1AKSB

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
SSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords ALPHA TRYPSIN
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksB00
2BQWB 3SU3A 1SSXA 3SORA 4XBDA 2PTCE 4IBLH 3ATIA 1ZR0A 2W26A 5AF9H 2HNTF 5IDKA 2HWLB 2QAAA 2AMDA 1ELDE 1TRYA 1O3KA 2ODYB 1SGRE 4ABJA 1K1OA 1BJVA 1L4ZA 2FI5E 4OS6A 2SGFE 3IITA 4CHAC 3ODDA 3P92A 1KDQB 1WAYB 1TRMA 1O2GH 2WUBA 1LPKB 1W14U 2FLBH 3MNSA 4LK4A 1DDJA 4UDWH 3U8OH 3URDA 1MTNC 2UUKB 2XTTB 1MAXA 1F92A 3SHCH 2V6NA 3IWMA 5E2PA 5FX6A 5EQQA 2GT8A 1LKBA 3SI3H 4WWYA 2FPZA 4IGDA 4FU7A 1GVZA 5JB8S 3KCGH 2V35A 1WUNH 3ZZ3A 1T4UH 1PPBH 2H9HA 1HAIH 3ZYEA 1ZRBA 1FQ3A 4LZ1H 4AYYB 4A6LA 3WY8A 5EW2H 1BJUA 1S6HA 2CGAA 1TX8A 3SU5A 2TPIZ 3SV6A 2Z9IA 2IJOB 3UY9A 1O2PA 2B0FA 2ZFRH 2ZPQA 3RP2A 3VFEA 2PV9B 3F6UH 2D2DA 2VB0A 1CQQA 1GVKB 1LDTT 1F0SA 1LVBA 1FZZA 5H4IB 2ZU2A 3TJNA 3T28A 4ZUHA 3P17H 2CJIA 4X6OA 4KELA 3NKKA 1BBRH 1NY22 1AO5A 1ZJDA 3UTUH 5CMXH 2VIQA 1S84A 4RN6A 4Y6DA 2ZDKA 1EAUA 4TWWA 3KIDU 1AQ7A 1T8NA 1H9IE 4ZROA 2ANYA 2OQ5A 1MD7A 1UVSH 2BX3A 1YLDA 3BG8A 1L1JA 5B6OA 1N6YA 4K1TA 1OP8A 1UTPA 1M9UA 2DUCA 2G4UA 1P02A 2R2MB 1FY1A 4X8VH 2ZHEH 3QWCH 4B2CA 1P2OA 1C1UH 4JZFH 2BD9A 3IG6B 2ZDMA 1CA0B 1O2VA 3ZVDA 1GHZA 1KLIH 4OS2A 3SGQE 4OGYA 3T62A 2GDEH 1P04A 1B0FA 1OWJA 4X2XA 1BRBE 2A0QB 1ESAA 3SV2H 1OSSA 1FY3A 1GBJA 3F9FA 1MQ5A 3ZZCA 4D9QA 8KME2 1Y5UT 2G8TA 4Y76A 5DP7A 1TIOA 2J92A 4D8NA 2JKHA 1ZGIA 5E0HA 3KL6A 2BOKA 2HRVA 2G00A 2GCHG 1YC0A 1LMWB 1PPEE 2PWXA 3JZ2B 4X8TH 1GMHF 3E16B 1GCTC 1MU8B 5A0AE 6CHAB 1A4WH 3GCTF 4TY7A 4AORA 3RXIA 1FAKH 4ISHH 3R3GB 4Y8XA 1LHFH 3P8NA 2YNBA 4D9RA 1NPMA 1CT4E 1BMLA 3BIUH 1GJ9B 5LPFA 1C1SA 4X2YA 1B0EA 1OWKA 4YT6H 3DHKH 1EX3A 1ZSJA 3A87A 1B5GH 1FLEE 1ZHMA 1MAYA 3E1XB 4JK6A 3H5CB 4NSVA 2C90B 1Z1JA 1EQ9A 4I8KA 1LO6A 1QL7A 4MNVA 1K2I1 5EU8A 3S9CA 3AASA 4JZDH 4CRDA 8LPRA 2Y5GA 1Q3XA 2R3UA 4DJZB 3PMBB 1XMNB 1EP6A 1IQEA 1NRNH 1HAXB 1TA6A 2AS9A 1CA0C 1SI5H 4K60A 3O8RA 3A83A 5FX5A 1C2FA 3HK3B 3NZIA 4O9VA 4OS7A 2ZZUH 5FPSA 5GIBA 1GDNA 1YKTA 1HXFH 3RXUA 3ZVBA 3SUGA 1LQEA 2QGRA 3BTFE 1LKAA 1OX1A 1Y3WA 5GXPA 1DUAA 2BLQA 2BXUH 1P10A 1SLXB 3RC4A 1MZAA 1TWXB 6CHAC 3NWUA 1DSTA 1SHYA 1W7XH 1WOFA 5EXMA 1SGNE 4XFQA 2GMTB 1TX6A 3ZZ6A 3MFJA 3QUMP 2FXRA 1P2QA 1LTOA 1U6QA 1K28D 3L6PA 3FP7E 2VVCA 3ITIA 4MDSA 1ID5H 1JIRA 5TCAA 4Q2KA 3TITA 5A09A 2ZP0H 1ZTJA 4ABAA 1SQTA 5EQSA 1DE7H 1ZMJA 1T7CA 3CENA 5L2YH 5HM9A 3BN9A 3TJVA 1Z6EA 2R9PA 1HAOH 1AIXH 1ABJH 3BV9B 5DP8A 1PPGE 1EAWA 1GI0A 3F9GA 4Y8ZA 3KHVA 1KIGH 3U98H 2A4GA 3M3SA 4JYVH 3HGNA 2BD8A 2SGAA 2A7HA 1O2HA 4GVUA 2WPLS 3MU8A 2SGDE 2GKVE 1OPHB 2B5TB 2D8WA 2VJ1A 4WXIA 2Y7XA 3UNQA 1WSSH 1GCDA 1RD3B 3M5LA 3SI4H 1FV9A 2TRMA 2ZFQH 3GDVA 1ACBE 1ZGVA 4INKA 3RXJA 3RDZA 2FIRH 4B2AA 2BLOA 1T32A 3KQCA 1IQJA 2BDIA 3BTHE 3VGCB 1DPOA 2BD3A 2BDCA 4Z6AH 2WV4A 2Z3EA 4ISOA 1ELBA 1VITG 1ZHPA 3EA8A 1NFWA 5DK1A 2J34A 3SZNA 1O2MA 5C1YA 1P2NA 2D26C 1C5RA 4XSKU 1V2NT 4K8YA 4CRCA 1GHBG 1GJ8B 1IQFA 4Z0KA 1G32B 2GV7A 