LNWA 3A0HC 5BMZA 4DYCA 2FNPA 3KZYA 4EATA 4JK1X 3M9AA 5E8GA 3TGNA 2VJ5A 2DN0A 2MH9A 3GCMA 3LQRA 2IW5A 5FKOA 3PUBA 1K7AA 2H6CA 3CCQI 1HF0A 2H8RA 3SEQA 4BKXA 2P7CB 2OQGA 3FM3A 3I71A 4ZTFA 1VQOI 5F1RA 2E60A 3S1MJ 3RTRA 1JTYA 1GV2A 1T2KA 4M6XA 2CH0A 4NDLA 4PCQA 3MKWB 4B3XA 4E7ZA 2BY0A 3F8MA 3DTIA 5IP7J 4BY7J 5ICCA 3BQZA 1LUJB 2VOOA 1MMNA 3I4MJ 2HQAA 1I6HJ 1Z0XA 2BHZA 1ZKGA 4Y13A 1OR7C 2QM3A 3JREA 4RAGA 1BW6A 2VONA 3P9KA 1EJ9A 4N0BA 5LHIA 5F0CA 2HPMA 1XSDA 4RGSA 1SFOJ 3GXOA 5M5XJ 2L7MP 3EDPA 2ZNYA 2MFZA 2DFHA 3IKVA 2FRHA 1CF7B 3F21A 3QU3A 5BNGA 3QP6A 2F4IA 2EILH 2QUFA 3ERED 3BZ6A 2FNAA 3ZN1A 4P1WA 1QHHD 2ZXIA 3ECOA 2FOWA 4WK8F 1RR7A 4XN0A 3Q0WA 2V1UA 3SZGA 2F48A 4Y17A 3OS0A 1JE8A 2L9VA 2VASA 2NRAC 2NS8A 4RGUA 3D0SA 1I1SA 2R7DA 3TDUC 4NC7A 5IYDJ 4A3EJ 4A5MA 2W84A 5HDNA 2F4MB 1T8IA 3REOA 3SJMA 2F5EA 1QA6A 2AQFA 1T08B 4BQNA 2GA2A 5D4RA 4IHWA 5KAFC 3TMOA 3W2VA 4R79A 4P96A 3M07A 1R1TA 3H5NA 4ZDPA 2BEOA 3DEUA 4ENNA 2P8TA 2VT2A 5HNHA 2YUSA 2R5YA 2XAGA 2H94A 1W5TA 4OAZA 4D7MA 2JA8J 4ZDOA 1HQCA 1UG0A 3HPHA 4PJNA 3FKJA 2JZYA 2WBMA 3SXYA 1X1PA 4RB2C 3A01B 2CV1A 1D8KA 3CJNA 1X4PA 4BNCA 3AG4H 2KIUA 2EZIA 3CDHA 2E71A 4BXUA 3H9JA 4LIUA 2LH9A 4CA0A 3S3OA 3CUQA 3MD2A 1ZRDA 1Z91A 1D0ZA 2HPIA 5CVRA 2M5WA 4XK4A 3OOUA 4PJ0C 3GFLA 3ZQLA 4KICA 5E18F 2XROA 3ZMTA 5IYCJ 3MZYA 3FX3A 2FX0A 4RGXA 4IQ4A 2NYXA 4UUTA 1R5HA 3HOSA 4G6TB 1H9GA 5LFAA 2R7QA 3F8BA 1VQ8I 5AIQA 4WCGA 1ZARA 2RGVA 2M2EA 3K70C 1ZAOA 1J0RA 4Y33A 1RNLA 4MLOA 3F8CA 3IH2A 2CQKA 2KIMA 2WV1A 3BDDA 2XGDA 4BYYA 3G6EI 4RAFA 1WPKA 1H88C 2V79A 2M4GA 4RDUA 1JGSA 4GYIA 1X1DA 5TISC 1TT0A 4BBRJ 4XOPA 1WCMJ 2NVXJ 1ZYRF 5DUKA 2EFQA 2I5UA 2XB5A 1OYIA 1BR1A 1G59A 3U2RA 5LGUA 1WJCA 3BR0A 1HDDC 3GO5A 1AOYA 1KYWA 4DBQA 4FTHA 4PSXA 4IHSA 2KZVA 3IWFA 1KYZA 3LOCA 4A2UA 2F6CA 1MW7A 2K85A 4LB5A 1ETVA 4UUSB 2KRCA 2LOOA 2Z16A 3VSLA 3C1DA 5ICFA 1NK2P 5DD8A 1JUMA 3FK7A 1Q1HA 2Y30A 5K7FA 1TT5B 1U6GA 2JA7J 3CDLA 1PUEE 1J59A 1Z9CA 1YHQI 1NHAA 2TRTA 3ABTA 1JXSA 1LDJA 2L4MA 2OF7A 1E17A 4UHTA 1P92A 1SFKA 2LDUA 3DKXA 4FX0A 4LITA 4B44A 1NTCA 2CU7A 1F1ZA 3E0JB 4FE7A 3CJRB 4U87A 3TO7A 5D5XB 1FYMA 1LFPA 3CESA 3CCYA 2KHMA 1S8NA 1ZR4A 1XTAA 2M3AA 3J7ZI 4I01A 2OJED 1SD5A 2KJCA 2ME6A 5L3EA 5GADJ 1RETA 2KPMA 2X85A 4ZZLA 2O61A 5ICEA 2ZNZA 4MIMA 4F3QA 3V7SA 4OIOF 1ZLJA 2MG4A 5FKLA 3B6AA 3J7AO 4YEJA 1VQ6I 4LMYA 3C3WA 3PM1A 2PLYA 2LYCA 1RKWA 4DZJA 4DQ2A 3JAMZ 4C3JJ 4HOBA 5LEJA 1OMIA 3CO6C 2VODA 3QP5A 2E2IJ 2ID3A 4G94A 1SFUA 1NK3P 5CLSA 3J7YJ 4QPOA 5B1BH 1NG7A 4M9ZA 5IOZA 4BL0B 3ZQ7A 1S7OA 3L09A 1I3AA 1FT9A 3MKYB 3DKWA 3X2QH 1DQUA 1J5YA 2M7AA 2K27A 2A07F 2JVHA 3HKZA 1XMKA 4HX7A 5JLXA 2PBIA 3TQNA 1K61A 2CSOA 3TO9A 4FQGA 3DQVC 2XVCA 4M9XA 3RSNA 2P81A 2DTZA 1WJBA 2LK2A 2ELJA 1MSFC 4PFOA 2KKOA 4D1QA 2ZXWH 2W48A 4B48A 4BQQA 3J81Z 2WB1N 4A0ZA 2ZXJA 5J1YA 3OYHA 4A0YA 4II2A 4XR6A 1W7PD 4M72A 1IJWC 2ECCA 3GUDA 2EIJH 2IPQX 2EV5A 2PMUA 4B4CA 1ZRCA 1SEUA 2Z1DA 3WU2C 4V19K 5CYVA 2IS1A 3CD6I 3CDIA 1OLTA 4HNVA 1ETQA 1A36A 3EYIA 5DV5A 5IYBJ 1OYWA 3HOZJ 2VBWA 2Y9YA 5LRRA 1GV5A 4XLEA 1G3TA 1MBJA 2GXGA 3JTHA 4HF0A 3K1NA 2JT1A 1UB9A 1FSEA 2FUG2 2R92J 2E5NA 2DMQA 2HYGD 3ZMUA 1DU0A 1R71A 5LHHA 3HTUA 2ETHA 1FC3A 1Z05A 4AVZA 1ZQ3P 3WTTC 5FO5A 1ZREA 3G2BA 3K1PA 1T56A 4QLCU 3G3ZA 3A1YA 4ZDLA 3LFUA 1VQPI 4DBRA 5D6EA 2GOXB 2V7FA 3CCSI 1MH4A 2HZDA 3CLQA 3D5SC 4BGDA 2V1XA 3HDDA 1Z7LA 4FASD 4M71A 4M3GA 2MBFA 3K2AA 5C4XJ 2CO5A 5LHGA 1R6RA 4BJ6C 5HODA 4L9NA 2R7UA 3ABLH 4HV6A 1E3HA 1MMDA 2COBA 3WE3A 4O6JA 1O7FA 3BG7A 2HI3A 1R58A 1XCVA 4RLQA 4C9YA 4EEFG 1SD7A 2BW3A 2VJIA 1YLFA 3IKTA 1DPRA 1A35A 1Z1DA 2X51A 1SAUA 2YU3A 2MA3A 3G1LA 1RPWA 4Y4RA 5D5WB 1G3WA 3ECHA 4GXOA 2V26A 4A3KJ 3SQNA 2XSJC 1KU3A 2PMZN 3OYDA 3CJTB 4EGZA 5JVGF 3KPHA 3R60A 1E3PA 5E3MA 4KITB 2DMTA 5LRSA 5D5VB 3PO3J 1IN6A 4BHCA 1JI8A 4HQEA 1FNNA 3PQKA 3WGGA 1P9QC 4EQQA 2EIKH 3AG2H 1EKEA 4U7DA 4Q5SF 4D7NA 2OTJI 2X4HA 4BHPA 4Q48A 5J47A 2WA0A 2DW4A 2LY2A 4E7KA 1EF4A 2NVYJ 4XORA 1VFCA 1B72A 1OQYA 1H8AC 4OIPF 1Y1VJ 4IXAA 1RUNA 2DBBA 4IKFA 3ONQA 3BR1A 1AKHB 1EH6A 5CQEA 2CJJA 1J2XA 3GVAA 4YELA 1I50J 3MZHA 3K10A 3MEXA 2G0EA 1TBXA 5EG0B 2VB6A 2BVMA 3R0AA 5GTHC 1APLC 3ZQHA 3F9KA 1OISA 4JOMA 1CGPA 1GXPA 3ZGKA 5CVIA 4A3BJ 1VQLI 3J80K 2YPRA 4NUBA 4YFXF 1MMSA 1K4TA 1Z7UA 2QSGX 2IS4A 1BOBA 2R7XA 5H6RA 2CV0A 1R1UA 3P7NA 4JX4A 4I09A 3M3YJ 1OFCX 3BY6A 1Q1VA 2QQ9A 3Q3SA 2Q8KA 3W6KB 1Y6IA 4AIDA 4IF4A 2LC2A 2NVUB 2Z9OA 3BCAA 2DLLA 2QLZA 3LFKA 3HRSA 3SFZA 1S6LA 1KONA 3LSJA 1V5EA 1MGTA 2BVLA 1MBGA 4GFBA 5CKTA 5FFXA 1WI3A 1XSVA 3NAUA 2XAQA 5FRNA 3H1CA 3BROA 1O3QA 3OYGA 3QPSA 2OCCH 3BTCA 2MLGA 2FXAA 1WRJA 2L4AA 3ZQIA 2LMDA 3D5RC 3VPRA 2W4SA 3M8FA 2DK8A 3MN2A 1E3OC 3VSKA 1JUPA 2WAFA 5HNFA 3P5JA 1MBHA 5C44J 4FT8A 3NEUA 1ETOA 2HTSA 1W36C 1FY7A 1HCRA 2GZWA 2FA5A 3KZIC 2E2HJ 2D45A 2V4JC 5DCMB 3H0DA 3ZMSA 1YW7A 3WTUC 4Y52J 1B59A 4B47A 2Q2EB 2HDCA 1YJ9I 2WB1A 5JR3A 3OYNA 1CQTA 1O3RA 4HSTA 2HEOA 4KIBA 3S16J 1CF7A 5LBQA 5EEAA 1BBYA 2ESNA 5GP9A 1TL8A 3EQLF 1U78A 4P9UA 4GDFA 1UELB 4UNOA 1L3LA 1MH3A 3CMMA 4IRIA 4RM2A 3ZMDA 5DM7F 1WZ2A 4IHXA 3F8FA 2EZLA 4XM3A 2CQQA 2JRMA 4HSRA 3GX4X 4GRIA 1HSJA 1X19A 1LVAA 3OYBA 1EH7A 2HFHA 1ZGWA 4XKCA 3BP8A 4HZFA 3OYAA 1VQKI 3QPHA 3KYLA 1OCCH 2FJ1A 4KMFA 1W5SA 2LBFA 2H1LA 2DO7A 4CYCB 2VC1A 2HOEA 1VQ9I 4XLAA 5JI6A 2HWVA 2ECBA 4I02A 3IC7A 4XQFA 1X2NA 1RUOA 5FJ8J 1X3ZB 2EJRA 1ITYA 4ENJA 3NWSA 2HQNA 4HLXA 5EEGA 4G9YA 2LF8A 1VNDA 1FMVA 2CWEA 2F5VA 1XGMA 2YR2A 3VYTB 5FLXK 1RR8C 2OA4A 5FKMA 2R7WA 3HHGA 1WGXA 3A01A 5FLVA 4H4KC 2IS2A 2DMUA 5DEQA 3KP3A 1ONVA 4IZZA 2LKSA 1PUFB 1IRXA 3WTYC 3F3XA 2BW3B 1SD4A 1K78B 2RAEA 5J6XA 4CCOA 1HSTA 3U1KA 3Q0UA 1FTTA 2AQEA 2F2EA 4UB6C 5BOXA 1K6OA 2CG4A 3FBNB 2UXXA 2E1MB 2JWTA 1SMYF 4U7BA 4E7SA 1DUXC 2GXAA 4LJZF 1OCRH 3JRFA 1MNMC 3BR5A 1Y0NA 1B72B 3OR1C 5IT3A 1XG1A 3JR9A 3MWMA 2XF6A 5E1ZB 1VZ0A 3FXRA 2QQ8A 2X48A 4NHJA 3E6DA 3KP4A 2TCTA 2KRFA 3S3MA 2F5CA 2FBKA 3K9TA 4MEYF 4B1RA 2Q1ZB 4KN4X 5FD6A 1YIJI 2XKPA 2B7EA 2IA0A 2GLOA 2CS3A 1JKPC 2HYJA 3SYTA 3E7LA 5LEKA 3V7CA 1ULYA
chains in the Genus database with same CATH topology
