1AKRA

G61a oxidized flavodoxin mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWADDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of the redox potentials of FMN in Desulfovibrio vulgaris flavodoxin: thermodynamic properties and crystal structures of glycine-61 mutants.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1akrA00
1NNI1 2QX6A 3N3BC 4ZVNA 5LBTA 2D5IA 2N1MA 5LJIA 4CF6A 2ZKIA 4C14A 3B6KA 2MWMA 2QMYA 2QR2A 1ZWKA 1CZHA 2BF4A 3FVWA 2OYSA 2FDXA 1X77A 1GG5A 3GFQA 4HEQA 5NULA 5FUQA 4NULA 2Q62A 1QBGA 3UXHA 1AKRA 3ESXA 3F90A 4N82A 3U7IA 1JA1A 2MTBA 1BVYF 4GQIA 2FZ5A 2QX4A 5ULLA 1V4BA 3OJWA 1E5DA 4F8YA 2WC1A 2R97A 3NHUA 4DY4A 2M6SA 3D7NA 1YCFA 1JA0A 1QR2A 2BN4A 3K20A 1ZWLA 4GR9A 4M0CA 1CZUA 4QOHA 3UXEA 1F4PA 1B1CA 3NFRA 2HPVA 3OX3A 2FOXA 4XDHA 1D03A 3HLYA 4YAOA 2FCRA 3NHPA 4CETA 1XI2A 2FLVA 1FLAA 1WSBA 4LTNA 2FZVA 2V9CA 4OXXA 3OX2A 1C7FA 1QRDA 1AKUA 1TLLA 4LTDA 5A4KA 1YDGA 2FVXA 1WSWA 4ZVKA 2W5UA 1KBQA 2F1OA 3O2NA 2GSWA 3NHYA 3OVMA 4U7GA 4Y9RA 2OHHA 1CZLA 3G5MA 3QE2A 4Y7CA 4U7HA 4BMPB 4YQEA 4QOJA 2BPOA 3QFRA 5EAIA 1CZRA 1YRHA 4ZVLA 2V5UA 2KQUA 2OHIA 1D04A 5B3LA 2M6RA 5JROA 3U7RA 1AKTA 3QFCA 2QX8A 3F6RA 3NHWA 4C0XA 3GAMA 1J9EA 1FUEA 3TE7A 5F4BA 2MOKA 4PU0A 3OWHA 1RCFA 1YKGA 3K1YA 4LA4A 3W79A 5B3KA 3ESYA 3S2YA 1J8QA 2BZSA 3B6IA 1QHEA 2Z9DA 3KAPA 1YCHA 2ARKA 3OJXA 4HS4A 4N65A 3ES9A 1BU5A 2QMZA 3W7AA 1I1OA 4DILA 3JSXA 1AZLA 5FA6A 3TZBA 4YAUA 3L9WA 3NLLA 4ESEA 1CZNA 2HNBA 1DX9A 1OBOA 2XOEA 3P0RA 4FX2A 6NULA 4H6PA 1CZOA 2BMVA 1J9GA 1T0IA 1SG0A 1T5BA 4QODA 4YAFA 1AKQA 5F12A 5BUCA 1XYVA 1FLDA 1YCGA 2FX2A 2Z9CA 3LT5A 4NLLA 5LLDA 3FJOA 4H2DA 4S24A 2QX9A 3FX2A 5F51A 1RLJA 2X2OA 3W78A 4R81A 1AKVA 1KBOA 2Z98A 2R96A 4FGJA 1H66A 1SQSA 1VMEA 1C7EA 1XT6A 2QWXA 3FNIA 3KAQA 3O73A 3OX1A 5NLLA 4D02A 4FGLA 2Q9UA 3SVLA 1FX1A 3NHFA 4N9QA 3KEGA 3L9XA 4U7FA 4PTZA 2X2PA 4PTYA 4C76A 3FW1A 5EA2A 3F2VA 3NHKA 3KLBA 4ZVMA 1H69A 1FLVA 2KLBA 3ESZA 4DIKA 3TEMA 4YALA 2FAXA 4LTMA 1J9ZA 1D4AA 4Y9UA 1AMOA 4YAWA 3B6JA 3W77A 4ICIA 2AMJA 5LMCA 1AHNA 4BMOB 3NHSA 5FX2A 4C0WA 3OWXA 3RPEA 4QOFA 1ZX1A 4GI5A 1YOBA 3B6MA 3GFSA 1DXOA 3HR4A 1RLIA 3N3AC 3R6WA 4XDGA 1XYYA 3EYWA 1FLNA 1FVXA 5TGZA 2RG1A 3HA2A 1RTTA 5LVAA 1AKWA 1OFVA 1TIKA 2Z9BA 3ZHOA 3N39C 3NHJA 1DXQA 1FTGA 1OBVA 3EDOA 3GFRA 2A5LA 3NHLA 2HNAA 5LBUA 3F6SA 4J8PA 1AG9A 4FGKA 3NHRA 4QOEA 4LAFA 2OHJA 4QOGA 2MT9A 2B3DA 5LJLA 3LCMA 2XODA 2V5VA 1CZKA 4QOIA 5EMNA
chains in the Genus database with same CATH superfamily
2DHQA 2JH8A 1DCMA 2YIDA 1N25A 3HGQA 3ASUA 2I7XA 2VEOA 4XEHA 8ADHA 4TWAA 3ZCTA 4DBZA 1MAVA 4YROA 5CT6A 2RIPA 3VDNB 4HWTA 4TMZA 2HDOA 5M3BA 2AOXA 2B37A 3CLUC 3GRPA 5ICGA 4B82A 1H1TA 2ZUEA 621PA 4GOND 4HNQA 4RIEA 4TZKA 4X97A 5LUAA 4GWLA 1N8TA 2FPUA 2RHWA 5JV5A 2VF4X 4OHVA 1UAAA 4Z8XA 2P7IA 1GV1A 4HYYA 4OYYA 1ZA2A 5I9MA 3U7FB 2ATCA 3COJA 1NX9A 1F0PA 5E8JA 2AQ8A 3QPCA 3L07A 2CVFA 1GPJA 4QJ5A 3R7LA 4GU5A 1GEEA 4D96A 2A0YA 4R05A 3HKBA 2Q7OE 2JD1A 3AVQA 2HMYB 1M2VA 3QXHA 2LE0A 4FSXA 1P2FA 4LHXA 5G4KA 1IVYA 2FVXA 3R5XA 5JNLA 3QVGB 4ADSG 4JXZA 1KBQA 1Z8NA 3D7LA 3Q3EA 4DMUB 1NLUA 4MI3A 5KX5F 1V1JA 4FGSA 1J2UA 5C31A 4EPXA 4HGOA 1F4VA 4NK5A 1P81A 4Z5XA 1PLJA 5HJEA 1JFSA 2NZ8A 1JQAA 2Y0CA 4IIVA 4BE4A 4BMZA 2D62A 2YZ7A 2ODTX 2ZGVA 3E18A 1G59A 3EMDA 3UANA 4RZQA 2CFCA 2D1QA 3A27A 4KXXA 4QC2A 5JH7F 4ZOQI 3PXXA 5CFLA 2CMGA 1SC4A 1BKSB 2FPIA 2HJVA 2IFTA 3A1TA 3K09C 5TT1A 2YZMA 1A4XA 1TJ4A 2A0WA 3T7AA 3W7AA 1OOEA 2G5TA 1PJLA 3GLIA 1RHJA 2WMDA 2Z5FA 3SEFA 1Z7YA 4DIBA 4Q7EA 3TMKA 4YCMA 4ZAWA 5AVYA 1UFVA 1X7WB 3S2ZA 3DP9A 1AGNA 3W05A 2HF2A 3C3MA 2NUBA 3MB5A 4WCFA 2UZ4A 1ZGBA 4LQ4A 1Q3HA 5EPUA 4UBMA 821PA 4WW0A 4WQMA 2B5VA 2B78A 5IUNC 5SZKB 2WNHA 1ATIA 1TCVA 5IDVA 1JFRA 2NU6B 3QE4A 5G2OA 1NXPA 3BGOS 3KVOA 2P9GA 4D02A 5IZCA 3FPKA 3QEBZ 5HBRA 4OGFA 2XCQA 4W7IA 1LX7A 1TYCA 2UVQA 3AR3A 1Z7WA 2F8MA 2IZ1A 2QXUA 2WICA 4HQ0A 2CLIB 1ILWA 4LHYA 3C7TA 4TWBA 5ED4A 5FPTA 3FVVA 1H42A 1XWIA 3E3LA 4F4CA 1GSIA 5EIAA 2DR2A 4ZICA 4RS3A 4L51A 5LMCA 5IXSA 4I4LA 2Z04A 4B6EA 4XH9B 2QXTA 4G0QA 1P5FA 5CLGA 3WL7A 2WMNB 3ABZA 4L5JA 4PXSA 1QHGA 2C5AA 1QYDA 2RHGB 3FCOA 4IINA 3UH1A 4LRTB 4BTLA 1KYQA 1N2GA 2O8CB 3A31A 1XQ6A 4E5PA 1SBTA 4CKYA 1JTEA 2IK8A 2VTBB 1GNVA 3EC1A 1JVSA 4WY8A 2CDAA 4QUIA 4HK4A 1NLYA 4NY1A 4Q3BA 1V3VA 1MOSA 3IVMA 5IW8A 3NGLA 3G5AA 3R0QA 2IPMA 2XODA 1QFZA 2ODAA 3M4NA 1ORDA 2DT5A 4Y7DA 3VUFA 1M76A 2P0AA 1P33A 2AE1A 1GA4A 3G0BA 1YJBA 1KJ9A 2VVTA 1IHDA 1SB8A 1RDFA 2IYRA 4UTOA 3OQIA 1MJGM 4KUGA 4RV9A 2XSZD 4YJFB 5K3SA 5ALOA 5SZIA 2O8BB 2ZSKA 3FI9A 3ZK7A 3PQ7A 2XVAA 3QKWA 2NO5A 1L7VC 2VA8A 3C6KA 1XD8A 1VRCA 2EX0A 3F6YA 2FB9A 4OD0A 3U7QB 4BMXA 4URXR 4EWLA 2FWRA 2C5GA 2M6SA 3AFIA 4GNKA 4RKRA 2C7BA 3O38A 3N0RA 1J0AA 1JBEA 1NLZA 4WOCA 5HX7A 4NXNB 3MCTA 1GAEO 4RSGA 2QJWA 5P8WA 3IB6A 5E9AA 3BEDA 3K0FA 2J0VA 1DMSA 4JBXA 2Y1KA 3BXXA 4A6PA 3FCAA 1RKBA 1Z63A 3GA5A 3OZDA 3FOFC 3RH0A 2CE7A 1JJIA 1ZZGA 4B6JA 1X8KA 3FRIA 3PC7A 2IL1A 1WUIS 9GPBA 1JKJA 1JNXX 1VPLA 2Z8ZA 4EKEA 5ESDA 2E4ZA 4KQXA 4P3NA 3PUWA 5J2UB 2V4UA 3VR6H 3U1BA 