4MPXA 1THPB 1EZSC 4AB8A 1MCVA 4ESTE 4X1PU 4NWLA 3RMMH 3ZZBA 1NU7B 4Y10E 1VCQA 1C5PA 1O2SA 1O2QA 2C93B 2FODA 4DCDA 2VGCC 4GSOA 2Z94A 1O3HA 4NIWA 2BVXH 3F68H 4SGBE 4X2VA 1L2EA 1ARCA 3M5MA 5CE1A 3AAUA 4MPWA 2ZPSA 4NSYA 1MKXK 2ZDNA 5EPNA 4HTCH 1K9OE 2O8MA 4OS5A 1P3CA 2F91A 5IYTA 4FUGA 1C1TA 5SGAE 1VITF 3RC6A 1ELAA 3OX7U 1ANCA 3GY7A 4GCHF 1A61H 1XX9A 4O3TA 3TJOA 1EZUC 2ZGBH 1QL9A 5LPEA 3TGKE 1K1JA 2NU1E 3W94A 1AU8A 1EASA 3M3TA 1SMFE 4FVBA 2FM2A 1V2PT 1GJ7B 1CO7E 3I29A 1IQMA 3LGUA 1GG6B 1KXEA 1XUKA 2QCYA 4RKOB 4CRBA 1Z1IA 1T8MA 2P3UB 4IC6A 2HNTC 1O5AB 2J95A 4DURA 2THFB 4FUBA 4BAHB 2BZAA 3N7OA 3UPEA 2G51A 3DD2H 5EGMA 1C5LH 1RTFB 2A4RA 2ZHQH 2P93A 2XNIA 2UWOA 1E37B 1EPTA 4R8TB 1GHWH 2Y5HA 4DY7B 3EGKH 3KN2A 3ZZ9A 3P8GA 2CHAC 4I31A 3RU4E 1PQ8A 2XXLA 4A1XA 5FXLA 1A7SA 4GAWA 2A5KA 4Y7AA 3TU7H 1TNJA 2LNCA 2GV6A 3STJA 1ZPZA 3CP7A 4THNH 3A85A 4Y8YA 2EC9H 5C5NA 3ZVCA 1UHBA 1OWDA 2UUYA 3ZZAA 1UTNA 3E6PH 1N8OB 2JH5D 2VGCB 5C1XA 2A31A 1P57B 3G01A 4YLUA 4B1TA 1YPMH 2EEKA 1TPSA 1GI3A 2ASUB 1O2XA 4WVPE 3TH4H 1G36A 2FS8A 1GJCB 4X1SU 5FCKA 4Q7YA 4CH2B 3TLOA 5I25A 4BAQB 1ETRH 1XM1A 1VJAU 3PWBA 3M35A 4H6TA 2TGPZ 4D7FA 1T8OA 2OLGA 1C2KA 4CBOA 4UFEH 3BG4C 2ALPA 1QB9A 3A7TA 1O5GH 1AKSA 4J1YA 4ASHA 2V3OH 3BTDE 4FUIA 3UIRA 3RXKA 1BHXF 1O3DA 1UTLM 2FX4A 2FTLE 2GCTB 3GCNA 1C2HA 4NGAH 3E8LA 1GBHA 1WV7H 4FUHA 4H4FA 3PO1C 1P12E 1GG6C 3Q76A 2ZWLH 3TK6A 4YOJA 1BBRK 3AVZA 4INHA 1CSOE 3SNEA 2I6SA 4K2YA 1BIOA 1TMBH 1V2UT 1Z71A 2ZPRA 1AWHB 2YNAA 2FOGA 1RJXB 3A7WA 1GL1A 1OWHA 2H5DA 1Y3VA 4IW4E 1GHXH 1E0FD 1CU1A 1HRTH 1JBUH 3GCTG 3LJJA 3RU4T 4TWYA 1HAVA 1FUJA 1MBMA 2G55A 1WTHD 4B76A 1E36B 1VJ9U 1ESTA 3UNRA 2BDBA 4UONA 3M7TA 1V2MT 2R2WU 3KEEA 4AB9A 1P11E 1BRCE 1SOTA 1HPGA 1TGCA 1W13U 2PTNA 2ZDLA 1AKSB 1YPEH 3DFJA 4BTIB 8GCHF 5JPMH 4X6MA 1LVMA 1FY8E 1A0LA 1BTZA 4UD9H 3Q77A 1AZZA 1L4DA 2GT7A 1DXPA 3RXBA 1D3DB 1DXWA 1PJPA 1C5MD 1O2LA 1D4PB 2ZC9H 1AVXA 1LHDH 3FAOA 5L6NH 1EB2A 2BVRH 1SR5C 5JYIA 3A7VA 4AN7A 2Z6BD 5C3NA 2OC1A 1FY4A 1HB0B 5LPRA 1C5WB 5L30H 5FHTA 1TBQH 3QN7A 1A5HA 3UFAA 3LKWA 5EODA 3K65B 2ZHDA 1Y5BT 1HUTH 2Z3CA 3GDSA 1DWCH 3LOXA 1O3CA 5DP4A 1TMTH 1QNJA 2P59A 4R0IA 3LIWA 3RXRA 1RXPA 2C4FH 2PGQB 1JRTA 3L33A 2QIQA 3ZZ5A 5GCHF 3URCA 6ESTA 1KXFA 3SU6A 2WUCA 3BEUA 4CREA 4DVAU 3H7OA 2VVUA 1O30A 1LPZB 3H7TA 1SGCA 2FZZA 1GMCG 2P95A 2QC2A 1HAGE 1Y5AT 1H9HE 1UK2A 1WQSA 3K9XB 1DWDH 1V2JT 1J17T 3U1JB 2JH0D 4X2WA 2XC5A 1TMUH 2AYWA 1O3LA 2Z9LA 1GGDC 1EPTC 3TNSA 1C5ZB 3UQVA 2HLCA 1D6RA 2RDLA 2BY8X 3PWCA 2O9QA 4B75A 1TNKA 5PTPA 4AGKA 2AGGX 4O03A 1TONA 2AEIH 4K8BA 2QF0A 2FOBA 4A1VA 1DVAH 3SOSA 3HKIB 1NS3A 1TOCB 1V3XA 4NFFA 3A80A 3MYWA 2WPIS 2VWMA 3LH3A 1ANEA 1GBDA 1SFIA 3QX5H 3R0FA 2UWLA 2C8ZB 4YLQH 4E06H 2QXJA 1S6FA 3RM2H 3TH3H 3TVJB 1YPHE 2XWAA 3VEQB 3GY3A 1JIMA 2VWOA 1AUJA 4DIHH 1C2GA 1A3EH 1WTGH 1XXFA 3LJOA 3SU1A 1V2TT 4U01A 2PUXB 3A84A 1ZOMA 4AYVB 1GBEA 1KY9A 2PR3A 1SFQB 5E0GA 1AMHA 3VB4A 4ZMAH 4JCNA 3RMOH 2BLWA 1F0UA 1AFQC 1HCGA 1INCA 1QB6A 2VH6A 1SGQE 1NN6A 1W0ZU 