5IYCJ 1W0TA 3S15J 2FX0A 2KT0A 3SFIA 1JKOC 4UUTA 1B8IA 3GTKJ 4UUSA 5EDNA 5EZHA 2GBYA 2CUFA 1OCPA 2IAIA 2M2EA 1TWCJ 2R5YB 1FTZA 5J1UA 5M5WJ 2LVSA 5C4JJ 1MBEA 4MLOA 2DA2A 3IH2A 2M0CA 3UKGA 2WV1A 5EGOA 2DMNA 2XGDA 5E3LA 4IHYA 1WPKA 2EBIA 1H88C 2D5VA 4RDUA 2JJ7A 4BBRJ 5EYRA 1WCMJ 2NVXJ 4AC0A 1DU6A 3S1RJ 1IV6A 1ORKA 2XB5A 1P7IA 2Y31A 5F0FA 4B3AA 2YS9A 1POGA 3BR0A 2E2JJ 1HDDC 3BQYA 5M5YJ 4FTHA 5F04A 3GBGA 1IRZA 3JRCA 4DYRA 3LOCA 3D1NI 4M3FA 1ETVA 1JUSA 4UUSB 3O8GA 2JMWA 1GVDA 3BTIA 1NK2P 4XRSG 2VI6A 1JUMA 3FK7A 2Y30A 3ZQGA 1ZR2A 5K7FA 2DMPA 3IH4A 2K40A 2DA3A 5EGOB 2JA7J 3CDLA 2HDDA 3BR3A 2HXIA 1K83J 3FIWA 5F1JA 4XIDA 2TRTA 3OIOA 5K7ZA 4L5EA 2OF7A 3C2BA 4A3JJ 1RKTA 2K9SA 4XICA 2ID6A 2FD5A 4G12A 2KDZA 1NTCA 3ZOBA 3GTQJ 2CU7A 5F27A 3S17J 1FEXA 4FE4A 4AYBN 2VUMJ 2M34A 4FE7A 3GTOJ 1JJ6C 3TW7A 2LTPA 2XGEA 1VI0A 3CCYA 4DW6A 1ZR4A 1OCTC 4D5FA 2ME6A 1RETA 1JJ8C 5IP6A 1U8BA 3G1MA 3MKLA 4MIMA 1SANA 2MG4A 5FKLA 3LSGA 3B6AA 3S2DJ 3GTGJ 4V2FA 4QTRA 3PM1A 4FISA 3JRGA 1HLVA 1RKWA 4DZJA 3RZDJ 2IBDA 2O7OA 4S0HB 1XS9A 4C3JJ 4M3DA 2XPVA 4QSHA 2JK3A 2DJNA 2E2IJ 2ID3A 1NK3P 4A69C 1TWFJ 2LP0A 5IOZA 2Y9ZA 2AHQA 5DTDA 1JKQC 4A3CJ 3LNQA 1TWHJ 2GM4A 5M3FJ 3IV5A 5E3NA 1FJLA 4IHVA 5JLXA 1K61A 3S14J 2XPUA 2EZHA 4ABZA 3B6CA 2O9LA 2P81A 2DTZA 2MSYA 2LK2A 3HEFA 4BXXJ 3FKIJ 5GPCA 1MSFC 3H3VK 1QVUA 4I76A 3BR6A 2W48A 2WB1N 5J1YA 3GTPJ 2XSDC 1IJWC 4MFDA 2ECCA 3HBLA 4B4CA 2LD5A 2AO9A 2X9DA 1GDTA 4MO7A 3RQIA 4IEJA 4HNVA 1ETQA 5IYBJ 3HOZJ 1U9OA 2L9RA 3WHBA 2LKXA 2Y9YA 1GV5A 1MBJA 4C3HJ 4C3IJ 1LFBA 2VKVA 5J3LA 2JA6J 3A02A 2R92J 3QQAA 2DMQA 1DU0A 3PO2J 3S1NJ 4I6ZA 3ZQFA 3HOYJ 1ZQ3P 2DA5A 4LOCA 1T56A 5EZGA 3BTLA 3TP0A 4A3MJ 2LFBA 3BT9A 4A3GJ 1TC3C 1MH4A 2NVTJ 1YRNA 3OSGA 4BBSJ 5IP9J 4FCYA 5F08A 3RKQA 1B8IB 3WHCA 1GUUA 3HDDA 2IEKA 4A3IJ 4BY1J 1OJLA 3OSFA 4M3GA 3K2AA 5C4XJ 1AKHA 5HODA 2HOAA 3MVPA 3ZQCA 2NVQJ 5EF6A 2COBA 3BTJA 3JRBA 1P7JA 2DA7A 2HI3A 5EG0A 3BG3A 4DYQA 4EEFG 4W97A 3HB9A 2VPRA 4JP0A 1TWGJ 2XRLA 3G1LA 1RPWA 2MGQA 2QCOA 5IOYA 4A3KJ 4JX6A 1RESA 3HGYA 2PMZN 2O8KA 2H1KA 1QVTA 2HOTA 3GTLJ 1IGNA 5E3MA 2M9HA 1H89C 2DMTA 3PO3J 2LLKA 4C2MJ 2EH3A 1BL0A 4D7NA 3NARA 4A3DJ 3I4NJ 2LR8A 3FISA 1YRNB 1EF4A 2NVYJ 5IPAA 1VFCA 1B72A 3BG5A 3K7AJ 1H8AC 1ZK8A 1Y1VJ 3JRAA 1BJZA 1AKHB 3BR1A 1JGGA 1IDYA 2CJJA 4Y7NJ 1I50J 3FK6A 2G0EA 1FIAA 5EG0B 2Y0SN 2LY9A 1APLC 3ZQHA 2N8GA 3HKZN 3HM5A 2MW8A 2JA5J 3O8HA 1WH7A 4AUXA 4A3BJ 1VF9A 2XGCA 3JRHA 3JRDA 4JX4A 3W6VA 4A3LJ 1MBFA 3M3YJ 1OFCX 1Q1VA 2E1OA 3Q3SA 5DS9A 4JYKA 1IC8A 2VKEA 3LSJA 1ENHA 1MBGA 3BR2A 3Q0VA 4GFBA 2YU9J 1ETXA 2QF7A 2R0QC 1WI3A 3NAUA 3TEDA 1UMQA 2EZKA 3GTMJ 5FKKA 4QIWN 1QPIA 2R93J 3H0GJ 3QPSA 1ETKA 2K9QA 3BTCA 1JTXA 1TWAJ 2FQ4A 3ZQIA 2DA4A 1MSEC 5JLWA 4MFEA 3VPRA 1ETWA 3MN2A 3TW6A 1E3OC 1JUPA 2OPTA 1MBHA 2E19A 1X58A 3G1OA 5C44J 2DA1A 1ETOA 3HOVJ 1BW5A 1Z77A 3QPLA 1UG2A 1F36A 2ELKA 1I3QJ 1HCRA 1R9TJ 2E2HJ 2L7FP 1IUFA 1IG7A 2WAQN 4Y52J 4CYCA 2NOGA 2XPWA 1CQTA 1U9NA 1ZTRA 1ETYA 2NS7A 4DYCA 3JRIA 3HOWJ 2JN6A 3S16J 2ME0A 5EEAA 5GP9A 1HOMA 4X1EA 2DN0A 1U78A 3GTJJ 2HOSA 1FIPA 3S2HJ 1MH3A 2CQXA 3HOUJ 3A03A 5FKOA 4M6VA 1HF0A 4IHXA 1D5YA 3HOXJ 2H8RA 4BKXA 2EZLA 1F43A 2CQQA 1AU7A 3S1MJ 4XRMA 1A6IA 1JTYA 1GV2A 1X2MA 1WH5A 4V2GA 4NDLA 1IDZA 3IH3A 1ZGWA 1PUFA 5IP7J 4BY7J 2EQRA 1A5JA 3BQZA 3I4MJ 2FJ1A 2R5ZA 1I6HJ 1Z0XA 5K7HA 1G2HA 1ZKGA 2XB0X 2ZB9A 3JREA 4CYCB 3HGGA 1BW6A 4M3BA 5F0CA 4D5CA 2ECBA 1SFOJ 5M5XJ 2L7MP 1MBKA 2HXOA 3S1QJ 1X2NA 1BA5A 5FJ8J 4X6AJ 2Y2ZA 1ITYA 3SDGA 1O4XA 5BNGA 3BG9A 5M3MJ 1VNDA 4J19A 1GT0C 5FLMJ 4M3EA 5FKMA 3TP3A 2HQ5A 1WGXA 3A01A 1Y1WJ 4JX5A 5C3EJ 1RR7A 1W0UA 1JT0A 5FLVA 3Q0WA 2DMUA 5GPAA 1XC5A 2NS8A 5E3OA 3RZOJ 1PUFB 5IYDJ 4A3EJ 1LE8A 3SJMA 2RAEA 4XRSA 4IHWA 3LSPA 2R5ZB 2CRGA 4A3FJ 3Q0UA 1FTTA 4RBOA 1HDPA 4W1UA 5FKNA 2JWTA 2YUSA 5J1RA 2L7ZA 3CQZJ 2R5YA 2R7ZJ 1S7EA 3JRFA 2L0KA 4D7MA 2JA8J 3F0CA 1AHDP 1MNMC 3BR5A 2K9NA 1B72B 4DZPA 3LSRA 1UHSA 1XG1A 2DA6A 5F0HA 3JR9A 1JT6A 1QRYA 3L1PA 3A01B 2X48A 1LFUP 1T33A 2TCTA 3DEWA 3CMYA 3M4OJ 4B1RA 2EZIA 9ANTA 2M8GX 2CUEA 1JKRC 2X6OA 2B63J 1LE8B 3DCFA 1JKPC 2HYJA 4XK4A 2I10A 3E7LA 3OOUA 3ZQLA 2GLOA 4A93J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC J;  1W0T A;  3S15 J;  2FX0 A;  2KT0 A;  3SFI A;  1JKO C;  4UUT A;  1B8I A;  3GTK J;  4UUS A;  5EDN A;  5EZH A;  2GBY A;  2CUF A;  1OCP A;  2IAI A;  2M2E A;  1TWC J;  2R5Y B;  1FTZ A;  5J1U A;  5M5W J;  2LVS A;  5C4J J;  1MBE A;  4MLO A;  2DA2 A;  3IH2 A;  2M0C A;  3UKG A;  2WV1 A;  5EGO A;  2DMN A;  2XGD A;  5E3L A;  4IHY A;  1WPK A;  2EBI A;  1H88 C;  2D5V A;  4RDU A;  2JJ7 A;  4BBR J;  5EYR A;  1WCM J;  2NVX J;  4AC0 A;  1DU6 A;  3S1R J;  1IV6 A;  1ORK A;  2XB5 A;  1P7I A;  2Y31 A;  5F0F A;  4B3A A;  2YS9 A;  1POG A;  3BR0 A;  2E2J J;  1HDD C;  3BQY A;  5M5Y J;  4FTH A;  5F04 A;  3GBG A;  1IRZ A;  3JRC A;  4DYR A;  3LOC A;  3D1N I;  4M3F A;  1ETV A;  1JUS A;  4UUS B;  3O8G A;  2JMW A;  1GVD A;  3BTI A;  1NK2 P;  4XRS G;  2VI6 A;  1JUM A;  3FK7 A;  2Y30 A;  3ZQG A;  1ZR2 A;  5K7F A;  2DMP A;  3IH4 A;  2K40 A;  2DA3 A;  5EGO B;  2JA7 J;  3CDL A;  2HDD A;  3BR3 A;  2HXI A;  1K83 J;  3FIW A;  5F1J A;  4XID A;  2TRT A;  3OIO A;  5K7Z A;  4L5E A;  2OF7 A;  3C2B A;  4A3J J;  1RKT A;  2K9S A;  4XIC A;  2ID6 A;  2FD5 A;  4G12 A;  2KDZ A;  1NTC A;  3ZOB A;  3GTQ J;  2CU7 A;  5F27 A;  3S17 J;  1FEX A;  4FE4 A;  4AYB N;  2VUM J;  2M34 A;  4FE7 A;  3GTO J;  1JJ6 C;  3TW7 A;  2LTP A;  2XGE A;  1VI0 A;  3CCY A;  4DW6 A;  1ZR4 A;  1OCT C;  4D5F A;  2ME6 A;  1RET A;  1JJ8 C;  5IP6 A;  1U8B A;  3G1M A;  3MKL A;  4MIM A;  1SAN A;  2MG4 A;  5FKL A;  3LSG A;  3B6A A;  3S2D J;  3GTG J;  4V2F A;  4QTR A;  3PM1 A;  4FIS A;  3JRG A;  1HLV A;  1RKW A;  4DZJ A;  3RZD J;  2IBD A;  2O7O A;  4S0H B;  1XS9 A;  4C3J J;  4M3D A;  2XPV A;  4QSH A;  2JK3 A;  2DJN A;  2E2I J;  2ID3 A;  1NK3 P;  4A69 C;  1TWF J;  2LP0 A;  5IOZ A;  2Y9Z A;  2AHQ A;  5DTD A;  1JKQ C;  4A3C J;  3LNQ A;  1TWH J;  2GM4 A;  5M3F J;  3IV5 A;  5E3N A;  1FJL A;  4IHV A;  5JLX A;  1K61 A;  3S14 J;  2XPU A;  2EZH A;  4ABZ A;  3B6C A;  2O9L A;  2P81 A;  2DTZ A;  2MSY A;  2LK2 A;  3HEF A;  4BXX J;  3FKI J;  5GPC A;  1MSF C;  3H3V K;  1QVU A;  4I76 A;  3BR6 A;  2W48 A;  2WB1 N;  5J1Y A;  3GTP J;  2XSD C;  1IJW C;  4MFD A;  2ECC A;  3HBL A;  4B4C A;  2LD5 A;  2AO9 A;  2X9D A;  1GDT A;  4MO7 A;  3RQI A;  4IEJ A;  4HNV A;  1ETQ A;  5IYB J;  3HOZ J;  1U9O A;  2L9R A;  3WHB A;  2LKX A;  2Y9Y A;  1GV5 A;  1MBJ A;  4C3H J;  4C3I J;  1LFB A;  2VKV A;  5J3L A;  2JA6 J;  3A02 A;  2R92 J;  3QQA A;  2DMQ A;  1DU0 A;  3PO2 J;  3S1N J;  4I6Z A;  3ZQF A;  3HOY J;  1ZQ3 P;  2DA5 A;  4LOC A;  1T56 A;  5EZG A;  3BTL A;  3TP0 A;  4A3M J;  2LFB A;  3BT9 A;  4A3G J;  1TC3 C;  1MH4 A;  2NVT