3CMMA 4FZVA 1J9EA 2AQHA 4PIMA 4EG1A 3RIHA 3UA3A 1IZ9A 3BE8A 3OBIA 2V3CC 4Q19A 2IS4A 2WVJA 3AWIA 3MFYA 3WGIA 4ITVA 5F9FA 2HUNA 3JQAD 3KUDA 4RFLA 5FAXA 4IIFA 2QRZA 3SDBA 2BSXA 4KN8A 5JC1A 3T3NA 4H6VA 3ICWA 1HSOA 2XD9A 4HGYA 3L0OA 5AKHA 5BVGB 4MV7A 4D44A 1N2CB 4C6TA 1LLUA 3TOVA 1J9GA 4JR1A 4Q9NA 1RHMA 1Y98A 4R1QA 2XA1A 1I36A 4X64B 1XYVA 4HNUA 3RM3A 1WZ2A 3IHLA 2Y9PB 4ZVSA 2YHUA 1ZQ1A 2H11A 1QOZA 4XM2A 3SC2A 1HLGA 1R1DA 3IT2A 1XT6A 4DNXA 2H5JA 2DKNA 1XRLA 4NOJA 1YB2A 2ACKA 4FFSA 1DC7A 4LSGA 3QEKA 4KEAA 4F8JA 4IDAA 4HNVA 3PFKA 4NDNE 3V00A 1RMYA 3H1TA 2BCJQ 3PRKE 2GN2A 2X1HA 4UJ5A 3H84A 4H1WA 3OOEA 2AOVA 2PS9A 3OF5A 4Q16A 4QUKA 3FUVA 3EYAA 3M81A 5AI5A 5FWYA 5ICMA 2II6A 3E7FA 4JFRA 1M8GA 3AUJB 1YBFA 4MHSA 5IF9A 1QP7A 1EK2A 8ABPA 1IQUA 2A0XA 5SZHB 3FDJA 3L7YA 1CQXA 5HBGA 2Z8XA 3OG9A 1JSCA 3IKMB 4M8KA 2A1UB 4DIOA 3OQ1A 3ZTWA 2X0JA 1XTTA 3L8MA 3L7MA 4KXQA 4P54A 4KLAA 4NWIA 3U5TA 2ERYA 3AY3A 4YCSA 2JNWA 1CUWA 3KVYA 4XX1A 2GFIA 2X1MA 3NHLA 3H2KA 3BB1A 5TJ9A 3ZH2A 2PKQP 3STUA 3VRHA 2HU5A 3VNQA 3WWOA 2P2NA 3WLEA 2H1OA 1T9AA 4RE5A 5F2OA 5HCIA 3SI7A 5EUQB 1EXVA 2CLKB 3G9XA 1U99A 2XUGA 4HVAA 5DIZA 3PNKA 1U0BB 1JR2A 1XQVA 3HL0A 5E2AA 4C7BA 5KDDA 1QFXA 4LYDA 3H9UA 3VR2A 1M0EA 1NBOA 3BORA 1BGXT 3K1TA 1GQFA 2BEWB 3BZUA 4D9FA 3VAAA 3NOXA 5KU1A 1N92A 5J2TA 4PX2A 3L4KA 3QY9A 1N1DA 3A3YA 2BZGA 4INOA 4YUWA 4OI4A 4JLNA 4WRRA 5DBIA 5AK0A 3OCJA 4W99A 4YJ2B 1KOGA 1IAQA 2HW8A 1YZQA 1WMFA 4L1KA 4KMMA 2BRUC 1ZOSA 3NFRA 4TVOA 3QEOA 2HIGA 1AKNA 4X3OA 5EJ5A 3BK1A 3WKBA 3FOCA 4IAOA 1KYVA 4UHBA 3HTXA 1VYUA 3BRSA 1HQKA 1OYOA 3MJVA 4DMCA 2QBYA 3RUIA 3DOCA 3V8EA 1NJ8A 1EDZA 1LLQA 1UANA 3QE9Y 4YR9A 1WSWA 2GZAA 4TTSA 1I24A 4H7HA 4LBZA 1TO6A 1VYTA 2R68A 3CN7A 4GLLA 3ACBA 4WKCA 1JKMA 4ZQHA 3R24A 2YH2A 4WK2B 5L3VA 2ZIFA 5CVTA 1PGJA 5GM1A 2VQDA 5ICCA 4NCNA 1FFYA 1S3GA 2QY9A 3Q8XB 3GA0A 4LJLA 3UY4A 5B3LA 2ECPA 2H0AA 1H8ED 1R18A 1TJPB 3IQGX 4MLZA 1KARA 2SNIE 3N7TA 4KAAA 1MA0A 1OX4A 2ADFA 2ZPAA 1ZVKA 4O4JA 4RNDB 1G17A 3V3KA 5F2KA 2AOTA 3PVZA 2E6UX 2HLPA 1SOAA 2XQJA 3GVCA 3DFKA 3VSBA 2DUMA 4R16A 4GP7A 3QNWA 3TF5A 3RC8A 1QGUB 1ECJA 1Z17A 3GRRA 4L78A 1P9OA 1FBTA 1S2DA 2L69A 3BN3A 4B8WA 1PGPA 3AZPA 2R8YA 1KJQA 4H6PA 2X4LA 4OJYA 2J87A 3K53A 1IY2A 2NQ2C 3USES 4NLLA 1F1JA 3BWCA 2I91A 1MQAA 1E61A 2OGTA 5K6TA 1F7VA 3DHNA 1P7YA 5P21A 4BZWA 1U2ZA 1XDSA 3ICCA 3MTAA 1HDGO 4QXOA 1C4WA 4PCAA 2HIMA 1U0LA 1LDEA 1Z4KA 3JW8A 4WZBB 1E0SA 3GDGA 4E3ZA 3EPRA 3MT8A 4G8JA 4MHTA 3ESCA 3DKRA 4NVRA 2R8XA 1DC3A 3T15A 3AGQA 4RWZA 1Q6YA 1NQXA 1QDUA 1H69A 2B7BA 4L5IA 4F2DA 2JGJA 4ZCSA 1V7ZA 4M8IA 1CYEA 3RVKA 1PT6A 3DXFA 3ZPXA 3RTGA 1IATA 1F9AA 2O5VA 3O2SB 4S1OA 3VU8A 3AV0B 2A9RA 2IU3A 4DG8A 1XF1A 2HJSA 4O29A 4JLVA 3ROTA 5HHTA 3VZDA 1P18A 1UL1X 3IEUA 2PJZA 2Q21A 3FLEA 2HSZA 1AKWA 2YW9A 2GJ4A 1C9NA 4N0EA 4CNQA 5BMVA 3AI3A 1KWKA 4M1TA 1X8LA 5T67A 1JBQA 1NN3A 4MV3A 2B4RO 5EIWA 3O21A 2EZTA 3B7WA 4F38A 2CMFA 2OAGA 2N1MA 3HFGA 4O4IF 4OH1A 3ENKA 4B0OA 1VIVA 8MHTA 1KH2A 1NJFA 3F46A 2GM9A 1JR6A 1G6Q1 5E4JA 3WL3A 1U9YA 2CB0A 3U26A 3KPUA 3IUPA 1T8PA 1X9GA 4PHTA 3T3EA 1PZEA 3I05A 3GFBA 3P9RA 4EB0A 4U3JB 1PZXA 3JAWA 4X6XA 4O2BA 3BQMB 1SKBA 4PYNA 1NATA 3UJ9A 5K7SA 3V8MA 5B64A 1AV7A 1DUIA 2A2ZA 2VOJA 4LI0A 4TKUB 3TCKA 2QM8A 3PGJA 2Z5GA 3FVRA 3JATB 5AKKA 1YJ5A 2DHDA 2IV3A 1L7AA 3TFQA 3PEEA 3NMUF 5LQMA 1WTCA 1I7LA 1MFPA 2RHJA 4LTNA 4YJ3F 4EUKA 1XZQA 3QVUA 1M34E 2PRZA 5KWJA 4JIGA 4ASUD 3ZDDA 4OHMA 2VUTA 3KR0A 5B1SA 3DTVB 5DK6A 1IPEA 1Z8DA 1JDNA 4X63A 1F4LA 3H99A 3DKVA 3QH4A 4Y7CA 4QBGB 4NMLA 2ZULA 1GG8A 2AX4A 2V7VA 1MC5A 2VQ3A 2K2WA 1NFFA 1Z0KA 3HZZA 4AQDA 4CKXA 2EP7A 2FMFA 1ZM4A 4KBYA 4BVEA 2XVMA 4YUAA 1P4JA 5DHFA 4JT4A 4KIWA 2H59A 3W2FA 4HATA 4KMOA 3C7DB 3AQ4A 3F1LA 1BE8A 3CUVA 2IYVA 2PS1A 3SX2A 4W6QA 2C5EA 5AVOA 1P1BA 2CWDA 2XECA 2ZXEA 3OUZA 4QTTB 1DX9A 4DCVA 3H2YA 3E8SA 4ER0A 5CM2Z 4WAUA 3MTEA 4GIBA 2WY2D 2PGAA 1AA6A 3PGA1 1LZLA 1C81A 5L3RA 4LF8B 5L6LB 1A97A 4S24A 4BLVA 2ZTUA 3LGSA 4EHNA 1M2VB 4GZ6A 5GINE 2QTTA 5F23A 4HDKB 2B25A 4D9NA 1EVJA 3SS9X 1TUGA 4A27A 3B2QA 2ZBDA 2A84A 2PZFA 1CS4C 2QSJA 4UU7A 4DJDC 4B84A 4DCJA 3BK2A 3JASA 4HPWA 5IC4A 2XPCA 3QWIA 1JVBA 3DE2X 1AUVA 1L5FA 1GTJ1 1QFJA 3VDXA 3BERA 3A28A 4PC3A 5AUQA 2XRZA 2KBEA 3V2IA 4J91A 2WT8A 3DDNA 4LVUA 4ECEA 2B8WA 4OQPA 5IJXA 3QELA 1JDJA 1XCPA 1J5EB 1NW7A 1IXRC 1TO1E 1G7CA 1UXKA 4UTXA 1W76A 1Z16A 1G20B 4I1RA 1BD3A 1RWBA 3AERA 5ALXA 3RK4A 4LBYA 2IP2A 1FY2A 5KREA 3G2PA 3KDSE 3HM9A 4MNTA 1DJNA 1NVDA 4RCZA 3KPVA 3IYLW 2PUDA 5CJJA 1WW2A 5ILQA 1N2JA 3V7UA 2OO7A 3PUXA 4IDOA 3I8SA 4CG1A 2DBZA 3Q41A 4Z9FA 3VHXA 4M2LA 1Z2DA 2CXOA 1CS0A 1KDTA 4G23A 4K6CA 3RFXA 4EO9A 3JS5A 4H1HA 2HTFA 4URHA 2DUNA 2XNKA 3A36A 4JR2A 5B2EA 3UC9A 4PO1A 3DEIA 1JJFA 1VPEA 2VYVA 1YR2A 1MRSA 3B1VA 1TLFA 4DAEA 2RE8A 3TM5A 3HWX1 2QENA 4A8PA 3TH5A 1DOAA 3NBAA 3EZXA 3UK1A 3TX2A 3FTCA 3LBAA 3RNLA 1HKHA 3K6KA 1A71A 2YHBA 1JLHA 2IELA 2NM0A 3SIPA 3GAZA 4BX3A 3NQ41 4NF2A 3IIIA 4YDRA 2YNMC 2ZSUA 2NZXA 5HCUA 3GUYA 4DJTA 3IQFA 1ZCAA 3N2IA 1Q21A 1R3DA 3ZGOA 3DMTC 2FZVA 1KWGA 4GO1A 2FH5B 1AKUA 