1AKSB

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
SSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords ALPHA TRYPSIN
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksB00
2HALA 1QBNA 1ZSJA 3A84A 1QHRB 2NU2E 1LHEH 2A5KA 5FXLA 1HRTH 5A09A 3P92A 1JOUB 3RMOH 3TH2H 4OS6A 1SLWB 2TBSA 1EZUC 1QY6A 1HLTH 1XKBC 2VWOA 1Z7KA 1TE0A 1T8OA 4D9QA 5A0BA 6GCHF 2ZA5A 1HIAB 1UTOA 2Z3DA 1SGNE 3A7XA 1W8BH 1QIXB 1EP6A 2Q6DA 2GDDA 2OTVA 1TX8A 4H6SB 1ZOMA 3H7TA 3RXFA 4I8HA 4OS2A 2AEIH 4X6OA 1SGEE 3M37A 1C2IA 2XTTB 5DK1A 8KME2 1W0YH 2OP9A 4UFFH 1BMNH 1T8MA 3MH6A 5HYOA 1CGIE 1AUTC 5HM2A 1GI4A 4WWYA 3O8RA 3SNDA 1PPBH 3LPRA 4YO9A 3Q3KA 1JIMA 2BY6X 1E35B 4IMQA 2ZZUH 3LGVA 2C8WB 5E2PA 1JRTA 1LDTT 3HK6B 5AHGH 2ZKSA 1AGJA 3Q77A 4X6MA 5EXLA 4JZEH 2IN2A 2BZ6H 2ZDLA 3V0XA 2WPHS 1S5SA 1A1RA 1GHBF 1FIZA 3FP7E 1C5QA 4ABDA 1DE7H 3T2NA 3MU8A 2BHGA 1UTLM 4OS7A 1LHCH 1CA0B 1TONA 1Z8RA 1HAOH 2F9VA 3RMNH 1OX1A 2G81E 2FPZA 1GHWH 1KTSB 4DW2U 1P04A 4AFZA 2AERH 2QGRA 5HGGA 4OS4A 1OWHA 1HCGA 2QXGA 1O0DH 4LK4A 3BEUA 2GP9B 5AFZH 3SORA 5FAHA 1EP5A 1RIWC 4ZKRU 1BUIA 2ZNKH 2V3OH 2IPHA 3CS7A 1GJ4H 1ETSH 4H6TA 5TCCA 2OXSA 1C5NH 1MKWK 1XUGA 5GWZA 2F9OA 1W3CA 1GVKB 2RCEA 5DP8A 1P09A 4TY7A 4HFPB 1SLXB 1MCVA 3SQHE 4ABGA 2XC4A 3UY9A 1C2MA 3RXEA 1SGQE 6ESTA 2GD4B 3UQOA 7LPRA 3DFLA 3BG8A 3PO1B 2F9PA 4M7GA 4I33A 1BIOA 4Q7ZA 1XUHA 2VGCC 1AN1E 1MH0A 1QB6A 1OP8A 4ZXXH 1O2TA 3MH5A 2FTMA 3LGTA 2SNWA 5GCHG 2FESH 4ZUHA 5AF9H 4O97A 1UHBA 1CGHA 2UWLA 3ODFA 5I46H 1SBWA 1GL1A 3D62A 3RXKA 3RXQA 1WU1A 1GG6B 4MTBA 1C4V2 4U2WA 2FP7B 1GBFA 2JH0D 2YNBA 1SFIA 2OINA 4J1YA 4AYVB 1IQFA 3ATWA 4NZQA 1Z8JB 1FY4A 3C1KA 4TY6A 2AGEX 1DLEA 1ZMNA 1AKSB 1TNHA 3M5OA 1MBMA 4CRCA 3MNSA 2QA9E 1GHZA 1DDJA 2B7DH 2BDIA 6CHAB 1MD8A 1S84A 1TWXB 2Q6GA 4Y11E 1MKXK 1O36A 3BTWE 2Z9LA 1VZQH 3M61U 1P02A 1BBRE 1TALA 7ESTE 2VINA 3FFGA 3MHWU 1LPGB 1C5MD 1EPTB 3GY4A 1D9IA 1DWDH 4I8JA 3VB6A 1YM0A 1Q3XA 5EQRA 1TGBA 3LKWA 3A82A 2WPIS 1AUJA 2Y7XA 3RXMA 5LH8A 4B2CA 4BOHA 2FOGA 2B0FA 5E0HA 3BIUH 3LGIA 2GZ7A 2TGTA 1QRXA 3UQVA 2VGCB 3AAUA 1SR5C 1Q2WA 1CBWB 1F0RA 5DG6A 1ZMLA 2SGPE 1AVXA 1YBWA 1GI1A 3CS0A 4UE7H 4INLA 1O34A 1PQ7A 7GCHF 1KXBA 1PPCE 3R0FA 5GCHF 5EW2H 1M9UA 1F5KU 2ZQ2A 1T31A 2FWWA 1DUAA 2G52A 3PROA 1E36B 1G9IE 3E3TA 1YLCA 4THNH 4X1SU 1IQNA 3GCNA 3SNAA 1P03A 3SU6A 1TFXA 1GHXH 1AY6H 3FP8E 4XFQA 1IHSH 2A0QB 2FMJA 2WPMS 1QBOA 3BTME 1NC6A 1NTPA 1S0QA 3BTKE 3HK3B 1GBJA 2TGAA 2FIRH 4OS1A 5TJXA 1O2OA 5DPAA 2AMPA 2GDEH 1P2NA 5C1YA 1FQ3A 1SGFA 4FVDA 3BIVH 3MMGA 3SHAH 1ACBE 1HJ9A 4X1RU 2EI7A 5E0JA 1B0EA 8ESTE 3OY6U 5LPEA 2H6MA 3BSQA 4J2YB 1SFQB 1O2RA 4Y10E 5CE1A 1W0ZU 1WUNH 3QK1A 3GCHB 3RXJA 1TYNA 2ANYA 2ZGHA 2GCHF 4X8UH 2VJ1A 1WV7H 4RKOB 2ILNA 2OBOA 1AQ7A 1XUIA 2H2ZA 3M7TA 1N8OC 3ZV8A 2AIPA 1J9CH 1ABJH 3ZVGA 1DWBH 4MPXA 1Y5AT 4QT8C 1O3PB 1CA8B 1RJXB 1TB6H 1TPOA 1ZGVA 5JBAS 3VXEH 4ESTE 1O3JA 7GCHG 1SOZA 4F49A 3MNBA 1GI8B 1LVBA 1ETRH 2FDAA 4NFFA 3SJIA 2BQ7B 1SGYE 3SQEE 1LMWB 1W11U 1FLEE 1OYQA 4XDEA 4Q2KA 5E8EH 3DD2H 3S9BA 1N6YA 1GBKA 4XOJA 1E38B 1UO6A 1GWAA 4E7NA 1ARBA 4ISHH 2FI5E 1AWHB 1TBQH 1UK4A 4ZHLU 3Q00A 1IQMA 2J92A 2BVXH 1TMBH 2G00A 3SNEA 2P3UB 1OYTH 1O35A 4U30A 4I8LA 3RXHA 3ZZ5A 2BDCA 5JYIA 3KN2A 1O3IA 4DIHH 4K1EA 2CHAB 4A5TS 1VJ9U 1WQVH 1HAPH 2QY0B 1CSOE 1SOTA 2GCTC 5ESTE 1PYTC 1S82A 1F92A 1TNJA 1TNKA 5SGAE 1SGCA 2ESTE 4ABIA 5LPFA 3A81A 4E05H 2P93A 3MO3A 2BVRH 4BAKB 3QN7A 1W2KH 3UR6A 2F9NA 1QQ4A 2BYAX 1O5DH 3MNXA 5A8YA 2Y5FA 4MPUA 1ZRKA 3VGCB 1LVOA 4Q7YA 1O5CB 2VH0A 3M35A 2ZGJA 5DP4A 1JXPA 4FUHA 1FN8A 2JETB 1G3CA 1BITA 2HVXA 3B8JA 2NU4E 3EAJA 1HIAA 1NRPH 1FMGA 5EXMA 4GSOA 1OWKA 2V35A 1GBAA 1ZYOA 1QA0A 3R3GB 2JH6D 3KQBA 2P59A 1F5RA 1RS0A 4YLUA 4MQAA 4DG4A 1ZTJA 1O3AA 2XWBI 4B76A 3P6ZB 1GHYH 2ZQ1A 1HUTH 1QL7A 3RXCA 1ZMJA 2OQ5A 1CHOG 4AZ2B 4ZMAH 1GHBG 3LH1A 1OWJA 4ZAEA 1F0UA 1O2WA 3ENSB 2VVVA 4TPIZ 1QFKH 3SZNA 2HPQH 1Z6EA 3HGNA 5J4QA 3MH7A 2Q1JA 1SMFE 1O2VA 1IAUA 1KIGH 1C2JA 3BTHE 1L4ZA 1NFYA 1O2GH 1GMCG 2AGIX 2ZTYA 3LGUA 2XBXA 2BX3A 1BOQA 2ASUB 2BY8X 2OC0A 1O2JA 3TGKE 2QCYA 1GMHF 4YT7H 1AKSA 5JDUB 1TBRH 4A1XA 2VIWA 1UVSH 3QTOH 4XBCA 2W7SA 1A5IA 1ZR0A 3QWCH 1ZJKA 1ZTKA 4X2XA 5A0CA 1QJ7B 4TYDA 1YP9A 2LNCA 5A8ZA 1GI5A 5FCRA 4DCDA 1N1LA 4K60A 3OX7U 1TX6A 3OTJE 2CF9H 1CU1A 5A2MH 1RFNA 2Y6TA 3SU5A 2F3CE 2HNTC 3ZZ6A 2FX4A 1C5YB 1KY9A 4K1SA 1SB1H 4Q7XA 5K7RA 3EA7A 1THSH 3GDUA 4OS5A 2FZZA 2PUQH 1IQHA 4AX9H 3O8BA 2XC5A 2HLCA 4FUEA 3SV7A 5DP6A 3LJOA 3KIDU 3V12A 4CR9A 4K3JA 2RDLA 4AB8A 5C5NA 3TNSA 3S9CA 2WPKS 1Y8TA 2ZHQH 4F4OC 1MZAA 2H9HA 4JZIA 1OXGA 2G55A 3K2UA 2UUFB 1EATA 4KGAA 3U8TH 1QJ1B 1PPZA 3E1XB 3PWCA 3KF2A 7KMEH 2ZU1A 2R2WU 1LQEA 1CVWH 2R3YA 1ZPCA 3A83A 5T6GA 3UNQA 4X8TH 4FUGA 1CT4E 3T25A 3UWJH 1U6QA 4Z0KA 3SNCA 1AFEH 1A7SA 1HYLA 1VITF 1CGJE 1P2MA 1WSSH 1BMMH 3TJOA 3I78A 4E06H 1QJ6B 1SGFG 1YC0A 1GBMA 3O8CA 3Q76A 2WPLS 3STJA 1IQIA 5FBEA 1Y3UA 2PFEA 1NFUA 3A8CA 1O2SA 1YPKH 3MNCA 1SLVB 4YM9A 2BD5A 3NPSA 2P16A 2QXIA 2XW9A 1K1IA 1LHFH 1IQEA 3PM3A 3MU0A 2ZPQA 5EXNA 1C5TA 4ZROA 4X2YA 1C1TA 2Z6BD 