J;  1YRN A;  3OSG A;  4BBS J;  5IP9 J;  4FCY A;  5F08 A;  3RKQ A;  1B8I B;  3WHC A;  1GUU A;  3HDD A;  2IEK A;  4A3I J;  4BY1 J;  1OJL A;  3OSF A;  4M3G A;  3K2A A;  5C4X J;  1AKH A;  5HOD A;  2HOA A;  3MVP A;  3ZQC A;  2NVQ J;  5EF6 A;  2COB A;  3BTJ A;  3JRB A;  1P7J A;  2DA7 A;  2HI3 A;  5EG0 A;  3BG3 A;  4DYQ A;  4EEF G;  4W97 A;  3HB9 A;  2VPR A;  4JP0 A;  1TWG J;  2XRL A;  3G1L A;  1RPW A;  2MGQ A;  2QCO A;  5IOY A;  4A3K J;  4JX6 A;  1RES A;  3HGY A;  2PMZ N;  2O8K A;  2H1K A;  1QVT A;  2HOT A;  3GTL J;  1IGN A;  5E3M A;  2M9H A;  1H89 C;  2DMT A;  3PO3 J;  2LLK A;  4C2M J;  2EH3 A;  1BL0 A;  4D7N A;  3NAR A;  4A3D J;  3I4N J;  2LR8 A;  3FIS A;  1YRN B;  1EF4 A;  2NVY J;  5IPA A;  1VFC A;  1B72 A;  3BG5 A;  3K7A J;  1H8A C;  1ZK8 A;  1Y1V J;  3JRA A;  1BJZ A;  1AKH B;  3BR1 A;  1JGG A;  1IDY A;  2CJJ A;  4Y7N J;  1I50 J;  3FK6 A;  2G0E A;  1FIA A;  5EG0 B;  2Y0S N;  2LY9 A;  1APL C;  3ZQH A;  2N8G A;  3HKZ N;  3HM5 A;  2MW8 A;  2JA5 J;  3O8H A;  1WH7 A;  4AUX A;  4A3B J;  1VF9 A;  2XGC A;  3JRH A;  3JRD A;  4JX4 A;  3W6V A;  4A3L J;  1MBF A;  3M3Y J;  1OFC X;  1Q1V A;  2E1O A;  3Q3S A;  5DS9 A;  4JYK A;  1IC8 A;  2VKE A;  3LSJ A;  1ENH A;  1MBG A;  3BR2 A;  3Q0V A;  4GFB A;  2YU9 J;  1ETX A;  2QF7 A;  2R0Q C;  1WI3 A;  3NAU A;  3TED A;  1UMQ A;  2EZK A;  3GTM J;  5FKK A;  4QIW N;  1QPI A;  2R93 J;  3H0G J;  3QPS A;  1ETK A;  2K9Q A;  3BTC A;  1JTX A;  1TWA J;  2FQ4 A;  3ZQI A;  2DA4 A;  1MSE C;  5JLW A;  4MFE A;  3VPR A;  1ETW A;  3MN2 A;  3TW6 A;  1E3O C;  1JUP A;  2OPT A;  1MBH A;  2E19 A;  1X58 A;  3G1O A;  5C44 J;  2DA1 A;  1ETO A;  3HOV J;  1BW5 A;  1Z77 A;  3QPL A;  1UG2 A;  1F36 A;  2ELK A;  1I3Q J;  1HCR A;  1R9T J;  2E2H J;  2L7F P;  1IUF A;  1IG7 A;  2WAQ N;  4Y52 J;  4CYC A;  2NOG A;  2XPW A;  1CQT A;  1U9N A;  1ZTR A;  1ETY A;  2NS7 A;  4DYC A;  3JRI A;  3HOW J;  2JN6 A;  3S16 J;  2ME0 A;  5EEA A;  5GP9 A;  1HOM A;  4X1E A;  2DN0 A;  1U78 A;  3GTJ J;  2HOS A;  1FIP A;  3S2H J;  1MH3 A;  2CQX A;  3HOU J;  3A03 A;  5FKO A;  4M6V A;  1HF0 A;  4IHX A;  1D5Y A;  3HOX J;  2H8R A;  4BKX A;  2EZL A;  1F43 A;  2CQQ A;  1AU7 A;  3S1M J;  4XRM A;  1A6I A;  1JTY A;  1GV2 A;  1X2M A;  1WH5 A;  4V2G A;  4NDL A;  1IDZ A;  3IH3 A;  1ZGW A;  1PUF A;  5IP7 J;  4BY7 J;  2EQR A;  1A5J A;  3BQZ A;  3I4M J;  2FJ1 A;  2R5Z A;  1I6H J;  1Z0X A;  5K7H A;  1G2H A;  1ZKG A;  2XB0 X;  2ZB9 A;  3JRE A;  4CYC B;  3HGG A;  1BW6 A;  4M3B A;  5F0C A;  4D5C A;  2ECB A;  1SFO J;  5M5X J;  2L7M P;  1MBK A;  2HXO A;  3S1Q J;  1X2N A;  1BA5 A;  5FJ8 J;  4X6A J;  2Y2Z A;  1ITY A;  3SDG A;  1O4X A;  5BNG A;  3BG9 A;  5M3M J;  1VND A;  4J19 A;  1GT0 C;  5FLM J;  4M3E A;  5FKM A;  3TP3 A;  2HQ5 A;  1WGX A;  3A01 A;  1Y1W J;  4JX5 A;  5C3E J;  1RR7 A;  1W0U A;  1JT0 A;  5FLV A;  3Q0W A;  2DMU A;  5GPA A;  1XC5 A;  2NS8 A;  5E3O A;  3RZO J;  1PUF B;  5IYD J;  4A3E J;  1LE8 A;  3SJM A;  2RAE A;  4XRS A;  4IHW A;  3LSP A;  2R5Z B;  2CRG A;  4A3F J;  3Q0U A;  1FTT A;  4RBO A;  1HDP A;  4W1U A;  5FKN A;  2JWT A;  2YUS A;  5J1R A;  2L7Z A;  3CQZ J;  2R5Y A;  2R7Z J;  1S7E A;  3JRF A;  2L0K A;  4D7M A;  2JA8 J;  3F0C A;  1AHD P;  1MNM C;  3BR5 A;  2K9N A;  1B72 B;  4DZP A;  3LSR A;  1UHS A;  1XG1 A;  2DA6 A;  5F0H A;  3JR9 A;  1JT6 A;  1QRY A;  3L1P A;  3A01 B;  2X48 A;  1LFU P;  1T33 A;  2TCT A;  3DEW A;  3CMY A;  3M4O J;  4B1R A;  2EZI A;  9ANT A;  2M8G X;  2CUE A;  1JKR C;  2X6O A;  2B63 J;  1LE8 B;  3DCF A;  1JKP C;  2HYJ A;  4XK4 A;  2I10 A;  3E7L A;  3OOU A;  3ZQL A;  2GLO A;  4A93 J; 
#chains in the Genus database with same CATH topology
 2EV6 A;  3JW4 A;  1F5T A;  1FOK A;  5ILU A;  2RV8 A;  2MD0 A;  3K4L A;  2M30 A;  1JKO C;  3S93 A;  3GTK J;  4UUS A;  1V5F A;  3H35 A;  5EZH A;  5J4V A;  4UXN A;  1XSX A;  1BIB A;  2EA2 A;  5JHU A;  1OCP A;  2XAF A;  4C2T A;  3DP7 A;  1IRG A;  5J1U A;  4P5O A;  5C4J J;  1MBE A;  1F9N A;  2JRT A;  3F23 A;  1O3S A;  2DMN A;  3IL2 A;  3JSP A;  1Z67 A;  2EBI A;  2PFB A;  1R4M B;  3K4B A;  4EM2 A;  2D5V A;  2STT A;  3NRV A;  4Q4Z F;  3MQ0 A;  3T0Y A;  3CCL I;  2RQQ A;  3WTW C;  1N25 A;  1JHF A;  1Z21 A;  4II3 A;  1HC8 A;  4L18 B;  2L54 A;  2BE5 F;  2IVM A;  4B3A A;  3F8N A;  5J8F A;  1POG A;  4O5V A;  4MTD A;  2RKH A;  5FFZ A;  1K4S A;  3K4J A;  1MMG A;  2DQR A;  1IN8 A;  1NH3 A;  4EM0 B;  3OV8 A;  3CP2 A;  2YSR A;  3I54 A;  2HKX A;  3Q9S A;  3ABM H;  3LST A;  2K4B A;  3L2R A;  1DPU A;  3OYK A;  2OD5 A;  1PVE A;  3O8G A;  2VBY A;  3VYS B;  3ELK A;  3GFJ A;  3P9C A;  4DNC A;  3CF5 F;  2KMU A;  3HHH A;  2DMP A;  1V3F A;  2K40 A;  4EJO A;  4J00 A;  2DA3 A;  2D1H A;  3ABK H;  1IF1 A;  1QZY A;  3V42 A;  3G4S I;  3BR3 A;  2QQB A;  4YFK F;  3H36 A;  5F1J A;  2EB7 A;  1ZLK A;  1X4O A;  3A4C A;  3C2B A;  4B43 A;  2O5R A;  1K79 A;  4XIC A;  2ID6 A;  2FQ3 A;  3ZOB A;  3GTQ J;  5F27 A;  3DKY A;  4AYB N;  2VUM J;  1GHC A;  1IW7 F;  1MKM A;  2HU9 A;  1JJ6 C;  5DM6 F;  1YIT I;  1RIO H;  1OYY A;  2XGE A;  2Z33 A;  5ICG A;  5TJJ A;  4D0P A;  3A2K A;  2VXD A;  1X3W B;  4BJ5 C;  4GYG A;  1IO2 A;  5F64 A;  2LBF B;  2J5P A;  3LSG A;  3ZMV A;  3SZP A;  4V2F A;  4QTR A;  1HLV A;  2VXZ A;  2O7O A;  1XS9 A;  3LMM A;  3CCJ I;  4YRV A;  2Y69 H;  1D1C A;  2VKH A;  4HG2 A;  4WWC A;  3OYE A;  1BI2 A;  4AWX B;  2Q0O A;  4LLN A;  4E7L A;  1YS6 A;  1TWF J;  3FXO A;  3JCU C;  2AHQ A;  4O3M A;  1S3J A;  3KX2 A;  2GM4 A;  5M3F J;  4NQW A;  4M9S A;  1FJL A;  4XKV A;  1XGO A;  3CUO A;  1D0X A;  3LA3 A;  4ABZ A;  4XSZ F;  3EET A;  4XKW A;  3HRU A;  2QSF X;  1XPX A;  1OCZ H;  2FF4 A;  1YS7 A;  3BPV A;  4XLP F;  3H3V K;  5H20 A;  4I76 A;  5J40 A;  4RM3 A;  2DT5 A;  1TP4 A;  2PN6 A;  1E2X A;  2KFD A;  2BGC A;  3V4G A;  4IX7 A;  2GAU A;  2LD5 A;  1T0F A;  4DGW B;  4BJT A;  4EMS A;  3PFI A;  4WX9 A;  3E6B A;  2X9D A;  1ZG1 A;  3I5U A;  4IEJ A;  4CSW A;  4WXC A;  4YIR X;  1KZH A;  1U9O A;  4HLY A;  5BPD A;  3OR2 C;  3PSF A;  2H8W A;  1QGP A;  3DTK A;  1K6Y A;  1YE9 A;  1HA8 A;  3ULQ B;  3K4M A;  3K69 A;  2E1M C;  2DYS H;  3WOD F;  2VKV A;  4A0X A;  4C3I J;  4CCL A;  1MZB A;  3A02 A;  4AIJ A;  3E5Q A;  3S1N J;  3DPU A;  1REP C;  2VN2 A;  4I6Z A;  3ZQF A;  3HOY J;  3Q5F A;  3A0B C;  4LOC A;  1ACI A;  1LEA A;  1BN5 A;  4PGH A;  4KNY A;  5EZG A;  3BTL A;  1YW9 A;  1ZEL A;  3OMY A;  3GZ6 A;  4HF2 A;  2DAO A;  1M1E B;  