1AKSB

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
SSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA TRYPSIN
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksB00
2TIOA 1UVPA 2PKSC 3SORA 4B1TA 4X2YA 3MTYA 1FY1A 4BAQB 3ZYDA 1S6HA 1OWKA 2F3CE 8LPRA 1IQHA 2BX4A 3SNBA 1CVWH 2KAIB 1DOJA 4FUBA 4Y10E 4YM9A 2ZFFH 2GCTC 3TGKE 5F03A 4AN7A 5C67A 4ZHAA 1K1PA 2ZU1A 5CE1A 1TNIA 3LGWA 1LHCH 2W3IA 1RS0A 2PHBA 3SU2A 1L4ZA 8KME2 1UTNA 3BEIB 5HM9A 4MNYA 2AH4X 1P09A 3LH3A 5F8TA 1FY5A 2FOEA 1IQJA 4FXGH 1JMOH 2AS9A 1QJ1B 5EODA 1YYY1 1O0DH 2OD3B 3SU1A 1WYKA 1GMDF 1BMAA 1O3OA 2OLGA 1SGIB 1CT4E 4TY7A 2CJIA 1SVPA 2VGCB 5BRRE 1C5XB 5FHTA 3NK8A 4YTAA 1YPLH 4AFQA 2WUBA 1UTOA 1AB9B 2F9BH 1T8LA 1XXDA 5K7RA 3URCA 2Y7ZA 4XBBA 1IQEA 1OWHA 5SGAE 4ZUHA 1C9TA 3RLWH 3AAUA 1KXAA 3QGNB 2FIRH 2NU1E 4AGJA 3M35A 1UTQA 4GPGA 2UWOA 4OS6A 4Y6DA 4CH8B 1MKWK 1O2HA 1TAWA 4D76A 1NY22 2WPIS 1Z7KA 2ZHFH 4BNRA 2QF3A 1NRQH 2ZKSA 1UVTH 4BTTB 1TGCA 1TOMH 3NPSA 3A7ZA 2OC7A 2PUXB 3FAOA 3MNXA 4A1VA 1ZHMA 4YESB 2ZTZA 4B76A 1CHOF 1K2I1 2BZ6H 2FI5E 1ZTKA 2LPRA 3BTTE 1ETRH 4BOHA 1ZRKA 4MNWA 4GCHG 1A2CH 3STIA 3UQVA 1NC6A 1PPZA 2GKVE 2ODQA 3D62A 3FP6E 1AGJA 1Y8TA 3L33A 1DPOA 1QL9A 1F0UA 3HK6B 3RXHA 1RTKA 5DP3A 1Z71A 1YPJH 4FU8A 5E2OA 1HAHH 5J4SA 3EA8A 1TBZH 3L6PA 1BHXB 2J95A 1MTVA 1GDQA 1Q3XA 1YCPH 2UUKB 1CBWB 3RXMA 2QXHA 1VCWA 5FAHA 1WU1A 1TOCB 1TX6A 4X1NU 1D3PB 2ZZUH 4B2BA 2O8UA 2SGAA 1C5QA 1PPHE 3MU1A 2GMTB 3GY2A 3RXEA 1TWXB 2Z6BD 5ESBA 4A92A 2THFB 3U8OH 2O8WA 3SJKA 1TE0A 2ALPA 3UR6A 3SHAH 4BTIB 2BD5A 1QFKH 1FQ3A 4GUXA 2A2XH 3GCHB 1UTPA 4AGKA 3QZQA 3RXGA 1JBUH 2G00A 5LPEA 1TNKA 4HGCA 4DCDA 2TGPZ 3F68H 1Z1IA 1C1MA 4NIYA 3EA9A 3RXRA 4KTUA 5A8XA 4THNH 5AVDA 1GL1A 3BG8A 1H9IE 1JRSA 1DANH 2AMPA 2PKAA 5T6FA 1K28D 4ZROA 3BTFE 5L30H 4XOJA 1XUFA 3ZVCA 4IMQA 2GZ8A 5A8ZA 1GBKA 1HJAB 1O2KA 1AHTH 1FNIA 3RM0H 5C1YA 1ESTA 3BG4C 3SNAA 1GVZA 1C1NA 2BB4A 2VVCA 2V6NA 3KNXA 3P17H 5I25A 1O3EA 2ODYB 3SUEA 3UUZA 1C2JA 2ANYA 2GCHF 4ZAEA 1GVKB 1MTNB 5A0AE 1GWAA 1UVSH 4AX9H 2H6MA 1WTHD 9ESTA 1A5IA 2FOMB 1EP5A 1MBMA 4SGBE 7KMEH 1ZHRA 1N6YA 1N8OC 1O3MA 4ZMAH 1TGSZ 1J15A 2FS8A 1V2OT 2WPHS 1PQ8A 4K5ZA 2ZQ1A 1BITA 2OQ5A 5FBIA 1K1MA 2FLRH 4NWLA 2P3FH 2VNTA 1E36B 5DP6A 5PTPA 1C1RA 1C5SA 4Z6AH 4YZUA 1GMHF 2P3TB 3UNQA 2AGIX 1KY9A 1QRZA 1EPTC 1KXEA 1L2EA 1SGQE 1TB6H 1O32A 3RU4E 5LH8A 1FMGA 3K65B 1ZJKA 4X2WA 1G2MA 4LZ4B 4X8TH 1NZQH 3BTDE 2JH5D 1NRNH 3PM3A 1Y5UT 1HYLA 4IC5A 4ZKSU 2C4FH 1L1NA 2Z94A 4FUCA 3TJVA 4CHAB 1QA7A 3A7XA 3S9AA 1PJPA 3A7YA 2FYRA 1XVMA 1GI1A 1GI3A 1W14U 5JDUB 1YCPK 4X6MA 1YLDA 3JZ1B 3ESTA 3KN2A 1GHAF 1O5EH 1WTGH 2FDAA 4GSOA 3UTUH 4D9QA 4I8HA 1G3BA 3QK1A 1CQQA 1UTMA 2LNCA 1D3QB 1DY8A 3Q00A 2H1UA 2QF0A 4JZ1A 1ZMNA 1ETTH 3VB6A 2Z3EA 3GY4A 2HPPH 1EZQA 3S7KB 4K69A 1FPHH 2G8TA 1AQ7A 3ZZ4A 2O8LA 5J4QA 3UOUA 2HNTC 1C1SA 3T5FH 5TCAA 2H9TH 5F8XA 1GG6B 5DP8A 3ZVFA 3MO3A 3LIWA 3LU9B 3S69A 3LC5A 1P06A 3OYPA 1Y5BT 3MH7A 2DE8A 1C2MA 3ELAH 3EQ0H 1VJAU 3T29A 3GCOA 4FUDA 3B9FH 2XW9A 3RU4D 3SI3H 2AYWA 1O3LA 2VIDA 3B8JA 1AUTC 1GJDB 4TPYA 1O34A 1C2LA 1OXGA 3LGUA 3KL6A 2PTCE 2C8WB 2A7HA 4Q7ZA 2R9PA 1O3AA 1ZRBA 3DT0H 1XUKA 1PPFE 2OQUA 2BOHB 2BDCA 2ZF0H 1MH0A 2FTMA 3UFAA 3ZZBA 3M5MA 2CF8H 3LT3A 3H5CB 3A83A 3BIVH 3KQDA 3L3TA 4RSPA 1C5OH 2WPMS 1C2HA 2RDLA 3M7QA 3BSQA 2Q6GA 4B2AA 4X2VA 6GCHG 3LKWA 1LHEH 1O37A 1JOUB 4MNVA 5EXNA 3SJ9A 3SU5A 2A2QH 5DP9A 4YOIA 2SNVA 4A6LA 1CT0E 1W10U 1VITG 4NSVA 1EJAA 3QN7A 1P11E 1F92A 1J14A 2R0KA 3O8RA 1PQ5A 2ZP0H 4IN2A 1MBQA 4WH8A 1DWEH 4CBNA 1KXFA 5E8EH 3BTGE 1F5RA 1IQGA 1BBRE 3VB5A 1TMBH 1TPAE 1D3TB 2ZPRA 1XX9A 4UD9H 1GJ8B 1SFQB 2F9OA 2XCFA 1BMMH 3E90B 1DWBH 4ZHMU 4MTBA 1WSSH 3E6PH 4AYYB 2Z9LA 1FAXA 3ATKA 2XBXA 2F9VA 1PPGE 1IAUA 2HNTF 1O5AB 3DFJA 2BXTH 1RD3B 2J38A 4X1SU 3MNCA 3D23A 1TQ7B 4ABBA 1OP2A 1HAVB 1E35B 1ABJH 2UWLA 4Q2KA 4U30A 3T28A 1NO9H 4RKJB 1K1NA 4DG4A 1LHGH 2J4IA 3OSYA 3ZVEA 3F1SB 3HATH 3MFJA 2OBQA 3QWCH 1AE5A 1C9PA 1TNGA 1ID5H 4Y0YE 2CV3A 3SGBE 2FI4E 2UUJB 1TNLA 1FAKH 3QUMP 3RMLH 3GY8A 2NU4E 2AMDA 2CXVA 2P95A 1ELCA 1P3EA 1H8IH 3A7WA 2XTTB 2GDDA 1KXBA 3E3TA 5ABWA 2BY8X 2GD4B 4I8JA 1GBCA 2XC0A 2QXIA 1HXEH 2BOKA 1C2KA 2WYGA 1DICA 3UY9A 5GJ4B 4B73A 4H6SB 1BTYA 3SUDA 2ZGXH 4CRGA 4K1EA 1EB1H 2BDBA 1NN6A 3KHVA 2HVXA 3RXVA 4FUJA 1O2ZA 2HLCA 2Y7XA 2ZPQA 1A5GH 2A4QA 3HKIB 1BTXA 4X1QU 3BTWE 2VIWA 4GLYA 2HNTE 4LK4A 3TK6A 4DJZB 1E0FD 1NFXA 1TA6A 5C5OA 3T27A 1O2MA 5F6MA 1SBWA 1J8AA 1HAOH 1ETSH 3ZVBA 1EPTB 1BTHH 4PROA 2XRCA 2QCYA 3JZ2B 3P8GA 4GCHF 3NKKA 1BTPA 3T62A 3DHKH 1Q2WA 1MZAA 4O3TA 1G9IE 3A88A 1Y59T 3NCLA 1BJVA 3RXLA 1O5FH 1TPOA 3QGJA 1V2KT 5L6NH 1GI2A 1NM6A 2BY9X 3BIUH 5CHAC 3ZZCA 2I6SA 1HAGE 5C20A 3KIDU 1L1GA 1W7GH 3S7HB 4ZHLU 1TYNA 2WV5A 1OKXA 4WXIA 1GI7B 3Q3YA 4E05H 1AFQC 1FXYA 4XBCA 3A8DA 1FJSA 2QIQA 2GV7A 2IOTA 4Y8YA 3A8AA 2VB0A 3ZZDA 1GCTC 4JZDH 1TLDA 1EAXA 1FY3A 3A8BA 4F4OC 4OS1A 2ZHEH 2XWBI 5L2YH 1Y5AT 3UREA 4R0IA 5EGMA 2ZFSA 1C5PA 1V2NT 3EDXB 1G3CA 5IDKA 1TRNA 2ULLA 1ZGIA 2BZAA 6CHAC 1AUJA 1ARBA 1NTPA 3RXIA 1DLKB 3MYWA 4KTCA 3EA7A 