3S7KB 1CE5A 1IHTH 3A7VA 1MU8B 2Z3EA 3TK9A 1ID5H 1O2PA 5DKMA 2PGBB 1UTNA 3RXDA 1HV7A 4R0IA 1GGDB 1ANCA 4ABAA 1NESE 4X0WU 2C8XB 1SGRE 1BBRH 3P8FA 4CR5A 1UVOA 2FOAA 5EW1H 1LVYA 3U69H 3ZZ8A 4XBDA 5GXPA 4IC5A 3P70B 1YPHE 2ALVA 3VB7A 3SGQE 3ZVCA 2Q6FA 1C1MA 2ANMH 2I6QA 1GJDB 4Y71A 2Z9KA 5DP9A 2BLWA 2O8MA 3DFJA 1FY1A 1OS8A 1TMUH 4MVNA 4GHQA 1FZZA 4UEHH 2W7UA 1S6FA 1ELDE 3MWIU 1F0TA 1OOKB 1X7AC 2J38A 2NWNA 3FZZA 1NZQH 1UCYH 3SU1A 1AO5A 1KLIH 1O2MA 2A5AA 2A4GA 3VB4A 4Q80A 1C5OH 3F68H 1AB9B 1K1NA 4GLYA 1G3EA 2ZTXA 4MG3A 2HNTE 1NU9A 1QTFA 4FUJA 3A89A 1TPSA 1C1VH 1EOLA 1RTLA 3D65E 1C5XB 3BTGE 1Z1IA 1H9HE 3A7WA 4NWKA 4B2BA 1O5FH 2VIOA 3CP7A 2A7HA 1V2KT 4MNWA 3SGBE 3TGIE 1TPPA 2DUCA 1P2JA 4HI3A 2FODA 3LH3A 4Y0ZE 3K6ZA 1MZDA 1Q31A 1O39A 2BB4A 3K9XB 2G4TA 1D6WA 1ZSKA 5C5OA 1AZZA 3SI4H 3GCTF 1C1PA 2BDAA 3LIWA 1P12E 2QAAA 1XMNB 4NCYA 3SO3A 1AZ8A 2XWAA 1VR1H 3U1IB 1KDQA 1HXEH 3M5NA 1ANDA 1XM1A 3SJ8A 2FOBA 4GVUA 1V2VT 4NA8A 1C1SA 1QL9A 2A4OA 1TABE 2H5CA 3PB1E 1LPZB 2PWXA 1NFXA 3LONA 1C5PA 3EA9A 1NRQH 1V2JT 1DM4B 2STAE 1K28D 2PLXA 2AH4X 4BAQB 4A1TA 1A61H 2BY9X 1J8AA 3ELAH 3KQEA 1TQ0B 1ELTA 1LPKB 1ETTH 2GMTB 2ZF0H 2R0LA 3QO6A 4TPYA 2BQ6B 1C2HA 2OC1A 2J4IA 1JRSA 4FU9A 2YNAA 1Y59T 3ZZ9A 1UVPA 1EKBB 4NA9H 1ESBA 1SC8U 1MTWA 3OY5U 1C2DA 1P3EA 1F0SA 3GY2A 4NWLA 3ZZ4A 4YLQH 1W13U 2BLQA 4CBOA 3GCOA 2OD3B 5ABWA 1C9PA 1K21H 1LHDH 1BTUA 1GMDF 2A5IA 3F1SB 4BXWA 5EGMA 2FS8A 1BJVA 1Y5BT 3ATLA 1RGQA 1BZXE 1G30B 1O30A 3H7OA 3M5MA 4WH6A 2D26C 4AB9A 1HB0B 1VCWA 2VNTA 3KHVA 1GJCB 4D7FA 4AG1A 2ZPRA 3A87A 1GI2A 5C1XA 1C9TA 1ZLRA 4RSPA 4Y79A 2F91A 1AD8H 3TLOA 1CHOF 2FYQA 1TA6A 5EPNA 4I7YH 1PQ5A 1K9OE 2JKHA 1HDTH 4B74A 4KTUA 4Y7BA 1MMJN 2SGAA 1DXPA 1FY3A 3RC4A 4UD9H 5EG4A 1AIXH 3VGCC 3SUGA 2BQWB 4O3TA 2ZU3A 2FOMB 1NRSH 3RXRA 3TK6A 1C1RA 2BXTH 2PV9B 1EAIA 2P8OB 2D8WA 1AVGH 2B8OH 2BVSH 1C5RA 1GCTB 2BD4A 1MKWH 3F9EA 2ZCLP 1TX7A 4BANB 4Y76A 4INHA 3FAOA 1OWEA 4RKJB 4JK6A 3S9AA 2D2DA 1UCYK 2QN5T 2ZDMA 3TU7H 5H4IB 2Y5HA 3A8DA 1ABIH 2BD8A 3GISB 4E7RG 3ZV9A 1GVZA 1NN6A 1OKXA 1SLUB 3RMLH 2BX4A 3WY8A 2FOCA 1DFPA 3TH4H 5CMXH 1ELAA 1FDPA 5PTPA 3TH3H 1THPB 2VU8E 4IN2A 2PSYA 1TNGA 3M3SA 1V2WT 4KELA 1DANH 3RXOA 4RN6A 1FPHH 4KKDA 5EODA 1TRMA 1YF4A 2ZO3H 3NXPA 1YGCH 1BTHH 1P05A 3K65B 3GY3A 1Z71A 2GTBA 3ZVBA 4XSKU 3RM2H 4NIVA 3GY6A 2UWPA 3QDZB 3U8RH 2A4RA 3RU4E 1DUEA 1TNLA 2R0KA 3ATIA 1SGDE 4K8BA 3UOUA 2ZCKP 1LKAA 1RXPA 5C3NA 1RIWB 2PW8H 1V2ST 2ZTZA 3RLYH 1NPMA 1SGPE 3BTDE 2WYJA 4NA7A 2W26A 1V2OT 1MTVA 4X1PU 5F8ZA 1KXDA 1ZGIA 4MNXA 1XXDA 1PYTD 2FS9A 1C5UA 1HAHH 2WYGA 4K69A 4K5ZA 5EU8A 4K1TA 3KQCA 2P8OC 2VIVA 4B71A 2GT7A 2DE9A 3EDXB 1O5GH 1GBHA 1SL3A 4BTTB 1UJ1A 1MTNC 1GGDC 1O3MA 4BAHB 1DSUA 2Z7FE 1BRUP 2R3UA 2XCNA 1O2XA 3BEFB 2ZG0H 3T26A 1LHGH 1C2LA 3KL6A 3E91A 3BEIB 4ZXYH 1NU7B 1B5GH 4UONA 1GJAB 3RXIA 3GY5A 4JYTA 1O5EH 1TOMH 2FOFA 3P8OA 3BG4C 1EAUA 2C90B 3PMBB 1TPAE 1UTQA 2FYRA 4UFDH 1DWCH 2QV1A 3SU4A 4DGJA 5HMAA 2ZGXH 1BBRK 1ESAA 1MCTA 3E0NB 3EA8A 3AW0A 1XX9A 1KXAA 2O8WA 1ZPZA 3QTVH 1XXFA 1DX5M 3LJJA 5DP7A 3RMMH 4ISIH 4WMFA 3LC5A 1BTPA 2DE8A 4OGYA 4AFQA 2VVUA 1TIOA 1G36A 1BMLA 2WV5A 1FJSA 1C2GA 1L1JA 2GGVB 4ZKNU 4CHAC 4CH2B 1O2QA 3M5LA 5LPRA 3NKKA 1ZTLA 2A32A 5CHAC 1T8LA 1GHAF 3SU3A 4I8GA 3F6UH 1AMHA 1ZHMA 2CMYA 2Y5GA 2Z9IA 1ELCA 3KNXA 4CREA 2WV4A 1C4Y2 1SSXA 4LZ4B 2ZGBH 3PMHB 1P2IA 1JBUH 1P3CA 2PR3A 4D7GA 2FI4E 1PPEE 2NU3E 3T29A 5HM9A 4SGAE 1GHVH 4R8TB 1A0LA 2F9BH 1YKTA 4SGBE 3ZYDA 1INCA 3LU9B 3ITIA 3RM0H 3KGPA 3W95A 4YTAA 1EASA 1P57B 3U9AH 4ISOA 1FY8E 3V13A 1E34B 4NIYA 1C5LH 2ZI2H 2ULLA 1ANBA 1O3DA 2ZEBA 1CBWC 1DLKB 1MBQA 1KTTB 1QL8A 1JWTA 3A85A 4INKA 3SV9A 1EZSC 1K1MA 1O2IA 4B2AA 1Y3XA 1O3EA 1LCYA 1C4U2 2ZECA 1K1OA 2A4QA 3L3TA 1H4WA 3SUDA 3BTQE 5JB8S 1TAWA 2GX4A 2W3IA 4KTSA 3U98H 1Z6JH 4ABEA 1SG8B 2A45B 3SJKA 1Z1JA 1TGTA 3ZYEA 1L2EA 4FVBA 1EQ9A 3RXUA 2ZPSA 5T3HA 1Z8GA 2O8UA 3HKIB 5FPYA 4Y0YE 3ZZCA 2C8YB 3PMAB 5GJ4B 1A5HA 1A3EH 1HAIH 1FXYA 5GPIB 1RTFB 3ATMA 1KLJH 5IYTA 3HGPA 1EX3A 3BTTE 2HOBA 1C5VA 1ZHRA 2BLOA 2D1JA 1GJ5H 1OP2A 4U01A 2WINI 1EB2A 1W14U 1T8NA 1TGCA 3UTUH 2CV3A 3BTEE 4XBBA 4JZ1A 1K1LA 3QLPH 1SQOA 2XBWA 4NIWA 1TRYA 3L6PA 3TGJE 3FANA 2BDHA 4HGCA 4FU8A 3FP6E 1WTGH 1O3BA 4NIXA 1AHTH 1ANEA 2RA0A 5T6DA 1GDNA 1VITH 1A0HB 4DOQA 1C1QA 2J34A 1XVOA 2AGGX 1C1UH 1BB0B 1TLDA 3QGJA 1KXEA 4IBLH 3A86A 2G5VA 1FONA 1D3PB 1V2UT 1EZXC 1QGFA 1EXFA 4JYUH 3SV6A 5HXFA 3LGYA 1S0RA 4FUIA 1GCTC 1GPZA 4WY3A 3T27A 1C2EA 4ABHA 1IQJA 2QXJA 4CRDA 1PQAA 2BDBA 2R2MB 2EI6A 2BOHB 1GI9B 3MH4A 2I6SA 4FXGH 1V2RT 3TNTA 1ZRBA 2BLVA 1VITG 1GCDA 3GDSA 3LOXA 3EE0B 4YOIA 1EAXA 4ZKSU 1C5SA 1EOJA 1UTPA 3RXBA 2BZAA 2Z3CA 1J16A 4LOYH 1GDQA 1NO9H 2R9PA 2EA3A 3SW2B 2LPRA 1XUJA 4AORA 1CQQA 1UVTH 1QB9A 3QX5H 2CHAC 1HFDA 4ISLA 1UTJA 3A7ZA 2GCTB 4JK5A 1BMAA 2W5EA 2F83A 2ZIQH 1FNIA 1KDQB 1VGCC 5EQQA 1RTKA 1P2OA 4O9VA 2WPJS 1T7CA 1YPEH 4DJZB 5F8TA 1MAYA 4MLFB 3P17H 5JB9S 1SQAA 8GCHF 3RP2A 2TIOA 1O2HA 6GCHG 3MOCA 1DOJA 3HKJB 1A2CH 3MU4A 1ORFA 2G51A 2PKAA 3MU5A 1G3BA 1FPCH 3E0PB 1UHBB 5DGJA 5TCAA 2NU1E 