3FXQ A;  1WI9 A;  4A3G J;  2WAQ A;  1TC3 C;  2RN7 A;  3I59 B;  2NVT J;  3ZQQ A;  5IP9 J;  5IY5 H;  3TDZ C;  3WHC A;  2HGC A;  1P6R A;  2ZFW A;  2Z3Y A;  3QYE A;  2IEK A;  1OJL A;  1VQ4 I;  2P4W A;  4KJZ A;  3OSF A;  4HRI A;  2VPL A;  1AKH A;  4FX4 A;  2BBY A;  3BPX A;  1FWZ A;  2HOA A;  4N4N B;  3ZQC A;  4RAY A;  4RGR A;  1GLN A;  2KIF A;  2DA7 A;  3DU5 A;  2K7L A;  5CVJ A;  2DFI A;  5EG0 A;  4Z6Y A;  4DYQ A;  4W97 A;  1DDN A;  1BI0 A;  2XRL A;  1KQ8 A;  3LAP A;  4ETS A;  1RES A;  2F5D A;  3LL7 A;  2PMH A;  4KT6 A;  2O8K A;  1V4R A;  2HOT A;  1QVT A;  2A6T A;  2DTR A;  1HW2 A;  1BC7 C;  3QYF A;  1EV7 A;  2VQL A;  2QSH X;  2HTJ A;  4E6K G;  2EH3 A;  2IS6 A;  3DV8 A;  3IAM 2;  2HVS A;  4NNJ A;  3T8R A;  4A3D J;  5B1A H;  3I4N J;  2LR8 A;  4ANJ A;  2ICW G;  1YRN B;  2QBY A;  2FSW A;  4FET A;  5IPA A;  1PYV A;  3BG5 A;  2E7W A;  3PSI A;  1ZGJ A;  3JRA A;  1BJZ A;  5IT9 K;  5HVQ C;  3QOE A;  1UJ8 A;  2R3S A;  3N97 A;  3VWB A;  2XF7 A;  1G8X A;  4XL9 A;  1WJE A;  3VFZ A;  4Y7N J;  3L2V A;  1I6X A;  2V6C A;  3FK6 A;  2W1O A;  2Y0S N;  2N8G A;  1G6N A;  1YTY A;  3M1C A;  3T5X A;  3H5A A;  1WH7 A;  4AUX A;  2HZT A;  5K5Q A;  1SMT A;  2GIZ A;  1VF9 A;  2XGC A;  3W2A A;  4XKB A;  4H0E A;  2VBZ A;  3CLO A;  3HSF A;  4BAC A;  1ODD A;  3W6V A;  3DLA A;  1MBF A;  2LG4 A;  1UFM A;  2E1O A;  2DFF A;  3DFG A;  1S72 I;  1LDD A;  5DCM A;  2DDB A;  2LSO A;  1TW2 A;  2K02 A;  4XOT A;  1T38 A;  1XN7 A;  3BWG A;  4RLF A;  2OBP A;  2Q2E A;  5FRM A;  4KIF A;  3BR2 A;  4R1H A;  3Q0V A;  4F92 B;  4IVN A;  1S29 A;  4KYW A;  3FMR A;  3CCE I;  2J5O A;  1ETX A;  3R4K A;  1UMQ A;  1ZN2 A;  5TGT A;  5FKK A;  3GTM J;  2D2W A;  2C6Y A;  1VQN I;  2R93 J;  2CFX A;  1PJR A;  2K9Q A;  1JTX A;  1TWA J;  1A6Q A;  1D5V A;  2QQA A;  4BHB A;  1XDU A;  1RC9 A;  3AFH A;  4YG2 F;  1ETW A;  1KA8 A;  3TOA A;  3E3V A;  5K1Y A;  3VYU B;  2LRE A;  4YFN F;  5L3G A;  3HRM A;  5J4Y A;  2E19 A;  5DCF A;  2W24 A;  4KIG A;  2DA1 A;  3LA2 A;  4ZYH A;  1BW5 A;  6PAX A;  3E1S A;  4I99 C;  2GOM A;  3QPL A;  1F36 A;  3DPT A;  1I3Q J;  4U0V A;  1WJF A;  1R9T J;  4NQW B;  1R4N B;  2XDV A;  3K4K A;  2L7F P;  4PJL A;  3DF8 A;  2G9W A;  4BQO A;  1U2W A;  3TBI A;  4CYC A;  3TL4 X;  1YG2 A;  2DT7 B;  2MAB A;  4P9F A;  3DBR B;  4G7O F;  2XPW A;  2DPD A;  2XF5 A;  3CME I;  4OAY A;  4XLN F;  1G3S A;  2E36 A;  1BR4 A;  3JRI A;  3HOW J;  2JN6 A;  2RNG A;  3R6S A;  2ME0 A;  4HA8 A;  1WJA A;  4CIC A;  3MZ8 A;  1HOM A;  2DOE A;  4X1E A;  3FMQ A;  4HEA 2;  3GTJ J;  1TNS A;  4PK4 A;  4KMU X;  1XMA A;  3H9Q A;  2CQX A;  3A03 A;  1YYV A;  4BUP A;  1D5Y A;  2DOA A;  1IZ1 A;  3KZZ A;  5HLT A;  4BU2 A;  3WU1 B;  3HOX J;  1F43 A;  3LWF A;  2LY1 A;  1AU7 A;  2FOK A;  2E7X A;  3ESW B;  3RJP A;  4FHT A;  1A6I A;  1X2M A;  2OC6 A;  2QYO A;  4V2G A;  3SEZ A;  4AM3 A;  3DEE A;  3IH3 A;  1PUF A;  2ACJ A;  1KU2 A;  3BJA A;  4OIN F;  3MMY B;  2EQR A;  4RB0 A;  2V9V A;  1K78 A;  1A5J A;  2QKM B;  3IUO A;  3OL3 A;  4Y15 A;  1SFX A;  3ZP5 A;  2OQR A;  2RRE A;  4F52 A;  5K7H A;  1G2H A;  2HQR A;  2ZB9 A;  2R7O A;  3K4N A;  4OU0 A;  4D5C A;  2XAJ A;  1Z6T A;  5EEH A;  1VQ7 I;  5HS9 A;  5BS6 A;  1T6S A;  1MBK A;  2HXO A;  2W00 A;  3HPG A;  3D5L A;  4I0A A;  3S1Q J;  2Y0M A;  3ZXS A;  2Y2Z A;  3L2Q A;  3SDG A;  3DXJ F;  4LG0 A;  3BC8 A;  3ERM A;  5M3M J;  3K4C A;  3FXJ A;  3J80 Z;  2EIM H;  5L3B A;  4J19 A;  4BAY A;  2KLO A;  3DU6 A;  3CMA I;  1GT0 C;  2HQ5 A;  2M1B A;  3K70 D;  1Y1W J;  2O03 A;  2L01 A;  5C3E J;  1W0U A;  1I39 A;  1JT0 A;  1KU9 A;  2P5K A;  4MGR A;  1UST A;  5GPA A;  1XC5 A;  4A6D A;  1F4K A;  1YFH A;  3DWL E;  1HKS A;  3QOP A;  4RS8 A;  3U21 A;  4LLG F;  3VB2 A;  4EV0 A;  3FBI B;  3I9V 2;  3S32 A;  2ZME B;  2G7U A;  1X1A A;  2KJB A;  1FP1 D;  1P4A A;  2R7R A;  2LF7 A;  3HUG B;  3LSP A;  2R5Z B;  2CRG A;  3IP4 B;  3UNG C;  4EJV A;  1XD7 A;  3O3K A;  1MJ9 A;  3IWZ A;  3AKZ A;  4ITV A;  2DPU A;  3JTG A;  5JFR A;  5FKN A;  4CZZ A;  1YO5 C;  2NAZ A;  5LGN A;  3ZN0 A;  4MQV A;  5HLH A;  5J1R A;  1FYL A;  3CQZ J;  1YI2 I;  5E8I A;  1XGN A;  3CC7 I;  1FLI A;  2EK5 A;  1S7E A;  2L0K A;  3F0C A;  1AHD P;  2QBY B;  3CC4 I;  3SDB A;  4KFC A;  2K9N A;  3FHN A;  2H6B A;  1UHS A;  3LSR A;  2OUM A;  3QYB A;  1D3Y A;  1JT6 A;  4ENK A;  1QRY A;  4EGY A;  2WAE A;  4ZJZ A;  2RQP A;  3C2G A;  2Z2S B;  4E7H A;  2KZG A;  1B9N A;  2DJI A;  2FBI A;  1T33 A;  4ZTJ A;  3DEW A;  3PNY A;  2PJR B;  2R7T A;  5KK1 A;  1JKR C;  2X6O A;  5B66 C;  4L0Z B;  1SAX A;  2B63 J;  1LE8 B;  3H3Z A;  4I2O A;  1IRF A;  2UWM A;  2KIQ A;  2E34 A;  1D1B A;  1WHU A;  3OY9 A;  3PJR A;  1R36 A;  2IXS A;  4U88 A;  4UV8 A;  4LIV A;  4KDP A;  1W0T A;  3RKX A;  4UUV A;  2KT0 A;  3CTA A;  3SFI A;  2TDX A;  1QHG A;  5EDN A;  3PNV A;  2CUF A;  2IAI A;  4I0B A;  1TWC J;  4CGZ A;  5H2F C;  1FBS A;  1A04 A;  2CQ7 A;  2HR3 A;  1W7P B;  3BJO A;  1Z3X A;  2VIX A;  2XIG A;  2M0C A;  3UKG A;  3OYJ A;  1TLH B;  1YX5 A;  3QOD A;  4LFU A;  4IHY A;  1X1B A;  4CO8 A;  2VJJ A;  1G3Y A;  4CUG A;  3DPL C;  4L9V A;  1R00 A;  3OYI A;  3HYI A;  4A6E A;  2JJ7 A;  3VOE A;  2IGK A;  5EYR A;  2A3S A;  3L7W A;  2A6E F;  1Y39 A;  4AC0 A;  4BS9 A;  1DU6 A;  1USS A;  3FXU A;  1IV6 A;  4KA4 A;  3AL0 B;  1ORK A;  3N4M A;  2A05 A;  3T1B A;  2Y31 A;  4BEH B;  5ERI A;  2BV6 A;  2A69 F;  2E2J J;  1UAA A;  1PP7 U;  2HVQ A;  4IJA A;  4LB6 B;  4MEX F;  1D8J A;  3PIP F;  5F04 A;  5KVR A;  4KT5 C;  1IRZ A;  4L5I A;  4DYR A;  3ASO H;  3D1N I;  4M3F A;  1PP8 F;  5FLX Z;  3WGI A;  1JUS A;  2NNN A;  2JMW A;  1N77 A;  4UY8 I;  2JSP A;  3BTI A;  2M87 A;  2EFN A;  3H9G A;  4C30 A;  1MNE A;  3IAS 2;  4OIR F;  4MNU A;  4QWQ A;  1ZR2 A;  1S9H A;  4G8X A;  4PSW A;  3LSI A;  1BR2 A;  5EGO B;  2EV0 A;  2HDD A;  1IN5 A;  1OCO H;  1JHH A;  3FIW A;  4C2U A;  3BZC A;  3E6M A;  2WC2 A;  5K7Z A;  1O7L A;  2FMY A;  4L5E A;  3M8E A;  1RKT A;  2K9S A;  3S17 J;  3EYY A;  4G12 A;  2KDZ A;  1FEX A;  3ML6 A;  2CW7 A;  4FE4 A;  2M34 A;  3CF2 A;  3DBH B;  4X0G A;  4CZC A;  2DT6 A;  2P5L C;  2LTP A;  4ESJ A;  2HNH A;  1W5C C;  4DW6 A;  2NS0 A;  4LG3 A;  1OCT C;  4D5F A;  1T0F C;  2PMZ A;  3VDX A;  4LK1 F;  4BE0 A;  3MKL A;  3KLN A;  1SAN A;  5KHD A;  4WXD A;  4CYD A;  1FPQ A;  3GTG J;  2CUJ A;  3HZJ A;  3S8P A;  4D9J A;  5GAH J;  1IUY A;  1BOA A;  2ISY A;  2JPC A;  1SD6 A;  3JRG