1SGEE 2RCEA 3UWJH 1VJ9U 1DM4B 2G81E 1BRCE 4XBDA 2W3KA 3PV4A 1EOLA 1O2JA 2O9QA 1G36A 2GV6A 1YF4A 3PMJA 1P2MA 5LGOA 2JKHA 3PYHA 2BQ6B 1F0TA 1SLWB 4OGYA 4D7FA 5A09A 3A85A 1SGYE 1TGBA 5JBBS 3SI4H 3BTHE 1SQOA 3TNTA 1L4DA 2WV4A 1C2FA 1FZZA 2Z3CA 4R8TB 1KDQB 7GCHG 1GJ7B 1CE5A 3GCNA 5FXLA 3VGCB 3GYMA 2B0FA 1IHSH 3ODDA 5B6OA 2ZDLA 3TJUA 3O8DA 1HB0B 3MO6A 2A0QB 3Q77A 1ZLRA 2OC1A 2R0LA 1O30A 1OS8A 4JMYA 1ANBA 1Z8JB 3H7OA 1ELVA 1UTJA 2G55A 1GJ4H 2ZU3A 1SHYA 1RTLA 1C4Y2 1TA2A 3UOPA 2OC8A 4HFPB 1BRBE 1AI8H 1UJ1A 4TPIZ 1C5NH 4NGAH 1FN8A 4K3JA 1GI8B 7ESTE 2Y81A 1GBMA 1TIOA 3MU8A 3HPTB 1O3GA 4Y79A 1O3KA 3E0PB 2G5VA 4GVUA 3QTOH 1UCYE 3PO1C 5E0JA 1ZSJA 1GGDC 4I8KA 2SFAA 4DT7B 2PGBB 4MG3A 3NXPA 2ZWLH 3M7TA 3SOSA 2BD2A 2GX4A 2ZCLP 1J17T 4X6PA 1RIWC 1VCQA 2P8OB 1SGNE 1DDJA 3TH4H 1EJNA 1A0JA 1G32B 1HV7A 3A87A 3PTBA 3K2UA 1SHHB 3T26A 3MH6A 4AYVB 1HBTH 2Y5GA 1IQFA 1E37B 4DOQA 2AERH 3WY8A 2Q6FA 1TNHA 1GI5A 1CU1A 1HRTH 2B5TB 1H4WA 1EAIA 3TK9A 1AD8H 1BTZA 1C5ZB 3ATLA 3NZIA 5C5NA 4ABGA 1FIZA 3RXTA 1SQAA 3R3GB 4WXVA 1G2LA 2FZZA 1P57B 1BBRK 2I6QA 5C3NA 1JIRA 1SGPE 1C1OA 2FI3E 2Y82A 1FY4A 1ZMJA 3B23B 4OGXA 4AB9A 1W8BH 1ESAA 1GHBG 1WQSA 1EATA 1SGFG 3ATMA 5GWZA 1O2IA 3BEFB 4NZQA 2FPZA 4AORA 2FOAA 1SGTA 3SO3A 1GJCB 2ZDKA 1SR5C 2NU3E 3PB1E 4ISIH 2J2UA 4NA7A 3RXJA 2BQ7B 2ANKH 4BAOB 2ZC9H 1O3BA 1OWIA 2ESTE 1S85A 3PTNA 3W95A 1ZYOA 2AEIH 3TGIE 2BTCE 3UWIA 3ZZ8A 1MTUA 1NS3A 1YPKH 3DUXH 4DURA 1O2WA 1ZSLA 4ZXYH 4AG1A 2BDHA 1EP6A 1GVLA 1BDAA 3A89A 1V2RT 6GCHF 1TBQH 1SB1H 5DO4H 3FVFB 3E0NB 2H2ZA 4YT7H 5CHAB 1VITF 3DD2H 4OS5A 2A4RA 4ZKNU 1V6DA 1JIMA 1HAIH 1TMUH 1GBBA 1EOJA 1MU6B 4UEHH 3O8BA 4ABIA 4E7NA 2BQWB 5FCKA 4X8UH 2JETC 4OS4A 1AFQB 2VU8E 2C8XB 4KP0A 1OYTH 1QB9A 4OS7A 2R3UA 2GZ9A 1Y3YA 3CP7A 1GCTB 1MKXH 4Q80A 3R0FA 1Z8RA 1T8OA 2EI8A 3C1KA 1MTWA 1UHBA 1GJAB 1F5KU 5AF9H 5FBEA 1HAPH 1P12E 2ZDAH 5HGGA 1HCGA 4Q7XA 2TPIZ 5EW1H 4JYTA 2C93B 2GZ7A 3UNRA 5DP7A 5BPEA 3LC3A 1C5MD 1HPGA 2IJOB 1G30B 3LPRA 1OWEA 1WUNH 2WYJA 3SGAE 1WV7H 1UCYH 1TBRH 1ZSKA 4MVNA 1DY9A 2V35A 4K60A 1DLEA 2QV1A 1LMWB 1WCZA 2A7CA 1QURH 3P8FA 5JBTA 1ANCA 4WWYA 1NESE 3MU0A 2P59A 2SGDE 3LOXA 2FOHA 3M37A 4JYVH 1LVBA 1C1WH 1JXPA 2QN5T 5A0BA 1A46H 3RMMH 1QY6A 3IWMA 2DE9A 5H4IB 1DE7H 2EC9H 1ZR0A 1GI9B 1SMFE 3TVJB 4ZKRU 1MAYA 4WMEA 1HJ8A 1O5DH 5TCCA 4WF8A 4DVAU 5HYOA 5A2MH 3SNCA 3GY5A 4BXSA 1S81A 3P70B 3LJJA 1W12U 2PKSB 1D6WA 1MAXA 2EEKA 4J2YB 2QYIA 1XXFA 1O2UA 1XKBC 4ISNA 1O3IA 3I29A 3SN8A 2CHAC 2D1JA 3RU4T 2GCTB 2QA9E 3A7VA 2FX6A 1O2NA 1AKSA 1P10A 1BT7A 3F9EA 4NIXA 2HGTH 1S6FA 1CGIE 3MU4A 2FP7B 2ZECA 2WPLS 3E91A 2J34A 3GDVA 4BXWA 2PKAB 2OBOA 2STBE 2B9LA 4B71A 1XUIA 4NCYA 1ELAA 4UE7H 4BAKB 4U01A 3SNDA 1O2XA 4BAMB 1RIWB 4DY7B 4CR9A 1B0FA 1HAZB 2IPHA 4KELA 4X6NA 3TH2H 1Y3VA 1MKXK 1P2JA 2OC0A 1LQDB 3STJA 1KIGH 3RUOA 2BY7X 2FESH 3A86A 1BJUA 1O33A 2A45B 2GVFA 4CBOA 3RMOH 1QBNA 3RXQA 3VEQB 4UFDH 3QTVH 4JYUH 3BF6H 5DJ7A 3M5LA 4UDWH 2A5KA 1VR1H 2HWLB 1AO5A 4NWKA 2PV9B 4WH6A 3TJOA 4CH2B 1KYNA 1AU8A 2QXJA 5EQQA 2C8ZB 3ATIA 4NIVA 1O35A 2VWNA 3SHCH 1UCYK 1HAXB 1O2TA 3A82A 2ZTYA 2B8OH 3U8RH 2VIVA 2ZIQH 4JK6A 1GHYH 2GT8A 1J16A 2C8YB 2FMJA 1D9IA 1GBTA 5EXLA 1GMCG 1K1IA 1QA0A 1ELBA 3PMHB 4IW4E 1RFNA 4OS2A 2ZI2H 2B7DH 2CF9H 5EPYA 2BX3A 2WPKS 3SUFA 3V12A 5E0GA 3PMBB 3SUGA 1GI4A 2ZU4A 3BV9B 2ZPSA 1EAUA 3OY6U 4I33A 3KEEA 1C1TA 1W0ZU 2HPQH 4AB8A 2BD8A 1HIAA 1YPGH 1EZSC 1GI6A 3SV7A 7GCHF 3F9HA 5F8ZA 2TGAA 1VGCC 1P2KA 3MNBA 5DGJA 1DS2E 1EAWA 3PROA 1AMHA 2G4UA 3V7TA 1T32A 1C5VA 5HMAA 3F9FA 1O3JA 2D2DA 2VVUA 4XE4A 3M5NA 1EXFA 3E1XB 5K0HA 3F9GA 1TX8A 2Z9KA 1O2GH 2BLOA 1G37A 1OX1A 4YT6H 3ZZ3A 1AZZA 2EI6A 3URDA 1LKBA 2ZHDA 4MDSA 1T31A 2A5AA 2EA3A 4IMZA 2XYAA 1FUJA 1P04A 1QGFA 5TJXA 1TPSA 1D6RA 3TH3H 3SV8A 1FLEE 3TGJE 1KLIH 1TABE 3SQHE 1VCPA 1MD8A 1BB0B 3BEUA 1GHZA 2WINI 1CA8B 3RXFA 2FS9A 9LPRA 1HDTH 1CGJE 1LPGB 2AGEX 1XUJA 3CS0A 3ZZ9A 2H5CA 1V2JT 2D8WA 2OUAA 3U1JB 1BCUH 1SPJA 5GXPA 2O8TA 4FUHA 4FU7A 3O8CA 1A7SA 4SGAE 4CRAA 1PPBH 5C1UA 1AVWA 1GPZA 4K8BA 2W5EA 1NFYA 4ABAA 2C90B 3BG4B 4GHQA 3GDSA 5E0HA 3U9AH 5EG4A 1HUTH 1LHDH 2P16A 3W94A 1QBOA 1AWHB 1C5YB 1ANDA 1UVOA 3RXSA 1YBWA 3M3VA 4UONA 3SV9A 1ZHPA 1ZZZA 2G52A 1OSSA 4AFSA 3CS7A 5T6DA 1N8OB 1O3HA 1V2WT 2J9NA 2VWOA 4IS5A 1GBJA 1GBEA 1O3PB 5HXFA 1O3NA 1NFUA 1UMAH 3RXUA 4CR5A 2BD9A 1KTTB 1VGCB 4KKDA 1O2PA 1MMJN 1O38A 3T2NA 2BDYA 1C1VH 5EPNA 4MQAA 1GHBF 1CSOE 1QQUA 4B75A 1C1UH 4UFEH 1XKAC 3LGYA 1GCDA 1SL3A 1THRH 4XFQA 3MU5A 2GT7A 2XBWA 1QJ6B 2SNWA 5AHGH 1EASA 1EUFA 1T4VH 2SGPE 2ZTXA 3FANA 1O3CA 3MH5A 4H4FA 4ABFA 4MPVA 4H42U 1C5WB 3VPKA 4FVDA 1VZQH 1DWCH 3TLOA 1YP9A 1Y3XA 2Y6TA 2CHAB 2DUCA 1EQ9A 3ATWA 1AFEH 3SJIA 1D4PB 3RXPA 1QR3E 1K1OA 5AFYH 1SGFA 2OXSA 1H8DH 1UK2A 4UFFH 3RC5A 3SQEE 2BMGB 2VH0A 3AW1A 4I32A 3ZV9A 4E06H 2R3YA 1DXPA 1OP8A 2WUCA 1V2QT 5HM2A 1NU7B 5EQSA 2H9HA 3MO9A 1JWTA 1DVAH 1UTLM 1LVYA 1AZ8A 4ABHA 1QB1A 4IBLH 8GCHG 4FUFA 1MCTA 2KAIA 2W26A 3KGPA 1FDPA 1RGQA 3LGVA 2BVXH 3A8CA 1GBIA 1FI8A 3M3SA 5ESTE 4ZKOU 1O2YA 1V2MT 1TMTH 1W0YH 4XDEA 1BBRH 1QL8A 