1MTNB 4FUCA 2XCFA 1MAXA 1TA2A 1ELVA 1A3BH 2PUXB 4AYYB 3NZIA 1T32A 4AFSA 2J94A 3IWMA 2O9QA 4KP0A 1HBTH 4ZH8A 5FX6A 1EAWA 4FUDA 5L6NH 2ODYB 1SHHB 3GICB 2OC7A 3KEEA 1V2NT 3TIUA 1FY5A 3P8GA 3VEQB 2PTNA 1AVWA 3SUEA 1FV9A 2AMQA 1O2ZA 2Z9JA 4JZFH 1O3KA 3SV2H 4CRFA 1YPGH 1O3FA 1SVPA 4UFEH 3RU4D 1IQGA 1GBBA 3D23A 1TOCB 1WOFA 1UK2A 2FLRH 2XYAA 1D3QB 4CRAA 1JIRA 2PKSB 5GIBA 3S69A 4I8KA 2V3HH 1ZJDA 4TWWA 2OCVB 2FLBH 1QNJA 2JH5D 3G01A 1MQ6A 1QR3E 2SGQE 3RXPA 2G8TA 1NROH 3RXSA 4K8YA 1YLDA 3E90B 2V0BA 1FIWA 2Y82A 5FPTA 4AOQA 4WH8A 2QF0A 1D6RA 2STBE 2BD9A 2CN0H 3MYWA 1O3OA 1BTXA 3RXAA 1W7XH 2VWLA 4GAWA 2BY7X 4A6LA 1T4VH 3V3MA 1H1BA 1PFXC 2HWLB 5GDSH 2KAIA 1KXFA 3GCTG 1S6HA 2G5NA 2GMTC 4WF8A 3BTFE 3PLBA 1BTZA 3A80A 3TITA 3SU2A 3SNBA 1S83A 1S85A 3RXVA 3D49H 3P8NA 3Q3XA 1AB9C 2XC0A 1OSSA 4ZKOU 1IOEA 1G3DA 6CHAC 4X8VH 3K6YA 1YPJH 4A7IB 3ODDA 1NRRH 1W10U 1XKAC 2ZDKA 4IC6A 2PKAB 2GV6A 4GCHF 1CHGA 2O8TA 2Y80A 1F7ZA 2GT8A 2ALPA 3PTNA 4IMZA 1E0FD 4MNYA 1O5AB 1UVUH 4YOJA 2ZHEH 2FEQH 1CA0C 1LKBA 1AE5A 3SGAE 2UUYA 1P9SA 2TPIZ 1XVMA 1A4WH 1AFQB 2UUJB 3DA9B 2SNVA 1MQ5A 1SPJA 4X6NA 2AIQA 2ZC9H 1D3TB 1PPHE 2C93B 3OU0A 4NG9H 1PJPA 2ZP0H 3SN8A 1TMTH 5ETXA 1YCPK 3V7TA 1EUFA 1HXFH 4D76A 5CHAB 3HATH 2OQUA 4WMDA 3MFJA 4X6PA 3HPTB 4B75A 5F03A 4IN1A 3U1JB 2XNIA 1GJ8B 1NS3A 1V2MT 1S81A 1GJ7B 2ZGCA 4IW4E 3UNRA 2VWMA 2RA3A 3SHCH 1YYY1 2FM2A 3A7YA 2VIDA 1P11E 3ZZ7A 5FCKA 2ZHDA 3F9HA 4YT6H 3QGNB 5AFYH 3RDZA 3M3TA 2FX6A 1L1GA 3MO9A 4JMYA 5EOKA 1MD7A 1UTMA 1O3NA 1G32B 4JZDH 1SQTA 4ABJA 1C2FA 2G4UA 3VFEA 3KQDA 1WTHD 1F2SE 1J17T 1DPOA 5BPEA 1UTKA 1E37B 2FI3E 1YPHC 2BM2A 1O2YA 1FAXA 1HGTH 4AFUA 1WYKA 1O2KA 1GL0E 5T6FA 4DT7B 3PLPA 1CO7E 1MUEB 3NK8A 1AI8H 1K1JA 5FX5A 3TJNA 1GI7B 1V2PT 2BMGB 3UNSA 3PMJA 1V2TT 4OGXA 1IQLA 3MO6A 1AWFH 1OWIA 1K1PA 4DIIH 1HJAB 3QUMP 1KXCA 2ZHWH 3SI3H 3RLWH 2CXVA 2CJIA 4Y8ZA 3VB5A 1BTWA 2H1UA 3ESTA 2UUKB 1C5WB 1N6XA 4MPWA 4O03A 4BAOB 1A5GH 5DP5A 1TQ7B 1GMDG 1NT1A 2J95A 5L30H 3UWIA 3AAVA 1VJAU 5EQSA 1AE8H 2ANWA 2QF3A 3M7UA 3RC5A 3RUOA 3IG6B 2AYWA 2SFAA 1PQ8A 3RXTA 1FAKH 2Y7ZA 1B0FA 4U32A 2BD3A 2VIQA 3RXGA 2ZWLH 3NCLA 2A7JA 4ABBA 2H9TH 1YCPM 2THFB 1CT2E 3MTYA 1WQSA 1KYNA 1EJMA 4ASHA 3UUZA 1GDUA 2Z9GA 2TGPZ 3GDVA 1HJ8A 3MU1A 4AGKA 1BRAA 3A8AA 3RC6A 4YESB 1GG6C 2OUAA 1DICA 1BRCE 1ELFA 5A8XA 4Y6DA 5I25A 3M36A 2XBVA 3L33A 1LTOA 1V2QT 1OPHB 1HAVB 4VGCC 3SJOA 2GCHG 2BD2A 2WUBA 2RG3A 1DY8A 5J4SA 2ZHFH 3PYHA 1QRZA 2C3SA 1TBZH 1KSNA 1SHYA 2V6NA 5L2YH 1EB1H 1P2KA 2O8LA 5E0GA 5DO4H 1VCQA 2FOHA 1EJAA 4MDSA 3TVJB 3LGWA 3UPEA 3S7HB 1O3GA 1QURH 1UMAH 2VIPA 4GCHG 1H9LB 2C8ZB 2P94A 1V6DA 1HNEE 1GBDA 1EJNA 1O5BB 1QQUA 1YCPH 3EYDA 4TWYA 4XE4A 3GOVB 3A88A 3N7OA 1BA8B 1EPTC 1V3XA 2ZDVH 1HAZB 1O3HA 2J9NA 5C67A 1GVLA 3UREA 2PKSC 3E16B 1O38A 1ZHPA 1GMHG 2ZU2A 1BTYA 1GI6A 1YPMH 1O2UA 1BDAA 3TPIZ 2XBYA 2GZ9A 3URDA 1GMCF 3RU4T 4WXVA 3OSYA 1BRBE 2ZDAH 1P01A 4B1TA 3VXFH 1O32A 2WUCA 4PROA 3E8LA 4D8NA 3ZZ3A 4BNRA 4YOGA 4ZHMU 2QXHA 3DUXH 1BQYA 3FVFB 1ZPBA 4H4FA 1ELEE 5JBCS 2QYIA 1XUKA 4K2YA 1BHXF 1CT0E 1L1NA 1EZQA 1FI8A 3P95A 4NFEA 5C20A 2AMDA 2P3TB 3ZVEA 3TK5A 4X1NU 1T4UH 5FHTA 1W7GH 1D3DB 1JMOH 4UDWH 4AG2A 3I77A 1UCYE 1DY9A 1ELGA 4MNVA 3C27B 1BCUH 5FBIA 1ZSLA 1WBGB 1B7XB 2Y81A 4X2VA 1TGNA 2PTCE 3UOPA 2GZ8A 1SGTA 4GUXA 3ZVAA 1MU6B 3EQ0H 2UWOA 1P0SH 5DP3A 3ZVFA 1A0JA 2FTLE 4X2WA 1O33A 4WMEA 1O2LA 2BD7A 2VWNA 4Y8XA 4A92A 4KTCA 1GBIA 3DT0H 5ESBA 1GBEA 3GCHC 4FUFA 1W12U 2Z94A 2BXUH 5C1UA 5F6MA 1TRNA 1ESTA 2QIQA 4NGAH 2H9EH 2SGFE 1ZZZA 3PO1C 2BY5X 2XRCA 1D4PB 4FUBA 3W94A 1WAYB 2GV7A 1K22H 2TRMA 3UR9A 9ESTA 4AN7A 4BAMB 2XXLA 3PV4A 3SU0A 3M3VA 1GHAG 1Y5UT 2HNTF 1BJUA 1LVMA 2ZU5A 3PLKA 1THRH 1J15A 2JETC 5DJ7A 3VB3A 3DHKH 2A2QH 4D9RA 1NM6A 2W3KA 5JPMH 2F9UA 1V2LT 1GI3A 3F9GA 4BTIB 3PTBA 1HAYB 3FZDA 3Q3YA 3ATKA 1AU8A 1EPTA 1GBTA 1WCZA 3TJVA 4X1QU 1A46H 1DITH 2VVCA 1C5ZB 1BHXB 3KCGH 3SV8A 1RRKA 3O8DA 1MKXH 2M5TA 5L2ZH 5EPYA 2A7CA 1MTUA 2A1DB 3U8OH 2B5TB 3GY7A 3VPKA 2BDGA 3EGKH 1QB1A 3ZVDA 1QBVH 1GBCA 2ZFSA 1ELBA 2CF8H 2ZU4A 3STIA 3GYMA 5E2OA 2YOLA 4HZHA 4ABFA 1Z8IB 1O37A 4UFGH 4WJG2 5BRRE 2H5DA 5IDKA 2VH6A 2TGDA 3LDXH 2A31A 5G4BA 1L4DA 1P8VC 3I29A 1O31A 3AW1A 1QRWA 2ZDNA 5LGOA 4DURA 1GJ6A 3JZ1B 4IGDA 3BN9A 4Y7AA 3SUFA 1H8IH 4CRBA 1O2NA 1SI5H 3IITA 2EEKA 3UIRA 1Y3WA 2AFQB 1DVAH 2P3FH 4DVAU 2KAIB 1NFWA 2NU0E 5AVDA 3ZZAA 1AFQC 4IS5A 4GPGA 4B73A 4Z6AH 5JBTA 1GI0A 1QA7A 4BXSA 4WXIA 2OC8A 4CHAB 1IQKA 2C4FH 1C1OA 5K0HA 2BOKA 2PGQB 2ZFQH 1P06A 1HPGA 1G37A 3SJ9A 2AS9A 2GKVE 9LPRA 3S0NA 2VB0A 4JCNA 2ZFFH 1K2I1 2BDYA 3PWBA 1G2LA 3E6PH 4H42U 1OWDA 4ISNA 1J14A 1TNIA 1YPLH 4ZHAA 2FXRA 3F9FA 1O3LA 4WVPE 3SBKA 2ODPA 3BF6H 1PPGE 1FUJA 4FU7A 1DT2A 3QZRA 3OYPA 4GHTA 4X8SH 4Y8YA 1XUFA 1C1WH 1HAVA 2ZFTA 2GVFA 1KLTA 2QC2A 1HAXB 1UK3A 3AVZA 2FO9A 5JBBS 3BV9B 3A7TA 1RD3B 2ZCHP 3BG4B 3URCA 6LPRA 1C2KA 4LXBH 1P10A 2EC9H 3GYLB 3T62A 3B9FH 4YZUA 2P95A 3H5CB 1DSTA 2ANKH 2ZFRH 4JYVH 5B6OA 2SGDE 2BTCE 4VGCB 5FPSA 4I32A 2HGTH 4I31A 4CBNA 1F5LA 3RXLA 2A2XH 3A8BA 1GBLA 1VGCB 2B9LA 2OLGA 4BTUB 4MPVA 1H8DH 2IOTA 3T28A 2SGEE 5F8XA 3T5FH 4A1VA 1LQDB 1N8OB 3SOSA 2HPPH 3JZ2B 1DS2E 1HJAC 1DXWA 3ZZDA 3B23B 3TJUA 1OP0A 2ODQA 1TGSZ 2IJOB 2PSXA 4DY7B 1P2QA 2PHBA 2CGAA 2EI8A 2FOEA 3LT3A 4NSYA 1BT7A 2J2UA 2OBQA 1HAGE 3M7QA 3MI4A 5A0AE 4LZ1H 1Y3VA 1Y3YA 1NRNH 1VCPA 3CENA 4CH8B 1NY22 3LC3A 2HRVA 4CRGA 4O3UA 5C2ZA 1QCPA 3QZQA 3NUMA 1P9UA 4NSVA 4NZLA 4AGJA 1GJBB 1G2MA 1SGIB 3ZZBA 1LO6A 1FN6A 1PPFE 4HTCH 1ARCA 8LPRA 1DWEH 3GY8A 1C1NA 8GCHG 1GJ9B 3NWUA 3AASA 2ZFPH 1O3CA 3UFAA 1L0ZA 1MTSA 1H9IE 2K1QA