A;  2W7N A;  4F91 B;  1QZE A;  3W6J B;  2IBD A;  5AIP A;  4S0H B;  5GAE J;  3RZD J;  1FBU A;  2K9M A;  4M3D A;  4F55 A;  1STZ A;  4MQ9 F;  3RPQ A;  1LPQ A;  2DJN A;  3EUH A;  4LG0 B;  3GF2 A;  4PUS A;  4A69 C;  2ZCW A;  3WG7 H;  4AIK A;  3FXL A;  5D4S A;  2V6E A;  3I58 A;  2W57 A;  2Y9Z A;  2MC4 A;  2PG4 A;  5DTD A;  3TKY A;  3C2H A;  1BC8 C;  1NG6 A;  3IV5 A;  2Z99 A;  3KCC A;  1W4M A;  3OS2 A;  1Y8R B;  4IHV A;  2HDW A;  4ZYD A;  2DDA A;  4U0Y A;  1A31 A;  3S14 J;  2XHK A;  2XPU A;  4HQM A;  1IN4 A;  1P2F A;  4K2E A;  2MSY A;  4ON0 A;  5K5O A;  3HEF A;  3SZT A;  3Q9V A;  3FKI J;  3BR6 A;  1N75 A;  4B8X A;  5HOO A;  3MKZ A;  3CCU I;  3WU0 A;  4IO9 F;  4MFD A;  1MJA A;  3HJE A;  1T98 A;  3I59 A;  1BM9 A;  2IGM A;  3HBL A;  2BZT A;  3H92 A;  4UV9 A;  3FMS A;  2ZME C;  2E1C A;  3ABU A;  2ISZ A;  3G71 I;  3RI4 A;  1R23 A;  2QZ8 A;  2Z5U A;  3ASN H;  1GDT A;  1KGS A;  2VLA A;  3RQI A;  2JQ7 A;  2CYY A;  5FGM A;  3RPU D;  1SFE A;  5A2Q K;  3SHF A;  4E7I A;  1YX3 A;  4P55 A;  2L9R A;  2V9K A;  3WHB A;  4BE1 A;  2LKX A;  2BY2 A;  3GWZ A;  4C3H J;  3CO7 C;  1LFB A;  4IOA F;  5JVT A;  3QQA A;  1OKR A;  4ZZD A;  1J7K A;  1LB2 A;  5ILV A;  5L3D A;  2LNB A;  1R1V A;  3V8L A;  2E5Z A;  4UVA A;  4RB3 C;  2BOL A;  2EA4 A;  4A3M J;  4AIH A;  1IV8 A;  4HX8 A;  4ESF A;  4G7H F;  4CCK A;  1EA3 A;  1WWX A;  1YRN A;  3OSG A;  1BI1 A;  3GZ5 A;  5F08 A;  5DUI A;  3I64 A;  1PDN C;  1LDK B;  5HLI A;  2O0Y A;  4HNT A;  5DD4 A;  4AD9 A;  5D8K B;  5JHF A;  1BIA A;  3MVP A;  2ELH A;  1O3T A;  1ZGA A;  2DCE A;  2FBH A;  2NVQ J;  3U1D A;  2IT0 A;  2OU2 A;  1P7J A;  2EPF A;  4LGW A;  1H9T A;  1Z3Y A;  3BG3 A;  4B09 A;  2VKD A;  3HB9 A;  2L02 A;  3P9I A;  4CDG A;  1TWG J;  2KRH A;  4JX6 A;  3HGY A;  4WF2 A;  4NC8 A;  4HAM A;  3VYR B;  4XLC A;  2M9H A;  2RDP A;  3DLL F;  1TW3 A;  1H89 C;  1FMW A;  3RKW A;  1WJ5 A;  2LLK A;  5DDG A;  4C2M J;  3HC7 A;  1BL0 A;  3QU6 A;  3K2Z A;  1W36 D;  1ON1 A;  2CGP A;  3NAR A;  3PUF A;  4J01 A;  3AL0 C;  3K7A J;  3CJQ B;  1JGG A;  1IDY A;  3DBL B;  4OMY A;  5D6F A;  1I1G A;  4L5J A;  1WVR A;  2DYR H;  2GQQ A;  3MAJ A;  2K3F A;  3OIQ A;  4F93 B;  2MLK A;  2UZK A;  2ZO4 A;  3S2W A;  2STW A;  1MD0 A;  3E5U A;  3GEZ A;  2QEN A;  2K86 A;  1YIO A;  3HKZ N;  1L0O C;  1J75 A;  2MW8 A;  3TO6 A;  3O8H A;  4YIF A;  5E17 F;  1YW8 A;  2LRD A;  4RA2 A;  2CMP A;  1IXR C;  4A3L J;  2QEX I;  3FDY A;  5DS9 A;  4NBQ A;  2L7K A;  4JYK A;  1R22 A;  1WFX A;  3V8K A;  3RIR A;  4RMN A;  2A61 A;  3MCZ A;  2L5Q A;  2VKE A;  2P6T A;  1KQ9 A;  1ENH A;  2P6S A;  4IQJ A;  2ZXH A;  1LQ1 A;  4PJJ A;  2YU9 J;  1TZL A;  2QF7 A;  3TED A;  4JBA A;  3OOP A;  2WY7 Q;  1ETK A;  2X1C A;  3H3U A;  2DU9 A;  2M8E A;  3I55 I;  1EH8 A;  4U0W A;  3ZMZ A;  5LLQ A;  2VQC A;  2FU4 A;  3PQJ A;  2DA4 A;  3RYP A;  5JLW A;  4MFE A;  2MYS A;  2GA1 A;  2FML A;  4KIS A;  2IJL A;  5AON A;  1FYK A;  4N9I A;  3I4P A;  2L9N A;  1UHM A;  5K5R A;  1UCR A;  2ZSH B;  2VJ4 A;  4HX4 A;  3G1O A;  4ZYA A;  2HYF A;  2UUZ A;  4IL6 C;  2K3P A;  3HOV J;  3QPT A;  1WQ2 A;  1Z77 A;  2COM A;  5ED4 A;  4IOC F;  2M0M A;  4G6Q A;  2A5W A;  3L9F A;  5FB2 A;  1IUF A;  1IXS B;  3KE2 A;  1V55 H;  1IG7 A;  2CQN A;  2GIV A;  3U9G A;  1TTY A;  3K6G A;  1MDM B;  3F6O A;  4BH9 A;  2ZBK A;  2D1V A;  4MHG A;  2CW8 A;  1U9N A;  1ZTR A;  1Z6R A;  3W3C A;  1ETY A;  2NS7 A;  4GGG A;  3HG9 A;  2AS5 F;  3O2P E;  1LEB A;  4N9H A;  4IHT A;  3BJ6 A;  2GXB A;  3FXM A;  2HOS A;  1FIP A;  4CCM A;  3PFY A;  3S2H J;  4EJT A;  3HOU J;  4M6V A;  4BE2 A;  1MJB A;  1GVJ A;  5KNL A;  3WGH A;  3GW2 A;  3UR3 C;  3E5X A;  2JUG A;  3BLY A;  4XRM A;  3VEP A;  1WH5 A;  3BOQ A;  2UV1 A;  4L9J A;  1B1B A;  1IDZ A;  4BXF A;  2ZME A;  5HS7 A;  1IAW A;  4CHU A;  3WTV C;  3GLX A;  3GME A;  3HUG A;  2R5Z A;  4Y3O A;  1FX7 A;  4Z2Y A;  3CP8 A;  1AA7 A;  2NOJ B;  1FOY A;  2XB0 X;  1U5T B;  3NWT A;  2WV0 A;  4AVP A;  3HGG A;  4M3B A;  3WTX C;  3L2W A;  4E7J A;  5IT9 Z;  2IA2 A;  2HS5 A;  2ZC2 A;  1B9M A;  4WXH A;  2BY1 A;  4R8H A;  1MIJ A;  1BA5 A;  3PIO F;  5D5U B;  1FBQ A;  1BJA A;  3KEO A;  4X6A J;  3ZR8 X;  1O4X A;  3BG9 A;  1XB4 A;  2JSC A;  3CCR I;  2ZJR F;  2VOP A;  2X1D A;  3T8T A;  2M45 A;  1G4D A;  2XAS A;  3M1E A;  5FLM J;  2P7V B;  3FHZ A;  3K0L A;  3ROU A;  4M3E A;  3TP3 A;  2ADU A;  4JX5 A;  2QKL B;  4XLH A;  2JTV A;  1D1A A;  5CPR B;  5GTI C;  4YII A;  5FRO A;  3KP5 A;  3HL2 A;  2A6H F;  2H09 A;  5E3O A;  1U8R A;  2PJR A;  3RZO J;  3CCV I;  1VQM I;  1LE8 A;  1V54 H;  3QRF F;  4S04 A;  1OPC A;  4AYB A;  3LA7 A;  4XRS A;  2W85 A;  3I0T A;  2L9S A;  4A3F J;  5HLG A;  3TOB A;  3F22 A;  3F6V A;  4LLL A;  2VC0 A;  3KFW X;  4PGG A;  4TV7 A;  2JPB A;  4RBO A;  4L9T A;  1KU7 A;  1HDP A;  4W1U A;  5EJC A;  1Y56 A;  4HBL A;  2IGN A;  1HW5 A;  4EJU A;  2L7Z A;  3LSH A;  2EFW A;  3ZRG A;  2R7Z J;  2DQL A;  1W7P A;  1OR7 A;  3NQO A;  2BXZ A;  4PZJ A;  5D8L B;  3I56 I;  2JVG A;  2IRF G;  3N05 A;  4DZP A;  5F0H A;  1FOX A;  2A5Y B;  2DA6 A;  4IPA A;  1J09 A;  2CV2 A;  3LSK A;  3L1P A;  3COA C;  2YX7 A;  2V9P A;  2VE8 A;  2OV7 A;  4EM1 A;  1LFU P;  5HDG A;  2GWR A;  4HDU A;  3CMY A;  3M4O J;  3I53 A;  3HSE A;  9ANT A;  2M8G X;  5GAG J;  3JAM K;  2CUE A;  2X1E A;  3F72 A;  1RI7 A;  3DCF A;  4XRF A;  2KP6 A;  4BEH A;  2OCE A;  2I10 A;  3E97 A;  4DJA A;  3OWT A;  2O8X A;  4BDY A;  5CVU A;  4A93 J;  3HIF A;  4PFP A;  1DP7 P;  2EFO A;  3S15 J;  3QWL A;  4GO1 A;  4IRH A;  3J7A Y;  2EWN A;  3KYC B;  1B8I A;  2DXI A;  2PQ8 A;  3CC2 I;  4CCN A;  3KP6 A;  2GBY A;  3FF5 A;  5L3F A;  5FD5 A;  2R5Y B;  1FTZ A;  3R0J A;  4DIQ A;  1P4W A;  1TQI A;  2VE9 A;  5M5W J;  2LVS A;  2DA2 A;  3L2C A;  4E70 A;  2VL8 A;  3CCM I;  5EGO A;  4LK0 F;  3HOT A;  4HPQ A;  5E3L A;  2QA4 I;  4OOI A;  1VQ5 I;  1FP2 A;  2NNY A;  3J81 K;  2MD5 A;  1DGW Y;  3B02 A;  1GXQ A;  3WTZ A;  2XAU A;  2PEX A;  1ERD A;  3S1R J;  4F7Z A;  3CUQ B;  3AG3 H;  1P7I A;  4XNF A;  5F0F A;  1X1C A;  2RNJ A;  3EUK L;  4LD5 A;  1SVM A;  2YS9 A;  3AAF A;  1LKX A;  2B0L A;  4M74 A;  4DOZ A;  3M7G A;  3BQY A;  2OTL I;  5M5Y J;  1N78 A;  4MTE A;  5HDK A;  5LD2 C;  4RAZ A;  3GBG A;  3JRC A;  5BQT A;  3C7J A;  3EUH C;  1HW1 A;  1GVD A;  3GYH X;  3C18 A;  1BI3 A;  4XRS G;  5TRD A;  2VI6 A;  3HXL A;  3ZQG A;  5LGT A;  4NC6 A;  3IH4 A;  3HTS B;  2X0L A;  1R5I D;  2HXI