3HKJB 2FLBH 2ZFPH 3RXBA 4K1TA 3GOVB 4ISLA 2H9EH 2Y80A 5EXMA 1Y3WA 1GJ5H 4FUIA 1XVOA 1ELEE 4Y8ZA 5A8YA 1O39A 3VXFH 1ZOMA 2ZDNA 2VIQA 1E34B 1G3DA 4DIIH 1GL0E 2HOBA 1WQVH 4JCNA 4ABJA 1B7XB 2HRVA 1DX5M 1NROH 4KTSA 3FZZA 3LH1A 4D9RA 3GDUA 2V3HH 2Z9GA 3RC4A 2D26C 4YOJA 1RRKA 1F2SE 2AIPA 2BDIA 1ELTA 5T6GA 1IQMA 2VWMA 1MTNC 3QDZB 4LOYH 1V2ST 3IG6B 2A31A 1AIXH 3OTJE 3BTKE 3GICB 4D8NA 3SBKA 5DG6A 1QBVH 2FM2A 2PUQH 2ZU5A 3MHWU 1C4V2 4FVBA 4O97A 2EI7A 4CRFA 1LKAA 1O2LA 3SJ8A 4Z0KA 4HTCH 3SU0A 2FOCA 3KCGH 4WMDA 2C3SA 1PQAA 3RLYH 2P94A 1CO7E 3P8OA 3P92A 1QHRB 1BHXF 1OYQA 1BRAA 1OWDA 1Q31A 2M5TA 3RM2H 3QZRA 1LPZB 2AGGX 2Z3DA 4ABDA 2UWPA 5JYIA 4A7IB 4MPUA 3RXCA 1IQNA 1IQLA 1SG8B 1GJ6A 1O31A 5GCHG 5EOKA 3MWIU 2Z9IA 1A61H 2FOGA 1ABIH 2XWAA 2ZO3H 4CHAC 3GISB 2XNIA 3I77A 2XBYA 4AZ2B 4DGJA 3RXKA 1K1JA 2K1QA 1LVMA 1GHWH 2ODPA 1V2VT 1YPHC 1XUGA 1EB2A 1DWDH 1PPCE 4FU9A 3LGTA 2ZCKP 5CMXH 2ANWA 2F9PA 3RDZA 2ZEBA 3TK5A 4AFZA 5JB9S 1BUIA 2G4TA 2QXGA 1P2NA 3ZZ6A 1F0SA 2BD7A 1WBGB 1XM1A 1GDUA 3ZYEA 3MOCA 3FP7E 1S0RA 1WAYB 2UUFB 2Y5FA 1A3EH 1P9UA 3U98H 1UK3A 1GG6C 1SFIA 2PW8H 4QT8C 3KQBA 1ANEA 1HFDA 3H7TA 2OINA 1QRWA 2P93A 2F91A 1BMNH 2FWWA 3BN9A 4Y7AA 1P9SA 2BDAA 2CN0H 2VIOA 1C4U2 4J1YA 3MNSA 4Y11E 3RXAA 1O2SA 2NU2E 3M7UA 4CRCA 1SLVB 1MQ6A 3MH4A 2ZGBH 3MI4A 2UUYA 1Z6EA 2PSXA 4NZLA 1A0HB 4U2WA 2Q1JA 3T25A 2HALA 2V3OH 4TY6A 2BDGA 1W3CA 5GDSH 1QNJA 3GY7A 3UNSA 2PTNA 4BTUB 1E38B 1HJ9A 5I46H 1BZXE 1W2KH 3PLBA 3GYLB 2ZU2A 3UR9A 1TX7A 1ZPBA 1IQKA 3PLPA 3A81A 3RMNH 2ZG0H 1SGCA 1GI0A 5DP5A 1K9OE 1G3EA 3TNSA 3VB7A 1BTWA 4JZEH 4X6OA 1AVXA 1GHVH 4ABEA 3BTME 3V0XA 2GDEH 5C1XA 1CT2E 2ASUB 1H9LB 1GMCF 4YO9A 3BTEE 2Q6DA 5ETXA 2GGVB 2BHGA 1KXDA 4JK5A 4LZ1H 1SLXB 1LVOA 1TFXA 2PFEA 4LXBH 1GJBB 1UK4A 1GBAA 2WPJS 1S84A 3EYDA 1DXWA 1H1BA 3FP8E 1J9CH 1KSNA 1X7AC 3GCTG 1O2OA 1NU9A 1LHFH 1UO6A 2ZHWH 1B5GH 2Y5HA 4Y0ZE 2TGDA 2PR3A 1TRMA 1QCPA 1YKTA 1HAYB 2YNBA 1O5GH 4MLFB 2ANMH 1GHXH 1A0LA 4I8GA 3PLKA 3LJOA 2FOFA 5FPSA 1O5CB 1ZPCA 1U6QA 5LPRA 2BLWA 2BLQA 5FCRA 1V2UT 5DK1A 1LCYA 1SGDE 3QX5H 3SZNA 4NFFA 6LPRA 1PPEE 6CHAB 1XUHA 5EU8A 5E2PA 4O9VA 1K21H 1MD7A 4X8SH 1V2TT 1ORFA 2STAE 1OWJA 2FTLE 2FO9A 1TQ0B 5DPAA 3ZZ7A 2VJ1A 3HK3B 4NA8A 2A7JA 1MQ5A 1P2IA 3M3TA 2YOLA 3TJNA 1IOEA 1N1LA 1C2EA 3FFGA 3PWCA 1C2DA 3TIUA 3M36A 1QIXB 2QGRA 1V3XA 2BM2A 2TGTA 4O03A 3OY5U 1ARCA 1BOQA 1EZUC 2BLVA 2ALVA 2QAAA 3BTQE 1Z6JH 2ZGJA 3I78A 1F5LA 1RTFB 1SLUB 1YPHE 2ZA5A 1S82A 4YOGA 1AVGH 2GTBA 4ASHA 3ITIA 5FX6A 2ZCHP 4K2YA 2A4OA 1NRPH 5EQRA 3MMGA 1FPCH 1FONA 2Z9JA 1C5TA 1MZDA 1Y3UA 3F6UH 1PQ7A 2ZDMA 3UQOA 1ZTLA 1UTKA 4CRBA 6ESTA 2VWLA 1YPMH 4DIHH 2ZGCA 1M9UA 2FYQA 1O3FA 1SQTA 3ZV8A 2XBVA 1GBDA 4NFEA 3M61U 3TPIZ 1SI5H 2SGQE 3LGIA 1GMDG 1UHBB 4O3UA 3CENA 1TALA 1Z8IB 3PO1B 5LPFA 1GGDB 2G51A 2XCNA 5EW2H 2R2WU 5G4BA 3LONA 1T7CA 4AOQA 3S9CA 3GY6A 2PLXA 3FZDA 1O5BB 5FPTA 4D7GA 1H9HE 1T8NA 2XXLA 4CRDA 4MPWA 2BY6X 1SC8U 3ZVDA 2FXRA 2VIPA 1P01A 1THSH 1OPHB 4I8LA 1L1JA 1A3BH 1DUAA 3A80A 1D3DB 1SSXA 3PWBA 2BYAX 1BMLA 4XSKU 4VGCC 4AG2A 2PGQB 1MUEB 2ZHQH 3DFLA 3HGNA 1QRXA 5A0CA 2R2MB 1QL7A 1FY8E 3EE0B 2ZGHA 4TWYA 8GCHF 1L0ZA 4F49A 3SU3A 3SU6A 1TNJA 1CHOG 1KXCA 1HAVA 3ODFA 4FUGA 3E8LA 4X0WU 3SU4A 1GDNA 4ZH8A 1BIOA 1LTOA 1AN1E 1RXPA 1KLJH 1C5RA 1YLCA 1O2QA 3Q76A 3UIRA 2RA0A 4RN6A 1DFPA 3D49H 4ESTE 4X1PU 1C1QA 1GBLA 1PYTC 2BD4A 1ACBE 1QB6A 1O3DA 1SOTA 1ZGVA 1T8MA 1FV9A 3VB4A 1YC0A 3GY3A 4B2CA 3SNEA 3VGCC 2F9NA 1BTUA 2A5IA 4WY3A 3S9BA 2A32A 3K6ZA 1P03A 1CA0C 3A84A 3AAVA 1AKSB 2W7SA 5JB8S 5DP4A 2JH6D 3SV6A 2SGEE 3RXDA 1QTFA 2QC2A 2VINA 1W13U 1IHTH 3QO6A 1LQEA 1F0RA 1YPEH 2ZFQH 1NRRH 4X2XA 4NIWA 4AFUA 1LPKB 2PSYA 2A1DB 4B74A 1MCVA 3ENSB 1P8VC 1C2GA 2ZFRH 1VITH 4INKA 4H6TA 4NG9H 4A5TS 3SGQE 1FN6A 2ILNA 1Z8GA 1ELFA 3D65E 3V3MA 4ISHH 1NRSH 1WOFA 2BXUH 1P2QA 3EAJA 2JETB 1P2OA 5GIBA 3AASA 1EPTA 1NFWA 2OCVB 3Q3KA 4E7RG 1O2RA 1BA8B 1T4UH 3G01A 2IN2A 2JH0D 5GCHF 1FIWA 2AFQB 4INLA 3P8NA 1EKBB 1HXFH 4IN1A 3ZVAA 2RA3A 1TRYA 2ZFTA 5JPMH 4I7YH 2VGCC 3A7TA 2P8OC 5AFZH 5T3HA 4GAWA 3OX7U 1GJ9B 2ZNKH 5FX5A 3C27B 1ZPZA 3LDXH 1AB9C 1AWFH 1C2IA 1EZXC 2NWNA 2GCHG 1JRTA 5JBCS 4GHTA 1AY6H 2AIQA 5JBAS 3SW2B 3TITA 2FEQH 1CGHA 2F9UA 3KF2A 1S5SA 1V2PT 1CHGA 1O2VA 2BD3A 1LDTT 4UFGH 3N7OA 1F7ZA 4ZXXH 2O8MA 4JZIA 4NA9H 3AW0A 3QLPH 2BVSH 3DA9B 4X8VH 5C2ZA 1HIAB 1Z1JA 4MPXA 1NT1A 4TYDA 4BANB 1GMHG 1GBFA 2P3UB 1MTSA 1P0SH 1B0EA 5FPYA 3EGKH 3UPEA 3NWUA 1YGCH 3P95A 4U32A 1ELDE 4BAHB 3IITA 2W7UA 2AMQA 3NUMA 2ZDVH 3M5OA 1DUEA 4WMFA 3ZZ5A 1DSTA 1OOKB 1QJ7B 3ZZAA 1INCA 1ELGA 1THPB 1TGTA 1EJMA 1S0QA 1AE8H 8ESTE 2F83A 1GHAG 1HLTH 1N6XA 4KGAA 4K1SA 1ZMLA 3VB3A 3VXEH 1CBWC 1KDQA 2FOBA 3PMAB 4FUEA 1UVUH 1TGNA 4Y7BA 4X1RU 2CMYA 3KQCA 1OP0A 4HI3A 2XC5A 2FODA 1A5HA 1HNEE 2TBSA 2FX4A 4MNXA 2PWXA 2V0BA 1BRUP 1C1PA 1MU8B 2GMTC 4M7GA 1DT2A 1KLTA 4IC6A 3E16B 1IQIA 2J94A 4NSYA 1QQ4A 4TWWA 4INHA 1A1RA 1K1LA 1A4WH 1ZJDA 1RJXB 2J92A 2RG3A 1P02A 4Q7YA 4IGDA 7LPRA 3GCTF 3K6YA 1ESBA 1LO6A 1NPMA 1O36A 1HGTH 3GCHC 3HGPA 2QY0B 4WJG2 3OU0A 1DITH 4Y8XA 2GP9B 1TPPA 3RC6A 1DSUA 3SJOA 2Z7FE 1ZTJA 4HZHA 1P05A 3P6ZB 2BVRH 4A1XA 1C5LH 1KTSB 4VGCB 4Y71A 1MKWH 3VFEA 2ZQ2A 4WVPE 3ZVGA 4RKOB 4A1TA 1SGRE 1YM0A 5IYTA 2NU0E 1GBHA 1HJAC 3U1IB 1SOZA 4DW2U 2TRMA 5GPIB 1BQYA 1K22H 3Q3XA 4YLQH 3RXOA 3U69H 3U8TH 4K8YA 1C5UA 2OP9A 3AVZA 3TU7H 2XC4A 4ISOA 1P3CA 1S83A 3V13A 1XMNB 4JZFH 1W11U 4I31A 2YNAA 2H5DA 2BY5X 4YLUA 1TONA 3S0NA 1W7XH 3RP2A 1YCPM 1PFXC 2G5NA 2VVVA 1EX3A 5DKMA 2SGFE 5L2ZH 1PYTD 2VH6A 4Y76A 4CREA 1V2LT 2A4GA 3KQEA 2OTVA 3SV2H 1CA0B 3K9XB 2CGAA