5C20A 1SBWA 1HJ9A 1C5OH 2SFAA 1P0SH 3GCHB 3QGNB 1O3AA 3A81A 1MTSA 4WMFA 3ZVAA 1YCPM 2BQ7B 1C5VA 2Q1JA 4IN1A 1TGNA 2WPHS 5DP6A 4AZ2B 2B9LA 5LGOA 1QR3E 3GY2A 1Z8GA 2Y82A 1TBRH 3GYMA 3HATH 2ANMH 1D3QB 1T31A 2F9NA 1GI7B 1BZXE 3UUZA 1O33A 1PPHE 4BNRA 2RG3A 4YOIA 1CHOF 3QZQA 1TGSZ 1TRNA 3HK6B 1TYNA 3TNTA 4Y71A 1IOEA 2FOCA 3LGTA 4NFEA 3TJUA 1GBTA 1HAYB 1O5DH 3SO3A 1CBWB 3UOPA 1AB9B 2O8TA 5E8EH 3LGVA 1WU1A 2GDDA 2UWPA 3K6YA 3BTEE 1GI6A 1Y3YA 5C2ZA 2OP9A 1GBBA 3TK5A 1G9IE 1QURH 1XKAC 2GMTC 3S0NA 4MQAA 1HNEE 3P8FA 5HGGA 3BTQE 2V0BA 3RXOA 2FEQH 1AE8H 1ZMNA 3FZZA 3SNCA 2BXTH 1CE5A 3AW1A 1JRSA 2SNVA 1NRSH 1IQHA 1TX7A 3A7XA 1SGYE 4A7IB 1HBTH 5FBEA 1F5LA 2A45B 5K7RA 1KTTB 1BTXA 3MU4A 4U30A 1KLJH 3CS7A 5TJXA 2P16A 1QQ4A 3S7HB 4UEHH 4X8SH 1BMNH 1LQDB 3A8DA 5T3HA 3UQOA 3ZV8A 5K0HA 4HZHA 3SNBA 1TOMH 3SUDA 1ZSKA 1TGTA 1BQYA 2Y80A 4GHQA 1S0RA 4DIIH 3BTWE 3ELAH 4HGCA 3NXPA 1QJ6B 6LPRA 1XXDA 3BEFB 4A1TA 2PUQH 1O5EH 1QRXA 3SGAE 3T29A 2XBYA 1K1NA 1PYTC 4FUEA 1FONA 4Q7ZA 1DX5M 1ZPBA 1KDQA 1NFUA 2ZFSA 1O3EA 1K1PA 3DUXH 2A4OA 5DP9A 3FVFB 1ZHRA 2AIPA 3T2NA 2ALVA 2TGAA 1LVYA 3ATWA 4I33A 1P06A 1GBMA 1UVTH 1D6WA 3LPRA 1UHBB 1C5XB 1SOZA 1GMCF 2W5EA 4Q80A 2PKSB 4H42U 2BB4A 2C3SA 3V3MA 1DS2E 1Y59T 1WBGB 4AG2A 1K21H 4MPVA 1MTWA 1JMOH 2BYAX 2HOBA 2R0LA 3QTOH 4HFPB 1C1RA 8GCHG 1C4U2 1GWAA 2XWBI 1IQLA 1A0HB 3ZVFA 4BANB 4K1SA 3GCOA 4U32A 2FDAA 1F0RA 1V2VT 3FP6E 1BCUH 2FI3E 4M7GA 1HXEH 3UREA 1W12U 3PO1B 1CGIE 1TNGA 1TPAE 2DE9A 1TLDA 4YO9A 1C2JA 1SGIB 2BQ6B 4MVNA 4X1QU 2G4TA 2ZTZA 1S83A 7KMEH 1FNIA 2F9OA 3FFGA 4CRFA 3LC3A 1D3PB 1HJAC 4BAKB 2W3KA 3CS0A 3D62A 3SHAH 1DY9A 3MTYA 3ZVGA 3STIA 1UVUH 1V2OT 4QT8C 3PB1E 3OSYA 2P3TB 3MH4A 1ZZZA 1EOLA 4PROA 1LPGB 3U8RH 1A46H 1Y3XA 2FOMB 3TH2H 2FO9A 2ULLA 3E91A 1WYKA 3SV9A 1O31A 3T25A 3ATKA 2OUAA 2R3YA 3S9BA 1XUIA 1GBKA 2ZDVH 3PYHA 2FYRA 3ZZDA 2IOTA 2AGIX 2FESH 3RM0H 1C1MA 3OY5U 2AFQB 4JZEH 1BT7A 1UJ1A 2O8LA 4YT7H 2ZGCA 1HAVB 5J4SA 1O3PB 4I8GA 3MNCA 3KQEA 3P70B 2Y5FA 1V2QT 2EA3A 2ODQA 1D9IA 2NU4E 1W3CA 2VNTA 4MPUA 2BVSH 1ELEE 3UR6A 2WYGA 3MNXA 2GGVB 3UWIA 1HIAA 3A7YA 4ZKOU 1OXGA 4ZHLU 1GJ6A 2ZF0H 1C1QA 4OS1A 1GBLA 2WYJA 1QIXB 1WQVH 1A3BH 1O2RA 1SQAA 4BOHA 1GHAF 2A5AA 2JETC 1GBAA 2PSYA 4ZXXH 2FWWA 4KTCA 3P95A 3M36A 1ABIH 1RIWC 1YYY1 2ZGHA 5FPYA 4CR5A 4RKJB 4K69A 1C9TA 2ZI2H 1GL0E 1GBCA 5HXFA 1C5NH 1GI1A 1P2KA 1PPZA 2BY7X 1QY6A 2BOHB 3NK8A 1UMAH 4DOQA 2F9VA 3NPSA 3E0NB 5C1UA 3EA9A 2HNTE 3Q00A 1KXCA 5GDSH 1A5GH 1AWFH 5HM2A 2NU3E 3QLPH 4LZ4B 4U2WA 1H1BA 1J16A 1MTNB 1GI9B 1P9UA 2HALA 1O2KA 2BHGA 3ATLA 1OP0A 2ZFTA 4E7NA 4TPIZ 2OQUA 3QDZB 2ZU1A 3AW0A 4Q7XA 1O32A 1OP2A 4FUCA 2W7UA 4NA8A 1ZMLA 3ODFA 1HV7A 2ZU3A 1C2MA 1MQ6A 1MTVA 1J8AA 1L0ZA 2ZIQH 3EYDA 1SGDE 1D3TB 3E3TA 5GWZA 2BD4A 2TIOA 1YM0A 2ZQ2A 4KP0A 3PMAB 1ELGA 1T8LA 3MH5A 3SQHE 2A32A 3MOCA 1MKWK 4IMZA 1VGCC 1DWEH 3RMNH 7ESTE 1P05A 2VIWA 1J15A 1O2OA 2ZO3H 1MH0A 4NIYA 1ANBA 3M37A 2F83A 1VCPA 4CH8B 2PW8H 3BTKE 1O5BB 4O97A 2VU8E 4DT7B 3HKJB 1SG8B 3T5FH 2IN2A 3SUFA 1YF4A 