1J2EA 3GV0A 2O3UA 2NSDA 4PRYA 2QTHA 4RZIA 1NVVR 1QPBA 4I4TF 4IEFB 4YDHB 4AUNA 4RH0A 3PGMA 1CUJA 1VIDA 1XB2A 3ZX4A 2HJWA 3QBJA 4B4VA 2J4CA 1FXUA 1G9TA 3KLMX 5K0EA 3QI7A 3KZVA 4EA6A 5FA8A 1CIVA 4V3BA 2PD4A 3N8GA 3WB9A 4ILKA 1MVNA 1BNCA 2GCOB 2RAVA 4B71A 4CEJA 4PQEA 1JMKC 1U3FA 4MKXA 3U80A 3GT7A 3AO0B 1WPQA 4M9UA 1IL0A 1EWTA 1GGFA 1N6RA 3EOAI 3R3ZA 3T99A 1LJLA 1T2NA 2BTQA 5LNK6 4J07A 4D0NA 2EBUA 2X0RA 4URVR 2NACA 4UMVA 4IYRA 3V42A 1MOQA 2OCYC 3LQ1A 4IKPA 1JEYB 2R6CA 1X38A 5DP1A 3D54D 3QYJA 2DPGA 4I55B 1ULAA 5FOUA 5A9TA 3RSOA 2WHYA 4HGRA 2CKDA 3SE7A 4REOA 1CULC 1JILA 2CLCX 3FR8A 1NOIA 4OGLA 3GRZA 2UZAA 5ICFA 4FT2A 4OBXA 2C4TA 4UPDA 5HF8A 1HEIA 3AUKA 3RU3A 1P80A 5AVUA 4CCSA 3WLJA 3LWBA 1RZRA 2YN0A 2BFBB 4YI5A 3KQHA 5CURA 3GLTA 4B81A 4QPZA 2LNDA 4L4XA 2UUPA 4JJKA 2H17A 4QDTA 4AG6A 1YZVA 4C21A 1VKJA 4NZ9A 1X3LA 2GNAA 4BKOA 4DQVA 2JHCA 1E5QA 1LB1B 1Z25A 2GK6A 3DOEA 3E3MA 5L8VA 2EFJA 1FPMA 1ODTC 5JAQA 1FXSA 3CEPB 3JQFA 5JZBA 3VA7A 4BZZA 3WL8A 4AQ7A 4Z1MD 1GL6A 2ZTHA 4AUMA 1LI4A 5AHWA 3R5KA 3WWPA 3WLTA 2PMCA 2ZJ3A 3W6NA 1FU4A 1BX3A 4C6HA 3KHTA 1FYEA 5LDHA 4I5DA 4J43A 3SYRA 1WABA 4XPIA 2DETA 4QUDA 3UBMA 2ONYA 2Y0DA 1OASA 5BNWA 3AHCA 3NEYA 1OZ0A 3V4PB 2OKCA 1Q91A 1WZIA 1GGVA 1K9VF 2NSLA 3BSSA 1FNSA 4NV0A 4QTYA 2EV9A 1Y6GA 1R2QA 1VL0A 3C3YA 3INGA 2ZJAA 4FQ8A 2XBLA 4LZOA 1BEEA 2GN4A 3DA8A 2H4WA 5E1OA 2YMMA 4FB5A 1ADGA 2HO5A 1GRQA 3H13A 1NAIA 2HNAA 2FETA 1CQPA 2ATVA 4NG5A 2OHJA 2IY9A 1I3LA 3HN2A 1BFUA 1I4OA 2LCIA 3D4IA 4RKEA 3CGGA 4IGEA 3RVDA 4YT2A 2Z6UA 3M5PA 2B20A 1JHOA 1SN7A 3C5EA 3PNSA 5HJ7A 3CQ9A 1UK7A 4N5LA 4KFCA 3FCEA 3VNSA 1PQWA 4Y0NA 2D13A 2O3TA 2YZ2A 2ECQA 2PK3A 2CL0X 5EP4A 3T35A 2JVJA 1UZNA 3OLVA 2J67A 5D5HA 4RC9A 2IUEA 1K7CA 1MV8A 1TVKA 1YZLA 1UZAA 2F00A 5K8TA 4E2XA 1KPGA 1TU3A 4U1RA 3WTCA 5I3ZA 4CN9A 4ZAZA 4DR5B 4ZRDA 2OK7A 3FR7A 3F2IA 3K9GA 3LHKA 4YMSA 3C16C 4DVJA 3G5UA 1STOA 5FYQA 2WG1A 1PHPA 5GOZA 4CIDA 5IZ4A 3EF1A 3IP9A 1XSEA 2HF9A 4PZ9A 4ZKEA 1H4SA 3PQ5A 1Z07A 4K8RB 2B30A 1G6OA 5K0ZA 1A4UA 4N3NA 5IUKC 1TQ8A 4OB6A 5CEEA 1U2GA 3BDAA 4UU1A 1V5EA 2QF7A 3RS4A 4EFKA 4OQXA 4TZTA 4OUDB 1N0VC 2XAUA 3GNTA 3ZU2A 3F74A 5LN1A 4ZVLA 5JS6A 1FIUA 1ORRA 1S7CA 4YFYA 1CR4A 1E4EA 3PEUA 5AXAA 3S2FA 4EA9A 5FL3A 4Q3DA 1N5DA 4PFSA 3NIFB 1NRXA 1PR2A 3ECSA 1GYPA 1EGVB 2P8JA 3V4SA 4QYIA 4ZJYA 4B3XA 4EPWA 4HG2A 2HR1A 2Q4BA 5KNCA 4TT8A 3EDYA 1NHWA 2B4QA 1Y4ZA 3FCUB 3G2KA 5CLHA 3H5TA 3S28A 4V02A 4M9RA 3CUUA 3FCCA 5ETJA 4R0MA 3PNPA 4NFSA 1XNQB 2RGXA 4RY0A 4MI1A 3EHEA 3U49A 3JY6A 1LW7A 1W6RA 4QO7A 5ITWA 3T5TA 4MW0A 3Q12A 3ZVKA 4JI0B 4RTRA 5F12A 1FP1D 1KU6A 1DXHA 2FX2A 2HRZA 1U4OA 1VL1A 3B20A 2PKYX 1JEDA 3H6HA 5K0LA 1VIAA 1MG0A 5JH7A 2PO5A 1RWMA 5KMGA 5JJKA 4AJJA 3KYBA 2EJBA 3H1FA 1VHLA 1Z36A 4U6SA 4QWMA 3S4YA 4HDOB 3IQEA 3I2KA 2YIJA 5CVDA 3IPXA 5DHAA 5DT9A 4GS5A 3SPXA 3WNDA 4G5OA 6CHYA 1P8JA 5E6RB 3LXRA 4WINA 1AE1A 1M2NA 3LXXA 3PC8C 4JJ7A 5FPYA 5CNMA 5B58C 4E21A 2VAMA 5MN5A 2DFNA 2GBGA 2VHQA 2GOYA 2YL2A 4PICA 2NU9B 3N87A 1KDZA 1P74A 3GEPA 2NPOA 2G8NA 1Y63A 4IP0A 2V6JA 2FP3A 2JAPA 4BE7B 1LSJA 3LX8A 4QDZA 3MQFA 3DUFB 4AZ3A 1CQJA 9MHTA 3MERA 2HXGA 1XZLA 2HHAA 5JDIC 1TEHA 4EKYA 1UOQA 4LDRA 4GRDA 1FPQA 1E2MA 3OTQA 4XEUA 1VSBA 3TW8A 1GADO 1MB9A 1P9NA 3KPWA 3NTLA 4D8VA 1Y8QA 1PJBA 3KVRA 1CY1A 3GFRA 2LRHA 2E1PA 4OB7A 1SXJD 2AG1A 3B5EA 4DCSA 2AUNA 4AS1A 4ZU6X 3UGTA 3O91A 1RD4A 4M1ZA 2Q41A 3A4LA 1O7JA 2NAFA 3GFTA 3PC6A 4KIUA 1Q95A 2OB2A 3HABA 4EF4A 3UWOA 3KR9A 1XBTA 1KS9A 5DHQA 3W7VA 6YASA 4ZI5A 3S8YA 3ZHZA 4YB8A 3I28A 3MSXA 4J0KA 4BYMA 4DG5A 3G8BA 1I2DA 4IDGA 4JJGA 1VTKA 1ZGHA 2O48X 3EBLA 5T4BA 4TVKA 2OUIA 2XSZA 5LL6P 1FRQA 3QPAA 3U7IA 3DHVA 3SXUA 4KO2S 5BN3B 1J8MF 3ZCUA 1R6VA 2IKSA 1Z3IX 1V3TA 3DGFC 4HDCA 4IDCA 5HE8A 1P4AA 4R68A 2C78A 2R2GA 3E9YA 1NJSA 3TQQA 1JMYA 5K0FA 3OMLA 3VR3A 3U7EB 3BMCA 2Q7XA 1N6IA 5EIBD 1TD1A 1QUFA 2WT9A 3E8XA 4IMRA 2VCHA 2WJZB 1DKMA 1U04A 2O7RA 5FFMA 4YMUA 5JBIA 2G0NA 5FADA 4DQKA 3I9JA 1XJWA 3AR4A 5BMVB 2AWNA 1UJ6A 3MRXA 3IOBA 2ZXFA 1KYYA 1PYOA 1GAWA 1VE1A 3LV8A 5EMHA 4PW0A 2HCFA 4E2YA 2VLIA 4GLFA 5DWQA 2MINB 2Q50A 3W3ZB 3RB8A 4H0FA 2QUHA 2HDWA 2MOKA 1JE1A 1LBIA 1YU6A 1E2KA 3I39X 3K1YA 2TMGA 2ZB4A 5AW4A 1M0TA 1QDEA 3ITNA 4MGZR 3LUCA 3FMGA 1T4BA 2X8WA 4JR0A 3TTSA 3TI7A 2FF7A 3KEOA 3WLNA 4P4LA 4XYMA 1U65A 2VL7A 1E3MA 5AVQA 1VI5A 4HP8A 3EGDB 5I6DA 2EWMA 1T9DA 4Q7JB 3RG8A 1TADA 3MXTA 2V58A 1R3UA 3QPVA 3E53A 1XQWA 3CRNA 4B7AA 4NXMB 3R2JA 3DMTA 1E96A 2JGMA 3IEPA 3NT5A 5IHPA 2G7ZA 3FOZA 3NVKI 4TQ9A 5J1TB 4BV8A 5CDTA 2Y99A 1F3OA 2E4WA 3D1VA 3IEXA 4M60A 4D1YA 4DUGD 4WFKA 1UPCA 4NENB 3EB9A 2J33A 4D8XA 1BA3A 4WJLA 1VPDA 2DU8A 3PNBA 2JBAB 4C22A 4RHFA 1KORA 2B8JA 3R3HA 1P60A 4DT1B 2R87A 3HXMA 3TD6A 3UXMA 1NFRA 1BA2A 4M9QA 1ZMOA 2Q6IA 2QDKA 3I9MA 4ZU3A 1OE0A 2XMZA 3UO8B 2FUEA 2UZIR 4BPBA 3RFVA 1H1LB 4I99A 3O26A 4I5IA 1P0PA 4D4IA 1VGVA 2D8AA 4KFTA 3UCXA 3KT8A 4R3NA 2X0KA 1W29A 4DHWA 4C01A 5GZ3A 5K0GA 4H7DA 2X5NA 2GUWA 4YRFA 4F5WA 1F2TB 2F1RA 1ND5A 3JQ7B 4KFSA 2XNCA 3R7WA 3BZBA 1KJ8A 2OESA 3Q72A 4TLCA 2P2GA 3S2EA 3G0DA 1X7XA 1O96B 