chains in the Genus database with same CATH superfamily
2HALA 1QBNA 1ZSJA 3A84A 1QHRB 2NU2E 1LHEH 2KCPA 2A5KA 5B6LA 5FXLA 1HRTH 5A09A 3P92A 1JOUB 3RMOH 3TH2H 4OS6A 1SLWB 2TBSA 1EZUC 1QY6A 3PRDA 1HLTH 1KMHB 1XKBC 2VWOA 1Z7KA 1TE0A 1T8OA 4D9QA 5A0BA 6GCHF 2ZA5A 1HIAB 1UTOA 2WZQA 2IPQX 2Z3DA 1SGNE 3A7XA 1W8BH 1QIXB 1EP6A 2Q6DA 2GDDA 4Z1MD 2OTVA 5FL7D 1TX8A 4H6SB 1ZOMA 3H7TA 3RXFA 4I8HA 4OS2A 2AEIH 4X6OA 1SGEE 3M37A 1C2IA 2XTTB 5DK1A 8KME2 1W0YH 2OP9A 5CHBA 4UFFH 1BMNH 1T8MA 3MH6A 5HYOA 1CGIE 1AUTC 5HM2A 1GI4A 4WWYA 3O8RA 3SNDA 1PPBH 3LPRA 4YO9A 3Q3KA 2L6OA 1JIMA 2BY6X 1E35B 4IMQA 2ZZUH 3LGVA 2C8WB 3OEHD 1JRTA 5E2PA 1LDTT 3HK6B 5AHGH 2ZKSA 1AGJA 3Q77A 4X6MA 5EXLA 4JZEH 2IN2A 2BZ6H 2ZDLA 3V0XA 2WPHS 1S5SA 1A1RA 1GHBF 1FIZA 3FP7E 1C5QA 4ABDA 1DE7H 1NBMD 3T2NA 3MU8A 2BHGA 1UTLM 4OS7A 1LHCH 1CA0B 1TONA 1Z8RA 1HAOH 2F9VA 3RMNH 1OX1A 2G81E 2FPZA 1GHWH 1KTSB 4DW2U 1P04A 4AFZA 2AERH 3WWBA 4ZCNA 2QGRA 5HGGA 4OS4A 1OWHA 1HCGA 2QXGA 1O0DH 4LK4A 3BEUA 2GP9B 5AFZH 3SORA 5FAHA 1EP5A 1RIWC 4ZKRU 1BUIA 2ZNKH 2V3OH 2IPHA 3CS7A 1GJ4H 1ETSH 4FETA 4H6TA 5TCCA 2OXSA 1C5NH 1MKWK 1XUGA 5GWZA 2F9OA 1W3CA 1GVKB 2RCEA 5DP8A 1P09A 4TY7A 4HFPB 1SLXB 1MCVA 3SQHE 4ABGA 2XC4A 3UY9A 1C2MA 3RXEA 1SGQE 6ESTA 2GD4B 3UQOA 7LPRA 3DFLA 1COWD 3BG8A 3PO1B 2F9PA 4M7GA 4I33A 1BIOA 4Q7ZA 1XUHA 2VGCC 1AN1E 1MH0A 1QB6A 1OP8A 4ZXXH 2JJ1D 1O2TA 3MH5A 4RI0A 2FTMA 3LGTA 2SNWA 5GCHG 2FESH 4ZUHA 5AF9H 5C17A 4O97A 1UHBA 1CGHA 2UWLA 3ODFA 5I46H 1SBWA 1GL1A 3D62A 3RXKA 3RXQA 1WU1A 1GG6B 4MTBA 1C4V2 4U2WA 2FP7B 1GBFA 2JH0D 2YNBA 1SFIA 2OINA 4J1YA 4AYVB 1IQFA 3ATWA 1YY3A 2JJ2D 4NZQA 1Z8JB 1FY4A 3C1KA 4TY6A 5IK2D 2AGEX 1DLEA 1ZMNA 4F48B 1AKSB 1TNHA 3M5OA 1MBMA 4CRCA 3MNSA 2QA9E 1GHZA 1DDJA 2B7DH 2BDIA 2F4LA 1MD8A 6CHAB 1S84A 1TWXB 2Q6GA 4Y11E 1MKXK 1O36A 3BTWE 2Z9LA 1VZQH 3M61U 1P02A 1BBRE 1TALA 7ESTE 2VINA 3FFGA 3MHWU 1LPGB 1C5MD 1EPTB 3GY4A 1D9IA 1DWDH 4I8JA 3VB6A 1YM0A 1Q3XA 5EQRA 2RFKC 1TGBA 3LKWA 3A82A 2WPIS 1AUJA 2Y7XA 3RXMA 5LH8A 4B2CA 4BOHA 2FOGA 2B0FA 1W0KD 5E0HA 3BIUH 3LGIA 2GZ7A 2TGTA 1QRXA 3UQVA 2VGCB 3AAUA 4F55A 1SR5C 1Q2WA 2VBCA 3U28C 1CBWB 1F0RA 5DG6A 1ZMLA 2SGPE 1AVXA 1YBWA 1GI1A 3CS0A 4UE7H 4INLA 1O34A 1PQ7A 7GCHF 4ACBA 1KXBA 1PPCE 3R0FA 5GCHF 5EW2H 1M9UA 1F5KU 2ZQ2A 1T31A 2FWWA 1DUAA 2G52A 3PROA 1E36B 1G9IE 3E3TA 1YLCA 4THNH 4X1SU 1IQNA 3GCNA 3SNAA 1P03A 3SU6A 1TFXA 1GHXH 1AY6H 3FP8E 4XFQA 1IHSH 2A0QB 2FMJA 2WPMS 1QBOA 3BTME 1NC6A 4ASUD 1NTPA 1S0QA 3BTKE 3HK3B 5GNDA 1GBJA 2TGAA 2FIRH 3F0OA 4OS1A 5TJXA 1O2OA 5DPAA 2AMPA 2GDEH 1P2NA 5C1YA 1FQ3A 1SGFA 4FVDA 3BIVH 3MMGA 3SHAH 1ACBE 1HJ9A 4X1RU 2EI7A 2J5UA 3F2FA 5E0JA 1B0EA 8ESTE 3OY6U 5LPEA 2H6MA 3BSQA 4J2YB 1SFQB 1O2RA 4Y10E 5CE1A 1W0ZU 1WUNH 3QK1A 3GCHB 5HKKD 3RXJA 1TYNA 2ANYA 2ZGHA 2GCHF 4X8UH 2VJ1A 1WV7H 2K8IA 4RKOB 2ILNA 2OBOA 1AQ7A 1XUIA 2H2ZA 3M7TA 1N8OC 3ZV8A 2AIPA 1J9CH 1ABJH 3ZVGA 1DWBH 4MPXA 1Y5AT 4QT8C 4RT1A 1O3PB 1CA8B 1RJXB 1TB6H 1TPOA 1ZGVA 5JBAS 3VXEH 4ESTE 1O3JA 7GCHG 1SOZA 4F49A 3MNBA 1GI8B 1LVBA 1ETRH 2FDAA 4NFFA 3SJIA 2BQ7B 1SGYE 3SQEE 1LMWB 1W11U 1FLEE 1OYQA 4XDEA 4Q2KA 5E8EH 3DD2H 3S9BA 1N6YA 1GBKA 4XOJA 5EIYA 1E38B 1UO6A 1GWAA 4E7NA 1ARBA 4ISHH 2FI5E 1AWHB 3OE7D 1TBQH 1UK4A 4ZHLU 3Q00A 1IQMA 2J92A 2BVXH 1TMBH 2G00A 3SNEA 2P3UB 1OYTH 1O35A 4U30A 4I8LA 3RXHA 3ZZ5A 2BDCA 1OHHD 5DN6D 5JYIA 3KN2A 1O3IA 4DIHH 4K1EA 2CHAB 4A5TS 1VJ9U 1WQVH 1HAPH 2QY0B 1CSOE 1SOTA 2GCTC 5ESTE 1PYTC 1S82A 1F92A 1TNJA 1TNKA 5SGAE 1SGCA 2ESTE 4ABIA 5LPFA 3A81A 4E05H 2IJD1 2P93A 3MO3A 2BVRH 4BAKB 3QN7A 1W2KH 3UR6A 2F9NA 1QQ4A 2BYAX 1O5DH 3MNXA 5A8YA 2Y5FA 4MPUA 1ZRKA 3VGCB 1LVOA 4Q7YA 1O5CB 2VH0A 3M35A 2ZGJA 5DP4A 1JXPA 4FUHA 1FN8A 2JETB 1G3CA 1BITA 2HVXA 3B8JA 2NU4E 3EAJA 1HIAA 1NRPH 1FMGA 5EXMA 4GSOA 1OWKA 2V35A 1GBAA 1ZYOA 1QA0A 3R3GB 2JH6D 3KQBA 2P59A 1F5RA 5T1VA 1RS0A 4YLUA 4MQAA 4DG4A 1ZTJA 1O3AA 2XWBI 4I86A 4B76A 3P6ZB 1GHYH 2ZQ1A 1HUTH 1QL7A 3RXCA 1ZMJA 2OQ5A 1CHOG 4AZ2B 4ZMAH 1GHBG 3LH1A 1OWJA 4ZAEA 1F0UA 1O2WA 3ENSB 2VVVA 4TPIZ 1QFKH 2KCOA 3MQKC 1SKYE 3SZNA 2HPQH 1Z6EA 3HGNA 5J4QA 3MH7A 2Q1JA 1SMFE 1O2VA 1IAUA 1KIGH 4B6FA 1C2JA 3BTHE 1L4ZA 1NFYA 1O2GH 1GMCG 2AGIX 2ZTYA 3LGUA 3VG8A 5KEDA 3F0PA 2XBXA 2BX3A 1BOQA 2ASUB 2BY8X 2OC0A 1O2JA 3TGKE 1WDIA 2QCYA 1GMHF 4YT7H 2J98A 1AKSA 5JDUB 1TBRH 4A1XA 2VIWA 1UVSH 3QTOH 4XBCA 3F3BA 2W7SA 1A5IA 1ZR0A 3QWCH 1ZJKA 1ZTKA 4X2XA 5A0CA 1QJ7B 4TYDA 1YP9A 2LNCA 5A8ZA 1GI5A 5FCRA 4DCDA 1N1LA 4K60A 3OX7U 1K0HA 1TX6A 3OTJE 2CF9H 1CU1A 5A2MH 1RFNA 1S6LA 2Y6TA 3SU5A 2F3CE 2HNTC 