2JETB 4WH6A 4J2YB 3UR9A 1OYQA 1O3OA 3BIVH 1OYTH 1XUHA 3I77A 3T26A 3NUMA 2C8XB 3GCHC 4GHTA 2BZ6H 3GY8A 1QHRB 2ESTE 1EP5A 2CHAB 1XVOA 2QF3A 2ZECA 3KNXA 1HDTH 1QGFA 2OC7A 3MO6A 3F1SB 2ANKH 1ANDA 3GY6A 2Y7ZA 4INLA 2VIDA 1BUIA 2WPJS 3FZDA 3LH1A 5CHAC 2A4QA 3S9AA 2P8OB 3A8AA 3ZYDA 1P9SA 1S85A 2ZGJA 1O3IA 4TY6A 1O2JA 4ZHMU 2H9EH 3QZRA 3SU0A 7GCHF 3RUOA 3PLKA 1P3EA 1O34A 3LC5A 1SGEE 1EAIA 5F03A 1G30B 1UTKA 1MD8A 3MU1A 4AX9H 1HFDA 2A7JA 3EE0B 1J14A 3SJ9A 2TBSA 1VGCB 1ESBA 1TA2A 3A82A 1C1NA 3M5OA 4Y0YE 4YM9A 1DICA 1GVLA 1MZDA 1UCYE 1XUFA 1YPHC 4CHAB 5BRRE 1FPHH 1F0TA 1V2WT 1C1WH 2XBVA 4NZQA 2QXHA 1FJSA 4CBNA 4FVDA 1WCZA 1Z6JH 4ZKNU 1YPLH 4XBCA 4ABFA 2ZHWH 5A8YA 1EJNA 1AI8H 1KXAA 5HYOA 1O3JA 1DANH 1ZTLA 5C5OA 2UUFB 1O5FH 5F8XA 1Y3UA 4YTAA 1OWIA 3M7QA 1BTYA 1EJAA 2DE8A 5JBTA 1AFQB 5DP5A 3O8DA 1G2MA 2B8OH 5FPTA 3D23A 1QJ7B 2ZHFH 3MI4A 3MH6A 1O39A 5JB9S 2STAE 1MU6B 1QL8A 4FUDA 2OBQA 4UFFH 4B71A 4X0WU 4XE4A 1JOUB 2NWNA 5E2OA 4KKDA 4O3UA 1C5QA 4ABHA 3RXEA 3TIUA 1UTQA 3RLWH 3P8OA 1PYTD 3LGYA 1P8VC 2BDAA 2HVXA 3DA9B 3A89A 1QTFA 4JMYA 1A5IA 3MO9A 2QA9E 4XBBA 1GMDG 1LHEH 1NRRH 1Z7KA 2XW9A 4YZUA 1AFEH 2CXVA 2FTMA 2H1UA 1O3FA 2FX6A 1RRKA 1GMDF 1O3GA 2V3HH 2RCEA 2XRCA 3EA7A 2ZTYA 1K22H 6GCHF 1CT2E 3S7KB 3EQ0H 4ABDA 2A2QH 1GI2A 4AFUA 4DG4A 4ZXYH 1QBNA 2GZ7A 3L3TA 5JBCS 2ZNKH 1LHCH 1HLTH 1P2IA 9LPRA 1C2EA 2SNWA 3F9HA 5EOKA 1GI4A 4DGJA 3BF6H 2GVFA 2VIVA 3ZZ8A 1EB1H 2G5NA 4X8UH 4ZKSU 1DWBH 1AGJA 1UCYH 2OINA 3ZVEA 1GGDB 2TGTA 3RXVA 1K1LA 3HGPA 1PQ7A 4WY3A 1DY8A 4WF8A 1O5CB 1C2LA 1GJ4H 4X6NA 4WH8A 2GCTC 5DG6A 2P3FH 5L2ZH 1UVPA 3SJKA 1KXDA 5JDUB 1HJAB 2HGTH 1DUEA 4VGCB 1SPJA 3RXPA 1A2CH 1QB1A 5JBBS 3RXSA 4JYUH 1GDUA 1EKBB 4KTUA 3UNSA 1EPTB 2Q6GA 5AHGH 2GCHF 4K3JA 2FMJA 2I6QA 3A8CA 3B8JA 2CN0H 1W2KH 1QQUA 1UO6A 1YCPK 4NIVA 1TAWA 4KGAA 2GTBA 2FS9A 4ABBA 1OS8A 4IN2A 1FMGA 1Q2WA 1CVWH 2B7DH 1JWTA 4Y0ZE 1AY6H 2J38A 1BTUA 4B2BA 1KLTA 3LDXH 1GI8B 2D1JA 2M5TA 3B9FH 3KQBA 3EAJA 1BTPA 4FU8A 3V7TA 2AH4X 3TGJE 2QY0B 2Z9GA 4UE7H 1GHYH 5F8TA 5ESBA 4AGJA 4ZH8A 3VB6A 2XCFA 4RSPA 3MU5A 3OY6U 1GMHG 1T4VH 2BD5A 2SGQE 1Z8JB 1XUGA 1EOJA 3QO6A 3KQDA 5A8XA 1C4Y2 1RGQA 1HIAB 5F6MA 2CF8H 2BX4A 1AD8H 1TBZH 3UOUA 1FY5A 1IQGA 2STBE 5HMAA 4MNXA 1QRWA 2Z9JA 1LHGH 2BMGB 3SV7A 1XKBC 1YCPH 3SQEE 5EW1H 1L1NA 3M61U 5DPAA 2C8WB 3FANA 5GPIB 4IMQA 1SC8U 1FAXA 2ZTXA 2H2ZA 3A8BA 3RXAA 1KSNA 1QFKH 2VWNA 1VR1H 1NROH 3T27A 5FBIA 1C2IA 1TPPA 1XVMA 4YESB 2WV5A 2GX4A 2XC4A 1FDPA 2Y6TA 5EG4A 1NTPA 4NG9H 1GJ5H 4AG1A 1GCTB 4ABIA 2A5IA 1VITH 1DITH 1AE5A 2VIPA 1F2SE 1P03A 2A1DB 3K6ZA 4Y79A 1K1MA 3GY4A 1SLVB 2TGDA 1K1IA 2QXIA 5EXLA 1BMAA 3KF2A 1A1RA 4X1RU 3U9AH 3AAVA 4TYDA 1B7XB 4ABGA 4MNYA 3MNBA 1RTKA 1C1VH 1GJBB 2QN5T 4E05H 4GPGA 4AFZA 3OU0A 1MBQA 1THSH 1X7AC 2BTCE 3ENSB 3ZZ4A 1TNIA 4JK5A 2AMPA 1QA0A 1MUEB 4HI3A 3GISB 3RLYH 2ZU4A 1NESE 4MLFB 7LPRA 1FPCH 1S5SA 2EI6A 1GPZA 2QYIA 1C5UA 2FLRH 4NA7A 1E34B 1BTWA 1YGCH 3K2UA 3RXTA 3QK1A 4NCYA 1RTLA 1NO9H 3BG4B 3GDUA 4OGXA 3RU4D 3LT3A 1N1LA 1O36A 3MWIU 