3REQB 1G66A 1QJ4A 3NUQA 3RANA 1I13A 2AEEA 4XB2A 3ZQUA 4F0JA 5EGSA 1HRKA 2O2ZA 3FPCA 4QYTA 3ZY5A 1E2GA 2YXNA 4NNOA 2H4ZA 2O14A 4TV9B 2VK1A 2QRUA 2O2SA 4ZHQF 3LPAA 2QW8A 1LPNA 3ZG6A 4B32A 1H3FA 3LQQA 1F1BA 1CUDA 2GBIA 4FGKA 5CUQA 5GMOA 4E1VA 1X1CA 1VSTA 3L05A 5JPDA 1HFEL 3QXCA 3GVHA 4O63O 2IYYA 3MJSA 4R7ZA 3A1NA 3O1LA 4ZAFA 4DKJA 4PAOA 5J1SB 3REFA 5HA5A 1K2WA 4EMSA 1KZ1A 2H0RA 3FVWA 4MRSA 3QP9A 5AKXA 1L7NA 3AVPA 3O4FA 3SE0A 3T6KA 2XRFA 2EJTA 1P6UA 1R00A 1NT2A 1ST2A 3D6MA 3GRYA 3TLGB 1AQIA 2VWHA 2RGCA 4OYRA 2OXIA 5ALEA 1LK7A 1A9QA 2FRVA 3C7AA 2ASVA 2C2KA 2V8BA 3RSFA 4F86A 3VR4H 1XPUA 3LT1A 4M9ZA 1RRFA 4N0QA 1FMFA 1JUDA 5K45A 5J2UA 2RK4A 1VLVA 2W2KB 3UQZA 1QVWA 1MG5A 1SD5A 2ZE6A 1U3GA 2ZU6A 1E8DA 3H4VA 1NE2A 4QFCA 1O54A 1J20A 5AK5A 2C59A 2IW3A 4DPKA 4WLEA 1D7OA 4EJSA 5BY2A 4DV7B 1ZESA 2WD7A 1TTTA 5A4MS 2P4QA 3M7IA 4ZMSA 1D6NA 4LJKA 1WDTA 2M1ZA 2MSCB 4BVHA 3ZIAD 5HSGA 4N41A 2ZZNA 1CEEA 1ZBDA 2JFPA 4JL5A 3ZOKA 2WHPA 1RBMA 4HZUA 3K0KA 4IRUB 2XUZA 1BGWA 2QX8A 4R71A 1C30A 1Q0SA 2D4AA 5MN4A 1QNLA 3WICA 1CRLA 2E87A 1E2FA 1NI4B 1TU0A 1BW9B 2F3RA 4MMZB 3HADA 3N0TA 3DONA 1KEEA 1V8BA 1E5VA 3WLHA 2AD5A 4ZXFA 4F5DA 1PT5A 1GD1O 4LY6A 3U5ZB 2NXCA 3N05A 3I1IA 4IJUA 3JASB 4RKQA 2F62A 1PDWA 2R86A 3RYFB 3MTJA 5KNCH 1DC5A 2H7CA 3NBQA 5DM0A 2DTEA 2EHDA 2C83A 4Z1MA 4QJ3A 3RS2A 4RHYA 1T1JA 3AF2A 2DBVO 2VZEA 2KPOA 2R96A 4YCBA 3NALA 5JTTA 1ULBA 3O73A 2ECOA 1JTFA 3EA4A 4YRMA 2BYTA 1EVEA 1SXJA 2AZMA 3KU4A 1PVDA 3CV3A 4FN4A 4HN9A 2Z3WA 4RORA 1W1WA 5EJIA 1VFPA 3AY6A 3N9IA 5JFOA 2QAJA 2ZS9A 4K9SA 3R7SA 1DHTA 1XD2A 2A59A 3MYRA 3OSZA 1UEJA 2BEWA 2A9VA 2V3VA 4EMBA 4YV7A 2QYOA 1JLKA 1E2IA 1KOJA 2CEAA 2OO3A 4TGLA 4D57A 2BEUB 1SCQA 4R84A 3C3DA 2FQXA 2VPYA 1KI3A 5B7PA 2P8SA 1NULA 1SOVA 4Y6GB 1SXHA 5KYTA 3WA7A 4QGHA 1XMOB 3F4BA 3N2GA 4RFVA 4S2UA 3FHJA 3CPSA 3GGJA 5EPOA 4CGZA 4PBSA 3HDJA 2YJ4A 3W5UA 2OLKA 2XMQA 2V59A 3EAGA 1XU7A 5B1EA 4YP0A 3T5DA 2F3SA 3F7NA 5AOAA 3UOWA 4UAJA 4Y0AA 1DDGA 2FGKA 4J2HA 4TTVA 3L6UA 5TF4A 4DLTA 1H05A 4Y3UA 1MB4A 3OPYA 3OTOB 4W9NC 1GITA 2YWRA 3C8ZA 3C45A 3NEJA 5CT4A 5EP2A 3RADC 1QHHA 1QG2A 1R8JA 2XRYA 3B6KA 2HIAA 1C3XA 1P7CA 3R3UA 3KEQA 4LE0A 1GZ5A 1OV6A 3PIRA 4Q3LA 3C6BA 3JWEA 4HQNA 1PCXA 2WYVA 5J59A 3NI2A 1SUCA 3RJTA 3ZZTA 4CNBA 1KZ7B 3ND9A 1X7ZA 1S6YA 2Z83A 2HK9A 3BH0A 3AONB 1QIIA 3KO8A 4B5LA 4L02A 2NQTA 4LCBA 4XUGB 4I2NA 4F3YA 1WY7A 4X1OA 1U2QA 3OM8A 4UU0A 3SBOA 3QU4A 4BFZA 1QG4A 1NXSA 1W0JD 3EODA 5GJCA 1TQHA 2EW2A 4ZA2A 4J0HA 1ZSVA 4O5AA 1FRVA 3Q10A 1SKMA 1IHPA 4CV3A 2WQZA 2Q4OA 2REQB 5CR9A 1C5KA 1AS2A 4HC4A 4S2EA 3EFOA 3EN0A 3F49S 1BQ4A 4IH9A 4ROTA 4EW6A 4YGXB 2C2HA 3UT5A 5CYOA 1FS4A 2WFLB 4D8TA 3D31A 4OMCA 4C30A 1RLUA 3OE7D 3MWEB 3LTNC 3F73A 4HTAA 3RFTA 4FDAA 1F6DA 4NBNA 3IIEA 4TV9F 1JI3A 2JIZD 1JR3E 3D4PA 1YH3A 3HI6A 4LJAA 1ZLYA 1Z6XA 2RK3A 3ZW8A 1OFUA 1YQDA 2V9ZA 4V0NA 1GPH1 3C74A 3BMCB 2W48A 3QV1A 2AJCA 4GMDA 1J06A 1RRGA 1A8SA 4MQ5A 1TW3A 4MQEA 1GZ4A 1FFAA 1EJ0A 5CD1A 3L4SO 3OU7A 5JS2A 4TT3D 1QVAA 5CU7A 4CE6A 1EZZA 3PJGA 2ZB8A 1RYYA 4CKZA 4CLHA 4EA7A 4XWAA 3D02A 5I9IA 4JZYA 4MRMA 2PUBA 1HNXB 3T7SA 2GLXA 2PMDA 1BH6A 3B3GA 3WLRA 4P7KA 4D3FA 3SGLA 5EIHA 5BUCA 2EZ8A 4PX5A 3FPEA 4GF5A 4RMHA 1HT0A 4YRGA 2BAGA 2E55A 4ZGWA 5JSZA 4PYRA 4DNOA 4JT9A 1EVKA 2P4SA 2ATEA 5LWQA 1Z5PA 2GWHA 3LHSA 4CXMA 1V26A 1UJCA 4UD2A 1BJKA 1EVZA 1CEXA 3TS1A 3WZMA 3IPCA 4AIIA 4F4DA 4HDNB 2EAUA 3AF5A 2XIJA 5IH7A 3ILXA 1ID8A 1GQSA 1JLLB 5KC9A 4MVJM 3L9XA 3AHEA 4A1OA 1XZDA 2IP1A 3GIDA 2RFLA 1KSJA 3A05A 3R6DA 1Y80A 1OH5A 1JHZA 2H2DA 3X3HA 4TXMA 1U7PA 1WEHA 1DCFA 1QK3A 3CEJA 3CJTA 3HBMA 4RW0A 3UCFA 4OQZA 4Q4JA 3W9UA 4FZJA 3F7TA 3FTPA 4BIIA 4X62B 3JD1A 1UEXC 2CNLA 5FV4A 3WB2A 3O1IC 2AR7A 2GPAA 4WBSA 3L7LA 2XUJA 1JLMA 2QIOA 3QYFA 3RSSA 1JKXA 5IFLA 4PN7A 4WESA 3URMA 3Q9LA 4MJ7A 4OK3A 5HCNA 2R85A 5AOVA 5DMXA 1W5FA 4MQUA 4YUYA 2ZI6A 3UBTA 3DBLB 4HH4A 1CLEA 3ZV3A 3K35A 1KFJB 1P0MA 3AHDA 2I4MA 4G1BA 1C4KA 1CU1A 2B3DA 1AQLA 1UJNA 2JZCA 2WKWA 3C3JA 3PYLA 2GESA 2UV8A 3MUNA 1QP8A 4JBLA 2E5WA 4ZPJA 5DSZA 3ILYA 4EY5A 4AT1A 3F97A 3ZTTA 5TIIA 5FI0B 1W59A 3KJQA 4TSKA 5BOVA 4RADA 2IUTA 3ZIAA 1HWYA 1MO2A 3K16A 1C7IA 1I7DA 1KO1A 2ON6A 1WAMA 1X94A 3RV3A 3L4BC 3O4HA 4MV4A 2EDAA 4I6EA 2VWGA 3ROZA 1I7QB 3R6TA 3Q3HA 2AXQA 3Q3JB 4HSEA 5F9HA 4FQ5A 1GUZA 1ABFA 3KVVA 4WKNA 1Y1PA 2XDQA 5L95A 1N9GB 3NYWA 2GK3A 4FW8A 2EGGA 4JWKA 5JADA 4YRAA 2BH2A 1XO1A 3KYCA 1X8JA 4PX9A 1DAMA 2BBWA 3PLRA 4O5OA 3QU5A 3G1WA 3STWA 5IKXA 5E9JA 1AQUA 1L5LA 1LSUA 2CD9A 1QLJA 2V3WA 1T0PA 2JCYA 1HE5A 2ZT7A 4Q9KA 3DEYX 4B6QA 1XDWA 1CWUA 4BQPA 3ABOB 3O0DA 4CTKA 1OIWA 3GC6A 1PV4A 4HDSA 4LDPA 1SCNE 5K3DA 5B12A 2PZLA 2JCXA 1I4LD 1TNDA 2XE7A 1G7SA 2JGDB 4QE3A 2WWGA 5HF6A 5C0OE 3QMMA 4NE7A 3BWEA 1KNXA 2VBIA 1Y8QB 1FJ2A 3BGVA 3EGXB 2WWXA 4G63A 3TTUA 4M1YA 4WBNF 3V5NA 3INYA 2VKTA 1OVGA 4Y2JA 3K0SA 3N2KA 4Y6LA 1MMFB 3DOIA 4PAGA 4BQFA 4QM7A 5CLQA 2AGVA 1OXMA 3HCOA 4WLUA 3DULA 1P5ZB 1QFYA 4XR9A 2WF5A 2Q4RA 4JUIA 1NV8A 5IHXA 2PSSA 1OU4A 3NDBB 1WBJB 3EGOA 4K1LA 4B79A 3ITEA 1TMKA 4Q4CA 1UEIA 3JXEA 2YWFA 4AMBA 1PEKE 