3ZZ6A 2FX4A 1C5YB 1KY9A 4K1SA 1SB1H 4Q7XA 5K7RA 3EA7A 1THSH 3GDUA 4OS5A 2FZZA 2PUQH 1IQHA 4AX9H 3O8BA 1H8HD 2XC5A 2HLCA 4FUEA 3SV7A 5DP6A 3LJOA 3KIDU 3V12A 4CR9A 4K3JA 2RDLA 4AB8A 5C5NA 3TNSA 3S9CA 2WPKS 1Y8TA 2ZHQH 4F4OC 1MZAA 2H9HA 2QE7D 1OXGA 2G55A 3K2UA 4JZIA 2UUFB 1EATA 4KGAA 3U8TH 1QJ1B 1PPZA 3E1XB 3PWCA 3KF2A 7KMEH 2ZU1A 2R2WU 1LQEA 1CVWH 2R3YA 3DSOA 1ZPCA 3A83A 5T6GA 3UNQA 4X8TH 4FUGA 1CT4E 3T25A 3UWJH 1U6QA 3N7EA 4Z0KA 3SNCA 1AFEH 1A7SA 1HYLA 1VITF 1CGJE 1P2MA 1WSSH 1BMMH 3TJOA 3I78A 4E06H 1QJ6B 1SGFG 1YC0A 1GBMA 3O8CA 3Q76A 2WPLS 3STJA 1E1QD 1IQIA 5FBEA 1Y3UA 2PFEA 1NFUA 3A8CA 1O2SA 1YPKH 3MNCA 1SLVB 4YM9A 2BD5A 3NPSA 2P16A 2QXIA 2XW9A 1K1IA 1LHFH 1IQEA 3PM3A 3MU0A 2ZPQA 5EXNA 1C5TA 1BMFD 4ZROA 4X2YA 1C1TA 2Z6BD 3S7KB 1CE5A 1IHTH 3A7VA 1MU8B 2Z3EA 3TK9A 1ID5H 1O2PA 5DKMA 2PGBB 1UTNA 3RXDA 1HV7A 4R0IA 1GGDB 1ANCA 4ABAA 1NESE 4X0WU 2C8XB 1SGRE 1BBRH 3P8FA 4OM9A 4CR5A 1UVOA 5F53A 2FOAA 5EW1H 1LVYA 3U69H 3ZZ8A 4XBDA 5GXPA 4IC5A 3P70B 1YPHE 2ALVA 3VB7A 3SGQE 3ZVCA 2Q6FA 1C1MA 2ANMH 2I6QA 1GJDB 5HIZA 4Y71A 2Z9KA 5DP9A 2BLWA 2O8MA 3DFJA 1FY1A 1OS8A 1TMUH 4MVNA 4GHQA 1FZZA 4UEHH 2W7UA 1S6FA 1ELDE 3MWIU 1F0TA 1OOKB 3OEED 1X7AC 2J38A 2NWNA 3FZZA 1NZQH 1UCYH 3SU1A 1AO5A 1KLIH 5EJ1A 1O2MA 2A5AA 2A4GA 3VB4A 2HVYB 4Q80A 2KCAA 1C5OH 3F68H 1AB9B 1K1NA 4GLYA 1G3EA 2ZTXA 4MG3A 2HNTE 1NU9A 1QTFA 4FUJA 3A89A 1TPSA 1C1VH 1EOLA 1RTLA 3D65E 1C5XB 3BTGE 1Z1IA 1H9HE 3A7WA 4NWKA 4B2BA 1O5FH 2VIOA 3CP7A 2A7HA 1W0JD 1V2KT 4MNWA 3SGBE 3TGIE 1TPPA 2DUCA 1P2JA 3H09A 4HI3A 2FODA 3LH3A 4Y0ZE 2V7QD 3K6ZA 1MZDA 1Q31A 1O39A 2BB4A 3K9XB 2G4TA 1D6WA 1ZSKA 5C5OA 1AZZA 3SI4H 3GCTF 1C1PA 2BDAA 3LIWA 1P12E 2QAAA 1XMNB 4NCYA 3SO3A 1AZ8A 2XWAA 1VR1H 4Q63A 3U1IB 1KDQA 1HXEH 3M5NA 1ANDA 1XM1A 3SJ8A 2FOBA 4GVUA 1V2VT 4NA8A 1C1SA 1QL9A 2A4OA 1TABE 2H5CA 3PB1E 1LPZB 2PWXA 1NFXA 3LONA 1C5PA 2JIZD 3EA9A 1NRQH 1V2JT 1DM4B 3FOAA 2STAE 1K28D 2PLXA 2AH4X 4BAQB 4A1TA 1A61H 3SZEA 2BY9X 1J8AA 3ELAH 3KQEA 3OAAD 1TQ0B 1ELTA 1LPKB 3PRBA 1ETTH 2GMTB 2ZF0H 2R0LA 3QO6A 4TPYA 2BQ6B 1C2HA 2OC1A 2J4IA 1JRSA 4FU9A 2YNAA 1Y59T 3ZZ9A 1UVPA 1EKBB 4NA9H 1ESBA 1SC8U 1MTWA 3OY5U 1C2DA 1P3EA 1F0SA 3GY2A 4NWLA 3ZZ4A 4YLQH 1W13U 2BLQA 4CBOA 3GCOA 2OD3B 5ABWA 1C9PA 1K21H 1LHDH 1BTUA 1GMDF 2A5IA 3F1SB 4BXWA 5EGMA 2FS8A 1BJVA 1Y5BT 3FN8A 3ATLA 1RGQA 1BZXE 1G30B 1O30A 3H7OA 3M5MA 4WH6A 2D26C 4AB9A 1HB0B 4HG6A 1VCWA 2VNTA 3KHVA 1GJCB 4D7FA 4AG1A 2ZPRA 3A87A 1GI2A 5C1XA 1C9TA 1ZLRA 4RSPA 4Y79A 2F91A 2YMSC 1AD8H 3TLOA 1CHOF 2FYQA 1TA6A 5EPNA 4I7YH 1PQ5A 1K9OE 2JKHA 1HDTH 4B74A 4KTUA 4Y7BA 1MMJN 2SGAA 1DXPA 1FY3A 3RC4A 4UD9H 5EG4A 1AIXH 3VGCC 3SUGA 2BQWB 4O3TA 2ZU3A 2FOMB 1NRSH 3RXRA 3TK6A 3GS9A 1C1RA 2J97A 2BXTH 2PV9B 1EAIA 2P8OB 2D8WA 1AVGH 2B8OH 2BVSH 1C5RA 1GCTB 2BD4A 1MKWH 2F43B 3F9EA 2ZCLP 1TX7A 4BANB 4Y76A 4INHA 3FAOA 1OWEA 3NRLA 4RKJB 4JK6A 3S9AA 2D2DA 3UAIC 1UCYK 2QN5T 2ZDMA 3TU7H 5H4IB 2Y5HA 3A8DA 1ABIH 2BD8A 3GISB 4E7RG 3ZV9A 1GVZA 1NN6A 1OKXA 1SLUB 3RMLH 2BX4A 3WY8A 3FO8D 2FOCA 1DFPA 3TH4H 5CMXH 2WPDD 1ELAA 1FDPA 5PTPA 3TH3H 1THPB 2VU8E 4IN2A 2PSYA 1TNGA 3M3SA 1V2WT 3EE7A 4KELA 1DANH 3RXOA 4RN6A 1FPHH 4KKDA 5EODA 1TRMA 1YF4A 2ZO3H 3NXPA 1YGCH 1BTHH 1P05A 3K65B 3GY3A 1Z71A 2GTBA 3ZVBA 4XSKU 3RM2H 4NIVA 3GY6A 2UWPA 3QDZB 5C0TA 3U8RH 2A4RA 3RU4E 1DUEA 1TNLA 2R0KA 3ATIA 1SGDE 4K8BA 3UOUA 2ZCKP 1LKAA 1RXPA 5C3NA 1RIWB 2PW8H 1V2ST 2ZTZA 3RLYH 3ZIAD 1NPMA 1SGPE 2CK3D 2WYJA 3BTDE 2W26A 4NA7A 4TSFD 1V2OT 1MTVA 4X1PU 5F8ZA 1KXDA 1ZGIA 4MNXA 1XXDA 1PYTD 2FS9A 1C5UA 1HAHH 2WYGA 4K69A 4K5ZA 5EU8A 4K1TA 3KQCA 2P8OC 2VIVA 4B71A 2GT7A 2DE9A 3EDXB 1O5GH 1GBHA 1SL3A 4BTTB 1UJ1A 1MTNC 1GGDC 1O3MA 4BAHB 1DSUA 2Z7FE 1UW7A 1BRUP 2R3UA 2XCNA 1O2XA 3BEFB 2ZG0H 3T26A 1LHGH 1C2LA 3KL6A 3E91A 3BEIB 4ZXYH 1NU7B 1B5GH 4UONA 1SQRA 1GJAB 3RXIA 3GY5A 4JYTA 1O5EH 1TOMH 2FOFA 3P8OA 3BG4C 1EAUA 2C90B 3PMBB 1TPAE 1UTQA 2FYRA 4UFDH 1DWCH 2QV1A 3SU4A 4DGJA 5HMAA 2ZGXH 1BBRK 1ESAA 1MCTA 3E0NB 3EA8A 3AW0A 1XX9A 1KXAA 2O8WA 1ZPZA 3QTVH 1XXFA 1DX5M 3LJJA 5DP7A 3RMMH 4ISIH 4WMFA 3LC5A 3PV2A 1BTPA 2DE8A 4OGYA 4AFQA 2VVUA 1TIOA 1G36A 1BMLA 2WV5A 1FJSA 1C2GA 1L1JA 2GGVB 4ZKNU 4CHAC 4CH2B 1O2QA 2V3MA 3M5LA 5LPRA 3NKKA 1ZTLA 2A32A 5CHAC 2W6JD 1T8LA 3KQ5A 1GHAF 3SU3A 4I8GA 3F6UH 1AMHA 1ZHMA 2CMYA 2PP6A 2Y5GA 1ELCA 2Z9IA 3KNXA 4CREA 2WV4A 1C4Y2 1SSXA 4LZ4B 2ZGBH 3PMHB 1P2IA 1JBUH 1P3CA 1H8ED 2PR3A 4D7GA 2FI4E 1PPEE 2NU3E 3T29A 5HM9A 4SGAE 1GHVH 4R8TB 1A0LA 2F9BH 1YKTA 4SGBE 3ZYDA 1INCA 3LU9B 3ITIA 3RM0H 3KGPA 3W95A 4YTAA 1EASA 1P57B 3U9AH 4ISOA 1FY8E 3V13A 1E34B 4NIYA 1C5LH 2ZI2H 1FX0B 2ULLA 4AC9A 1ANBA 1O3DA 2ZEBA 1CBWC 3DSPA 1DLKB 1MBQA 1KTTB 1QL8A 1JWTA 3A85A 4INKA 3SV9A 1EZSC 1K1MA 1O2IA 4B2AA 1Y3XA 1O3EA 1LCYA 1C4U2 2ZECA 1K1OA 2A4QA 3L3TA 1H4WA 3SUDA 3BTQE 2KZ4A 5JB8S 1TAWA 2GX4A 2W3IA 4KTSA 3U98H 1Z6JH 4ABEA 1SG8B 2A45B 3SJKA 1Z1JA 1TGTA 3ZYEA 1L2EA 4FVBA 1EQ9A 3RXUA 2ZPSA 5T3HA 1Z8GA 2O8UA 3HKIB 3PV5A 2XOKD 5FPYA 4Y0YE 3ZZCA 2C8YB 3PMAB 5GJ4B 1A5HA 1A3EH 1HAIH 1FXYA 5GPIB 1RTFB 3ATMA 1KLJH 5IYTA 5C94A 