chains in the Genus database with same CATH superfamily
2TIOA 1UVPA 2PKSC 3SORA 4B1TA 4X2YA 3MTYA 1FY1A 4BAQB 3ZYDA 1S6HA 1OWKA 2F3CE 1E79D 8LPRA 1IQHA 2BX4A 4RI0A 3SNBA 1CVWH 2KAIB 1DOJA 4FUBA 4Y10E 4YM9A 2ZFFH 2GCTC 3TGKE 5F03A 4AN7A 5C67A 4ZHAA 1K1PA 2ZU1A 5CE1A 1TNIA 3LGWA 1LHCH 2W3IA 1RS0A 2PHBA 3SU2A 1L4ZA 8KME2 1UTNA 3BEIB 5HM9A 4MNYA 2AH4X 1P09A 3LH3A 4TSFD 1FY5A 2FOEA 5F8TA 1IQJA 4FXGH 1JMOH 2AS9A 1QJ1B 3F2FA 5EODA 5HIZA 1YYY1 1O0DH 2OD3B 3SU1A 1WYKA 1GMDF 1BMAA 1O3OA 2OLGA 1SGIB 1CT4E 4TY7A 2CJIA 1SVPA 3F0PA 2VGCB 5BRRE 1C5XB 5FHTA 3NK8A 4YTAA 1YPLH 4AFQA 2WUBA 2JDID 1UTOA 1AB9B 2F9BH 1T8LA 2V7QD 1XXDA 3FKSD 5K7RA 3URCA 2Y7ZA 4XBBA 1IQEA 1OWHA 5SGAE 4ZUHA 1C9TA 3RLWH 3AAUA 1KXAA 3QGNB 2FIRH 5DSFA 2NU1E 4AGJA 3M35A 1UTQA 4GPGA 2UWOA 4OS6A 4Y6DA 4CH8B 1MKWK 1O2HA 1TAWA 4D76A 1NY22 2WPIS 1Z7KA 2ZHFH 4BNRA 2QF3A 2KR7A 1NRQH 2ZKSA 1UVTH 4BTTB 1TGCA 2RDEA 1TOMH 3NPSA 3A7ZA 2OC7A 2PUXB 3FAOA 3MNXA 4A1VA 1ZHMA 1S6LA 4YESB 2ZTZA 4B76A 1CHOF 1K2I1 2BZ6H 2FI5E 1ZTKA 2LPRA 1YWUA 3BTTE 1ETRH 2J98A 4BOHA 1ZRKA 4MNWA 4GCHG 3DSPA 1A2CH 3STIA 2V3MA 3UQVA 1NC6A 1PPZA 2GKVE 2ODQA 3D62A 3FP6E 1AGJA 1Y8TA 3L33A 3FOAA 5KGOA 1DPOA 1QL9A 1F0UA 3HK6B 3RXHA 1RTKA 5DP3A 3DSOA 1Z71A 1YPJH 4FU8A 5E2OA 1HAHH 5J4SA 3EA8A 1TBZH 3L6PA 1BHXB 2J95A 1MTVA 1GDQA 1Q3XA 1YCPH 2UUKB 1BMFD 1CBWB 3RXMA 2QXHA 2KZ4A 2PP6A 1VCWA 5FAHA 1WU1A 1TOCB 1TX6A 4X1NU 1D3PB 2ZZUH 4B2BA 2O8UA 2SGAA 3EE7A 1C5QA 1PPHE 3MU1A 1QZ8A 2GMTB 3GY2A 3RXEA 1TWXB 2Z6BD 5ESBA 4A92A 2THFB 3U8OH 2K0QA 2O8WA 3SJKA 2WSSD 1TE0A 2ALPA 3UR6A 3SHAH 4BTIB 2BD5A 1QFKH 1FQ3A 4GUXA 2A2XH 3GCHB 1UTPA 4AGKA 3QZQA 3RXGA 1JBUH 2G00A 5LPEA 1TNKA 4HGCA 3PV2A 4DCDA 2TGPZ 3F68H 4XD7D 1Z1IA 1C1MA 4NIYA 3EA9A 3RXRA 4KTUA 5A8XA 4THNH 5AVDA 1GL1A 3BG8A 1H9IE 1JRSA 1DANH 2AMPA 2GJGA 2PKAA 5T6FA 1K28D 4ZROA 3BTFE 5L30H 4XOJA 3KQ5A 1XUFA 3ZVCA 4ACBA 4IMQA 2GZ8A 5A8ZA 1GBKA 1HJAB 4I86A 1O2KA 1AHTH 1FNIA 3RM0H 5C1YA 1ESTA 3BG4C 3SNAA 1GVZA 1C1NA 2BB4A 2VVCA 4OM9A 2V6NA 3KNXA 3P17H 5EJLA 2RFKC 5I25A 1O3EA 2ODYB 3SUEA 4Q4LA 3UUZA 1C2JA 2ANYA 2GCHF 4ZAEA 1GVKB 1MTNB 5A0AE 1GWAA 1UVSH 4AX9H 2H6MA 1WTHD 9ESTA 1A5IA 2FOMB 1EP5A 1MBMA 4SGBE 7KMEH 1ZHRA 1N6YA 1N8OC 1O3MA 2XNDD 1TGSZ 4ZMAH 1J15A 2FS8A 1V2OT 2WPHS 1PQ8A 4K5ZA 2ZQ1A 1BITA 2OQ5A 5FBIA 1K1MA 2FLRH 4NWLA 2P3FH 2VNTA 1E36B 5DP6A 5PTPA 1C1RA 1C5SA 4Z6AH 4XRNA 4YZUA 1GMHF 2P3TB 3UNQA 2AGIX 1KY9A 5C17A 1QRZA 1EPTC 1KXEA 1L2EA 1SGQE 1TB6H 1O32A 3RU4E 5LH8A 1FMGA 3K65B 1ZJKA 4X2WA 1G2MA 4LZ4B 4X8TH 1NZQH 3BTDE 2JH5D 1NRNH 3PM3A 1Y5UT 1HYLA 4IC5A 4ZKSU 2C4FH 1L1NA 2Z94A 4FUCA 2F4LA 3TJVA 4CHAB 1QA7A 3A7XA 3S9AA 1PJPA 3A7YA 2FYRA 1XVMA 1GI1A 1GI3A 1W14U 4YXWD 5JDUB 1YCPK 4X6MA 1YLDA 3JZ1B 3ESTA 3KN2A 1GHAF 1O5EH 1WTGH 2FDAA 4GSOA 3UTUH 4D9QA 4I8HA 1G3BA 3QK1A 1CQQA 1UTMA 2LNCA 1D3QB 1DY8A 3Q00A 1WDIA 2H1UA 2QF0A 5KEDA 4JZ1A 1ZMNA 1ETTH 3VB6A 2Z3EA 3GY4A 2HPPH 1EZQA 3S7KB 4K69A 1FPHH 2G8TA 1AQ7A 3ZZ4A 2O8LA 5J4QA 3UOUA 2HNTC 2JJ1D 1C1SA 3T5FH 5TCAA 2H9TH 5F8XA 3KYFA 1GG6B 5DP8A 3ZVFA 3MO3A 3LIWA 3LU9B 3S69A 3LC5A 1P06A 3OYPA 1Y5BT 3MH7A 2DE8A 1C2MA 3ELAH 3EQ0H 1VJAU 3T29A 3GCOA 4FUDA 3B9FH 2XW9A 3RU4D 3SI3H 2AYWA 1O3LA 3FN8A 2VIDA 3B8JA 1AUTC 1GJDB 4TPYA 1O34A 1C2LA 1OXGA 3LGUA 3KL6A 2PTCE 2C8WB 2A7HA 4Q7ZA 2R9PA 1O3AA 1ZRBA 3DT0H 1XUKA 1PPFE 2OQUA 2BOHB 5FL7D 2BDCA 2ZF0H 1MH0A 2FTMA 3UFAA 3ZZBA 3M5MA 2CF8H 3LT3A 3H5CB 3A83A 3BIVH 3KQDA 3L3TA 4RSPA 1C5OH 2WPMS 1C2HA 2RDLA 3M7QA 3BSQA 2Q6GA 4B2AA 4X2VA 6GCHG 3LKWA 1LHEH 1O37A 1JOUB 4MNVA 5EXNA 3SJ9A 3SU5A 2A2QH 5DP9A 4YOIA 2SNVA 4A6LA 1CT0E 1W10U 1VITG 4NSVA 1EJAA 2WPDD 3QN7A 1P11E 1F92A 1J14A 2R0KA 3O8RA 4ZCNA 1PQ5A 2ZP0H 4IN2A 1MBQA 4WH8A 1DWEH 4CBNA 1KXFA 5E8EH 3BTGE 1F5RA 1IQGA 1BBRE 3VB5A 1YLNA 1TMBH 1TPAE 1D3TB 2ZPRA 1XX9A 4UD9H 1GJ8B 1SFQB 2F9OA 2XCFA 1BMMH 2CK3D 3E90B 1DWBH 4ZHMU 4MTBA 1WSSH 3E6PH 4AYYB 2Z9LA 1FAXA 3ATKA 2XBXA 2F9VA 1PPGE 1IAUA 2HNTF 1O5AB 3DFJA 2BXTH 1RD3B 2J38A 4X1SU 3MNCA 3D23A 1TQ7B 4ABBA 1OP2A 1HAVB 1E35B 1ABJH 2UWLA 4Q2KA 2JIZD 1WXRA 4U30A 3T28A 1NO9H 4RKJB 1K1NA 2M2AA 4DG4A 1LHGH 2J4IA 3OSYA 3ZVEA 3F1SB 3HATH 3PRBA 3MFJA 2OBQA 3QWCH 1AE5A 1C9PA 1TNGA 1ID5H 4Y0YE 2CV3A 3SGBE 2FI4E 2UUJB 1TNLA 1FAKH 3QUMP 3RMLH 3GY8A 2NU4E 2AMDA 2CXVA 2P95A 1ELCA 1P3EA 1H8IH 3A7WA 2XTTB 2GDDA 1KXBA 3E3TA 5ABWA 2BY8X 2GD4B 4I8JA 1GBCA 2XC0A 3OAAD 2QXIA 1HXEH 2BOKA 1C2KA 2WYGA 1DICA 3UY9A 5GJ4B 4B73A 4H6SB 1BTYA 3SUDA 2ZGXH 4CRGA 4K1EA 1EB1H 2BDBA 1NN6A 3KHVA 2HVXA 4FETA 3RXVA 4FUJA 1O2ZA 2HLCA 2Y7XA 