1PR3A 2GZ1A 2VC2B 4ESEA 3ONFA 4XCXA 2PLRA 4DJAA 4B3GA 3GXOA 3ZZUA 3HVIA 5FBVB 1GFSA 3QG5A 5E6RA 1PZMA 3G5TA 2XV1A 1L3BA 3AM3A 4KLCA 1AKQA 2NUAA 4NS1A 4R9UC 2I2DA 4CODB 2QE7D 3R76A 2G5PA 4KR6A 2V0NA 1KI1A 3I04M 4ASUA 2X2OA 4WK4B 5B1DA 4HFNA 5FBWB 3ZVLA 1C14A 1W75A 1ZQ9A 2AKAB 4NYIR 3SFVA 1KO5A 3VYTB 1L7PA 1YT5A 4E5DA 4BFUA 3Q2IA 5A3QA 2VZ8A 3QVGA 3OT5A 4OP2A 2PQ2A 4D4MA 1VQ1A 2VTVA 2IQIA 1YKSA 4V0RA 5GV8A 1O5OA 2PUAA 4QYMA 1Z83A 2FFHA 1GNSA 2WIBA 4EYOA 1U0FA 1DTEA 1ZU4A 3KFXA 3R7AA 3ACCA 1PL7A 4UMDA 1LBSA 3I2GA 1IVNA 3W77A 4DMGA 4KFRA 2WF9A 4ZCQA 1YACA 2GCNA 2WTUA 1CC1S 1SXGA 2QROA 3MCVA 4O2AB 4GRIA 2ZRCA 5DNCA 4KHPB 2Y4OA 1KO4A 5DF1A 5F3DA 2PRKA 3QJ5A 4G24A 1KC1A 2D1YA 5IFKA 1Y6FA 3HKEB 3MF4A 3BJEA 5IANA 3ELUA 1NNLA 4AY4A 4YP5A 1ZGZA 1YR6A 2I6GA 2IX3A 1FNNA 2AUTA 1JEOA 3LDUA 1P3JA 2V7GA 1JFFA 3PFBA 5JNSA 2AVDA 1QU2A 3SCZA 1NW3A 1PJ4A 4L27A 4ZV4A 1GKIA 3GRAA 3MLBA 5IU6A 3VU0A 4EYEA 4HYTA 1CQJB 4ZOLF 2VDJA 4I8DA 3KB8A 1SXJC 2KLHA 1FRFS 1Z38A 1YZKA 4PWZA 4DLBA 4P4TA 3E81A 2C94A 3TL6A 1KTIA 4CF3A 5WRFA 1OA1A 2CFSA 1T36B 1OX4B 3CB2A 1N4AA 5I7FA 3PUJA 3WXMA 1KQPA 3QMVA 1XXHE 1M6YA 4NZYA 3WV4A 4GYYA 2DR0A 5HZKA 3EPHA 5KVVA 3BRWA 4E4YA 3TOCA 4BDSA 3QI2A 2Z1MA 3OOJA 1V2HE 4EJ6A 4K88A 3WBBA 4IICA 3V9AA 3W2GA 4D9CA 3ZGNA 1MRZA 4EGQA 1C1XA 4BX0A 1O3YA 1XI2A 2BJHA 2O8VA 2ZB7A 3ANNA 4EY8A 3TLYA 1C3JA 2YVQA 4C3ZA 3EVGA 1CQIA 4LTDA 1GPAA 4M98A 4NEGA 2I2CA 2R1UA 3KKNA 2C4UA 3IT3A 2JK1A 2R7LA 2QP9X 3N6XA 3PI7A 3RBZA 2CBGA 3HB4X 1CZLA 1HR0B 1IHYA 2Z43A 1VJGA 2OY0A 1S7GA 3CBQA 1CUHA 4IDNA 3RYTC 3ZEIA 4YV1A 1WKBA 5KSOA 2GCPA 2GJAA 3KE9A 5HFNA 4G0UA 4OCZA 4U2EA 3TNLA 2ZI3A 3CZ4A 1NXWA 1TM5E 1RZVA 4CDRA 2YFKA 2VYVD 5CPFA 1Y3DE 3A3KA 4M38A 1CEYA 2OWDA 3OF3A 4KYVA 3LQ2A 4X61A 4ZYLA 1SQGA 4R7GA 1MNQA 5F5XA 5F52A 1V96A 3IVXA 1H2AS 1N0WA 1W9MA 4WXMA 1O89A 1N75A 2G9RA 1O77A 3AXSA 2IYSA 1W25A 1R0BA 3QBVA 4YDSA 5J4KA 3BL8A 3WO0A 1FQOA 1AZSC 4JJIA 1I3KA 3WL5A 1P2TA 3D6TB 3EDMA 5T4HA 1O95C 1MORA 3EXFB 3UA4A 2QZSA 3PDIB 5TVKA 4BLSA 2JFQA 3EXIA 1ZHOA 4DCUA 3A6GA 5AHRA 1Q77A 1NSTA 1XRPA 2QJTA 1KVSA 2B9VA 4BPRA 2QWXA 3EBPA 1ND6A 2GN8A 3FI0A 3I53A 3FNRA 3LT2A 2VCYA 1TEZA 1JJVA 4IHAA 4AZ0B 4NARA 4U02A 4EL5A 3OLYA 3A26A 2FR8A 3MHPA 1A50B 5DJ5A 4CWAA 1QKJA 2NTNA 1ZOPA 3AERB 4KV7A 4BBZA 1V0JA 2XF8A 1RWOA 3DO8A 4KO4S 4BO9A 3D81A 6GPBA 1UPXA 4U3JA 2QV0A 1VZ2A 3R7BA 1DT3A 1RSZA 4ZALA 5K9ZA 2XCRB 2B4TO 3BAZA 5DCYA 3C6XA 1XK6A 1H9AA 2ZYDA 2WSMA 4OH7A 3K5IA 2AXPA 1IPFA 3ND7A 2IODA 1ZIOA 2YMLA 4C7VA 1CR6A 3AUYA 4HNAB 1CJBA 3GRFA 5ENDA 3PFWO 2J0EA 3CLTC 1I4DD 2QTAA 1FYDA 3ZBQA 2BKXA 2JAHA 1VFNA 4EFMA 2ZCJA 4RVUA 4HDQB 3KU1A 1CB7A 3JYQA 4MYCA 5CDFE 4XR4A 1VG9B 3L41A 4C78A 5B3AA 1UK8A 2XNDD 3DTTA 3D4BA 3RTAA 3A9VA 3G2QA 3H2HA 5F3WB 3CZ5A 4I4TA 3ESBA 1E5XA 2Q1YA 5DN6A 1XP5A 5KWVA 4OJNA 1XZFA 3ZD8A 1M6VA 4ZVPA 2IWRA 2G9ZA 1YSCA 4LYEA 4U2KA 4GLBA 2VRCD 3H5AA 5CDSA 3FE2A 3O3MB 1KY3A 1M1YE 3UXHA 1E9EA 4DR3B 4TTPA 1BVYF 4HUJA 721PA 4H15A 2PFSA 1Q16A 5ELXA 3IULA 1D0IA 3WJ1A 4DZZA 1V35A 2ZR0A 5ED0A 1QANA 3KKZA 2VDMB 2QAGC 2GB4A 3DZCA 3LLCA 5AFSA 1XDDA 2QOEA 3K0HA 4YJHA 1QF7A 2V9CA 5EXEA 2EATA 1U98A 3SLKA 1Z56C 5FNVB 4L6IA 1YFKA 5REQB 3UUWA 1EUDB 1OFTA 4HHEA 2P9TA 3DE4X 3AWDA 1IHUA 4QRIA 1Q74A 5DV9A 2OB1A 3SKYA 1GNTA 4COOA 1SUBA 3F3KA 3B2EA 4BQEA 1N5LA 1QIMA 3ET5A 1DWPA 4JK3A 3BXHA 3MT0A 3WYAA 4RTMA 3SVTA 1KQ3A 4GX2A 3WGGA 2O5RA 4JL6A 4XRGA 1D2AA 4XVRA 3TLJA 2CNKA 3L3BA 1T8SA 3L40A 2Z4SA 2V9PA 1UC4B 3F6BX 5JXHA 2ZVJA 5TMEA 4HRYA 5FOWA 5B1IA 3ANLA 5DLQC 3WK6A 4GZLA 1PT8A 1G8AA 4O8ZA 4Q3CA 1TZKA 2P35A 5KHLB 2Q3JA 1PGNA 2AD1A 4G1EB 3DNMA 3SBDA 4ODIA 3K0BA 4ZTZB 2B98A 1LKZA 4WN9B 2OYRA 5JARA 1I4TD 4PLGA 5ALQA 3Q1KA 3ZJ5A 1DIOB 2QS9A 2OQVA 3S3TA 2PSJA 1Y9DA 2BDEA 4INPA 4NYMR 1XRQA 2QJRA 5G0SA 3UAVA 2B34A 1KY4A 4TKZA 4EI9A 1K9SA 4JLMA 5F5NA 5SY4A 3ECCA 3QUSA 4Z9YA 4C7XA 1CB0A 2QTBA 4FNMA 1U0SY 5EEHA 2BKUA 4X5OA 4OQMA 1F8FA 1M0WA 1QAQA 2JFVA 4FYHA 2IWHA 3QSGA 3NDRA 2GKGA 3GQBA 4RUKA 3NWOA 5JZMA 1V48A 3DV0A 2IPOA 5LZ2A 3AY0A 3NDJA 4DIKA 3HPQA 3ZW7A 1DCTA 2Z3ZA 3EUWA 3OP4A 4UAUA 2QQ0A 4ECAA 4EYKA 2NTJA 4K2AA 1OGJA 1ZI8A 4GL4A 1KZ6A 1XGKA 3E05A 1F51E 1TUEA 4PR0A 2I80A 4OAQA 2AMFA 4KRGA 3X2SA 2C2ZA 4YCJA 4OHYA 2C4HA 4PYJA 2QYSA 3PENA 2HQRA 1BROA 2W90A 1XZNA 1V7PC 1BHJA 2X5JO 3ENNA 4WVFA 1W93A 3L7JA 1X7GA 2JFBA 4C4SA 3HPRA 3QVSA 4CL8A 4C03A 4XGIA 4JDPA 1RPZA 1E3IA 2C5LA 3MAJA 4MKRA 4L22A 4P53A 4MUKA 4X45A 2VHJA 1P44A 5BN1A 2ZB3A 4WOJA 1IN8A 2ZE7A 1GL7A 1UT8A 2IZ0A 2BPOA 1K92A 3CVWA 3R3WA 5DTRA 3GOQA 3HRIA 3OCWA 4C06A 4OXNA 2ZI7A 1G4UR 3U17A 3BB3A 1SHKA 2J5KA 2OP0A 1BJTA 3DFZA 3OLCX 1RI4A 1Z0SA 1VLMA 4YT5A 2NOAA 1ESZA 3TOXA 1C7QA 2VPWA 4DMFA 1V4VA 2E7ZA 3O1JC 5FI3A 2YUTA 5ANRB 1WU8A 4ARIA 2XTMA 4GMKA 5JE8A 2FSUA 4PG7A 3GD5A 4XCQA 1FCJA 3WC4A 5HRCA 3HXOA 4DV6B 2WUDA 1K5DA 3QKRB 1K7EB 3BMQB 2R8PA 3GMSA 1ETUA 2ECKA 3IQWA 4IOLA 4LHWA 4LMPA 4MV8A 1EZ4A 3KQWA 3SKVA 3PVSA 3PQ8A 4G1VA 4QBTA 3TOZA 4JT2A 4QOSA 1P0QA 3CVJA 4FMDB 4DNPA 4PZEA 3M89A 3HVUA 4DRYA 2JAXA 4OIMA 3J81k 1N2IA 2HWKA 