3HGPA 1EX3A 3BTTE 2HOBA 1C5VA 1ZHRA 2BLOA 2D1JA 1GJ5H 1OP2A 4U01A 5KGOA 2WINI 1EB2A 1W14U 1T8NA 1TGCA 3UTUH 2CV3A 2QF4A 3BTEE 4XBBA 4JZ1A 1K1LA 3QLPH 1SQOA 4XRNA 2XBWA 4NIWA 1TRYA 3L6PA 3TGJE 3FANA 2BDHA 4HGCA 4FU8A 3FP6E 1WTGH 1O3BA 4NIXA 1AHTH 1ANEA 2RA0A 5T6DA 1GDNA 1VITH 1A0HB 4DOQA 1C1QA 2J34A 1XVOA 2AGGX 1C1UH 1BB0B 1TLDA 3QGJA 1KXEA 4IBLH 3A86A 2G5VA 1FONA 1D3PB 1V2UT 1EZXC 1QGFA 1EXFA 4JYUH 3SV6A 5HXFA 3LGYA 3CNRA 1S0RA 4FUIA 1GCTC 1GPZA 4WY3A 3T27A 1C2EA 4ABHA 2QXJA 1IQJA 3WW7A 4CRDA 1PQAA 2BDBA 2R2MB 2EI6A 2BOHB 1GI9B 3MH4A 2I6SA 4FXGH 1V2RT 3TNTA 1ZRBA 2BLVA 1VITG 1GCDA 3GDSA 3LOXA 3EE0B 4YOIA 1EAXA 4ZKSU 1C5SA 1EOJA 1UTPA 3RXBA 2BZAA 2Z3CA 1J16A 4LOYH 1GDQA 1NO9H 2R9PA 2EA3A 3SW2B 2LPRA 1XUJA 4AORA 1CQQA 1UVTH 1QB9A 3QX5H 2LELA 2CHAC 1HFDA 2EY4C 1UTJA 4ISLA 5EJLA 3A7ZA 2GCTB 4JK5A 1BMAA 2W5EA 2QF5A 2F83A 2ZIQH 1FNIA 1KDQB 1VGCC 5EQQA 1RTKA 1P2OA 4O9VA 2WPJS 1T7CA 1YPEH 2XNDD 4DJZB 5F8TA 1MAYA 4MLFB 3P17H 5JB9S 1SQAA 8GCHF 3RP2A 2TIOA 1O2HA 6GCHG 3MOCA 2WV9A 1DOJA 3HKJB 1A2CH 3MU4A 1ORFA 2G51A 2PKAA 3MU5A 1G3BA 1FPCH 3E0PB 1UHBB 5DGJA 5TCAA 5CDFE 2NU1E 3N7DA 1MTNB 4FUCA 2XCFA 1MAXA 1TA2A 1ELVA 1A3BH 2PUXB 4AYYB 3NZIA 1T32A 4AFSA 2J94A 3IWMA 2O9QA 4KP0A 1HBTH 4ZH8A 5FX6A 1EAWA 4FUDA 5L6NH 2ODYB 1VKYA 1SHHB 3N99A 3GICB 2OC7A 3KEEA 1V2NT 3TIUA 1FY5A 3P8GA 3VEQB 2K0QA 2PTNA 1AVWA 3SUEA 2AHME 1FV9A 2AMQA 1O2ZA 2Z9JA 4JZFH 1O3KA 3SV2H 4CRFA 1YPGH 1O3FA 1SVPA 4UFEH 3RU4D 1IQGA 1GBBA 4Q4LA 3D23A 1TOCB 1WOFA 1UK2A 2FLRH 2XYAA 1D3QB 4CRAA 1JIRA 2PKSB 5GIBA 3S69A 4I8KA 2V3HH 1ZJDA 4TWWA 2OCVB 2FLBH 1QNJA 2JH5D 3G01A 1MQ6A 1QR3E 2SGQE 3RXPA 2OK5A 2G8TA 1NROH 3RXSA 4K8YA 1YLDA 3E90B 2V0BA 3W1EA 1FIWA 2Y82A 5FPTA 4AOQA 4WH8A 4ACAA 2QF0A 1D6RA 2STBE 2BD9A 2CN0H 3MYWA 1O3OA 1BTXA 3RXAA 1W7XH 2VWLA 4GAWA 2BY7X 4A6LA 1T4VH 3V3MA 1H1BA 1PFXC 2HWLB 5GDSH 2KAIA 1KXFA 3GCTG 3AK5A 1S6HA 2G5NA 2GMTC 4WF8A 3BTFE 3PLBA 1BTZA 3A80A 3TITA 3SU2A 3SNBA 1S83A 1S85A 3RXVA 3D49H 3P8NA 3Q3XA 1AB9C 2XC0A 1OSSA 4ZKOU 1IOEA 1G3DA 6CHAC 4X8VH 3K6YA 1YPJH 4A7IB 3ODDA 1NRRH 1W10U 1E1RD 1XKAC 2ZDKA 4RT0A 4IC6A 2PKAB 2GV6A 4GCHF 1CHGA 2O8TA 2Y80A 1F7ZA 2GT8A 2ALPA 3PTNA 4IMZA 1E0FD 4MNYA 1O5AB 1UVUH 4YOJA 2ZHEH 2FEQH 5C0UA 1CA0C 1LKBA 1AE5A 3SGAE 2UUYA 1P9SA 2TPIZ 1MABB 1XVMA 1A4WH 1AFQB 2UUJB 3DA9B 2SNVA 1MQ5A 1SPJA 4X6NA 2AIQA 2ZC9H 1D3TB 1PPHE 2C93B 3OU0A 4NG9H 1PJPA 2ZP0H 3SN8A 1TMTH 5ETXA 1YCPK 3V7TA 1EUFA 1HXFH 4D76A 5CHAB 3HATH 4TT3D 2OQUA 4WMDA 3MFJA 4P00A 4X6PA 4B6EA 3HPTB 4B75A 5F03A 4IN1A 3U1JB 2XNIA 1GJ8B 1NS3A 1V2MT 1S81A 1GJ7B 2ZGCA 2J98B 2L74A 4IW4E 3UNRA 2VWMA 2RA3A 3SHCH 1YYY1 2FM2A 3A7YA 2VIDA 1P11E 3ZZ7A 5FCKA 2ZHDA 3F9HA 4YT6H 3QGNB 5AFYH 3RDZA 3M3TA 2FX6A 1L1GA 3MO9A 4JMYA 5EOKA 1MD7A 1UTMA 1O3NA 1G32B 4JZDH 1SQTA 4ABJA 1C2FA 2G4UA 3F2GA 3VFEA 3KQDA 1WTHD 1F2SE 1J17T 4XD7D 1DPOA 5BPEA 1UTKA 1E37B 1YWUA 2FI3E 1YPHC 2BM2A 1O2YA 1FAXA 1HGTH 3DSGA 1WYKA 4AFUA 1O2KA 1GL0E 5T6FA 4DT7B 3PLPA 1CO7E 1MUEB 3NK8A 1AI8H 1K1JA 5FX5A 3TJNA 1GI7B 1V2PT 2BMGB 2HLDD 3UNSA 3PMJA 3FKSD 1V2TT 4OGXA 1IQLA 3MO6A 1AWFH 1OWIA 1K1PA 4DIIH 1HJAB 3QUMP 1KXCA 2ZHWH 3SI3H 3RLWH 2CXVA 2YMSD 2CJIA 2GJGA 4Y8ZA 3VB5A 1BTWA 2H1UA 3ESTA 2UUKB 1C5WB 1N6XA 4MPWA 4O03A 4BAOB 1A5GH 5DP5A 1TQ7B 1GMDG 1NT1A 2J95A 5L30H 3UWIA 3AAVA 1VJAU 5EQSA 1AE8H 2ANWA 2QF3A 3M7UA 3RC5A 3RUOA 3IG6B 2AYWA 2SFAA 1PQ8A 3RXTA 1FAKH 2Y7ZA 1B0FA 4U32A 2BD3A 2VIQA 3RXGA 3OFND 2ZWLH 3NCLA 2A7JA 4ABBA 2H9TH 1YCPM 2THFB 1CT2E 3MTYA 1WQSA 1KYNA 2LP6A 1EJMA 4ASHA 3UUZA 1GDUA 2Z9GA 2TGPZ 3GDVA 1HJ8A 3MU1A 4AGKA 1BRAA 3A8AA 3RC6A 4YESB 1GG6C 2OUAA 1DICA 1BRCE 1ELFA 5A8XA 4Y6DA 5I25A 3M36A 2XBVA 3L33A 1LTOA 1V2QT 1OPHB 1HAVB 4VGCC 3SJOA 2GCHG 2BD2A 2WUBA 2RG3A 1DY8A 5J4SA 2ZHFH 3PYHA 1QRZA 2C3SA 1TBZH 1KSNA 1SHYA 2V6NA 5L2YH 1EB1H 1P2KA 2O8LA 5E0GA 5DO4H 1VCQA 2FOHA 1EJAA 4MDSA 3TVJB 3LGWA 3UPEA 3S7HB 1O3GA 1QURH 1UMAH 2VIPA 4GCHG 1H9LB 2C8ZB 2P94A 1V6DA 1HNEE 1GBDA 1EJNA 1O5BB 3UB0A 1QQUA 1YCPH 3EYDA 4TWYA 4XE4A 3GOVB 2WSSD 3A88A 3N7OA 1BA8B 1EPTC 1V3XA 2ZDVH 1HAZB 1O3HA 2J9NA 5C67A 4M9FA 1GVLA 3UREA 2PKSC 3E16B 1O38A 1ZHPA 1GMHG 2ZU2A 1BTYA 4FOUC 1GI6A 1YPMH 1O2UA 1BDAA 3TPIZ 2XBYA 2GZ9A 3URDA 1GMCF 3RU4T 4WXVA 3OSYA 1BRBE 2ZDAH 1P01A 4B1TA 3VXFH 1O32A 3WWFA 2WUCA 4PROA 3E8LA 3KYGA 3ZZ3A 4D8NA 4BNRA 4YOGA 4ZHMU 2QXHA 3DUXH 5EJZA 1BQYA 3FVFB 1ZPBA 4H4FA 1ELEE 5JBCS 2QYIA 1XUKA 4K2YA 1BHXF 1CT0E 1L1NA 1EZQA 1FI8A 3P95A 4NFEA 5HIYA 5C20A 2AMDA 2P3TB 3ZVEA 3TK5A 4X1NU 1T4UH 5FHTA 1W7GH 1D3DB 1EFRD 1JMOH 4UDWH 4AG2A 3I77A 1UCYE 1DY9A 1ELGA 4MNVA 3C27B 2EQNA 1BCUH 5FBIA 1ZSLA 1WBGB 1B7XB 2Y81A 4X2VA 1TGNA 2PTCE 3UOPA 2GZ8A 1SGTA 4GUXA 3ZVAA 1MU6B 3EQ0H 2UWOA 1P0SH 5DP3A 3F2HA 3ZVFA 1A0JA 2FTLE 4X2WA 1O33A 4WMEA 1O2LA 2BD7A 2VWNA 5DSFA 4Y8XA 4A92A 4KTCA 1GBIA 3DCLA 3DT0H 5ESBA 1GBEA 2KFWA 3GCHC 1W12U 2Z94A 2BXUH 4FUFA 5C1UA 1TRNA 5F6MA 1ESTA 2QIQA 4NGAH 2H9EH 2SGFE 1ZZZA 3PO1C 2BY5X 2XRCA 1D4PB 4FUBA 3W94A 1WAYB 2GV7A 1K22H 2TRMA 3UR9A 9ESTA 4AN7A 4BAMB 2XXLA 3PV4A 3SU0A 3M3VA 1GHAG 