2ZPQA 1A5GH 2A4QA 3HKIB 1BTXA 2KCYA 4X1QU 3BTWE 2VIWA 4GLYA 2HNTE 4LK4A 3TK6A 4DJZB 1E0FD 1NFXA 1TA6A 1KMHB 5C5OA 1O2MA 3T27A 5F6MA 1SBWA 1J8AA 2EQNA 1HAOH 1ETSH 3N7DA 3ZVBA 1EPTB 1BTHH 4PROA 2XRCA 2QCYA 3JZ2B 3P8GA 4GCHF 3NKKA 1BTPA 3T62A 3DHKH 1Q2WA 1MZAA 4O3TA 1G9IE 3A88A 1Y59T 3NCLA 1BJVA 3RXLA 1O5FH 1TPOA 3QGJA 1V2KT 5L6NH 1GI2A 1NM6A 2BY9X 3BIUH 5CHAC 3ZZCA 2I6SA 1HAGE 5C20A 3KIDU 1L1GA 1W7GH 3S7HB 4ZHLU 1TYNA 2WV5A 1OKXA 4WXIA 1GI7B 3Q3YA 4E05H 1AFQC 1FXYA 4XBCA 3A8DA 1FJSA 2QIQA 2GV7A 2IOTA 4Y8YA 3A8AA 2VB0A 3ZZDA 1GCTC 4JZDH 1TLDA 1EAXA 1FY3A 3A8BA 4F4OC 4OS1A 2ZHEH 2XWBI 5L2YH 1Y5AT 1SKYE 3UREA 4R0IA 5EGMA 2ZFSA 1C5PA 1V2NT 3EDXB 1G3CA 5IDKA 1TRNA 2ULLA 1ZGIA 2BZAA 6CHAC 1AUJA 1ARBA 1NTPA 3KYGA 3RXIA 1DLKB 3MYWA 4KTCA 3EA7A 1SGEE 2W6ID 2RCEA 3UWJH 1VJ9U 1DM4B 2G81E 1BRCE 3UAIC 4XBDA 2W3KA 3PV4A 1EOLA 1O2JA 2O9QA 1G36A 2GV6A 1YF4A 3PMJA 1P2MA 5LGOA 2JKHA 3PYHA 2BQ6B 3AK5A 1F0TA 1SLWB 4OGYA 4D7FA 5A09A 3A85A 1SGYE 1TGBA 5JBBS 3SI4H 3BTHE 1SQOA 3TNTA 1L4DA 2WV4A 1C2FA 1FZZA 2Z3CA 4HG6A 1KDQB 4R8TB 1GJ7B 5F53A 1CE5A 7GCHG 3GCNA 5FXLA 3VGCB 3GYMA 2B0FA 3GS9A 1IHSH 3ODDA 5B6OA 2ZDLA 3TJUA 3O8DA 1H8HD 1HB0B 3MO6A 2QF4A 2A0QB 3Q77A 3F0OA 1ZLRA 2OC1A 2R0LA 1O30A 1OS8A 4JMYA 1ANBA 1Z8JB 3H7OA 1ELVA 1UTJA 2G55A 1GJ4H 2ZU3A 1SHYA 1RTLA 1C4Y2 1TA2A 3UOPA 2OC8A 4HFPB 1BRBE 1AI8H 1UJ1A 4TPIZ 1C5NH 4NGAH 1FN8A 4K3JA 1GI8B 7ESTE 2Y81A 1GBMA 1TIOA 3MU8A 2KCOA 3HPTB 1O3GA 4Y79A 1O3KA 3E0PB 2QE7D 2G5VA 4GVUA 3QTOH 1UCYE 3PO1C 5E0JA 1ZSJA 1GGDC 4I8KA 2SFAA 4DT7B 2PGBB 4MG3A 3NXPA 2ZWLH 3M7TA 3SOSA 3NRLA 4Q63A 2BD2A 2GX4A 2ZCLP 1J17T 4X6PA 1RIWC 1VCQA 2P8OB 1SGNE 1DDJA 3TH4H 1EJNA 1A0JA 1G32B 1HV7A 3A87A 3PTBA 3K2UA 1SHHB 3T26A 3MH6A 4AYVB 1HBTH 2Y5GA 1IQFA 1E37B 4DOQA 2AERH 3WY8A 2Q6FA 1TNHA 1GI5A 1CU1A 1HRTH 2B5TB 1H4WA 1EAIA 1E1QD 3TK9A 1AD8H 1BTZA 1C5ZB 3ATLA 3NZIA 5C5NA 4ABGA 1FIZA 3RXTA 1SQAA 3R3GB 4WXVA 1G2LA 2FZZA 4F55A 1P57B 1BBRK 2I6QA 2J5UA 1JIRA 5C3NA 1SGPE 1C1OA 2FI3E 2Y82A 1FY4A 1ZMJA 3B23B 3OTPA 4OGXA 4AB9A 1W8BH 1ESAA 1GHBG 1WQSA 1EATA 1SGFG 3ATMA 5GWZA 1O2IA 3BEFB 4NZQA 2FPZA 4AORA 2FOAA 1SGTA 2F43B 3SO3A 2HVYB 1GJCB 2ZDKA 1SR5C 2NU3E 3PB1E 4ISIH 2J2UA 4NA7A 3RXJA 2BQ7B 2ANKH 4BAOB 2ZC9H 1O3BA 1OWIA 2ESTE 5T1VA 1S85A 3PTNA 3W95A 1ZYOA 2AEIH 3TGIE 2BTCE 1K0HA 1W0JD 3UWIA 4TT3D 3ZZ8A 1MTUA 1NS3A 1YPKH 3DUXH 4DURA 1O2WA 1ZSLA 3SYJA 4ZXYH 4AG1A 2BDHA 1EP6A 1GVLA 1BDAA 3A89A 1V2RT 6GCHF 3PRDA 1TBQH 1SB1H 5DO4H 3FVFB 3E0NB 2H2ZA 4YT7H 5CHAB 1VITF 3DD2H 4OS5A 2A4RA 4ZKNU 1V6DA 1JIMA 1HAIH 1TMUH 1GBBA 1EOJA 1MU6B 4UEHH 3O8BA 4ABIA 4E7NA 2BQWB 5FCKA 4X8UH 2JETC 4OS4A 1AFQB 2VU8E 2C8XB 4KP0A 1OYTH 1QB9A 4OS7A 2R3UA 3UB0A 2GZ9A 1Y3YA 3CP7A 1GCTB 1MKXH 4Q80A 3R0FA 1Z8RA 1T8OA 2EI8A 3C1KA 1MTWA 1UHBA 1GJAB 1F5KU 5AF9H 5FBEA 1HAPH 1P12E 2ZDAH 5HGGA 1HCGA 4Q7XA 2TPIZ 5EW1H 4JYTA 2C93B 2GZ7A 3UNRA 5DP7A 5BPEA 3LC3A 1C5MD 1HPGA 2IJOB 1G30B 3LPRA 1OWEA 1WUNH 2WYJA 3SGAE 1WV7H 1UCYH 1TBRH 1ZSKA 4MVNA 1DY9A 2V35A 4K60A 1DLEA 2QV1A 3SZEA 1LMWB 4P00A 1WCZA 2A7CA 1QURH 3P8FA 5JBTA 1ANCA 4WWYA 1NESE 3MU0A 2P59A 2SGDE 3LOXA 2FOHA 3M37A 4JYVH 2QF5A 1LVBA 1C1WH 1JXPA 2QN5T 5A0BA 1A46H 3F2HA 3RMMH 1QY6A 3IWMA 2DE9A 5H4IB 3CNRA 1DE7H 2EC9H 1ZR0A 1GI9B 1SMFE 3TVJB 4ZKRU 2YMSC 1MAYA 4WMEA 1HJ8A 1O5DH 5TCCA 4WF8A 4DVAU 5HYOA 5A2MH 1W0KD 3SNCA 3GY5A 4BXSA 1S81A 3P70B 3LJJA 1W12U 4ACAA 2PKSB 1D6WA 1MAXA 2EEKA 4J2YB 2QYIA 1XXFA 1O2UA 1XKBC 4ISNA 1O3IA 3I29A 3SN8A 2CHAC 2D1JA 3RU4T 2GCTB 2QA9E 3A7VA 2FX6A 1O2NA 1AKSA 1P10A 1BT7A 3F9EA 4NIXA 2HGTH 1S6FA 1CGIE 3MU4A 5EJZA 2FP7B 2ZECA 2WPLS 3E91A 2J34A 5C0TA 3GDVA 4BXWA 2PKAB 2OBOA 2STBE 2B9LA 4B71A 1XUIA 4NCYA 1ELAA 4UE7H 5C0UA 1NBME 4BAKB 4U01A 3SNDA 1O2XA 4BAMB 1RIWB 4DY7B 4CR9A 1B0FA 1HAZB 2IPHA 4KELA 4X6NA 3TH2H 1Y3VA 1MKXK 1P2JA 1LQDB 2OC0A 3STJA 1KIGH 3RUOA 2BY7X 2FESH 3A86A 1BJUA 1O33A 2A45B 2GVFA 4CBOA 2J97A 3RMOH 1QBNA 3RXQA 3VEQB 4UFDH 3QTVH 4JYUH 4Z1MD 5CDFE 3BF6H 5DJ7A 3M5LA 2VBCA 4UDWH 2A5KA 1VR1H 2HWLB 1AO5A 4NWKA 2PV9B 4WH6A 5B6LA 3TJOA 4CH2B 1KYNA 1AU8A 2QXJA 5EQQA 2C8ZB 3ATIA 4NIVA 1O35A 2VWNA 3SHCH 1UCYK 1HAXB 1O2TA 3A82A 2ZTYA 2B8OH 3U8RH 2VIVA 2ZIQH 4JK6A 1GHYH 2GT8A 1J16A 2C8YB 2FMJA 1D9IA 1GBTA 5EXLA 1GMCG 1K1IA 1QA0A 1ELBA 3PMHB 4IW4E 1RFNA 4OS2A 2ZI2H 2B7DH 2CF9H 5EPYA 2BX3A 2WPKS 3SUFA 3V12A 5E0GA 3PMBB 3SUGA 1GI4A 2ZU4A 3BV9B 2ZPSA 1EAUA 3OY6U 4I33A 3KEEA 1NBMD 1C1TA 1W0ZU 2HPQH 5KECA 4AB8A 2BD8A 1HIAA 1YPGH 1EZSC 1GI6A 3SV7A 7GCHF 3F9HA 5F8ZA 2TGAA 1VGCC 1P2KA 3MNBA 5DGJA 1DS2E 1EAWA 3PROA 1AMHA 2L74A 2G4UA 3V7TA 1T32A 1C5VA 5HMAA 3F9FA 1O3JA 2D2DA 2VVUA 4XE4A 3M5NA 1EXFA 3E1XB 5K0HA 3F9GA 1TX8A 2Z9KA 1O2GH 2BLOA 2LELA 1G37A 1OX1A 4YT6H 3ZZ3A 1AZZA 2EI6A 3URDA 1LKBA 2ZHDA 4MDSA 1T31A 2A5AA 2EA3A 4IMZA 2XYAA 1FUJA 1P04A 1QGFA 3OFND 5TJXA 1TPSA 1D6RA 3TH3H 3SV8A 1FLEE 3TGJE 1KLIH 1TABE 3SQHE 1VCPA 1MD8A 3WWFA 1BB0B 3BEUA 1GHZA 2WINI 1CA8B 3RXFA 2FS9A 9LPRA 4B6EA 1HDTH 1CGJE 1LPGB 2AGEX 1XUJA 3CS0A 3ZZ9A 2H5CA 1V2JT 2D8WA 2OUAA 3U1JB 1BCUH 1SPJA 5GXPA 2O8TA 