4OLJA 1QH1B 2Q27A 4HD8A 4FOPA 4OK6A 4HSGA 1E4YA 4UBNA 4XQEA 2PMEA 4DYVA 2GTPA 2H9AA 4D0RA 1YL7A 3GT4A 2YDYA 4QPNA 3G9QA 4P5PA 1G6HA 1K4YA 3T38A 3USZA 3DLTA 4GECA 2GO7A 4GKVA 5JAUA 1EBUA 5FTMA 2J0SA 3BD6A 1PSDA 1XEXA 2POCA 5KAMA 3VISA 4C04A 4KKXB 5KOIA 3BHMA 3H2SA 5CLJA 2IOFK 4NCKA 5E2BA 3PHHA 5EPEA 2Y93A 4LDQA 2Z0MA 1D8TA 1GXSB 2WKPA 5EZ6B 3BMNA 1H4QA 4RANA 1PRYA 4C4AA 2VPXA 4TUYB 4BHTA 3GHHA 3ZV7A 4BCDA 3FETA 3W3AA 3VU9B 4NMMA 5EGNA 4YQZA 4C2AA 4EO4A 2YJZA 3TLZA 1ZD3A 3IAS6 1N78A 3ZDQA 5FOVA 3H6KA 4FP9A 3ZD7A 1F7UA 1D07A 2HA2A 2PTHA 1E20A 4I5GA 3A6HA 5DEIA 3IMEA 1XJ0A 5T4FA 3R3SA 3O8BA 1ZNZA 4LF7B 2ZWMA 1MA3A 1AF4A 2E9SA 3MWDA 5CT9A 4L08A 4KOEC 3X2FA 1MB0A 1N9KA 3K8YA 1HDRA 2QL5A 3WGYA 1ZOLA 5C3MA 5F7ZA 3RAEC 4FHDA 4JENA 4ACAA 1Q17A 3LU1A 5J23A 3LOUA 3DEJA 4CMIB 5C5IA 1TK3A 1ZD1A 3AIKA 2AJLI 3KZOA 1XXLA 2J3JA 1BAPA 4ZVMA 1UFOA 4RQUA 5HR5A 1ZNWA 2XWBF 1XA4A 1Q44A 2JAUA 3KOUA 3B1JA 3P9ZA 4HXYA 4JBIA 5J63A 2D2EA 4EYGA 1KZ4A 2Q6OA 4FMCF 4QEZA 3EUEA 4YRTA 3VJMA 4Q37A 1YB7A 4LOAA 1ENZA 2XB8A 4RGYA 5EE1A 4DADA 3G6KA 4XIYA 5BXYA 2V7UA 5TT0A 4E1BA 3AU9A 3IDSA 3JVUA 1T2FA 5H3HA 2C7QA 1NOJA 5BSGA 5FLKA 4EAQA 4FJ1A 3UWDA 1OYWA 4ZOLA 4BEJA 5C4IA 1SVIA 1FSZA 3CRMA 1T1EA 1Z08A 3UMCA 3QA3E 1PNOA 3PUVA 2OCGA 1CJMA 1O03A 2NO7A 2ZSIA 1KK3A 5K2MA 4R8KA 4X54A 3JQDA 4QATA 2QVBA 2VPZA 3NBMA 2QA5A 3QFRA 3BRWD 4UTVA 1NNI1 4EIWA 1SWVA 5A7GA 3GGDA 4JFAA 2O8FA 4IVPA 1G9SA 4UKDA 1VE7A 2X86A 4K81B 2APJA 2R65A 3OZUA 4MR9B 3AVWA 4KE9A 2XMGA 2BH9A 5HS6A 4B17A 4O0LA 1L4NA 2FPPB 3WL4A 5J4LA 5K8UA 3K0CA 5ESRA 5HPYB 1T3GA 2YJNA 4OQFA 2ZI9A 3Q6NA 2O8DB 3AVTA 2I99A 3T3DA 5HJ5A 4MVYA 5I9BA 3DZKA 4KXVA 5BV8A 4KAFA 3MTDA 2MIIA 1QRUA 1R6DA 2VK4A 1A9XA 3TLGA 2CLHB 1U2RA 3NKFA 3K30A 2Q5QA 1QMPA 4X66B 1G5IA 3LX5A 3X2EA 3MOGA 3DMFA 1XTZA 1G8FA 4UCQA 1ULUA 1C8KA 1E9BA 4Y9RA 3OVMA 4D5EA 4N40A 1A9TA 1GNPA 1SU6A 2O5CA 2H85A 3RI3A 3KYCB 3ERCA 4AP9A 1XNJA 2VYCA 3O4RA 2YFHA 5ENZA 5I4KA 1HDOA 1K86A 3N5KA 4E2WA 4PNZA 3AHHA 3ZWMA 4F6LA 4BBJA 3WLIA 4QYSA 2MMGA 5B5SA 1RJFA 2I2XB 1MX1A 5BMVF 4Z3OA 1CUIA 3DG9A 4FMBB 5EVJA 5EMKA 3NTUA 1UBNA 1VPTA 3D59A 3IKLA 4U00A 5HZMA 2VNJA 4ARZA 2FN9A 5LOVA 5AIAA 3CX3A 2TRSB 4HMOA 4H7IA 4CFZA 4PZZA 4P3PA 4JLJA 3LP5A 3DC7A 4CBVA 4FBMA 4Y1EA 1TAHA 3BA1A 3U9TA 4WADA 5IT5A 1ZCFA 1G8KA 2CJWA 3U81A 4EZBA 2CT8A 1OWLA 2A7QA 3EEQA 4R69A 5LR6A 3SOZA 3M82A 3MJEA 4H3VA 3NV7A 1YVPA 1W2WB 2A9FA 5JUWA 5KJFA 4UEOA 3DWIA 1L4GA 1V6SA 2EDCA 1O6ZA 2YXLA 3CF4A 4NMHA 3I2FA 4QDJA 3FUUA 4BB0A 4Z3DA 4KDEA 3JARB 3RIGA 4ENQA 1NXTA 1UIMA 4B8YA 4ENUA 2Z98A 2QBYB 1CQIB 1RM3A 4FGJA 4BNFA 3A4NA 4G26A 4B7UA 4BC1A 1D2CA 2OSVA 1RWNA 1HYEA 4CM6A 1P5RA 3OPYI 2HU8A 1D9ZA 3C24A 5HTOA 3LDGA 1C0LA 2JJYA 1SGWA 1Y6JA 3HVJA 4ZO6A 1LRJA 1YTLA 2VT2A 2IYQA 2NXEA 3O93A 1JP7A 3P9NA 5H3CA 4A0RA 1O1YA 2JLSA 2AN5A 3C3CA 3KQQA 3L79A 3OAAD 3AHFA 2KLBA 2EBHX 3LI2A 1FSSA 2R2AA 2P5UA 4I1VA 3SXUB 5CB8A 2CL6X 2IYTA 1CF9A 4BS9A 1NNEA 1BC5A 4JXXA 1VE3A 2RC5A 1YNOA 2BE7A 4L3OA 2PEYA 4ARZB 3JRNA 1WPXA 2H08A 5FI5A 3PIDA 3H9BA 3JATA 1T1RA 3NAMA 2WPNA 4YEDA 4CM8B 2GFHA 4DFDA 4DIMA 1XDGA 4P3XA 2JEYA 4HLDA 1JB1A 4R98A 3G2HA 5FBKA 2GRJA 2PPLA 2WM2A 3GZ4A 2EERA 1EUZA 3M49A 3QVKA 1T9ZA 4RZ2A 1OBVA 2JI4A 3R5FA 1F9EA 3UAZA 5L3QB 3WGOA 3ZLUA 2ET6A 5ALDA 1REQB 2WWFA 3K7EA 4MV6A 4M46A 1BRTA 1Q7EA 4DLVA 5D00A 2RMKA 3H0KA 2QVYX 5HM6A 4BJ5A 1CT9A 1WTAA 3HKDB 4C4PA 4P0PB 5BV1A 1UPUA 3HKEA 4LOJA 1I1HA 1OTYA 4HT3B 3DSRA 1I2MA 3RVJA 4JU8A 3TRDA 5B7QA 2G07A 2ZRJA 3REOA 4QWWA 2GS9A 2BTEA 3ELYA 2KB0A 3W90A 5AW9A 4MQEB 2XEDA 1ODIA 1TK9A 1J97A 2NYAA 3QUBA 2CVOA 4FOLA 4MUNA 2EEZA 2Q3DA 4EBFA 4OKSA 3O8CA 3RUPA 4J7CA 4Y8VA 3KXIA 3C7KA 3LD9A 3BRCA 2CMKA 3O95A 3T3GA 1EA7A 4DCGA 2CHFA 2INGX 3VOSA 4MW5A 3W6OA 4HH3C 3UH0A 1KFEB 4R2KA 1UKAA 1UOOA 1ICIA 4DREA 2CDRA 4NX2A 4F4IA 1BMTA 3ZI7A 5BN3A 4DSZA 3BCHA 3QU7A 3OA2A 3OF2A 1NNUA 4N6OA 4NZMA 4RYLA 2ILTA 5C3UA 4LDAA 1T91A 2HY7A 2MSLA 4R83A 4YWJA 4EG4A 2I2AA 3KQPA 1KFBB 3LWNA 5KS2A 4DVGA 4QG7A 5IABA 2C7OA 3K1AB 1SRQA 4ND6A 1T4CB 1TZCA 1U3TA 1DWOA 5PGMA 4N5IX 2QD4A 4GM0A 4OY3A 3A2LA 3O7WA 5C7LO 1QG0A 3WLOA 4PANA 1J8FA 2GHRA 3W8DA 4DWJA 1YB5A 3D4OA 4UM9B 4YCLA 5IWAB 4GMHA 1R6BX 3U7RA 4X1KA 4M49A 2IH5A 2BFNA 2WSSD 4M0KA 3OWHA 1Y9ZA 1J8QA 2ZAYA 4KYTA 1BXZA 1WD7A 1Y1SA 2ZBEA 3P9PA 1RTKA 3IVGA 2HMVA 4R51A 3BMXA 2QZ4A 2QN1A 4X7BA 5K3FB 3G79A 3L8DA 4LYGA 5DGHA 5K8VA 1B6SA 3A6LA 3UB3A 5JOQA 2AXEA 2ZYGA 3LVFO 5H82A 4JZKA 1PD0A 1UQTA 3RJMA 5D3MA 3DBHA 4BGVA 1TO2E 3RWMB 1HFWA 4BV3A 1KQFA 3NBXX 3TAXA 5FFNA 2FPIB 4TV9A 5GJVC 1PFKA 2ZWOA 1G2OA 3ZQKA 2ECFA 3MWYW 5BNIA 2N47A 3W3AH 1B23P 3E7PA 1TA0A 1ZH4A 3FNIA 3PNOA 4BP3A 3KBBA 4V39A 2HXSA 3IEIA 1E89A 3C5WP 3GY0A 3LY9A 3VQTA 3HJHA 1NOKA 4N9QA 3WLLA 3LX6A 4DABA 1GTRA 2J0QA 3D3QA 3FIJA 4Q4HA 1Y6RA 4F4UA 1JG7A 1HI9A 3F5SA 3LYUA 3VHQA 1H8HA 3VR2D 2OBBA 4EKDA 5CITA 4TSRA 2EOAA 3FDIA 1CVLA 3FZEA 4LW8A 1BCSA 1CY0A 3EA5A 4N5HX 4OM7A 5GWXA 1XMXA 2A0KA 3OEHA 4JQOA 1SHTX 5AW3A 2FJ0A 3GAFA 2JHGA 2IITA 4DLXA 3IV9A 1M0SA 1S3IA 1HTTA 1BMFA 2PWPA 3RTDA 4IDPA 