1NRQH 4FUJA 2UUJB 1C9PA 2F9UA 1A0JA 1ZYOA 4X6PA 1CHOG 3PLBA 4WXVA 2ZFFH 3A88A 1ZJKA 1GBIA 1GHAG 1MTUA 2WPKS 5I46H 1P2JA 1G2LA 2VH0A 3TK9A 1FIZA 4I8JA 3ESTA 2BD7A 1O37A 1SLWB 3PV4A 1ZRKA 1YBWA 1C5TA 5AVDA 5A8ZA 1BHXB 4NIXA 1W8BH 1TABE 2W7SA 1ELTA 4VGCC 7GCHG 4LOYH 1DM4B 1QCPA 1DOJA 4FU9A 5GJ4B 1UCYK 4JZIA 1BB0B 1ZPCA 1GHVH 2BLVA 3FP8E 1GHBF 4FUFA 3RXQA 4GLYA 3Q3XA 2QXGA 1H8DH 4NWKA 3GY5A 3A86A 2P94A 1CA8B 1AN1E 1IAUA 3MU0A 1W11U 1C1PA 2FOAA 4BAOB 1NT1A 2BDHA 1CBWC 5AFZH 1SHHB 3QTVH 2Q6DA 2ZU5A 2ILNA 1AVGH 1KTSB 2PSXA 2Y81A 3RXDA 2CMYA 5LH8A 1DLEA 2J9NA 1KXBA 2XCNA 2OXSA 1SLUB 3PTBA 1V6DA 5ESTE 1CT0E 5AFYH 3MH7A 4MG3A 1YPJH 2OCVB 2ZGXH 1FN8A 1EJMA 3GICB 2GP9B 4E7RG 3RXMA 1G37A 2F9BH 1MMJN 2BY9X 4XDEA 1BRUP 2OBOA 4WMEA 5C67A 1YP9A 1TNHA 1EZQA 3SUEA 1O0DH 1SVPA 2AIQA 2QV1A 2RA0A 1V2LT 1TE0A 2PGBB 1VZQH 4MNWA 1SB1H 1G3CA 3MHWU 2H5CA 1C5SA 1O3NA 1Z8RA 1SGPE 4BXWA 1CHGA 2O8WA 2J2UA 4JZ1A 2VINA 2JH6D 1FXYA 4B73A 3SNDA 2GZ8A 4H6SB 1O2WA 2O8UA 1NM6A 2SGPE 4A5TS 1O3BA 4IS5A 1XUJA 3F9EA 2EI7A 1NFXA 4I32A 1C2DA 1LCYA 5FAHA 1IQKA 1PFXC 3SJIA 1SGFG 2FOFA 1RS0A 3GYLB 1BOQA 5BPEA 1BITA 1IQNA 3B23B 4IC5A 1G3BA 1IQIA 1OWEA 3BTME 4ABEA 4ISLA 1Z8IB 3NCLA 1UK3A 1V2RT 1SL3A 3LGIA 2OD3B 1ZSLA 2ZDAH 9ESTA 4UFGH 2FYQA 3O8BA 1AZ8A 1PPCE 2J4IA 1O3MA 2F3CE 4I8HA 5DKMA 3SU2A 4NA9H 1EXFA 2PHBA 3HPTB 2LPRA 4ISIH 5T6DA 3I78A 4F4OC 4CR9A 1HGTH 4BTUB 1UK4A 2A7CA 3SU4A 1EAXA 1Q31A 2BD2A 2SGEE 2VVVA 4GUXA 1QBOA 1W0YH 2PFEA 1RIWB 2CF9H 2RA3A 1P09A 3RC5A 1AUTC 1H4WA 1W7GH 5A0BA 4B74A 1BTHH 2ODPA 4ZHAA 5DP3A 2BM2A 3SGBE 2XBWA 1UVOA 4MTBA 1O2IA 2ZEBA 1LVOA 3OTJE 1CGHA 1DT2A 1TB6H 2F9PA 2FOEA 3RXGA 3GOVB 1QRZA 2BY6X 3DT0H 3D65E 1AVWA 1QA7A 3SW2B 2ZFPH 2W3IA 1N6XA 2HPQH 3A7ZA 1ZTKA 4WJG2 3V13A 2G52A 1P01A 3V12A 3E0PB 3KGPA 3PTNA 4Y7BA 3P6ZB 2ZG0H 3JZ1B 4X1NU 2XYAA 4BXSA 2YOLA 3BEIB 4LXBH 1O2NA 1F7ZA 1BBRE 2Z9KA 1AB9C 3SN8A 1RFNA 1ELCA 1O2TA 4DW2U 1EUFA 2H6MA 2FI4E 1DLKB 2ZCHP 1C4V2 1C5YB 1F5RA 3SJ8A 3UWJH 3PM3A 2XC0A 1N8OC 2G81E 2PKAB 3BTGE 1O35A 1TQ0B 3RXFA 1BDAA 3C1KA 4A92A 6GCHG 4I7YH 2FOHA 2WPMS 5EPYA 5DO4H 1EATA 1NZQH 3MMGA 1HAPH 1ETSH 1L1GA 4I8LA 1DFPA 1TFXA 1PPFE 2NU0E 2Z3DA 1UTOA 1G3DA 3VB3A 5G4BA 1MKXH 4KTSA 5ABWA 3LGWA 3M5NA 5CHAB 2KAIB 2H9TH 1GBFA 4WMDA 3RXLA 2OC8A 2BDGA 1O2UA 1CGJE 2GZ9A 3E90B 1HAZB 1DSUA 4K1EA 2BY5X 3ZV9A 5DJ7A 2Z7FE 5A2MH 1MKWH 1GI5A 3ATMA 1QJ1B 5DGJA 5T6GA 4YOGA 3PROA 3TPIZ 2CV3A 3VB7A 4CRAA 2ZQ1A 3PLPA 3DFLA 2R0KA 3O8CA 3BTTE 5J4QA 1YPGH 4AOQA 1Y8TA 1TQ7B 3RMLH 4OS4A 3PMHB 2PKAA 4ISNA 1UTJA 2P8OC 3OYPA 1BRAA 1TALA 1S82A 3VXEH 1YLCA 1GJDB 1HJ8A 2PKSC 2WINI 3M7UA 2OC0A 4XOJA 3W95A 4GCHG 3SBKA 1S0QA 3SJOA 3C27B 1GDQA 4K5ZA 2KAIA 3Q3KA 1G3EA 5F8ZA 1HAHH 1V2ST 3U8TH 1NFYA 1J9CH 2VIOA 2XBXA 3PMJA 1BA8B 4FXGH 1QBVH 5EQRA 2PLXA 1PQAA 1O2YA 5FCRA 5A0CA 1C1OA 1VCWA 3Q3YA 1ZLRA 2ZCLP 5GCHG 1ARBA 3EDXB 2ZA5A 1BMMH 4ZKRU 1UTMA 1SGFA 4SGAE 2HPPH 1E38B 2AERH 4CRGA 1W10U 1ELFA 4Y11E 3V0XA 2AGEX 3VPKA 3ZZ7A 1YPKH 3LONA 8ESTE 2AMQA 1H8IH 1SQOA 