1Y5UT 2HNTF 2RDEA 1BJUA 1LVMA 2ZU5A 3PLKA 1THRH 2KM0A 1J15A 2JETC 5DJ7A 3VB3A 3DHKH 2A2QH 4D9RA 1NM6A 4YXWD 2W3KA 5JPMH 2F9UA 1V2LT 1GI3A 3F9GA 4BTIB 3PTBA 1HAYB 3FZDA 3Q3YA 3ATKA 1AU8A 1EPTA 1GBTA 1WCZA 3TJVA 4X1QU 1A46H 2JDID 1DITH 2VVCA 1C5ZB 1BHXB 3KCGH 3SV8A 1RRKA 3O8DA 1MKXH 2M5TA 5L2ZH 5EPYA 2A7CA 1MTUA 2A1DB 3U8OH 2B5TB 3GY7A 3VPKA 2BDGA 3EGKH 1QB1A 3ZVDA 1QBVH 3OTPA 1GBCA 2ZFSA 1ELBA 2CF8H 2ZU4A 3STIA 3GYMA 5E2OA 2YOLA 4HZHA 4ABFA 1Z8IB 1O37A 4UFGH 4WJG2 5BRRE 2H5DA 5IDKA 2VH6A 2TGDA 3LDXH 2A31A 5G4BA 1L4DA 1P8VC 3I29A 1O31A 3AW1A 5KECA 1QRWA 2ZDNA 5LGOA 4DURA 1GJ6A 3JZ1B 4IGDA 3BN9A 4Y7AA 3SUFA 1H8IH 4CRBA 1O2NA 1SI5H 3IITA 1YLNA 2EEKA 3UIRA 1Y3WA 1QZ8A 2AFQB 1DVAH 2P3FH 4DVAU 2KAIB 1NFWA 2NU0E 5AVDA 3ZZAA 1AFQC 4IS5A 4GPGA 4B73A 4Z6AH 5JBTA 1GI0A 1QA7A 4BXSA 1WXRA 4WXIA 2OC8A 4CHAB 1IQKA 2C4FH 1C1OA 5K0HA 2BOKA 2PGQB 2ZFQH 1P06A 1HPGA 1G37A 3SJ9A 2AS9A 2GKVE 9LPRA 3S0NA 2VB0A 4JCNA 2ZFFH 1K2I1 2BDYA 3PWBA 1G2LA 3E6PH 4H42U 1OWDA 4ISNA 1J14A 1TNIA 1YPLH 2M2AA 4ZHAA 2FXRA 2WHXA 3F9FA 1O3LA 4WVPE 3SBKA 2ODPA 2KCYA 3BF6H 1PPGE 1FUJA 4FU7A 1DT2A 3QZRA 3OYPA 4GHTA 4X8SH 4Y8YA 1XUFA 1C1WH 1HAVA 2ZFTA 2GVFA 1KLTA 1NBME 2QC2A 1HAXB 1UK3A 3AVZA 2FO9A 5JBBS 3BV9B 3A7TA 1RD3B 2ZCHP 3BG4B 3URCA 6LPRA 1C2KA 4LXBH 1P10A 2EC9H 3GYLB 3T62A 3B9FH 4YZUA 2P95A 3H5CB 1DSTA 2ANKH 2ZFRH 4JYVH 5B6OA 2SGDE 2BTCE 4DT4A 4VGCB 5FPSA 4I32A 2HGTH 4I31A 4CBNA 1F5LA 3RXLA 2A2XH 3A8BA 1GBLA 1VGCB 2KR7A 2B9LA 2OLGA 4BTUB 2YMSB 4MPVA 1H8DH 3KYFA 2IOTA 3T28A 2SGEE 5F8XA 3T5FH 2W6ID 4A1VA 1LQDB 1N8OB 3SOSA 2HPPH 3JZ2B 1DS2E 1HJAC 1DXWA 3ZZDA 3B23B 3TJUA 1OP0A 2ODQA 1TGSZ 2IJOB 2PSXA 4DY7B 1P2QA 2PHBA 2CGAA 2EI8A 2FOEA 3LT3A 4NSYA 1BT7A 2J2UA 2OBQA 1HAGE 3M7QA 3MI4A 5A0AE 4LZ1H 1Y3VA 1Y3YA 4P02A 1NRNH 1VCPA 3CENA 4CH8B 1NY22 3LC3A 2HRVA 4CRGA 1E79D 4O3UA 5C2ZA 1QCPA 3QZQA 3NUMA 1P9UA 4NSVA 4NZLA 4AGJA 1GJBB 1G2MA 1SGIB 3ZZBA 1LO6A 1FN6A 1PPFE 4HTCH 1ARCA 8LPRA 1DWEH 3GY8A 1C1NA 8GCHG 1GJ9B 3NWUA 3AASA 2ZFPH 1O3CA 3UFAA 3SYJA 1L0ZA 2KX4A 1MTSA 1H9IE 2K1QA
chains in the Genus database with same CATH topology
2HALA 1QBNA 1ZSJA 3A84A 1QHRB 2NU2E 1LHEH 2A5KA 5FXLA 1HRTH 5A09A 3P92A 1JOUB 3RMOH 3TH2H 4OS6A 1SLWB 2TBSA 1EZUC 1QY6A 1HLTH 1XKBC 2VWOA 1Z7KA 1TE0A 1T8OA 4D9QA 5A0BA 6GCHF 2ZA5A 1HIAB 1UTOA 2Z3DA 1SGNE 3A7XA 1W8BH 1QIXB 1EP6A 2Q6DA 2GDDA 2OTVA 1TX8A 4H6SB 1ZOMA 3H7TA 3RXFA 4I8HA 4OS2A 2AEIH 4X6OA 1SGEE 3M37A 1C2IA 2XTTB 5DK1A 8KME2 1W0YH 2OP9A 4UFFH 1BMNH 1T8MA 3MH6A 5HYOA 1CGIE 1AUTC 5HM2A 1GI4A 4WWYA 3O8RA 3SNDA 1PPBH 3LPRA 4YO9A 3Q3KA 1JIMA 2BY6X 1E35B 4IMQA 2ZZUH 3LGVA 2C8WB 5E2PA 1JRTA 1LDTT 3HK6B 5AHGH 2ZKSA 1AGJA 3Q77A 4X6MA 5EXLA 4JZEH 2IN2A 2BZ6H 2ZDLA 3V0XA 2WPHS 1S5SA 1A1RA 1GHBF 1FIZA 3FP7E 1C5QA 4ABDA 1DE7H 3T2NA 3MU8A 2BHGA 1UTLM 4OS7A 1LHCH 1CA0B 1TONA 1Z8RA 1HAOH 2F9VA 3RMNH 1OX1A 2G81E 2FPZA 1GHWH 1KTSB 4DW2U 1P04A 4AFZA 2AERH 2QGRA 5HGGA 4OS4A 1OWHA 1HCGA 2QXGA 1O0DH 4LK4A 3BEUA 2GP9B 5AFZH 3SORA 5FAHA 1EP5A 1RIWC 4ZKRU 1BUIA 2ZNKH 2V3OH 2IPHA 3CS7A 1GJ4H 1ETSH 4H6TA 5TCCA 2OXSA 1C5NH 1MKWK 1XUGA 5GWZA 2F9OA 1W3CA 1GVKB 2RCEA 5DP8A 1P09A 4TY7A 4HFPB 1SLXB 1MCVA 3SQHE 4ABGA 2XC4A 3UY9A 1C2MA 3RXEA 1SGQE 6ESTA 2GD4B 3UQOA 7LPRA 3DFLA 3BG8A 3PO1B 2F9PA 4M7GA 4I33A 1BIOA 4Q7ZA 1XUHA 2VGCC 1AN1E 1MH0A 1QB6A 1OP8A 4ZXXH 1O2TA 3MH5A 2FTMA 3LGTA 2SNWA 5GCHG 2FESH 4ZUHA 5AF9H 4O97A 1UHBA 1CGHA 2UWLA 3ODFA 5I46H 1SBWA 1GL1A 3D62A 3RXKA 3RXQA 1WU1A 1GG6B 4MTBA 1C4V2 4U2WA 2FP7B 1GBFA 2JH0D 2YNBA 1SFIA 2OINA 4J1YA 4AYVB 1IQFA 3ATWA 4NZQA 1Z8JB 1FY4A 3C1KA 4TY6A 2AGEX 1DLEA 1ZMNA 1AKSB 1TNHA 3M5OA 1MBMA 4CRCA 3MNSA 2QA9E 1GHZA 1DDJA 2B7DH 2BDIA 6CHAB 1MD8A 1S84A 1TWXB 2Q6GA 4Y11E 1MKXK 1O36A 3BTWE 2Z9LA 1VZQH 3M61U 1P02A 1BBRE 1TALA 7ESTE 2VINA 3FFGA 3MHWU 1LPGB 1C5MD 1EPTB 3GY4A 1D9IA 1DWDH 4I8JA 3VB6A 1YM0A 1Q3XA 5EQRA 1TGBA 3LKWA 3A82A 2WPIS 1AUJA 2Y7XA 3RXMA 5LH8A 4B2CA 4BOHA 2FOGA 2B0FA 5E0HA 3BIUH 3LGIA 2GZ7A 2TGTA 1QRXA 3UQVA 2VGCB 3AAUA 1SR5C 1Q2WA 1CBWB 1F0RA 5DG6A 1ZMLA 2SGPE 1AVXA 1YBWA 1GI1A 3CS0A 4UE7H 4INLA 1O34A 1PQ7A 7GCHF 1KXBA 1PPCE 3R0FA 5GCHF 5EW2H 1M9UA 1F5KU 2ZQ2A 1T31A 2FWWA 1DUAA 2G52A 3PROA 1E36B 1G9IE 3E3TA 1YLCA 4THNH 4X1SU 1IQNA 3GCNA 3SNAA 1P03A 3SU6A 1TFXA 1GHXH 1AY6H 3FP8E 4XFQA 1IHSH 2A0QB 2FMJA 2WPMS 1QBOA 3BTME 1NC6A 1NTPA 1S0QA 3BTKE 3HK3B 1GBJA 2TGAA 2FIRH 4OS1A 5TJXA 1O2OA 5DPAA 2AMPA 2GDEH 1P2NA 5C1YA 1FQ3A 1SGFA 4FVDA 3BIVH 3MMGA 3SHAH 1ACBE 1HJ9A 4X1RU 2EI7A 5E0JA 1B0EA 8ESTE 3OY6U 5LPEA 2H6MA 3BSQA 4J2YB 1SFQB 1O2RA 4Y10E 5CE1A 1W0ZU 1WUNH 3QK1A 3GCHB 3RXJA 1TYNA 2ANYA 2ZGHA 2GCHF 4X8UH 2VJ1A 1WV7H 4RKOB 2ILNA 2OBOA 1AQ7A 1XUIA 2H2ZA 3M7TA 1N8OC 3ZV8A 2AIPA 1J9CH 1ABJH 3ZVGA 1DWBH 4MPXA 1Y5AT 4QT8C 1O3PB 1CA8B 1RJXB 1TB6H 1TPOA 1ZGVA 5JBAS 3VXEH 4ESTE 1O3JA 7GCHG 1SOZA 4F49A 3MNBA 1GI8B 1LVBA 1ETRH 2FDAA 4NFFA 3SJIA 2BQ7B 1SGYE 3SQEE 1LMWB 1W11U 1FLEE 1OYQA 4XDEA 4Q2KA 5E8EH 3DD2H 3S9BA 1N6YA 1GBKA 4XOJA 1E38B 1UO6A 1GWAA 4E7NA 1ARBA 4ISHH 2FI5E 1AWHB 1TBQH 1UK4A 4ZHLU 3Q00A 