A;  2DFE A;  1K83 J;  3KIO A;  4XID A;  3OIO A;  1LVK A;  2CUZ A;  2O6G E;  4HDV A;  1P4X A;  4A3J J;  2FEZ A;  4CXF A;  3KET A;  4OWR B;  3JSO A;  2HKO A;  2X6X A;  4N4O B;  4S05 A;  2FD5 A;  2QVO A;  2W82 A;  1E0E A;  2KQR A;  2F4O B;  3ZCO A;  4ASN A;  5E1X A;  3GTO J;  3TW7 A;  1VI0 A;  3OYF A;  5E1W A;  1TQM A;  1W1W E;  1ON2 A;  3KYD B;  3OL4 A;  1YOV B;  4ZC3 A;  2BXY A;  1AWC A;  1JJ8 C;  5IP6 A;  2ESH A;  5L3C A;  2R7V A;  2G7H A;  2ZFU A;  3G1M A;  2ZJ2 A;  1U8B A;  1R49 A;  1B6A A;  2WY8 Q;  2KL4 A;  4GCV A;  3B73 A;  3S2D J;  2AXL A;  3BG6 A;  2IP2 A;  1SC7 A;  2KDO A;  4FIS A;  4JQF A;  2RC4 A;  4ZYE A;  3RCO A;  1I5Z A;  3EUA A;  2EIN H;  2CFO A;  2I8D A;  2R7F A;  2XPV A;  4QSH A;  5KCM A;  3V8J A;  2JK3 A;  1Y0U A;  1XX5 A;  2XKO A;  2ZSI B;  1HKQ A;  2O3F A;  3V7R A;  4I98 B;  2XV4 S;  5B3S H;  1U5T C;  1XCB A;  1HBX G;  2LP0 A;  4A5N A;  2JUC A;  1LJ9 A;  2PX9 A;  1FZP B;  1JKQ C;  4A3C J;  3LNQ A;  2VQH A;  3HSR A;  2QWW A;  2Y0S A;  4IRG A;  1TWH J;  3OIP A;  5E3N A;  2K5C A;  3L00 A;  4CCJ A;  1U0J A;  4ZH4 F;  4XSX F;  2EZH A;  5ILS A;  1H0M A;  2H27 A;  3B6C A;  3W2W A;  2O9L A;  2FE3 A;  4BXX J;  3EPZ A;  5GPC A;  1T95 A;  1ZG3 A;  2DOF A;  1QVU A;  4G7Z F;  2XRN A;  3GTP J;  2LKP A;  2XSD C;  3M8J A;  2DK5 A;  2XGX A;  2M4K A;  2NXN B;  3WE2 A;  2XAH A;  4XN3 A;  2AO9 A;  3MFK A;  2MH2 A;  2P5V A;  1FSH A;  3WTS C;  4MO7 A;  1QO0 D;  2X6Y A;  4NB5 A;  3H5R A;  2ZJQ F;  1YJN I;  1QBJ A;  2L2O A;  4Q47 A;  1RZ4 A;  5J8C A;  3ZPL A;  4M73 A;  5BPI A;  3S3N A;  3RDI A;  5J3L A;  1VTN C;  2JA6 J;  3LQQ A;  3PO2 J;  1MND A;  1HXD A;  3GFI A;  3FWE A;  1B4A A;  2DA5 A;  1U3E M;  2EFP A;  4HYE A;  2V1N A;  3KLO A;  1IXC A;  2BY3 A;  4A12 A;  4EVI A;  3TP0 A;  1ZG5 A;  2VT3 A;  1D0Y A;  2LFB A;  3QAH A;  2XC7 A;  3BT9 A;  5F6F A;  4G6D A;  3IRR A;  1DP3 A;  3I3L A;  5KAI C;  4BBS J;  4FCY A;  2ZJP F;  3RKQ A;  1B8I B;  3IHU A;  5DYM A;  4KN7 X;  1GUU A;  5CJ9 A;  4A3I J;  1UHW A;  1QNT A;  3PL8 A;  4PDK A;  4BDZ A;  4BY1 J;  2MC3 A;  2Y75 A;  1SVO A;  3KP2 A;  4BQA A;  5EF6 A;  3BTJ A;  3JRB A;  3OS1 A;  2Y48 A;  3K1M A;  3VOD A;  2IA1 A;  3HRT A;  3KEY A;  3GLL A;  1C0W A;  1HKT A;  2R4G A;  3BCB A;  2VPR A;  1QU3 A;  4JP0 A;  3KEQ A;  1YQA A;  2MGQ A;  2QCO A;  3FZV A;  5IOY A;  2CW0 F;  4HW0 A;  2UXN A;  2M7B A;  2H1K A;  3GTL J;  2WWY A;  5HS8 A;  1IGN A;  3LSM A;  2V1D A;  3DTE A;  2K9L A;  4UVB A;  3PNT A;  4UB8 C;  2JA2 A;  2QGU A;  3GZN B;  5CQG A;  3FIS A;  4QPQ A;  3G73 A;  2OZU A;  2OZ6 A;  3CUQ C;  1S5L C;  2E35 A;  1MMA A;  3R61 A;  1ZK8 A;  3IRQ A;  4ZYG A;  2PI0 A;  2KIS A;  4HF1 A;  1FOW A;  4XON A;  3BZK A;  4L0Y B;  1V5G A;  1TNT A;  5H6Q A;  1FIA A;  2R7S A;  3FXK A;  2LY9 A;  1ZRF A;  1TQP A;  1WKM A;  3HM5 A;  3LAJ A;  4I7H A;  3O6B B;  2JA5 J;  1XMX A;  4KUM A;  2PJP A;  3L2U A;  2VBX A;  3GFM A;  1O57 A;  3KP7 A;  2A68 F;  3JRD A;  1QQI A;  3JRH A;  2DOD A;  4OIQ F;  4M6Y A;  2BYV E;  4UVC A;  1X3U A;  2L3D A;  4HV5 A;  1J9I A;  2K4J A;  1MDM A;  1IC8 A;  1R5G A;  2BHY A;  5A2Q Z;  1R7J A;  4XLF A;  1RRJ A;  2VQG A;  2AXT C;  4HNU A;  4CH7 A;  1QPM A;  1Y8Q B;  3AG1 H;  4AU7 A;  1I27 A;  2R0Q C;  2EZK A;  5E79 C;  3CZ6 A;  4QIW N;  1QPI A;  3H0G J;  4RB1 A;  3WG9 A;  2F5F A;  3FM5 A;  4ESB A;  4OMZ A;  1XDS A;  2FQ4 A;  1KQ0 A;  2E1N A;  2ZKZ A;  1MSE C;  3RPU A;  2WTE A;  2IGO A;  2XUB A;  4E4H A;  2HVR A;  1WSU A;  4XBF A;  1SVL A;  3TW6 A;  5B5E C;  3OYM A;  4XMY A;  3OYC A;  1DGR M;  2OPT A;  1ZH5 A;  1X58 A;  2P0W A;  1QZZ A;  1IN7 A;  2WAD A;  4EJW A;  3OYL A;  3ISP A;  2RVC A;  3RKY A;  3RQ4 A;  1WJD A;  1UG2 A;  2ELK A;  3E6C C;  5CVV A;  1UZC A;  2YX4 A;  2OAZ A;  2B9S A;  1S7A A;  4PJM A;  1ZHF A;  1U5T A;  2WAQ N;  1YJW I;  2W25 A;  2NOG A;  1T39 A;  1XGS A;  2X6W A;  4ENM A;  2DI3 A;  5E20 A;  3RYR A;  1LNW A;  3A0H C;  5BMZ A;  4DYC A;  2FNP A;  3KZY A;  4EAT A;  4JK1 X;  3M9A A;  5E8G A;  3TGN A;  2VJ5 A;  2DN0 A;  2MH9 A;  3GCM A;  3LQR A;  2IW5 A;  5FKO A;  3PUB A;  1K7A A;  2H6C A;  3CCQ I;  1HF0 A;  2H8R A;  3SEQ A;  4BKX A;  2P7C B;  2OQG A;  3FM3 A;  3I71 A;  4ZTF A;  1VQO I;  5F1R A;  2E60 A;  3S1M J;  3RTR A;  1JTY A;  1GV2 A;  1T2K A;  4M6X A;  2CH0 A;  4NDL A;  4PCQ A;  3MKW B;  4B3X A;  4E7Z A;  2BY0 A;  3F8M A;  3DTI A;  5IP7 J;  4BY7 J;  5ICC A;  3BQZ A;  1LUJ B;  2VOO A;  1MMN A;  3I4M J;  2HQA A;  1I6H J;  1Z0X A;  2BHZ A;  1ZKG A;  4Y13 A;  1OR7 C;  2QM3 A;  3JRE A;  4RAG A;  1BW6 A;  2VON A;  3P9K A;  1EJ9 A;  4N0B A;  5LHI A;  5F0C A;  2HPM A;  1XSD A;  4RGS A;  1SFO J;  3GXO A;  5M5X J;  2L7M P;  3EDP A;  2ZNY A;  2MFZ A;  2DFH A;  3IKV A;  2FRH A;  1CF7 B;  3F21 A;  3QU3 A;  5BNG A;  3QP6 A;  2F4I A;  2EIL H;  2QUF A;  3ERE D;  3BZ6 A;  2FNA A;  3ZN1 A;  4P1W A;  1QHH D;  2ZXI A;  3ECO A;  2FOW A;  4WK8 F;  1RR7 A;  4XN0 A;  3Q0W A;  2V1U A;  3SZG A;  2F48 A;  4Y17 A;  3OS0 A;  1JE8 A;  2L9V A;  2VAS A;  2NRA C;  2NS8 A;  4RGU A;  3D0S A;  1I1S A;  2R7D A;  3TDU C;  4NC7 A;  5IYD J;  4A3E J;  4A5M A;  2W84 A;  5HDN A;  2F4M B;  1T8I A;  3REO A;  3SJM A;  2F5E A;  1QA6 A;  2AQF A;  1T08 B;  4BQN A;  2GA2 A;  5D4R A;  4IHW A;  5KAF C;  3TMO A;  3W2V A;  4R79 A;  4P96 A;  3M07 A;  1R1T A;  3H5N A;  4ZDP A;  2BEO A;  3DEU A;  4ENN A;  2P8T A;  2VT2 A;  5HNH A;  2YUS A;  2R5Y A;  2XAG A;  2H94 A;  1W5T A;  4OAZ A;  4D7M A;  2JA8 J;  4ZDO A;  1HQC A;  1UG0 A;  3HPH A;  4PJN A;  3FKJ A;  2JZY A;  2WBM A;  3SXY A;  1X1P A;  4RB2 C;  3A01 B;  2CV1 A;  1D8K A;  3CJN A;  1X4P A;  4BNC A;  3AG4 H;  2KIU A;  2EZI A;  3CDH A;  2E71 A;  4BXU A;  3H9J A;  4LIU A;  2LH9 A;  4CA0 A;  3S3O A;  3CUQ A;  3MD2 A;  1ZRD A;  1Z91 A;  1D0Z A;  2HPI A;  5CVR A;  2M5W A;  4XK4 A;  3OOU A;  4PJ0 C;  3GFL A;  3ZQL A;  4KIC A;  5E18 F;  2XRO A;  3ZMT A;  5IYC J;  3MZY A;  3FX3 A;  2FX0 A;  4RGX A;  4IQ4 A;  2NYX A;  4UUT A;  1R5H A;  3HOS A;  4G6T B;  1H9G A;  5LFA A;  2R7Q A;  3F8B A;  1VQ8 I;  5AIQ A;  4WCG A;  1ZAR A;  2RGV A;  2M2E A;  3K70 C;  1ZAO A;  1J0R A;  4Y33 A;  1RNL A;  4MLO A;  3F8C A;  3IH2 A;  2CQK A;  2KIM A;  2WV1 A;  3BDD A;  2XGD A;  4BYY A;  3G6E I;  4RAF A;  1WPK A;  1H88 C;  2V79 A;  2M4G A;  4RDU A;  1JGS A;  4GYI A;  1X1D A;  5TIS C;  1TT0 A;  4BBR J;  4XOP A;  1WCM J;  2NVX J;  1ZYR F;  5DUK A;  2EFQ A;  2I5U