4FUHA 4FU7A 3O8CA 5EJ1A 1A7SA 4SGAE 4CRAA 1PPBH 5C1UA 1AVWA 1GPZA 4K8BA 2W5EA 1NFYA 4ABAA 2C90B 3BG4B 4GHQA 3GDSA 5E0HA 3U9AH 5EG4A 1HUTH 1LHDH 2P16A 3W94A 1QBOA 1AWHB 1C5YB 1ANDA 1UVOA 3RXSA 1YBWA 3M3VA 4UONA 3SV9A 1ZHPA 1ZZZA 2G52A 1OSSA 4AFSA 3CS7A 5T6DA 1N8OB 1O3HA 1V2WT 2J9NA 2VWOA 4IS5A 1GBJA 1GBEA 1O3PB 5HXFA 1O3NA 1NFUA 1UMAH 3RXUA 4CR5A 2BD9A 1KTTB 1VGCB 4KKDA 1O2PA 1MMJN 1O38A 3T2NA 2BDYA 1C1VH 5EPNA 4MQAA 1GHBF 1CSOE 1QQUA 4B75A 1C1UH 4UFEH 1XKAC 3LGYA 1GCDA 3H09A 1SL3A 1THRH 4XFQA 3MU5A 2GT7A 2XBWA 1QJ6B 2SNWA 5AHGH 1EASA 1EUFA 1T4VH 1YY3A 2SGPE 2ZTXA 1O3CA 3FANA 3MH5A 4H4FA 4ABFA 4MPVA 4H42U 1C5WB 3VPKA 4FVDA 1VZQH 1DWCH 3TLOA 1YP9A 1Y3XA 2KFWA 2Y6TA 4F48B 2CHAB 2DUCA 1EQ9A 3ATWA 1AFEH 3SJIA 1D4PB 3RXPA 1QR3E 1K1OA 5AFYH 1SGFA 2OXSA 1H8DH 1UK2A 4UFFH 3RC5A 3SQEE 2BMGB 2VH0A 3AW1A 4I32A 3ZV9A 4E06H 2R3YA 1DXPA 1OP8A 2WUCA 1V2QT 5HM2A 1NU7B 5EQSA 2H9HA 3MO9A 1JWTA 1DVAH 1UTLM 1LVYA 1AZ8A 4ABHA 1QB1A 4IBLH 8GCHG 4FUFA 1MCTA 2KAIA 2W26A 3KGPA 1FDPA 1RGQA 3LGVA 2BVXH 3A8CA 1GBIA 1FI8A 3M3SA 5ESTE 4ZKOU 1O2YA 1V2MT 1TMTH 1W0YH 4XDEA 1BBRH 1QL8A 3HKJB 2FLBH 2ZFPH 3RXBA 4K1TA 3GOVB 4ISLA 2H9EH 2Y80A 5EXMA 1Y3WA 1GJ5H 4FUIA 1XVOA 1ELEE 4Y8ZA 5A8YA 1O39A 3VXFH 1ZOMA 2ZDNA 2VIQA 1E34B 1G3DA 4DIIH 1GL0E 2HOBA 1WQVH 4JCNA 4ABJA 4B6FA 1B7XB 2HRVA 1DX5M 1NROH 4KTSA 3FZZA 3LH1A 4D9RA 3GDUA 2V3HH 2Z9GA 3RC4A 2D26C 4YOJA 1RRKA 1F2SE 2AIPA 2BDIA 1ELTA 5T6GA 1IQMA 2VWMA 1MTNC 3QDZB 4LOYH 3OEHD 1V2ST 3IG6B 2A31A 1AIXH 3OTJE 3BTKE 3GICB 4D8NA 3SBKA 5DG6A 1QBVH 2FM2A 2PUQH 2ZU5A 3MHWU 1C4V2 4FVBA 4O97A 2EI7A 2HLDD 4CRFA 1LKAA 1O2LA 3SJ8A 4Z0KA 4HTCH 3SU0A 2FOCA 3KCGH 4WMDA 2C3SA 1PQAA 3RLYH 2P94A 1CO7E 3P8OA 3P92A 3F3BA 1QHRB 1BHXF 1OYQA 1BRAA 1OWDA 1Q31A 2M5TA 3RM2H 3QZRA 1LPZB 2AGGX 2Z3DA 4ABDA 2UWPA 5JYIA 4A7IB 4MPUA 3RXCA 2KX4A 2IJD1 1IQNA 1IQLA 3ZIAD 1SG8B 1GJ6A 4RT1A 3DCLA 1O31A 5GCHG 5EOKA 3VG8A 3MWIU 2Z9IA 1A61H 2FOGA 1ABIH 2XWAA 2ZO3H 4CHAC 3GISB 2XNIA 3I77A 2XBYA 4AZ2B 4DGJA 2EY4C 3RXKA 1K1JA 2K1QA 1LVMA 1GHWH 2ODPA 1V2VT 1YPHC 1XUGA 1EB2A 1DWDH 1PPCE 4FU9A 3LGTA 2ZCKP 5CMXH 2ANWA 2F9PA 3RDZA 2ZEBA 3TK5A 4AFZA 5JB9S 1BUIA 2G4TA 2QXGA 1P2NA 3ZZ6A 1F0SA 2BD7A 1WBGB 1XM1A 1GDUA 3ZYEA 3MOCA 3FP7E 1S0RA 1WAYB 2UUFB 2Y5FA 1A3EH 1P9UA 3U98H 1UK3A 1GG6C 1SFIA 2PW8H 4QT8C 3KQBA 1ANEA 1HFDA 3H7TA 2OINA 1QRWA 2P93A 2F91A 1BMNH 2FWWA 3BN9A 4Y7AA 1P9SA 2BDAA 2CN0H 2VIOA 1C4U2 4J1YA 3MNSA 4Y11E 3RXAA 1O2SA 2NU2E 3M7UA 4CRCA 1SLVB 1MQ6A 3MH4A 2ZGBH 3MI4A 2UUYA 1Z6EA 2PSXA 4NZLA 1A0HB 3OEED 4U2WA 2KCAA 2Q1JA 3T25A 2HALA 2KCPA 2V3OH 4TY6A 2BDGA 1W3CA 5GDSH 1QNJA 3GY7A 3UNSA 2PTNA 4BTUB 1E38B 1HJ9A 5I46H 1BZXE 1W2KH 3PLBA 3GYLB 2ZU2A 3UR9A 1TX7A 1ZPBA 1IQKA 3PLPA 4RT0A 3A81A 3RMNH 2ZG0H 1SGCA 1GI0A 5DP5A 1K9OE 1G3EA 3TNSA 3VB7A 1BTWA 4JZEH 4X6OA 1AVXA 1GHVH 4ABEA 3BTME 3V0XA 2GDEH 5C1XA 1CT2E 2ASUB 1H9LB 1GMCF 4YO9A 3BTEE 2Q6DA 5ETXA 2GGVB 2BHGA 1KXDA 4JK5A 4LZ1H 1SLXB 1LVOA 1TFXA 2PFEA 4LXBH 1GJBB 1UK4A 1GBAA 2WPJS 1S84A 3EYDA 1DXWA 1H1BA 3FP8E 1J9CH 1KSNA 1X7AC 3GCTG 1O2OA 1NU9A 1LHFH 1UO6A 2ZHWH 1B5GH 2Y5HA 4Y0ZE 2TGDA 2PR3A 1TRMA 1QCPA 1YKTA 1HAYB 2YNBA 1O5GH 4MLFB 2ANMH 1GHXH 1A0LA 4I8GA 3PLKA 3LJOA 2FOFA 5FPSA 1O5CB 1ZPCA 1U6QA 5LPRA 2BLWA 2BLQA 5FCRA 1V2UT 5DK1A 1LCYA 1SGDE 3QX5H 3SZNA 4NFFA 6LPRA 1PPEE 6CHAB 1XUHA 5EU8A 5E2PA 4O9VA 1K21H 1MD7A 4X8SH 1V2TT 1ORFA 2STAE 1OWJA 2FTLE 2FO9A 1TQ0B 2J98B 5DPAA 3ZZ7A 2VJ1A 3HK3B 4NA8A 2A7JA 1FX0B 1MQ5A 1P2IA 3M3TA 2YOLA 3TJNA 1IOEA 1N1LA 1C2EA 3FFGA 3PWCA 1C2DA 3TIUA 3M36A 1QIXB 2QGRA 1V3XA 2BM2A 2K8IA 2TGTA 4O03A 3OY5U 2OK5A 1ARCA 2XOKD 1BOQA 1EZUC 2BLVA 2ALVA 2QAAA 3BTQE 1Z6JH 2ZGJA 3I78A 1F5LA 1RTFB 1SLUB 1VKYA 1YPHE 2L6OA 1S82A 2ZA5A 1AVGH 2GTBA 4YOGA 5CHBA 4ASHA 3ITIA 5FX6A 2ZCHP 4K2YA 2A4OA 1NRPH 5EQRA 3MMGA 1FPCH 1FONA 2Z9JA 1C5TA 1MZDA 1Y3UA 3F6UH 1PQ7A 2ZDMA 3UQOA 1ZTLA 1UTKA 4CRBA 6ESTA 2VWLA 1YPMH 4DIHH 5C94A 2ZGCA 1M9UA 2FYQA 1O3FA 1SQTA 3ZV8A 2XBVA 1GBDA 4NFEA 3M61U 3TPIZ 1SI5H 2SGQE 3LGIA 3PV5A 1GMDG 1UHBB 4O3UA 3CENA 1TALA 1Z8IB 3PO1B 5LPFA 1GGDB 2G51A 2XCNA 3WW7A 5EW2H 2R2WU 5G4BA 3LONA 1T7CA 4AOQA 3S9CA 3GY6A 2PLXA 3FZDA 5IK2D 1O5BB 5FPTA 4D7GA 1H9HE 1T8NA 2XXLA 4CRDA 4MPWA 5DN6D 2BY6X 1SC8U 3ZVDA 2FXRA 2VIPA 1P01A 1THSH 1OPHB 1UW7A 4I8LA 1L1JA 1A3BH 1DUAA 3A80A 1D3DB 1SSXA 3N99A 2BYAX 3PWBA 1BMLA 4XSKU 4VGCC 4AG2A 2PGQB 1MUEB 2ZHQH 3DFLA 3HGNA 1QRXA 1EFRD 5A0CA 2R2MB 1QL7A 1FY8E 3EE0B 2ZGHA 4TWYA 8GCHF 1L0ZA 4F49A 3SU3A 3SU6A 1TNJA 1CHOG 1KXCA 1HAVA 3ODFA 4FUGA 3E8LA 4X0WU 3SU4A 1GDNA 4ZH8A 1BIOA 1LTOA 1AN1E 1RXPA 1KLJH 1C5RA 1YLCA 1O2QA 3Q76A 3UIRA 2RA0A 4RN6A 1DFPA 3D49H 4ESTE 4X1PU 1C1QA 1GBLA 1PYTC 2BD4A 1ACBE 1QB6A 1O3DA 1SOTA 1ZGVA 1T8MA 2LP6A 1FV9A 3VB4A 4M9FA 1YC0A 3GY3A 4B2CA 3SNEA 3VGCC 2F9NA 2W6JD 1BTUA 2A5IA 4WY3A 3S9BA 2A32A 3K6ZA 1P03A 1CA0C 3A84A 3AAVA 3DSGA 1AKSB 2W7SA 5JB8S 5DP4A 2JH6D 3SV6A 2SGEE 3RXDA 1QTFA 2QC2A 2VINA 1W13U 1IHTH 3QO6A 1LQEA 1F0RA 1YPEH 2ZFQH 1NRRH 5HKKD 4X2XA 4NIWA 4AFUA 5HIYA 1LPKB 2PSYA 2A1DB 4B74A 1MCVA 3ENSB 