1V2KT 2OTVA 3BSQA 1O38A 3MO3A 1JXPA 3VB5A 1ETTH 2ZCKP 3VGCC 1GJAB 1E35B 1TGBA 4D76A 3LU9B 1FN6A 5ETXA 2NU2E 1PQ5A 1O2ZA 3SNAA 3RXHA 1ELVA 1F5KU 4NZLA 1FI8A 4TPYA 1NRPH 2EI8A 1S81A 5TCCA 4D7GA 5JBAS 1H9LB 2C8YB 2BDYA 3QGJA 1NU9A 5EXNA 1OKXA 1TNLA 2G5VA 2FP7B 1AHTH 3D49H 1NC6A 2IPHA 4UFDH 4AFQA 2ZKSA 1FIWA 4F49A 5E0JA 4BAMB 1HYLA 3TGIE 1TPOA 2K1QA 3S69A 3SV8A 4BTTB 2VWLA 1THRH 4ZAEA 1EZXC 4JYTA 1MCTA 1IHSH 2J94A 2Q6FA 1OOKB 1ORFA 3U69H 3RXCA 3M3VA 2GD4B 4AFSA 5T6FA 3VXFH 3U1IB 1P2MA 2ANWA 1KYNA 1IHTH 2A2XH 1SGTA
chains in the Genus database with same CATH superfamily
2BQWB 3SU3A 1K0HA 1SSXA 3SORA 4XBDA 2PTCE 4IBLH 3ATIA 1ZR0A 2W26A 5AF9H 2HNTF 5IDKA 2HWLB 2QAAA 2AMDA 1ELDE 1TRYA 1O3KA 2ODYB 1SGRE 4ABJA 1K1OA 1BJVA 1L4ZA 2FI5E 4OS6A 2SGFE 5DN6D 3IITA 4CHAC 3ODDA 3P92A 1KDQB 1WAYB 1TRMA 2M2AA 1O2GH 1LPKB 2WUBA 1W14U 5KGOA 2FLBH 3MNSA 4LK4A 1DDJA 4UDWH 3U8OH 3URDA 1MTNC 2UUKB 3OEHD 2XTTB 1MAXA 1F92A 3SHCH 3F2FA 2V6NA 3IWMA 5E2PA 5FX6A 5EQQA 2GT8A 1LKBA 3SI3H 4WWYA 2FPZA 4IGDA 4FU7A 1GVZA 5JB8S 3KCGH 2V35A 1WUNH 3ZZ3A 1T4UH 1PPBH 2H9HA 1HAIH 3ZYEA 1ZRBA 1FQ3A 4LZ1H 4AYYB 4A6LA 3WY8A 5EW2H 2QF4A 1BJUA 1S6HA 2CGAA 1TX8A 3SU5A 2TPIZ 2YMSB 2Z9IA 3SV6A 2IJOB 3UY9A 1O2PA 2B0FA 2ZFRH 2ZPQA 3RP2A 3VFEA 2PV9B 3F6UH 2D2DA 2VB0A 1CQQA 1GVKB 1LDTT 1F0SA 1LVBA 1FZZA 5H4IB 2ZU2A 3TJNA 3T28A 4ZUHA 2EQNA 3P17H 2CJIA 4X6OA 4KELA 3NKKA 1BBRH 1NY22 1AO5A 1ZJDA 3DSPA 3UTUH 5CMXH 2VIQA 1S84A 4RN6A 4Y6DA 2ZDKA 1EAUA 1UW7A 4TWWA 3KIDU 1AQ7A 1T8NA 1H9IE 4ZROA 2ANYA 2OQ5A 1MD7A 1UVSH 2BX3A 1YLDA 3NRLA 3BG8A 1L1JA 5B6OA 1N6YA 4K1TA 1OP8A 1UTPA 1M9UA 2DUCA 3W1EA 2G4UA 1P02A 2R2MB 1FY1A 4X8VH 2ZHEH 3QWCH 4B2CA 1P2OA 1C1UH 4JZFH 1NBME 2BD9A 3IG6B 5IK2D 2ZDMA 1CA0B 1O2VA 3ZVDA 1GHZA 1KLIH 4OS2A 3SGQE 4OGYA 3T62A 2GDEH 1P04A 1B0FA 1OWJA 4X2XA 1BRBE 2A0QB 1ESAA 3SV2H 1OSSA 1FY3A 1GBJA 3F9FA 4ACAA 1MQ5A 3FOAA 3ZZCA 4D9QA 8KME2 1Y5UT 2G8TA 4Y76A 5DP7A 1TIOA 2J92A 2L74A 4D8NA 2JKHA 1ZGIA 5E0HA 3KL6A 2BOKA 2HRVA 2G00A 2GCHG 1YC0A 1LMWB 1PPEE 2PWXA 3JZ2B 3OFND 1GMHF 4X8TH 3E16B 1GCTC 1MU8B 5A0AE 6CHAB 1A4WH 3GCTF 4TY7A 4AORA 3RXIA 1FAKH 4ISHH 3R3GB 4Y8XA 1LHFH 3P8NA 2YNBA 4D9RA 1NPMA 1CT4E 1BMLA 3BIUH 1GJ9B 5LPFA 1C1SA 4X2YA 1B0EA 1OWKA 4YT6H 3UB0A 3DHKH 1EX3A 1ZSJA 3PV2A 4ASUD 2JIZD 3A87A 1B5GH 1FLEE 1ZHMA 1MAYA 3E1XB 4JK6A 3H5CB 4NSVA 2C90B 1Z1JA 1EQ9A 4I8KA 1LO6A 1QL7A 4MNVA 1K2I1 5EU8A 3S9CA 3AASA 3OTPA 4JZDH 4CRDA 8LPRA 2Y5GA 1Q3XA 2R3UA 3ZIAD 4DJZB 3PMBB 1XMNB 5T1VA 1EP6A 1IQEA 1NRNH 1HAXB 1TA6A 2PP6A 2AS9A 1CA0C 1SI5H 4RT1A 4K60A 3O8RA 3A83A 5FX5A 1C2FA 3HK3B 3NZIA 4O9VA 4OS7A 2ZZUH 5FPSA 5GIBA 1GDNA 1YKTA 1HXFH 3RXUA 3ZVBA 3SUGA 1LQEA 2QGRA 3BTFE 1LKAA 1OX1A 1Y3WA 5GXPA 3U28C 5B6LA 1DUAA 2BLQA 2BXUH 1P10A 2J5UA 1SLXB 3RC4A 2W6ID 1MZAA 1TWXB 6CHAC 3NWUA 2WZQA 1DSTA 1SHYA 1W7XH 1WOFA 5CDFE 5EIYA 5EXMA 1SGNE 4XFQA 2GMTB 4RT0A 1TX6A 3ZZ6A 3MFJA 3QUMP 2FXRA 1P2QA 1LTOA 1U6QA 1K28D 3L6PA 3FP7E 2VVCA 3ITIA 4MDSA 1ID5H 2KCYA 1JIRA 5TCAA 4Q2KA 3TITA 5A09A 2ZP0H 