A;  2XB5 A;  1OYI A;  1BR1 A;  1G59 A;  3U2R A;  5LGU A;  1WJC A;  3BR0 A;  1HDD C;  3GO5 A;  1AOY A;  1KYW A;  4DBQ A;  4FTH A;  4PSX A;  4IHS A;  2KZV A;  3IWF A;  1KYZ A;  3LOC A;  4A2U A;  2F6C A;  1MW7 A;  2K85 A;  4LB5 A;  1ETV A;  4UUS B;  2KRC A;  2LOO A;  2Z16 A;  3VSL A;  3C1D A;  5ICF A;  1NK2 P;  5DD8 A;  1JUM A;  3FK7 A;  1Q1H A;  2Y30 A;  5K7F A;  1TT5 B;  1U6G A;  2JA7 J;  3CDL A;  1PUE E;  1J59 A;  1Z9C A;  1YHQ I;  1NHA A;  2TRT A;  3ABT A;  1JXS A;  1LDJ A;  2L4M A;  2OF7 A;  1E17 A;  4UHT A;  1P92 A;  1SFK A;  2LDU A;  3DKX A;  4FX0 A;  4LIT A;  4B44 A;  1NTC A;  2CU7 A;  1F1Z A;  3E0J B;  4FE7 A;  3CJR B;  4U87 A;  3TO7 A;  5D5X B;  1FYM A;  1LFP A;  3CES A;  3CCY A;  2KHM A;  1S8N A;  1ZR4 A;  1XTA A;  2M3A A;  3J7Z I;  4I01 A;  2OJE D;  1SD5 A;  2KJC A;  2ME6 A;  5L3E A;  5GAD J;  1RET A;  2KPM A;  2X85 A;  4ZZL A;  2O61 A;  5ICE A;  2ZNZ A;  4MIM A;  4F3Q A;  3V7S A;  4OIO F;  1ZLJ A;  2MG4 A;  5FKL A;  3B6A A;  3J7A O;  4YEJ A;  1VQ6 I;  4LMY A;  3C3W A;  3PM1 A;  2PLY A;  2LYC A;  1RKW A;  4DZJ A;  4DQ2 A;  3JAM Z;  4C3J J;  4HOB A;  5LEJ A;  1OMI A;  3CO6 C;  2VOD A;  3QP5 A;  2E2I J;  2ID3 A;  4G94 A;  1SFU A;  1NK3 P;  5CLS A;  3J7Y J;  4QPO A;  5B1B H;  1NG7 A;  4M9Z A;  5IOZ A;  4BL0 B;  3ZQ7 A;  1S7O A;  3L09 A;  1I3A A;  1FT9 A;  3MKY B;  3DKW A;  3X2Q H;  1DQU A;  1J5Y A;  2M7A A;  2K27 A;  2A07 F;  2JVH A;  3HKZ A;  1XMK A;  4HX7 A;  5JLX A;  2PBI A;  3TQN A;  1K61 A;  2CSO A;  3TO9 A;  4FQG A;  3DQV C;  2XVC A;  4M9X A;  3RSN A;  2P81 A;  2DTZ A;  1WJB A;  2LK2 A;  2ELJ A;  1MSF C;  4PFO A;  2KKO A;  4D1Q A;  2ZXW H;  2W48 A;  4B48 A;  4BQQ A;  3J81 Z;  2WB1 N;  4A0Z A;  2ZXJ A;  5J1Y A;  3OYH A;  4A0Y A;  4II2 A;  4XR6 A;  1W7P D;  4M72 A;  1IJW C;  2ECC A;  3GUD A;  2EIJ H;  2IPQ X;  2EV5 A;  2PMU A;  4B4C A;  1ZRC A;  1SEU A;  2Z1D A;  3WU2 C;  4V19 K;  5CYV A;  2IS1 A;  3CD6 I;  3CDI A;  1OLT A;  4HNV A;  1ETQ A;  1A36 A;  3EYI A;  5DV5 A;  5IYB J;  1OYW A;  3HOZ J;  2VBW A;  2Y9Y A;  5LRR A;  1GV5 A;  4XLE A;  1G3T A;  1MBJ A;  2GXG A;  3JTH A;  4HF0 A;  3K1N A;  2JT1 A;  1UB9 A;  1FSE A;  2FUG 2;  2R92 J;  2E5N A;  2DMQ A;  2HYG D;  3ZMU A;  1DU0 A;  1R71 A;  5LHH A;  3HTU A;  2ETH A;  1FC3 A;  1Z05 A;  4AVZ A;  1ZQ3 P;  3WTT C;  5FO5 A;  1ZRE A;  3G2B A;  3K1P A;  1T56 A;  4QLC U;  3G3Z A;  3A1Y A;  4ZDL A;  3LFU A;  1VQP I;  4DBR A;  5D6E A;  2GOX B;  2V7F A;  3CCS I;  1MH4 A;  2HZD A;  3CLQ A;  3D5S C;  4BGD A;  2V1X A;  3HDD A;  1Z7L A;  4FAS D;  4M71 A;  4M3G A;  2MBF A;  3K2A A;  5C4X J;  2CO5 A;  5LHG A;  1R6R A;  4BJ6 C;  5HOD A;  4L9N A;  2R7U A;  3ABL H;  4HV6 A;  1E3H A;  1MMD A;  2COB A;  3WE3 A;  4O6J A;  1O7F A;  3BG7 A;  2HI3 A;  1R58 A;  1XCV A;  4RLQ A;  4C9Y A;  4EEF G;  1SD7 A;  2BW3 A;  2VJI A;  1YLF A;  3IKT A;  1DPR A;  1A35 A;  1Z1D A;  2X51 A;  1SAU A;  2YU3 A;  2MA3 A;  3G1L A;  1RPW A;  4Y4R A;  5D5W B;  1G3W A;  3ECH A;  4GXO A;  2V26 A;  4A3K J;  3SQN A;  2XSJ C;  1KU3 A;  2PMZ N;  3OYD A;  3CJT B;  4EGZ A;  5JVG F;  3KPH A;  3R60 A;  1E3P A;  5E3M A;  4KIT B;  2DMT A;  5LRS A;  5D5V B;  3PO3 J;  1IN6 A;  4BHC A;  1JI8 A;  4HQE A;  1FNN A;  3PQK A;  3WGG A;  1P9Q C;  4EQQ A;  2EIK H;  3AG2 H;  1EKE A;  4U7D A;  4Q5S F;  4D7N A;  2OTJ I;  2X4H A;  4BHP A;  4Q48 A;  5J47 A;  2WA0 A;  2DW4 A;  2LY2 A;  4E7K A;  1EF4 A;  2NVY J;  4XOR A;  1VFC A;  1B72 A;  1OQY A;  1H8A C;  4OIP F;  1Y1V J;  4IXA A;  1RUN A;  2DBB A;  4IKF A;  3ONQ A;  3BR1 A;  1AKH B;  1EH6 A;  5CQE A;  2CJJ A;  1J2X A;  3GVA A;  4YEL A;  1I50 J;  3MZH A;  3K10 A;  3MEX A;  2G0E A;  1TBX A;  5EG0 B;  2VB6 A;  2BVM A;  3R0A A;  5GTH C;  1APL C;  3ZQH A;  3F9K A;  1OIS A;  4JOM A;  1CGP A;  1GXP A;  3ZGK A;  5CVI A;  4A3B J;  1VQL I;  3J80 K;  2YPR A;  4NUB A;  4YFX F;  1MMS A;  1K4T A;  1Z7U A;  2QSG X;  2IS4 A;  1BOB A;  2R7X A;  5H6R A;  2CV0 A;  1R1U A;  3P7N A;  4JX4 A;  4I09 A;  3M3Y J;  1OFC X;  3BY6 A;  1Q1V A;  2QQ9 A;  3Q3S A;  2Q8K A;  3W6K B;  1Y6I A;  4AID A;  4IF4 A;  2LC2 A;  2NVU B;  2Z9O A;  3BCA A;  2DLL A;  2QLZ A;  3LFK A;  3HRS A;  3SFZ A;  1S6L A;  1KON A;  3LSJ A;  1V5E A;  1MGT A;  2BVL A;  1MBG A;  4GFB A;  5CKT A;  5FFX A;  1WI3 A;  1XSV A;  3NAU A;  2XAQ A;  5FRN A;  3H1C A;  3BRO A;  1O3Q A;  3OYG A;  3QPS A;  2OCC H;  3BTC A;  2MLG A;  2FXA A;  1WRJ A;  2L4A A;  3ZQI A;  2LMD A;  3D5R C;  3VPR A;  2W4S A;  3M8F A;  2DK8 A;  3MN2 A;  1E3O C;  3VSK A;  1JUP A;  2WAF A;  5HNF A;  3P5J A;  1MBH A;  5C44 J;  4FT8 A;  3NEU A;  1ETO A;  2HTS A;  1W36 C;  1FY7 A;  1HCR A;  2GZW A;  2FA5 A;  3KZI C;  2E2H J;  2D45 A;  2V4J C;  5DCM B;  3H0D A;  3ZMS A;  1YW7 A;  3WTU C;  4Y52 J;  1B59 A;  4B47 A;  2Q2E B;  2HDC A;  1YJ9 I;  2WB1 A;  5JR3 A;  3OYN A;  1CQT A;  1O3R A;  4HST A;  2HEO A;  4KIB A;  3S16 J;  1CF7 A;  5LBQ A;  5EEA A;  1BBY A;  2ESN A;  5GP9 A;  1TL8 A;  3EQL F;  1U78 A;  4P9U A;  4GDF A;  1UEL B;  4UNO A;  1L3L A;  1MH3 A;  3CMM A;  4IRI A;  4RM2 A;  3ZMD A;  5DM7 F;  1WZ2 A;  4IHX A;  3F8F A;  2EZL A;  4XM3 A;  2CQQ A;  2JRM A;  4HSR A;  3GX4 X;  4GRI A;  1HSJ A;  1X19 A;  1LVA A;  3OYB A;  1EH7 A;  2HFH A;  1ZGW A;  4XKC A;  3BP8 A;  4HZF A;  3OYA A;  1VQK I;  3QPH A;  3KYL A;  1OCC H;  2FJ1 A;  4KMF A;  1W5S A;  2LBF A;  2H1L A;  2DO7 A;  4CYC B;  2VC1 A;  2HOE A;  1VQ9 I;  4XLA A;  5JI6 A;  2HWV A;  2ECB A;  4I02 A;  3IC7 A;  4XQF A;  1X2N A;  1RUO A;  5FJ8 J;  1X3Z B;  2EJR A;  1ITY A;  4ENJ A;  3NWS A;  2HQN A;  4HLX A;  5EEG A;  4G9Y A;  2LF8 A;  1VND A;  1FMV A;  2CWE A;  2F5V A;  1XGM A;  2YR2 A;  3VYT B;  5FLX K;  1RR8 C;  2OA4 A;  5FKM A;  2R7W A;  3HHG A;  1WGX A;  3A01 A;  5FLV A;  4H4K C;  2IS2 A;  2DMU A;  5DEQ A;  3KP3 A;  1ONV A;  4IZZ A;  2LKS A;  1PUF B;  1IRX A;  3WTY C;  3F3X A;  2BW3 B;  1SD4 A;  1K78 B;  2RAE A;  5J6X A;  4CCO A;  1HST A;  3U1K A;  3Q0U A;  1FTT A;  2AQE A;  2F2E A;  4UB6 C;  5BOX A;  1K6O A;  2CG4 A;  3FBN B;  2UXX A;  2E1M B;  2JWT A;  1SMY F;  4U7B A;  4E7S A;  1DUX C;  2GXA A;  4LJZ F;  1OCR H;  3JRF A;  1MNM C;  3BR5 A;  1Y0N A;  1B72 B;  3OR1 C;  5IT3 A;  1XG1 A;  3JR9 A;  3MWM A;  2XF6 A;  5E1Z B;  1VZ0 A;  3FXR A;  2QQ8 A;  2X48 A;  4NHJ A;  3E6D A;  3KP4 A;  2TCT A;  2KRF A;  3S3M A;  2F5C A;  2FBK A;  3K9T A;  4MEY F;  4B1R A;  2Q1Z B;  4KN4 X;  5FD6 A;  1YIJ I;  2XKP A;  2B7E A;  2IA0 A;  2GLO A;  2CS3 A;  1JKP C;  2HYJ A;  3SYT A;  3E7L A;  5LEK A;  3V7C A;  1ULY A; 