1P8VC 1C2GA 2ZFRH 1VITH 4INKA 4H6TA 1SQRA 4NG9H 4A5TS 3SGQE 1FN6A 2ILNA 1Z8GA 1ELFA 3D65E 3V3MA 4ISHH 1NRSH 1WOFA 2BXUH 1P2QA 3EAJA 2JETB 1P2OA 5GIBA 3AASA 1EPTA 1NFWA 2OCVB 3Q3KA 4E7RG 1O2RA 1BA8B 1T4UH 3G01A 2IN2A 2JH0D 5GCHF 1FIWA 2AFQB 4INLA 3P8NA 1EKBB 1HXFH 4IN1A 3ZVAA 3F2GA 2RA3A 1TRYA 2ZFTA 5JPMH 4I7YH 2VGCC 3A7TA 2P8OC 5AFZH 5T3HA 4GAWA 3OX7U 1GJ9B 2KM0A 3W1EA 2ZNKH 5FX5A 3C27B 1ZPZA 3LDXH 1AB9C 1AWFH 1C2IA 1EZXC 2NWNA 2GCHG 1JRTA 5JBCS 4GHTA 3MQKC 1AY6H 2AIQA 5JBAS 3SW2B 3TITA 2FEQH 1CGHA 2F9UA 3KF2A 1S5SA 1V2PT 1CHGA 1O2VA 4DT4A 2BD3A 1LDTT 4UFGH 3N7OA 1F7ZA 4ZXXH 2O8MA 4JZIA 4NA9H 3AW0A 3QLPH 2BVSH 3DA9B 4X8VH 5C2ZA 1HIAB 1Z1JA 4MPXA 1NT1A 4TYDA 4BANB 1GMHG 1GBFA 2P3UB 1MTSA 1P0SH 1B0EA 5FPYA 3EGKH 1COWD 3UPEA 3NWUA 1YGCH 2YMSB 3P95A 3N7EA 4U32A 1ELDE 4BAHB 3IITA 2W7UA 2AMQA 3NUMA 2ZDVH 3M5OA 1DUEA 4WMFA 3ZZ5A 1DSTA 1OOKB 1QJ7B 2YMSD 3ZZAA 1INCA 1ELGA 1THPB 1TGTA 1EJMA 1S0QA 1AE8H 8ESTE 2F83A 1GHAG 1HLTH 1N6XA 4KGAA 4K1SA 1ZMLA 3VB3A 3FO8D 1CBWC 1KDQA 3VXEH 2FOBA 3PMAB 4FUEA 1UVUH 1TGNA 4P02A 4Y7BA 4X1RU 2CMYA 3KQCA 1OP0A 1OHHD 4HI3A 2XC5A 2FODA 1A5HA 1HNEE 2TBSA 2FX4A 4MNXA 2PWXA 2V0BA 1BRUP 1C1PA 1MU8B 2GMTC 4M7GA 1DT2A 1KLTA 4IC6A 3E16B 2AHME 1IQIA 2J94A 4NSYA 1QQ4A 4TWWA 4ASUD 4INHA 1A1RA 1K1LA 1A4WH 1ZJDA 1RJXB 2J92A 2RG3A 3OE7D 1P02A 4Q7YA 4IGDA 7LPRA 3GCTF 3K6YA 1ESBA 1MABB 1LO6A 1NPMA 1O36A 1HGTH 3GCHC 3HGPA 2JJ2D 2QY0B 4WJG2 3OU0A 1DITH 4Y8XA 2GP9B 1TPPA 3RC6A 1DSUA 2WZQA 3SJOA 2Z7FE 1ZTJA 4HZHA 1P05A 3P6ZB 2BVRH 4A1XA 1C5LH 1KTSB 4VGCB 4Y71A 5GNDA 1MKWH 3VFEA 2ZQ2A 4AC9A 4WVPE 3ZVGA 4RKOB 4A1TA 1SGRE 1YM0A 2WV9A 5IYTA 2NU0E 1GBHA 1HJAC 3U1IB 1SOZA 2IPQX 4DW2U 2TRMA 5GPIB 1BQYA 1K22H 3Q3XA 4YLQH 3RXOA 1H8ED 3U69H 3U8TH 4K8YA 1C5UA 2OP9A 3AVZA 3TU7H 3U28C 2XC4A 4ISOA 1P3CA 1S83A 3V13A 1XMNB 5EIYA 4JZFH 3WWBA 1W11U 4I31A 2YNAA 2H5DA 2BY5X 4YLUA 1TONA 3S0NA 4FOUC 1W7XH 3RP2A 1YCPM 1PFXC 2G5NA 2VVVA 1EX3A 5DKMA 2SGFE 5L2ZH 1PYTD 2VH6A 4Y76A 4CREA 1V2LT 2A4GA 3KQEA 2OTVA 3SV2H 1CA0B 1E1RD 2WHXA 3K9XB 2CGAA
chains in the Genus database with same CATH topology
2TIOA 1UVPA 2PKSC 3SORA 4B1TA 4X2YA 3MTYA 1FY1A 4BAQB 3ZYDA 1S6HA 1OWKA 2F3CE 8LPRA 1IQHA 2BX4A 3SNBA 1CVWH 2KAIB 1DOJA 4FUBA 4Y10E 4YM9A 2ZFFH 2GCTC 3TGKE 5F03A 4AN7A 5C67A 4ZHAA 1K1PA 2ZU1A 5CE1A 1TNIA 3LGWA 1LHCH 2W3IA 1RS0A 2PHBA 3SU2A 1L4ZA 8KME2 1UTNA 3BEIB 5HM9A 4MNYA 2AH4X 1P09A 3LH3A 5F8TA 1FY5A 2FOEA 1IQJA 4FXGH 1JMOH 2AS9A 1QJ1B 5EODA 1YYY1 1O0DH 2OD3B 3SU1A 1WYKA 1GMDF 1BMAA 1O3OA 2OLGA 1SGIB 1CT4E 4TY7A 2CJIA 1SVPA 2VGCB 5BRRE 1C5XB 5FHTA 3NK8A 4YTAA 1YPLH 4AFQA 2WUBA 1UTOA 1AB9B 2F9BH 1T8LA 1XXDA 5K7RA 3URCA 2Y7ZA 4XBBA 1IQEA 1OWHA 5SGAE 4ZUHA 1C9TA 3RLWH 3AAUA 1KXAA 3QGNB 2FIRH 2NU1E 4AGJA 3M35A 1UTQA 4GPGA 2UWOA 4OS6A 4Y6DA 4CH8B 1MKWK 1O2HA 1TAWA 4D76A 1NY22 2WPIS 1Z7KA 2ZHFH 4BNRA 2QF3A 1NRQH 2ZKSA 1UVTH 4BTTB 1TGCA 1TOMH 3NPSA 3A7ZA 2OC7A 2PUXB 3FAOA 3MNXA 4A1VA 1ZHMA 4YESB 2ZTZA 4B76A 1CHOF 1K2I1 2BZ6H 2FI5E 1ZTKA 2LPRA 3BTTE 1ETRH 4BOHA 1ZRKA 4MNWA 4GCHG 1A2CH 3STIA 3UQVA 1NC6A 1PPZA 2GKVE 2ODQA 3D62A 3FP6E 1AGJA 1Y8TA 3L33A 1DPOA 1QL9A 1F0UA 3HK6B 3RXHA 1RTKA 5DP3A 1Z71A 1YPJH 4FU8A 5E2OA 1HAHH 5J4SA 3EA8A 1TBZH 3L6PA 1BHXB 2J95A 1MTVA 1GDQA 1Q3XA 1YCPH 2UUKB 1CBWB 3RXMA 2QXHA 1VCWA 5FAHA 1WU1A 1TOCB 1TX6A 4X1NU 1D3PB 2ZZUH 4B2BA 2O8UA 2SGAA 1C5QA 1PPHE 3MU1A 2GMTB 3GY2A 3RXEA 1TWXB 2Z6BD 5ESBA 4A92A 2THFB 3U8OH 2O8WA 3SJKA 1TE0A 2ALPA 3UR6A 3SHAH 4BTIB 2BD5A 1QFKH 1FQ3A 4GUXA 2A2XH 3GCHB 1UTPA 4AGKA 3QZQA 3RXGA 1JBUH 2G00A 5LPEA 1TNKA 4HGCA 4DCDA 2TGPZ 3F68H 1Z1IA 1C1MA 4NIYA 3EA9A 3RXRA 4KTUA 5A8XA 4THNH 5AVDA 1GL1A 3BG8A 1H9IE 1JRSA 1DANH 2AMPA 2PKAA 5T6FA 1K28D 4ZROA 3BTFE 5L30H 4XOJA 1XUFA 3ZVCA 4IMQA 2GZ8A 5A8ZA 1GBKA 1HJAB 1O2KA 1AHTH 1FNIA 3RM0H 5C1YA 1ESTA 3BG4C 3SNAA 1GVZA 1C1NA 2BB4A 2VVCA 2V6NA 3KNXA 3P17H 5I25A 1O3EA 2ODYB 3SUEA 3UUZA 1C2JA 2ANYA 2GCHF 4ZAEA 1GVKB 1MTNB 5A0AE 1GWAA 1UVSH 4AX9H 2H6MA 1WTHD 9ESTA 1A5IA 2FOMB 1EP5A 1MBMA 4SGBE 7KMEH 1ZHRA 1N6YA 1N8OC 1O3MA 4ZMAH 1TGSZ 1J15A 2FS8A 1V2OT 2WPHS 1PQ8A 4K5ZA 2ZQ1A 1BITA 2OQ5A 5FBIA 1K1MA 2FLRH 4NWLA 2P3FH 2VNTA 1E36B 5DP6A 5PTPA 1C1RA 1C5SA 4Z6AH 4YZUA 1GMHF 2P3TB 3UNQA 2AGIX 1KY9A 1QRZA 1EPTC 1KXEA 1L2EA 1SGQE 1TB6H 1O32A 3RU4E 5LH8A 1FMGA 3K65B 1ZJKA 4X2WA 1G2MA 4LZ4B 4X8TH 1NZQH 3BTDE 2JH5D 1NRNH 3PM3A 1Y5UT 1HYLA 4IC5A 4ZKSU 2C4FH 1L1NA 2Z94A 4FUCA 3TJVA 4CHAB 1QA7A 3A7XA 3S9AA 1PJPA 3A7YA 2FYRA 1XVMA 1GI1A 1GI3A 1W14U 5JDUB 1YCPK 4X6MA 1YLDA 3JZ1B 3ESTA 3KN2A 1GHAF 1O5EH 1WTGH 2FDAA 4GSOA 3UTUH 4D9QA 4I8HA 1G3BA 3QK1A 1CQQA 1UTMA 2LNCA 1D3QB 1DY8A 3Q00A 2H1UA 2QF0A 4JZ1A 1ZMNA 1ETTH 3VB6A 2Z3EA 3GY4A 2HPPH 1EZQA 3S7KB 4K69A 1FPHH 2G8TA 1AQ7A 3ZZ4A 2O8LA 5J4QA 3UOUA 2HNTC 1C1SA 3T5FH 5TCAA 2H9TH 5F8XA 1GG6B 5DP8A 3ZVFA 3MO3A 3LIWA 3LU9B 3S69A 3LC5A 1P06A 3OYPA 1Y5BT 3MH7A 2DE8A 1C2MA 3ELAH 3EQ0H 1VJAU 3T29A 3GCOA 4FUDA 3B9FH 2XW9A 3RU4D 3SI3H 2AYWA 1O3LA 2VIDA 3B8JA 1AUTC 1GJDB 4TPYA 1O34A 1C2LA 1OXGA 3LGUA 3KL6A 2PTCE 2C8WB 2A7HA 