1OW3B 2QPLA 1R0WA 2WNIA 4OP1A 3WLQA 3HR4A 3WGNA 1YK1A 5AVRA 1XYYA 3W06A 1MC4A 4LOKA 1MF7A 3HDTA 5JQGA 5CRIA 5BSHA 1LEHA 1V6AA 3TTTA 2OZVA 1KE2A 4D0SA 5K5EA 3QTTA 5C5DA 3O94A 4J16A 2WU1A 1JWAB 3DZFA 2CZCA 4IO1A 1DBIA 4D9HA 4DMRA 2ZTMA 2BKLA 5COAA 3GMIA 4M7PA 1IXKA 1H0HA 2F3QA 2Z5LA 4AECA 1TAUA 4KR0A 3PUYA 4IY1A 1SCBA 3A2NA 1E60A 4G85A 1H0SA 1T5DX 4MAAA 4XA8A 2DULA 3DOJA 3ZDBA 1M3SA 4UQLA 2PZGA 4PLVA 3HBNA 1USWA 1YULA 4DPMA 5MFPA 4U5XA 1ECPA 2QD2A 2C88A 3QJGA 2HHCA 4C0SA 1FB5A 3FFBA 3WIDA 1GYQA 3B8HA 1IN5A 4KXMA 1QCZA 3GUUA 1NVWQ 4UDOA 5EQFA 3R8XA 3HNOA 3M0EA 5IJWA 1UDWA 2XQGA 1G8MA 2DHRA 1A8PA 3EIQA 4K6OA 1D03A 5T64A 1H65A 2B3TA 4DDWA 2PXAA 3LMKA 1I14A 4I7EA 2J9ZB 3QBTA 3HCBA 1GPYA 4JEIA 4OGGA 2HSDA 4EY6A 5D8DA 5JEDA 2R4TA 1T43A 1HF3A 3JWHA 1NT4A 3EPLA 1DEHA 1WF3A 4IDEA 1Y0BA 1KJYA 2IIBA 1HZJA 4HDMA 3ZLBA 5JJLA 1IOLA 3ODPA 3I6IA 2D5LA 3V7FA 1A7UA 4E13A 1M2WA 2V5UA 2P9JA 2B1IA 2V7XA 1QYVA 3L7NA 2X40A 2VCEA 2FSVA 1WVIA 1L9KA 3GLIB 4LMAA 3UK0A 2X7HA 1V5FA 1N77A 1J2JA 2G1KA 2SCUB 5DX0A 4TYWA 1EX1A 4I3FA 4QUHA 1U63A 2ZK7A 4IZOA 4YQYA 4TXJA 1DKOA 4DV4B 4HAVA 5ERXA 2JFFA 2QSZA 4E70A 4XB6B 4WWHA 2GZHA 4RELA 2QD1A 4RD1A 2ZUCA 1CJUC 2QB5A 3UJBA 2VHEA 4I1PA 5EUBA 2B6HA 3P2YA 1T10A 2HO4A 2R8BA 5DT2A 4ALNA 1L4UA 2AX3A 1AXRA 2XZDA 3DOOA 1ZAYA 1X14A 3ZBPA 3FBTA 4LZAA 1TDJA 4JV5B 3DLIA 3U3JA 1OAAA 4OUKX 2JIPA 3A4VA 2SBTA 3UM9A 1SQFA 4G9GA 2PUTA 5T8KC 1WXIA 4QRHA 2HYDA 1USIA 2IZ5A 4MAFA 1PZNA 4J4HA 2IU6A 5AH0A 1J2TA 1OBFO 1F2TA 3PR1A 2QZPA 3R7WB 3WYNA 2C7PA 1ZR2A 2I7TA 4O0MA 3IAS1 3N58A 3V97A 4AMUA 5GJBA 5ADHA 2JAQA 3MOIA 2ZBUA 4RBNA 1KGSA 2NO4A 4U2BA 4UDNA 1IUNA 1RPTA 5BP7A 2UUCB 1SUIA 4HN4B 1FP2A 1BX1A 1DS6A 2WE7A 4JUDX 3AP1A 2C2WA 2P9HA 2RJ3A 2Q07A 1X7ZB 1ZUD1 3T3HA 3GJSA 1IUPA 5ALYA 1KTVA 3AHIA 2W8BA 4Z1OA 3NWJA 2IYLD 4LOLA 5EMLA 2H3HA 1SQ0A 2ZWIA 2BLNA 4BKPA 2ZT6A 1WUKS 4KLNA 3R0ZA 4TLAA 4KIGA 1NBEA 3WQBA 1JGTA 1F0YA 5IKEA 4PZYA 4WXPA 1WHSA 1DXOA 3NKVA 4DGQA 1FL9A 3DCNA 2DFPA 2X6RA 1LW6E 4BLTA 2EKDA 4FD2A 4C9BA 2IE0A 4W1PA 3W5JA 3QVMA 4P32A 4D45A 4CEIA 4EVIA 3PL1A 4OXYA 1Q7RA 3DOUA 4U9IS 3ZV5A 3CMCO 1YGYA 2IXBA 4CL3A 4O4LB 1WOYA 3KHUA 4JJEA 4OQEA 4MVJA 1G1AA 4B80A 3ESYA 5GM2A 4JJ4A 2FW1A 2A7XA 1RFLA 1E9FA 4AB1A 2IOYA 1IH8A 1RP7A 2IHVA 3PHIA 2ZBRA 2Q3EA 3HXLA 3MJFA 3NM6B 4X41A 3UK2A 3WHPA 2CD7A 2B0CA 2BF4A 4GWGA 5IKPA 1V25A 4GG1A 4O3FA 5DBFA 4ZVQA 3B1ZA 1LPMA 1QFSA 1H5UA 2XWSA 5AJZA 5FTKA 4OHWA 3V34A 3U7GA 4L2IA 3SC4A 4KI7A 3LGAA 3PXCX 4I1UA 2WD9A 1N8NA 2JCGA 4NR0A 2GPTA 3BGWA 1OLUA 4OFWA 13PKA 1QPZA 1C0KA 2FEPA 3MTBA 2CL5A 4S1WA 4X65B 2IU0A 4MJ3A 1ZEMA 5TGTA 2WQ7A 3T9DA 4EGFA 5IS2A 2M1XA 1HNNA 4WXHA 1M6WA 4CUJA 2A3RA 2H54A 1ZP6A 1YS6A 2G76A 3CUWA 3GELA 5IBPA 3ZHCA 3ZXYA 1WHSB 3KAKA 3T7EA 2BKEA 1AGYA 2W2QA 3M1AA 4FOSA 5F9MA 5M7EA 1YJQA 3KWMA 3MXOA 3A58B 4GWKA 3BGSA 5TB5A 3ENWA 3F47A 3LNTA 2J5XA 2GI4A 3EASA 3HCEA 1O4WA 3FWKA 5DTMA 4GGPA 4AM8A 1ISRA 1PN3A 1NBIA 4P7JA 3C1UA 2GYUA 3M4ZA 2XYVA 3MJ4A 4WNAB 1B6TA 3MCWA 3SR4A 4UHEA 3T1TA 4E5YA 4INAA 1GA1A 3FOBA 4DLKA 3WIBA 2IYFA 1G55A 4U7TB 2BDUA 2I6FA 2QR3A 4RM3A 1IUOA 3B3FA 3WGVA 2PL3A 2AH5A 4WE3A 1FDTA 4WCFB 3SIWA 4DS3A 4RK5A 1TECE 3GJXC 4ZV7A 3L9WA 3PR2B 3LF2A 4XTRA 5A3SA 1EEXB 3ZKAA 2O2CA 1UJMA 1JJ7A 4O2BF 1DJOA 2POQX 1I3CA 3GDHA 3QOFA 1N34B 3RRMA 3ILVA 3BICA 2VTBA 3NAGA 5LQKA 3DEFA 4BNXA 4IJKA 2QRKA 3VU3A 2QX9A 4L4RA 5K0CA 1N3BA 5IMBA 3UGQA 1M1NB 10MHA 4OOFA 1PEDA 3JRXA 5U9CA 4LJ8A 1ZOOA 3ZK9A 1PR4A 5T3YA 2VWPA 2BT4A 3M70A 4X7MA 3EA0A 3IUNA 2WB2A 3LUKA 2C2BA 2VP4A 5TVGA 1IXSB 4NOMA 1SKUA 2HCJB 1RXEA 2RJOA 1NVAA 2YJ3A 4RTSA 2H1CA 3NM4A 4ITUA 2IDMA 3CX7A 5GIPE 5KO2A 1XN1A 2YQ5A 3M6FA 3L7IA 2P6PA 4CV0A 2B1QA 4CTNA 1GDTA 2QGZA 1ZH2A 4ND4A 3CPEA 2J6HA 2YQ4A 4BNDA 1WCV1 1GKUB 1EI9A 1OFGA 1V16B 4JLDA 5IC6A 4WL0A 1PNTA 2LVBA 5SYNA 3DO6A 4R54A 2WJVA 4NONA 1KA9H 4W5JA 4OHKA 1Y3IA 1YQUA 3GLVA 4DOMA 5LQJA 3G17A 5TGZA 1Z68A 3ZDXB 2WAOA 5I7VA 4C0AC 2QV7A 4Z2AA 1HOTA 1E6KA 1RHRA 2KYRA 2BI8A 1OTHA 2G7MC 3EC7A 3HU3A 3I23A 5IKMA 1DUSA 3P71T 2PH7A 4MDEA 2I1QA 1RM5A 1YNSA 1NZFA 2H07A 1TIPA 4IVQA 1J0CA 4MRNA 5JPIA 4RE6A 4TLLB 2OTCA 1W88B 2Q0XA 4PPNA 2CXSA 1JDBB 1S2IA 4HI0E 4CF6A 1BH2A 5BW8A 1UPTA 2WWTA 2KE5A 3SZRA 5EJ8A 2JGLA 3VHXB 1CZHA 4GMGA 1GZDA 2VT7A 4YV2A 2A0UA 4NULA 2HEGA 5KYUB 1NYRA 2RI1A 1WXQA 1V39A 2CF6A 1OF1A 3EULA 3HCAA 4XFJA 1KDOA 3CE6A 5DBOA 4INZA 2H1SA 1M67A 2J5RA 5CCEA 4AJ9A 4B9EA 2ZCVA 1YCFA 5DGCA 1RQGA 3PV0A 4FVTA 1JT9A 1Z28A 2QD3A 2YV2A 3EXEA 3HA3A 3T4XA 3VR3D 4DDKA 4DANA 1HQCA 5KWIA 2AG6A 4C5BA 3FPGA 4P1ZA 3DMNA 4PHFA 4RXMA 5C52B 4X7RA 5SV2A 5E6SB 1XXHA 2QRPA 1IQRA 2DPLA 3T5PA 5JSZB 1FQWA 1RQ7A 2XE6A 3L0PA 3L6OO 3O6VA 4MA0A 5AKJA 3RTEA 4F2PA 1Z15A 4F9EA 1TMYA 2VUUA 4D97A 3V3TA 2WLSA 1WU7A 2YY5A 3BOSA 4L8VA 1KH3A 4KGVA 4HBGA 4O4LF 4L50A 4QT0A 5JALA 4YPVA 2QUAA 4DC1A 2F4VB 4PINA 1RXUA 1NLMA 5H9VA 3LUAA 3QA9A 3P26A 1CQWA 1G3RA 1GUBA 1QGUA 4X85A 3L1JA 4FI3C 4AO7A 1N6NA 1M33A 3SFZA 1EX7A 3RRXA 3W79A 1EHCA 2G83A 2ZYVX 5BQ3A 1L7RA 5JHGB 1ZM9A 1R0RE 5AR1A 4LJYA 2AOUB 3IDAA 4IZ6A 1M6VB 