1ZTJA 4ABAA 1SQTA 4AC9A 5EQSA 1DE7H 1ZMJA 1T7CA 3CENA 5L2YH 5HM9A 3BN9A 3TJVA 1Z6EA 2R9PA 1HAOH 1AIXH 1ABJH 3BV9B 5DP8A 1PPGE 1EAWA 1GI0A 3F9GA 4Y8ZA 3KHVA 1KIGH 3U98H 2A4GA 3M3SA 2WPDD 4JYVH 3HGNA 2BD8A 2SGAA 2A7HA 1O2HA 4GVUA 2WPLS 3MU8A 2SGDE 2GKVE 1OPHB 2B5TB 2D8WA 2VJ1A 4WXIA 2Y7XA 3UNQA 1WSSH 1GCDA 1RD3B 3M5LA 3SI4H 1FV9A 2TRMA 2ZFQH 3GDVA 1ACBE 2QF5A 1ZGVA 4INKA 3RXJA 3RDZA 2FIRH 4B2AA 2BLOA 1T32A 3KQCA 1IQJA 2BDIA 3BTHE 3VGCB 1DPOA 2BD3A 2BDCA 4Z6AH 2WV4A 2Z3EA 4ISOA 1ELBA 1VITG 1ZHPA 3EA8A 1NFWA 5DK1A 2J34A 3SZNA 1O2MA 5C1YA 1P2NA 2D26C 1C5RA 2L6OA 4XSKU 1V2NT 4K8YA 4CRCA 1GHBG 1GJ8B 1IQFA 4Z0KA 1G32B 2GV7A 4MPXA 1THPB 1EZSC 4AB8A 1MCVA 4ESTE 4X1PU 4NWLA 3RMMH 3ZZBA 1NU7B 4Y10E 1VCQA 1C5PA 1O2SA 1O2QA 2C93B 2FODA 4DCDA 2VGCC 4GSOA 2Z94A 1O3HA 4NIWA 2BVXH 3F68H 4SGBE 4X2VA 1L2EA 1ARCA 2JJ1D 3M5MA 5CE1A 3AAUA 4MPWA 2ZPSA 4NSYA 1MKXK 2ZDNA 5EPNA 4HTCH 1K9OE 2O8MA 4OS5A 1P3CA 2F91A 5IYTA 4FUGA 1C1TA 5SGAE 1VITF 3RC6A 1ELAA 3OX7U 1ANCA 3GY7A 4GCHF 1A61H 1XX9A 3OAAD 4O3TA 3TJOA 1EZUC 2ZGBH 1QL9A 2EY4C 5LPEA 3TGKE 1K1JA 2NU1E 3W94A 1AU8A 1EASA 3M3TA 1SMFE 4FVBA 2FM2A 1V2PT 1GJ7B 1CO7E 3I29A 1IQMA 3LGUA 2QCYA 1GG6B 1KXEA 1XUKA 2J98A 4RKOB 4CRBA 1Z1IA 1T8MA 2P3UB 4IC6A 2HNTC 1O5AB 2J95A 3H09A 4DURA 3WWBA 2THFB 4FUBA 4BAHB 2BZAA 3N7OA 4XRNA 2G51A 3UPEA 3DD2H 5EGMA 1C5LH 1RTFB 2A4RA 2ZHQH 2P93A 2XNIA 2UWOA 1E37B 1EPTA 4R8TB 1GHWH 2Y5HA 4DY7B 3EGKH 3KN2A 3ZZ9A 3P8GA 2CHAC 4I31A 3RU4E 1PQ8A 2XXLA 4A1XA 5FXLA 1A7SA 4Q4LA 4GAWA 2A5KA 4Y7AA 3TU7H 1TNJA 2LNCA 2GV6A 3STJA 1ZPZA 3CP7A 4THNH 3A85A 4Y8YA 2EC9H 5C5NA 3ZVCA 1UHBA 1OWDA 2UUYA 3ZZAA 1UTNA 3E6PH 1N8OB 1YY3A 2JH5D 2VGCB 5C1XA 2A31A 1P57B 3G01A 4YLUA 4B1TA 2IPQX 1YPMH 2EEKA 1TPSA 1GI3A 2ASUB 1O2XA 4WVPE 3TH4H 1G36A 2FS8A 1GJCB 4X1SU 5FCKA 4Q7YA 4CH2B 3TLOA 2KCOA 5I25A 4BAQB 2KR7A 1ETRH 1XM1A 1VJAU 3PWBA 3M35A 2J98B 4H6TA 2TGPZ 4D7FA 1T8OA 2OLGA 3OEED 1C2KA 4CBOA 4UFEH 3BG4C 2ALPA 1QB9A 3A7TA 1O5GH 1AKSA 4J1YA 4ASHA 2V3OH 1FX0B 3BTDE 4FUIA 3UIRA 3RXKA 1BHXF 1O3DA 1UTLM 2FX4A 2FTLE 2GCTB 3GCNA 1C2HA 4NGAH 3E8LA 1GBHA 1WV7H 4FUHA 4H4FA 3PO1C 1P12E 1GG6C 4ZCNA 3Q76A 2ZWLH 3TK6A 4YOJA 1BBRK 3AVZA 4INHA 1CSOE 3SNEA 2I6SA 4K2YA 1BIOA 1TMBH 1V2UT 1Z71A 2ZPRA 1AWHB 2YNAA 2FOGA 4F48B 1RJXB 3A7WA 1GL1A 1OWHA 2H5DA 1Y3VA 4IW4E 1GHXH 1E0FD 1CU1A 1HRTH 1QZ8A 1JBUH 3GCTG 3LJJA 3RU4T 4TWYA 1HAVA 3WW7A 1FUJA 1MBMA 2G55A 1WTHD 4B76A 1E36B 1VJ9U 1ESTA 3UNRA 1YLNA 2BDBA 4UONA 4HG6A 3KQ5A 3M7TA 1V2MT 2R2WU 3KEEA 4AB9A 1P11E 1BRCE 1SOTA 1HPGA 1TGCA 1W13U 2HVYB 2PTNA 2ZDLA 1AKSB 1YPEH 3DFJA 4BTIB 8GCHF 5JPMH 4X6MA 1LVMA 1FY8E 1A0LA 1BTZA 1COWD 4UD9H 3Q77A 1AZZA 1L4DA 2GT7A 1DXPA 3RXBA 1D3DB 1DXWA 1PJPA 1C5MD 1O2LA 1D4PB 2ZC9H 1AVXA 1LHDH 3FAOA 5L6NH 1EB2A 2BVRH 4TSFD 1SR5C 5JYIA 3A7VA 4AN7A 2Z6BD 5C3NA 2OC1A 1FY4A 1HB0B 5LPRA 1C5WB 5L30H 5FHTA 1TBQH 3QN7A 1A5HA 3UFAA 3LKWA 5EODA 1E1RD 2ZHDA 3K65B 1Y5BT 1HUTH 2Z3CA 3GDSA 1DWCH 3LOXA 1O3CA 5DP4A 1TMTH 1QNJA 2P59A 4P00A 4R0IA 4B6EA 3LIWA 3RXRA 