4Q7ZA 2R9PA 1O3AA 1ZRBA 3DT0H 1XUKA 1PPFE 2OQUA 2BOHB 2BDCA 2ZF0H 1MH0A 2FTMA 3UFAA 3ZZBA 3M5MA 2CF8H 3LT3A 3H5CB 3A83A 3BIVH 3KQDA 3L3TA 4RSPA 1C5OH 2WPMS 1C2HA 2RDLA 3M7QA 3BSQA 2Q6GA 4B2AA 4X2VA 6GCHG 3LKWA 1LHEH 1O37A 1JOUB 4MNVA 5EXNA 3SJ9A 3SU5A 2A2QH 5DP9A 4YOIA 2SNVA 4A6LA 1CT0E 1W10U 1VITG 4NSVA 1EJAA 3QN7A 1P11E 1F92A 1J14A 2R0KA 3O8RA 1PQ5A 2ZP0H 4IN2A 1MBQA 4WH8A 1DWEH 4CBNA 1KXFA 5E8EH 3BTGE 1F5RA 1IQGA 1BBRE 3VB5A 1TMBH 1TPAE 1D3TB 2ZPRA 1XX9A 4UD9H 1GJ8B 1SFQB 2F9OA 2XCFA 1BMMH 3E90B 1DWBH 4ZHMU 4MTBA 1WSSH 3E6PH 4AYYB 2Z9LA 1FAXA 3ATKA 2XBXA 2F9VA 1PPGE 1IAUA 2HNTF 1O5AB 3DFJA 2BXTH 1RD3B 2J38A 4X1SU 3MNCA 3D23A 1TQ7B 4ABBA 1OP2A 1HAVB 1E35B 1ABJH 2UWLA 4Q2KA 4U30A 3T28A 1NO9H 4RKJB 1K1NA 4DG4A 1LHGH 2J4IA 3OSYA 3ZVEA 3F1SB 3HATH 3MFJA 2OBQA 3QWCH 1AE5A 1C9PA 1TNGA 1ID5H 4Y0YE 2CV3A 3SGBE 2FI4E 2UUJB 1TNLA 1FAKH 3QUMP 3RMLH 3GY8A 2NU4E 2AMDA 2CXVA 2P95A 1ELCA 1P3EA 1H8IH 3A7WA 2XTTB 2GDDA 1KXBA 3E3TA 5ABWA 2BY8X 2GD4B 4I8JA 1GBCA 2XC0A 2QXIA 1HXEH 2BOKA 1C2KA 2WYGA 1DICA 3UY9A 5GJ4B 4B73A 4H6SB 1BTYA 3SUDA 2ZGXH 4CRGA 4K1EA 1EB1H 2BDBA 1NN6A 3KHVA 2HVXA 3RXVA 4FUJA 1O2ZA 2HLCA 2Y7XA 2ZPQA 1A5GH 2A4QA 3HKIB 1BTXA 4X1QU 3BTWE 2VIWA 4GLYA 2HNTE 4LK4A 3TK6A 4DJZB 1E0FD 1NFXA 1TA6A 5C5OA 3T27A 1O2MA 5F6MA 1SBWA 1J8AA 1HAOH 1ETSH 3ZVBA 1EPTB 1BTHH 4PROA 2XRCA 2QCYA 3JZ2B 3P8GA 4GCHF 3NKKA 1BTPA 3T62A 3DHKH 1Q2WA 1MZAA 4O3TA 1G9IE 3A88A 1Y59T 3NCLA 1BJVA 3RXLA 1O5FH 1TPOA 3QGJA 1V2KT 5L6NH 1GI2A 1NM6A 2BY9X 3BIUH 5CHAC 3ZZCA 2I6SA 1HAGE 5C20A 3KIDU 1L1GA 1W7GH 3S7HB 4ZHLU 1TYNA 2WV5A 1OKXA 4WXIA 1GI7B 3Q3YA 4E05H 1AFQC 1FXYA 4XBCA 3A8DA 1FJSA 2QIQA 2GV7A 2IOTA 4Y8YA 3A8AA 2VB0A 3ZZDA 1GCTC 4JZDH 1TLDA 1EAXA 1FY3A 3A8BA 4F4OC 4OS1A 2ZHEH 2XWBI 5L2YH 1Y5AT 3UREA 4R0IA 5EGMA 2ZFSA 1C5PA 1V2NT 3EDXB 1G3CA 5IDKA 1TRNA 2ULLA 1ZGIA 2BZAA 6CHAC 1AUJA 1ARBA 1NTPA 3RXIA 1DLKB 3MYWA 4KTCA 3EA7A 1SGEE 2RCEA 3UWJH 1VJ9U 1DM4B 2G81E 1BRCE 4XBDA 2W3KA 3PV4A 1EOLA 1O2JA 2O9QA 1G36A 2GV6A 1YF4A 3PMJA 1P2MA 5LGOA 2JKHA 3PYHA 2BQ6B 1F0TA 1SLWB 4OGYA 4D7FA 5A09A 3A85A 1SGYE 1TGBA 5JBBS 3SI4H 3BTHE 1SQOA 3TNTA 1L4DA 2WV4A 1C2FA 1FZZA 2Z3CA 4R8TB 1KDQB 7GCHG 1GJ7B 1CE5A 3GCNA 5FXLA 3VGCB 3GYMA 2B0FA 1IHSH 3ODDA 5B6OA 2ZDLA 3TJUA 3O8DA 1HB0B 3MO6A 2A0QB 3Q77A 1ZLRA 2OC1A 2R0LA 1O30A 1OS8A 4JMYA 1ANBA 1Z8JB 3H7OA 1ELVA 1UTJA 2G55A 1GJ4H 2ZU3A 1SHYA 1RTLA 1C4Y2 1TA2A 3UOPA 2OC8A 4HFPB 1BRBE 1AI8H 1UJ1A 4TPIZ 1C5NH 4NGAH 1FN8A 4K3JA 1GI8B 7ESTE 2Y81A 1GBMA 1TIOA 3MU8A 3HPTB 1O3GA 4Y79A 1O3KA 3E0PB 2G5VA 4GVUA 3QTOH 1UCYE 3PO1C 5E0JA 1ZSJA 1GGDC 4I8KA 2SFAA 4DT7B 2PGBB 4MG3A 3NXPA 2ZWLH 3M7TA 3SOSA 2BD2A 2GX4A 2ZCLP 1J17T 4X6PA 1RIWC 1VCQA 2P8OB 1SGNE 1DDJA 3TH4H 1EJNA 1A0JA 1G32B 1HV7A 3A87A 3PTBA 3K2UA 1SHHB 3T26A 3MH6A 4AYVB 1HBTH 2Y5GA 1IQFA 1E37B 4DOQA 2AERH 3WY8A 2Q6FA 1TNHA 1GI5A 1CU1A 1HRTH 2B5TB 1H4WA 1EAIA 3TK9A 1AD8H 1BTZA 1C5ZB 3ATLA 3NZIA 5C5NA 4ABGA 1FIZA 3RXTA 1SQAA 3R3GB 4WXVA 1G2LA 2FZZA 1P57B 1BBRK 2I6QA 5C3NA 1JIRA 1SGPE 1C1OA 2FI3E 2Y82A 1FY4A 1ZMJA 3B23B 4OGXA 4AB9A 1W8BH 1ESAA 1GHBG 1WQSA 1EATA 1SGFG 3ATMA 5GWZA 1O2IA 3BEFB 4NZQA 2FPZA 4AORA 2FOAA 1SGTA 3SO3A 1GJCB 2ZDKA 1SR5C 2NU3E 3PB1E 4ISIH 2J2UA 4NA7A 3RXJA 2BQ7B 2ANKH 4BAOB 2ZC9H 1O3BA 1OWIA 2ESTE 1S85A 3PTNA 3W95A 1ZYOA 2AEIH 3TGIE 2BTCE 3UWIA 3ZZ8A 1MTUA 1NS3A 1YPKH 3DUXH 4DURA 1O2WA 1ZSLA 4ZXYH 4AG1A 2BDHA 1EP6A 1GVLA 1BDAA 3A89A 1V2RT 6GCHF 1TBQH 1SB1H 5DO4H 3FVFB 3E0NB 2H2ZA 4YT7H 5CHAB 1VITF 3DD2H 4OS5A 2A4RA 4ZKNU 1V6DA 1JIMA 1HAIH 1TMUH 1GBBA 1EOJA 1MU6B 4UEHH 3O8BA 4ABIA 4E7NA 2BQWB 5FCKA 4X8UH 2JETC 4OS4A 1AFQB 2VU8E 2C8XB 4KP0A 1OYTH 1QB9A 4OS7A 2R3UA 2GZ9A 1Y3YA 3CP7A 1GCTB 1MKXH 4Q80A 3R0FA 1Z8RA 1T8OA 2EI8A 3C1KA 1MTWA 1UHBA 1GJAB 1F5KU 5AF9H 5FBEA 1HAPH 1P12E 2ZDAH 5HGGA 1HCGA 4Q7XA 2TPIZ 5EW1H 4JYTA 2C93B 2GZ7A 3UNRA 5DP7A 5BPEA 3LC3A 1C5MD 1HPGA 2IJOB 1G30B 3LPRA 1OWEA 1WUNH 2WYJA 3SGAE 1WV7H 1UCYH 1TBRH 1ZSKA 4MVNA 1DY9A 2V35A 4K60A 1DLEA 2QV1A 1LMWB 1WCZA 2A7CA 1QURH 3P8FA 5JBTA 1ANCA 4WWYA 1NESE 3MU0A 2P59A 2SGDE 3LOXA 2FOHA 3M37A 4JYVH 1LVBA 1C1WH 1JXPA 2QN5T 5A0BA 1A46H 3RMMH 1QY6A 3IWMA 2DE9A 5H4IB 1DE7H 2EC9H 1ZR0A 1GI9B 1SMFE 3TVJB 4ZKRU 1MAYA 4WMEA 1HJ8A 1O5DH 5TCCA 4WF8A 4DVAU 5HYOA 5A2MH 3SNCA 3GY5A 4BXSA 1S81A 3P70B 3LJJA 1W12U 2PKSB 1D6WA 1MAXA 2EEKA 4J2YB 2QYIA 1XXFA 1O2UA 1XKBC 4ISNA 1O3IA 3I29A 3SN8A 2CHAC 2D1JA 3RU4T 2GCTB 2QA9E 3A7VA 2FX6A 1O2NA 1AKSA 1P10A 1BT7A 3F9EA 4NIXA 2HGTH 1S6FA 1CGIE 3MU4A 2FP7B 2ZECA 2WPLS 3E91A 2J34A 3GDVA 4BXWA 2PKAB 2OBOA 2STBE 2B9LA 4B71A 1XUIA 4NCYA 1ELAA 4UE7H 4BAKB 4U01A 3SNDA 1O2XA 4BAMB 1RIWB 4DY7B 4CR9A 1B0FA 1HAZB 2IPHA 4KELA 4X6NA 3TH2H 1Y3VA 1MKXK 1P2JA 2OC0A 1LQDB 3STJA 1KIGH 3RUOA 2BY7X 2FESH 3A86A 1BJUA 1O33A 2A45B 2GVFA 4CBOA 3RMOH 1QBNA 3RXQA 3VEQB 4UFDH 3QTVH 4JYUH 3BF6H 5DJ7A 3M5LA 4UDWH 2A5KA 1VR1H 2HWLB 1AO5A 4NWKA 2PV9B 4WH6A 3TJOA 4CH2B 1KYNA 1AU8A 2QXJA 5EQQA 2C8ZB 3ATIA 4NIVA 1O35A 2VWNA 3SHCH 1UCYK 1HAXB 1O2TA 3A82A 2ZTYA 2B8OH 3U8RH 2VIVA 2ZIQH <