3K96A 4QX6A 5LCXA 3DF7A 1T3HA 1KHTA 5G4LA 1GU7A 3WISA 1VRWA 1Z4IA 1L7XA 4P6VF 4UQOA 4RJLA 1LBEA 1G21E 3HH8A 3V8PA 3U39A 1CIPA 5IK2D 5KTPA 5IJ0A 2QMUA 1ECFA 4O4LA 3HDGA 1T1SA 3OLXA 3L49A 1KY2A 3PQ3A 4FC7A 3LWZA 4XWKA 1ZMXA 1Y3CE 4YRLA 4ENTA 2BFCA 2DFTA 4BUCA 2PMFA 5FI1B 4DLNA 4F3NA 3W5BA 4QG3A 1Z4QA 5F77A 2CB9A 1N2CE 3NIWA 3OEHD 4K6GA 3RF6A 1Z0ZA 1EEHA 2Q9UA 2FMKA 2XB9A 4MARA 3W2IA 3K71B 3MS7A 2HWWA 1E6LA 3CPHA 1ISPA 3H86A 3NS7A 4LE1A 5KOYA 3DWEX 2X0FA 1XTSA 3GFVA 1FVOA 3OKFA 4Q3AA 3Q7PA 4KQWA 3BUSA 4A7PA 4HB0A 1XHEA 3TNJA 2J3HA 2C4WA 3VR4A 1M7HA 2Q2QA 3UB4A 3I6BA 1HC7A 4EX6A 2J0UA 5KNDA 4YJ3B 1E77A 1DVRA 4BYGA 3COYA 3GFSA 4V0OA 1K0FA 4KR9A 4CQMD 3UMGA 4W5HA 4OJQA 2FVYA 3HFSA 2WZBA 1EK6A 2IIQA 2JGKA 3DVQX 4EG3A 4CRWB 2FV8A 2DHEA 3X1DA 2Z9BA 2PTGA 4L75A 4QRDA 4RKFA 3GCGA 2IEIA 3FZGA 5FPPA 2W70A 3SXPA 4BO1A 5IJ0B 1Z6PA 2RJNA 5K3BA 3KQKA 4F7WA 2PIDA 4E46A 4F1JA 2CUNA 4UUOA 2XF2A 1A5TA 2C5BA 5JJIA 2FX3A 3O03A 4X0EA 2VDRB 3VC2A 3VTZA 2O8CA 1X15A 4FWIB 3JPWA 2XQVA 4N1AA 1A1VA 1H0RA 3EPPA 1QP4A 5JSUA 2OGUA 4HLCA 5C8VA 2HL6A 3SZOA 2VSXA 2HSGA 1XCBA 2I4LA 4G5YA 5F7XA 5JZSA 2CV2A 2WHRA 4PYMA 3A1UA 5ELMA 2O2DA 2Q5HA 1Q0LA 1QUEA 2GSDA 3N28A 4PCLA 2PUHA 5ELLA 3IP7A 1GSHA 1P9LA 5AJUA 2DCMA 4JSTA 1JR3D 4KBFA 2HBYA 5G1PA 2R7NA 4ND5A 4RVHA 3VI4B 2JIBA 1XIVA 3JQPA 1Y82A 3FKSD 1RJGA 1FMCA 3JV7A 4XVQA 5GGXA 4LJ4A 3SLRA 2PO7A 1SHZA 2YYYA 2QPAA 3M5DA 1J09A 3PG5A 2BFOA 1SHLA 4FDMA 4MVJG 5K20A 1T9BA 1E0JA 1M8JA 4UHHA 3AUUA 4MPPA 3A6JA 3PQ4A 3WLMA 1E2BA 1DAKA 1AS3A 1SBCA 1ZINA 2PXXA 3FXAA 2E5FA 3G5MA 1KNQA 3EXEB 4UCWA 3VZRA 4BMPB 4AJKA 4HJRA 3VH2A 4ZAXA 3TZCA 1TM4E 2V1UA 1NJGA 1OLSB 2PYIA 4UNPA 5BNFA 4FHFA 4B4WA 4KN9S 4LSMA 1XD2B 3JD0A 3GAMA 3PE3A 3CRW1 2QSYA 2GXQA 1YRYE 3MWFA 4OQ4A 2H52A 3HP4A 2XDAA 1GGHA 2D2VA 4FOOA 5E8RA 3LQYA 4ETWA 2K5UA 4IYJA 4CI9A 1K97A 3OTHA 3AHGA 2ZYWX 3OA0A 3ZY4A 1NVTA 3GLFE 3L1HA 3HV0A 1A8IA 1I1OA 1FVHA 2WT4A 1WBDA 3NLLA 4MW4A 2MYUA 1IK6A 2RHTA 3JCZA 2PWAA 2REBA 2YWCA 4RSMA 3OETA 5T8KA 3MYYA 4YAFA 4G4SP 3P2JA 5IAGA 1KZGB 3CG0A 3ETEA 3IVAA 2YHSA 3FX2A 3OCUA 4JELA 1E9SA 4KW7A 5AK4A 4BO7A 5BVHB 3FSGD 4H6XA 1PLLA 2Q2WA 1P7WA 1POWA 3ETHA 2IY8A 4V0LA 3UYLA 4YAWA 4QYXA 1J42A 1O0SA 2XGMA 3PB3A 2DH5A 4MQBA 2BD0A 4NPCA 1OXTA 1UCFA 2E18A 2DKOA 2ZUBA 2B2CA 3HR8A 1LDBA 4DG9A 4E2ZA 3OLWA 5CDYA 4OX9B 4Q7QA 1GT91 3E1KA 2OD9A 3RC7A 3FPLA 5FBLB 1W4ZA 4RULA 3GGPA 1EGAA 3VI3B 4HZUB 4ZI3A 4Q03A 3O83A 4YMGA 1K5HA 3WA6A 5AM2A 3IUMA 2VDKB 1UT5A 4JB3A 4WFJA 1MAUA 4M55A 2AMVA 3E0QA 4BMOB 5DHPA 4BNWA 3HCNA 5C7IO 3MK31 1O2DA 5BXQC 3KZKA 1G5QA 3FD8A 7YASA 2QRVB 2WAYA 5I7EA 1I6WA 3DT9A 1X87A 3D2CA 2N1BA 2HREA 2AIRA 4A2WA 4EGJA 1V6CA 1WETA 1WP4A 1JQDA 1A5AB 2O1WA 2QX7A 1WXWA 4WEOA 2I9KA 3D6NB 1EP9A 2IOQA 1QQTA 3TDKA 1CR2A 1Z6AA 5AW0A 3ESQA 3A2KA 1DRKA 4PZUA 1L5NA 1ZIXA 2PD3A 3OPXA 1OREA 2HRRA 3LP6A 2JIRA 4DMLA 3I1YA 3HO8A 4LJSA 3LL4A 4ZEWA 1XCLA 4QU0A 5K0TA 5JLJA 1PLKA 2BJVA 1KMNA 4GOXA 1NQVA 2QVXX 4QYIB 3RVRA 5BUZA 2DFDA 3T5GA 3VVLA 2PJRA 1A8HA 4WEQA 1P3Y1 4ZI7B 3PX7A 3M34A 3ORHA 3NIBA 2ZE5A 5I5GA 1U2DA 4GNRA 5LD2B 3FKJA 3JWJA 5AESA 3EWAA 5KOJB 1RQ2A 1JHYA 2FKNA 1K2VN 3I5UA 5AI9A 4EH1A 2FPPA 4MITA 4KQ6A 4WY2A 3ZWDA 4EJ0A 2I4IA 4TKUA 2HIHA 3PEVA 4LZJA 2YMPA 4YFVA 4G0ZA 5EE9A 5FUWA 3PDIA 3PF9A 3O2NA 4XJTA 5HIMA 1E92A 2Z6VA 2ZPUA 2O3QA 5DCWA 4J0QA 1J25A 5HOEA 3L0SA 3W34A 4NHEA 1K6MA 1P2VA 3QE2A 3DBOB 4JQZA 3BF7A 2C2GA 2Z58A 4DPLA 4G09A 4FFOA 1CZRA 4LJ6A 4YACA 4EENA 4TRJA 4JY7A 4IGFA 2JW5A 1D04A 4TYQA 5MGBA 2TYSB 4KWTA 4CDMA 1NYTA 5HK8A 3AEXA 2D06A 2O7NA 4H60A 3S7ZA 5JT1A 3THXB 2R1VA 3L01A 3QM1A 5JRDS 3MTGA 1MHTA 3QOYA 1AY0A 4FYYA 4P92A 1WSDA 1QRAA 4RQBA 1IM2A 1AZWA 1HMPA 1MJHA 2CE2X 2QN6A 1JDPA 1P1KA 2W4MA 3QMWA 1I2BA 4GQBA 2HPHA 3PDHA 1VPVA 1Q3KA 3Q5DA 5H8WA 2SECE 5GONA 3PEFA 3DZGA 2Q6TA 3HQ4O 3QOWA 4GI7A 1RWXA 4ER5A 2C4KA 3BH7A 3EWIA 2O8EA 4CCAA 4N54A 2OHXA 1EJ2A 2AFHA 2F6RA 1ADYA 5ALHA 3GEHA 2XA2A 1K3UB 1WPGA 4YMLA 1EUDA 2ZT5A 1BE6A 5INTA 2DP4E 3ORYA 4L28A 4Z53A 3LC7O 4Y9TA 4KIJA 2VH1A 4TMWA 3T94A 1BS1A 3K9CA 3L0YA 4Q9LA 2JH9A 3L0BA 2NZ2A 3H97A 3M6XA 3CR3C 1P19A 4I4IA 2R6FA 2IDZA 3DE0X 4NJEA 4B2IA 4HRXA 1LPAB 5KYVA 2DPMA 2VNAA 1LQ2A 2IUSA 1R5NA 1U0JA 4FGUA 3ZQ6A 5LVAA 1YL5A 4YJKA 3RUCA 4CG0A 5FKJA 3TPZA 5F2EA 1RQNA 2FNAA 2ZIWB 4D3SA 2YWDA 2FQQA 1FFWA 1Z2AA 2C98A 4Y6QA 5EKUA 1FDOA 3ZXIA 2BHRA 5ISMA 1G20E 3C8HA 4HQKA 4RGVA 3VO1A 4EB8A 2AW3A 3OT1B 2LIVA 3HBJA 3EXHA 1T3ZA 1K7SN 3P32A 1PEYA 5AJXA 4B44A 2IYZA 5KYWB 5LP6B 1GPLA 3C41J 2ADMA 1E3QA 2FN4A 4D9GA 1UKBA 3RIEA 1JHUA 3ZGXA 5KIAA 3C8DA 1X77A 3U3XA 3M9WA 4KWEA 3EZNA 5HFAA 2ZRBA 1E7SA 4C4ZA 5KAPA 5KUTA 1IXYA 2WMOB 2YXBA 5AJHA 3SBXA 1QDLB 1DAOA 4W9NA 3B1XA 2VJAA 1U7OA 3A6ZA 2PLWA 4XWTA 4AL4A 2PKRA 3CW9A 2NV2B 2WWHA 4CU2A 2X19A 3V7YA 3JQ7A 3BKWA 5SY6A 1Q19A 5DDIP 2BMWA 1DUVG 3OH8A 5KI6A 1QRDA 1OJLA 2RGNA 3ISTA 3IE0A 4A8HA 3BILA 5JXJA 5A4KA 1Y34E 4AO6A 3HUUA 2HPZA 3S2IA 3R4VA 3O47A 2P3LA 1FOEB 4XJXA 2CLLB 4G07A 3JAMA 1KJIA 2H1FA 2JLAA 3GPLA 4RKYA 4ZIRB 2WBLC 1B3RA 4PF1A 1JAZA 3FRHA 1E2UA