#chains in the Genus database with same CATH homology
 5IYC J;  1W0T A;  3S15 J;  2FX0 A;  2KT0 A;  3SFI A;  1JKO C;  4UUT A;  1B8I A;  3GTK J;  4UUS A;  5EDN A;  5EZH A;  2GBY A;  2CUF A;  1OCP A;  2IAI A;  2M2E A;  1TWC J;  2R5Y B;  1FTZ A;  5J1U A;  5M5W J;  2LVS A;  5C4J J;  1MBE A;  4MLO A;  2DA2 A;  3IH2 A;  2M0C A;  3UKG A;  2WV1 A;  5EGO A;  2DMN A;  2XGD A;  5E3L A;  4IHY A;  1WPK A;  2EBI A;  1H88 C;  2D5V A;  4RDU A;  2JJ7 A;  4BBR J;  5EYR A;  1WCM J;  2NVX J;  4AC0 A;  1DU6 A;  3S1R J;  1IV6 A;  1ORK A;  2XB5 A;  1P7I A;  2Y31 A;  5F0F A;  4B3A A;  2YS9 A;  1POG A;  3BR0 A;  2E2J J;  1HDD C;  3BQY A;  5M5Y J;  4FTH A;  5F04 A;  3GBG A;  1IRZ A;  3JRC A;  4DYR A;  3LOC A;  3D1N I;  4M3F A;  1ETV A;  1JUS A;  4UUS B;  3O8G A;  2JMW A;  1GVD A;  3BTI A;  1NK2 P;  4XRS G;  2VI6 A;  1JUM A;  3FK7 A;  2Y30 A;  3ZQG A;  1ZR2 A;  5K7F A;  2DMP A;  3IH4 A;  2K40 A;  2DA3 A;  5EGO B;  2JA7 J;  3CDL A;  2HDD A;  3BR3 A;  2HXI A;  1K83 J;  3FIW A;  5F1J A;  4XID A;  2TRT A;  3OIO A;  5K7Z A;  4L5E A;  2OF7 A;  3C2B A;  4A3J J;  1RKT A;  2K9S A;  4XIC A;  2ID6 A;  2FD5 A;  4G12 A;  2KDZ A;  1NTC A;  3ZOB A;  3GTQ J;  2CU7 A;  5F27 A;  3S17 J;  1FEX A;  4FE4 A;  4AYB N;  2VUM J;  2M34 A;  4FE7 A;  3GTO J;  1JJ6 C;  3TW7 A;  2LTP A;  2XGE A;  1VI0 A;  3CCY A;  4DW6 A;  1ZR4 A;  1OCT C;  4D5F A;  2ME6 A;  1RET A;  1JJ8 C;  5IP6 A;  1U8B A;  3G1M A;  3MKL A;  4MIM A;  1SAN A;  2MG4 A;  5FKL A;  3LSG A;  3B6A A;  3S2D J;  3GTG J;  4V2F A;  4QTR A;  3PM1 A;  4FIS A;  3JRG A;  1HLV A;  1RKW A;  4DZJ A;  3RZD J;  2IBD A;  2O7O A;  4S0H B;  1XS9 A;  4C3J J;  4M3D A;  2XPV A;  4QSH A;  2JK3 A;  2DJN A;  2E2I J;  2ID3 A;  1NK3 P;  4A69 C;  1TWF J;  2LP0 A;  5IOZ A;  2Y9Z A;  2AHQ A;  5DTD A;  1JKQ C;  4A3C J;  3LNQ A;  1TWH J;  2GM4 A;  5M3F J;  3IV5 A;  5E3N A;  1FJL A;  4IHV A;  5JLX A;  1K61 A;  3S14 J;  2XPU A;  2EZH A;  4ABZ A;  3B6C A;  2O9L A;  2P81 A;  2DTZ A;  2MSY A;  2LK2 A;  3HEF A;  4BXX J;  3FKI J;  5GPC A;  1MSF C;  3H3V K;  1QVU A;  4I76 A;  3BR6 A;  2W48 A;  2WB1 N;  5J1Y A;  3GTP J;  2XSD C;  1IJW C;  4MFD A;  2ECC A;  3HBL A;  4B4C A;  2LD5 A;  2AO9 A;  2X9D A;  1GDT A;  4MO7 A;  3RQI A;  4IEJ A;  4HNV A;  1ETQ A;  5IYB J;  3HOZ J;  1U9O A;  2L9R A;  3WHB A;  2LKX A;  2Y9Y A;  1GV5 A;  1MBJ A;  4C3H J;  4C3I J;  1LFB A;  2VKV A;  5J3L A;  2JA6 J;  3A02 A;  2R92 J;  3QQA A;  2DMQ A;  1DU0 A;  3PO2 J;  3S1N J;  4I6Z A;  3ZQF A;  3HOY J;  1ZQ3 P;  2DA5 A;  4LOC A;  1T56 A;  5EZG A;  3BTL A;  3TP0 A;  4A3M J;  2LFB A;  3BT9 A;  4A3G J;  1TC3 C;  1MH4 A;  2NVT J;  1YRN A;  3OSG A;  4BBS J;  5IP9 J;  4FCY A;  5F08 A;  3RKQ A;  1B8I B;  3WHC A;  1GUU A;  3HDD A;  2IEK A;  4A3I J;  4BY1 J;  1OJL A;  3OSF A;  4M3G A;  3K2A A;  5C4X J;  1AKH A;  5HOD A;  2HOA A;  3MVP A;  3ZQC A;  2NVQ J;  5EF6 A;  2COB A;  3BTJ A;  3JRB A;  1P7J A;  2DA7 A;  2HI3 A;  5EG0 A;  3BG3 A;  4DYQ A;  4EEF G;  4W97 A;  3HB9 A;  2VPR A;  4JP0 A;  1TWG J;  2XRL A;  3G1L A;  1RPW A;  2MGQ A;  2QCO A;  5IOY A;  4A3K J;  4JX6 A;  1RES A;  3HGY A;  2PMZ N;  2O8K A;  2H1K A;  1QVT A;  2HOT A;  3GTL J;  1IGN A;  5E3M A;  2M9H A;  1H89 C;  2DMT A;  3PO3 J;  2LLK A;  4C2M J;  2EH3 A;  1BL0 A;  4D7N A;  3NAR A;  4A3D J;  3I4N J;  2LR8 A;  3FIS A;  1YRN B;  1EF4 A;  2NVY J;  5IPA A;  1VFC A;  1B72 A;  3BG5 A;  3K7A J;  1H8A C;  1ZK8 A;  1Y1V J;  3JRA A;  1BJZ A;  1AKH B;  3BR1 A;  1JGG A;  1IDY A;  2CJJ A;  4Y7N J;  1I50 J;  3FK6 A;  2G0E A;  1FIA A;  5EG0 B;  2Y0S N;  2LY9 A;  1APL C;  3ZQH A;  2N8G A;  3HKZ N;  3HM5 A;  2MW8 A;  2JA5 J;  3O8H A;  1WH7 A;  4AUX A;  4A3B J;  1VF9 A;  2XGC A;  3JRH A;  3JRD A;  4JX4 A;  3W6V A;  4A3L J;  1MBF A;  3M3Y J;  1OFC X;  1Q1V A;  2E1O A;  3Q3S A;  5DS9 A;  4JYK A;  1IC8 A;  2VKE A;  3LSJ A;  1ENH A;  1MBG A;  3BR2 A;  3Q0V A;  4GFB A;  2YU9 J;  1ETX A;  2QF7 A;  2R0Q C;  1WI3 A;  3NAU A;  3TED A;  1UMQ A;  2EZK A;  3GTM J;  5FKK A;  4QIW N;  1QPI A;  2R93 J;  3H0G J;  3QPS A;  1ETK A;  2K9Q A;  3BTC A;  1JTX A;  1TWA J;  2FQ4 A;  3ZQI A;  2DA4 A;  1MSE C;  5JLW A;  4MFE A;  3VPR A;  1ETW A;  3MN2 A;  3TW6 A;  1E3O C;  1JUP A;  2OPT A;  1MBH A;  2E19 A;  1X58 A;  3G1O A;  5C44 J;  2DA1 A;  1ETO A;  3HOV J;  1BW5 A;  1Z77 A;  3QPL A;  1UG2 A;  1F36 A;  2ELK A;  1I3Q J;  1HCR A;  1R9T J;  2E2H J;  2L7F P;  1IUF A;  1IG7 A;  2WAQ N;  4Y52 J;  4CYC A;  2NOG A;  2XPW A;  1CQT A;  1U9N A;  1ZTR A;  1ETY A;  2NS7 A;  4DYC A;  3JRI A;  3HOW J;  2JN6 A;  3S16 J;  2ME0 A;  5EEA A;  5GP9 A;  1HOM A;  4X1E A;  2DN0 A;  1U78 A;  3GTJ J;  2HOS A;  1FIP A;  3S2H J;  1MH3 A;  2CQX A;  3HOU J;  3A03 A;  5FKO A;  4M6V A;  1HF0 A;  4IHX A;  1D5Y A;  3HOX J;  2H8R A;  4BKX A;  2EZL A;  1F43 A;  2CQQ A;  1AU7 A;  3S1M J;  4XRM A;  1A6I A;  1JTY A;  1GV2 A;  1X2M A;  1WH5 A;  4V2G A;  4NDL A;  1IDZ A;  3IH3 A;  1ZGW A;  1PUF A;  5IP7 J;  4BY7 J;  2EQR A;  1A5J A;  3BQZ A;  3I4M J;  2FJ1 A;  2R5Z A;  1I6H J;  1Z0X A;  5K7H A;  1G2H A;  1ZKG A;  2XB0 X;  2ZB9 A;  3JRE A;  4CYC B;  3HGG A;  1BW6 A;  4M3B A;  5F0C A;  4D5C A;  2ECB A;  1SFO J;  5M5X J;  2L7M P;  1MBK A;  2HXO A;  3S1Q J;  1X2N A;  1BA5 A;  5FJ8 J;  4X6A J;  2Y2Z A;  1ITY A;  3SDG A;  1O4X A;  5BNG A;  3BG9 A;  5M3M J;  1VND A;  4J19 A;  1GT0 C;  5FLM J;  4M3E A;  5FKM A;  3TP3 A;  2HQ5 A;  1WGX A;  3A01 A;  1Y1W J;  4JX5 A;  5C3E J;  1RR7 A;  1W0U A;  1JT0 A;  5FLV A;  3Q0W A;  2DMU A;  5GPA A;  1XC5 A;  2NS8 A;  5E3O A;  3RZO J;  1PUF B;  5IYD J;  4A3E J;  1LE8 A;  3SJM A;  2RAE A;  4XRS A;  4IHW A;  3LSP A;  2R5Z B;  2CRG A;  4A3F J;  3Q0U A;  1FTT A;  4RBO A;  1HDP A;  4W1U A;  5FKN A;  2JWT A;  2YUS A;  5J1R A;  2L7Z A;  3CQZ J;  2R5Y A;  2R7Z J;  1S7E A;  3JRF A;  2L0K A;  4D7M A;  2JA8 J;  3F0C A;  1AHD P;  1MNM C;  3BR5 A;  2K9N A;  1B72 B;  4DZP A;  3LSR A;  1UHS A;  1XG1 A;  2DA6 A;  5F0H A;  3JR9 A;  1JT6 A;  1QRY A;  3L1P A;  3A01 B;  2X48 A;  1LFU P;  1T33 A;  2TCT A;  3DEW A;  3CMY A;  3M4O J;  4B1R A;  2EZI A;  9ANT A;  2M8G X;  2CUE A;  1JKR C;  2X6O A;  2B63 J;  1LE8 B;  3DCF A;  1JKP C;  2HYJ A;  4XK4 A;  2I10 A;  3E7L A;  3OOU A;  3ZQL A;  2GLO A;  4A93 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...