1IQMA 2J92A 2BVXH 1TMBH 2G00A 3SNEA 2P3UB 1OYTH 1O35A 4U30A 4I8LA 3RXHA 3ZZ5A 2BDCA 5JYIA 3KN2A 1O3IA 4DIHH 4K1EA 2CHAB 4A5TS 1VJ9U 1WQVH 1HAPH 2QY0B 1CSOE 1SOTA 2GCTC 5ESTE 1PYTC 1S82A 1F92A 1TNJA 1TNKA 5SGAE 1SGCA 2ESTE 4ABIA 5LPFA 3A81A 4E05H 2P93A 3MO3A 2BVRH 4BAKB 3QN7A 1W2KH 3UR6A 2F9NA 1QQ4A 2BYAX 1O5DH 3MNXA 5A8YA 2Y5FA 4MPUA 1ZRKA 3VGCB 1LVOA 4Q7YA 1O5CB 2VH0A 3M35A 2ZGJA 5DP4A 1JXPA 4FUHA 1FN8A 2JETB 1G3CA 1BITA 2HVXA 3B8JA 2NU4E 3EAJA 1HIAA 1NRPH 1FMGA 5EXMA 4GSOA 1OWKA 2V35A 1GBAA 1ZYOA 1QA0A 3R3GB 2JH6D 3KQBA 2P59A 1F5RA 1RS0A 4YLUA 4MQAA 4DG4A 1ZTJA 1O3AA 2XWBI 4B76A 3P6ZB 1GHYH 2ZQ1A 1HUTH 1QL7A 3RXCA 1ZMJA 2OQ5A 1CHOG 4AZ2B 4ZMAH 1GHBG 3LH1A 1OWJA 4ZAEA 1F0UA 1O2WA 3ENSB 2VVVA 4TPIZ 1QFKH 3SZNA 2HPQH 1Z6EA 3HGNA 5J4QA 3MH7A 2Q1JA 1SMFE 1O2VA 1IAUA 1KIGH 1C2JA 3BTHE 1L4ZA 1NFYA 1O2GH 1GMCG 2AGIX 2ZTYA 3LGUA 2XBXA 2BX3A 1BOQA 2ASUB 2BY8X 2OC0A 1O2JA 3TGKE 2QCYA 1GMHF 4YT7H 1AKSA 5JDUB 1TBRH 4A1XA 2VIWA 1UVSH 3QTOH 4XBCA 2W7SA 1A5IA 1ZR0A 3QWCH 1ZJKA 1ZTKA 4X2XA 5A0CA 1QJ7B 4TYDA 1YP9A 2LNCA 5A8ZA 1GI5A 5FCRA 4DCDA 1N1LA 4K60A 3OX7U 1TX6A 3OTJE 2CF9H 1CU1A 5A2MH 1RFNA 2Y6TA 3SU5A 2F3CE 2HNTC 3ZZ6A 2FX4A 1C5YB 1KY9A 4K1SA 1SB1H 4Q7XA 5K7RA 3EA7A 1THSH 3GDUA 4OS5A 2FZZA 2PUQH 1IQHA 4AX9H 3O8BA 2XC5A 2HLCA 4FUEA 3SV7A 5DP6A 3LJOA 3KIDU 3V12A 4CR9A 4K3JA 2RDLA 4AB8A 5C5NA 3TNSA 3S9CA 2WPKS 1Y8TA 2ZHQH 4F4OC 1MZAA 2H9HA 4JZIA 1OXGA 2G55A 3K2UA 2UUFB 1EATA 4KGAA 3U8TH 1QJ1B 1PPZA 3E1XB 3PWCA 3KF2A 7KMEH 2ZU1A 2R2WU 1LQEA 1CVWH 2R3YA 1ZPCA 3A83A 5T6GA 3UNQA 4X8TH 4FUGA 1CT4E 3T25A 3UWJH 1U6QA 4Z0KA 3SNCA 1AFEH 1A7SA 1HYLA 1VITF 1CGJE 1P2MA 1WSSH 1BMMH 3TJOA 3I78A 4E06H 1QJ6B 1SGFG 1YC0A 1GBMA 3O8CA 3Q76A 2WPLS 3STJA 1IQIA 5FBEA 1Y3UA 2PFEA 1NFUA 3A8CA 1O2SA 1YPKH 3MNCA 1SLVB 4YM9A 2BD5A 3NPSA 2P16A 2QXIA 2XW9A 1K1IA 1LHFH 1IQEA 3PM3A 3MU0A 2ZPQA 5EXNA 1C5TA 4ZROA 4X2YA 1C1TA 2Z6BD 3S7KB 1CE5A 1IHTH 3A7VA 1MU8B 2Z3EA 3TK9A 1ID5H 1O2PA 5DKMA 2PGBB 1UTNA 3RXDA 1HV7A 4R0IA 1GGDB 1ANCA 4ABAA 1NESE 4X0WU 2C8XB 1SGRE 1BBRH 3P8FA 4CR5A 1UVOA 2FOAA 5EW1H 1LVYA 3U69H 3ZZ8A 4XBDA 5GXPA 4IC5A 3P70B 1YPHE 2ALVA 3VB7A 3SGQE 3ZVCA 2Q6FA 1C1MA 2ANMH 2I6QA 1GJDB 4Y71A 2Z9KA 5DP9A 2BLWA 2O8MA 3DFJA 1FY1A 1OS8A 1TMUH 4MVNA 4GHQA 1FZZA 4UEHH 2W7UA 1S6FA 1ELDE 3MWIU 1F0TA 1OOKB 1X7AC 2J38A 2NWNA 3FZZA 1NZQH 1UCYH 3SU1A 1AO5A 1KLIH 1O2MA 2A5AA 2A4GA 3VB4A 4Q80A 1C5OH 3F68H 1AB9B 1K1NA 4GLYA 1G3EA 2ZTXA 4MG3A 2HNTE 1NU9A 1QTFA 4FUJA 3A89A 1TPSA 1C1VH 1EOLA 1RTLA 3D65E 1C5XB 3BTGE 1Z1IA 1H9HE 3A7WA 4NWKA 4B2BA 1O5FH 2VIOA 3CP7A 2A7HA 1V2KT 4MNWA 3SGBE 3TGIE 1TPPA 2DUCA 1P2JA 4HI3A 2FODA 3LH3A 4Y0ZE 3K6ZA 1MZDA 1Q31A 1O39A 2BB4A 3K9XB 2G4TA 1D6WA 1ZSKA 5C5OA 1AZZA 3SI4H 3GCTF 1C1PA 2BDAA 3LIWA 1P12E 2QAAA 1XMNB 4NCYA 3SO3A 1AZ8A 2XWAA 1VR1H 3U1IB 1KDQA 1HXEH 3M5NA 1ANDA 1XM1A 3SJ8A 2FOBA 4GVUA 1V2VT 4NA8A 1C1SA 1QL9A 2A4OA 1TABE 2H5CA 3PB1E 1LPZB 2PWXA 1NFXA 3LONA 1C5PA 3EA9A 1NRQH 1V2JT 1DM4B 2STAE 1K28D 2PLXA 2AH4X 4BAQB 4A1TA 1A61H 2BY9X 1J8AA 3ELAH 3KQEA 1TQ0B 1ELTA 1LPKB 1ETTH 2GMTB 2ZF0H 2R0LA 3QO6A 4TPYA 2BQ6B 1C2HA 2OC1A 2J4IA 1JRSA 4FU9A 2YNAA 1Y59T 3ZZ9A 1UVPA 1EKBB 4NA9H 1ESBA 1SC8U 1MTWA 3OY5U 1C2DA 1P3EA 1F0SA 3GY2A 4NWLA 3ZZ4A 4YLQH 1W13U 2BLQA 4CBOA 3GCOA 2OD3B 5ABWA 1C9PA 1K21H 1LHDH 1BTUA 1GMDF 2A5IA 3F1SB 4BXWA 5EGMA 2FS8A 1BJVA 1Y5BT 3ATLA 1RGQA 1BZXE 1G30B 1O30A 3H7OA 3M5MA 4WH6A 2D26C 4AB9A 1HB0B 1VCWA 2VNTA 3KHVA 1GJCB 4D7FA 4AG1A 2ZPRA 3A87A 1GI2A 5C1XA 1C9TA 1ZLRA 4RSPA 4Y79A 2F91A 1AD8H 3TLOA 1CHOF 2FYQA 1TA6A 5EPNA 4I7YH 1PQ5A 1K9OE 2JKHA 1HDTH 4B74A 4KTUA 4Y7BA 1MMJN 2SGAA 1DXPA 1FY3A 3RC4A 4UD9H 5EG4A 1AIXH 3VGCC 3SUGA 2BQWB 4O3TA 2ZU3A 2FOMB 1NRSH 3RXRA 3TK6A 1C1RA 2BXTH 2PV9B 1EAIA 2P8OB 2D8WA 1AVGH 2B8OH 2BVSH 1C5RA 1GCTB 2BD4A 1MKWH 3F9EA 2ZCLP 1TX7A 4BANB 4Y76A 4INHA 3FAOA 1OWEA 4RKJB 4JK6A 3S9AA 2D2DA 1UCYK 2QN5T 2ZDMA 3TU7H 5H4IB 2Y5HA 3A8DA 1ABIH 2BD8A 3GISB 4E7RG 3ZV9A 1GVZA 1NN6A 1OKXA 1SLUB 3RMLH 2BX4A 3WY8A 2FOCA 1DFPA 3TH4H 5CMXH 1ELAA 1FDPA 5PTPA 3TH3H 1THPB 2VU8E 4IN2A 2PSYA 1TNGA 3M3SA 1V2WT 4KELA 1DANH 3RXOA 4RN6A 1FPHH 4KKDA 5EODA 1TRMA 1YF4A 2ZO3H 3NXPA 1YGCH 1BTHH 1P05A 3K65B 3GY3A 1Z71A 2GTBA 3ZVBA 4XSKU 3RM2H 4NIVA 3GY6A 2UWPA 3QDZB 3U8RH 2A4RA 3RU4E 1DUEA 1TNLA 2R0KA 3ATIA 1SGDE 4K8BA 3UOUA 2ZCKP 1LKAA 1RXPA 5C3NA 1RIWB 2PW8H 1V2ST 2ZTZA 3RLYH 1NPMA 1SGPE 3BTDE 2WYJA 4NA7A 2W26A 1V2OT 1MTVA 4X1PU 5F8ZA 1KXDA 1ZGIA 4MNXA 1XXDA 1PYTD 2FS9A 1C5UA 1HAHH 2WYGA 4K69A 4K5ZA 5EU8A 4K1TA 3KQCA 2P8OC 2VIVA 4B71A 2GT7A 2DE9A 3EDXB 1O5GH 1GBHA 1SL3A 4BTTB 1UJ1A 1MTNC 1GGDC 1O3MA 4BAHB 1DSUA 2Z7FE 1BRUP 2R3UA 2XCNA 1O2XA 3BEFB 2ZG0H 3T26A 1LHGH 1C2LA 3KL6A 3E91A 3BEIB 4ZXYH 1NU7B 1B5GH 4UONA 1GJAB 3RXIA 3GY5A 4JYTA 1O5EH 1TOMH 2FOFA 3P8OA 3BG4C 1EAUA 2C90B 3PMBB 1TPAE 1UTQA 2FYRA 4UFDH 1DWCH 2QV1A 3SU4A 4DGJA 5HMAA 2ZGXH 1BBRK 1ESAA 1MCTA 3E0NB 3EA8A 3AW0A 1XX9A 1KXAA 2O8WA 1ZPZA 3QTVH 1XXFA 1DX5M 3LJJA 5DP7A 3RMMH 4ISIH 4WMFA 3LC5A 1BTPA 2DE8A 4OGYA 4AFQA 2VVUA 1TIOA 1G36A 1BMLA