1RXPA 2C4FH 2PGQB 1JRTA 3L33A 2QIQA 3ZZ5A 5GCHF 3URCA 6ESTA 2KCAA 1KXFA 3SU6A 2WSSD 2WUCA 3BEUA 1OHHD 4CREA 4DVAU 3H7OA 2VVUA 1O30A 1LPZB 3H7TA 1SGCA 2FZZA 1GMCG 2P95A 4Z1MD 2QC2A 1HAGE 1Y5AT 1H9HE 1UK2A 1WQSA 3K9XB 1DWDH 1V2JT 4OM9A 1J17T 3U1JB 2JH0D 4X2WA 2XC5A 1TMUH 2AYWA 1O3LA 2Z9LA 1GGDC 5C94A 1EPTC 3TNSA 1C5ZB 3UQVA 2HLCA 1D6RA 2RDLA 2BY8X 3PWCA 2O9QA 4B75A 1TNKA 5PTPA 4AGKA 2AGGX 4O03A 1TONA 2AEIH 4K8BA 2QF0A 2FOBA 4A1VA 1DVAH 3SOSA 3HKIB 1NS3A 1TOCB 1V3XA 4NFFA 3A80A 3MYWA 2WPIS 2VWMA 3LH3A 1ANEA 1GBDA 1SFIA 2LELA 3QX5H 3R0FA 2UWLA 2C8ZB 4YLQH 4E06H 2QXJA 1MABB 1S6FA 3RM2H 3TH3H 3TVJB 1YPHE 2XWAA 3VEQB 3GY3A 1JIMA 2VWOA 1AUJA 4DIHH 1C2GA 1A3EH 1WTGH 1XXFA 3LJOA 3SU1A 1V2TT 4U01A 2PUXB 3A84A 1ZOMA 4AYVB 1GBEA 1KY9A 2PR3A 1SFQB 5E0GA 1AMHA 3VB4A 4ZMAH 4JCNA 3RMOH 2BLWA 1F0UA 1AFQC 1HCGA 1INCA 1QB6A 2VH6A 2K0QA 1SGQE 1NN6A 1W0ZU 5C20A 1SBWA 1HJ9A 1C5OH 2SFAA 1P0SH 3GCHB 3QGNB 1O3AA 2WHXA 3A81A 1MTSA 4WMFA 3ZVAA 1YCPM 2BQ7B 1C5VA 2Q1JA 4IN1A 1TGNA 2WPHS 5DP6A 4AZ2B 2B9LA 5LGOA 1QR3E 3GY2A 1Z8GA 2Y82A 1TBRH 3GYMA 3HATH 2ANMH 1D3QB 1T31A 2F9NA 1GI7B 1BZXE 3UUZA 1O33A 1PPHE 4BNRA 2RG3A 4YOIA 1CHOF 3QZQA 1TGSZ 1TRNA 3HK6B 1TYNA 3TNTA 4Y71A 1IOEA 2FOCA 3LGTA 4NFEA 3TJUA 1GBTA 1HAYB 1O5DH 3SO3A 1CBWB 2XNDD 3UOPA 1AB9B 1WDIA 2O8TA 5E8EH 3LGVA 1WU1A 2GDDA 2UWPA 3K6YA 1YWUA 3BTEE 1GI6A 1Y3YA 5C2ZA 2OP9A 1E79D 1GBBA 3TK5A 1G9IE 1QURH 1XKAC 2GMTC 3S0NA 4MQAA 1HNEE 1SQRA 3P8FA 5HGGA 3BTQE 4M9FA 2V0BA 3RXOA 2FEQH 1AE8H 1ZMNA 3FZZA 3SNCA 2BXTH 1CE5A 3AW1A 1JRSA 2SNVA 1NRSH 1IQHA 1TX7A 3A7XA 1SGYE 4A7IB 1HBTH 5FBEA 1F5LA 2A45B 5K7RA 1KTTB 1BTXA 3MU4A 4U30A 1KLJH 3CS7A 5TJXA 2P16A 1QQ4A 3S7HB 4UEHH 4X8SH 1BMNH 1LQDB 3A8DA 5T3HA 3UQOA 3ZV8A 5K0HA 4HZHA 3SNBA 1TOMH 3SUDA 1ZSKA 1TGTA 1BQYA 2Y80A 4GHQA 1S0RA 3F3BA 4DIIH 3BTWE 3ELAH 4HGCA 3NXPA 1QJ6B 6LPRA 1XXDA 3BEFB 4A1TA 2PUQH 1O5EH 1QRXA 3SGAE 3T29A 2XBYA 1KMHB 1K1NA 1PYTC 4FUEA 1FONA 4Q7ZA 1DX5M 1ZPBA 3F0OA 1KDQA 1NFUA 2ZFSA 1O3EA 1K1PA 3DUXH 2A4OA 5DP9A 5KEDA 3FVFB 1ZHRA 2AIPA 3T2NA 2ALVA 2TGAA 1LVYA 3ATWA 4I33A 1P06A 1GBMA 1UVTH 1D6WA 3LPRA 1UHBB 1C5XB 1SOZA 1GMCF 2W5EA 4Q80A 2PKSB 4H42U 2BB4A 2C3SA 3V3MA 1DS2E 1Y59T 1WBGB 4AG2A 1K21H 4MPVA 1MTWA 3AK5A 1JMOH 2BYAX 2HOBA 2R0LA 3QTOH 4HFPB 1C1RA 8GCHG 1C4U2 1GWAA 2XWBI 1IQLA 1A0HB 3ZVFA 4BANB 4K1SA 3FKSD 3GCOA 4U32A 2FDAA 1F0RA 1V2VT 3FP6E 1BCUH 2FI3E 4M7GA 1HXEH 3UREA 1W12U 3PO1B 1CGIE 1TNGA 1TPAE 2DE9A 1TLDA 4YO9A 1C2JA 1SGIB 2BQ6B 4MVNA 4X1QU 2G4TA 2ZTZA 1S83A 1H8HD 7KMEH 1FNIA 2KFWA 2F9OA 3FFGA 4CRFA 3LC3A 1D3PB 1HJAC 4BAKB 2W3KA 3CS0A 3D62A 5CHBA 3SHAH 1DY9A 3MTYA 3ZVGA 3STIA 1UVUH 1V2OT 4QT8C 3PB1E 3OSYA 2P3TB 3MH4A 1ZZZA 1EOLA 2OK5A 4PROA 1LPGB 3U8RH 1A46H 1Y3XA 2FOMB 3TH2H 2FO9A 2ULLA 3E91A 1WYKA 3SV9A 1O31A 3T25A 3ATKA 2OUAA 2R3YA 3DSOA 3S9BA 1XUIA 1GBKA 2ZDVH 3OE7D 3PYHA 2FYRA 3ZZDA 2IOTA 4F55A 2AGIX 2FESH 3RM0H 1C1MA 3OY5U 2AFQB 4JZEH 1BT7A 1UJ1A 2O8LA 4YT7H 2ZGCA 1HAVB 5J4SA 1O3PB 4I8GA 3MNCA 3KQEA 3P70B 2Y5FA 1V2QT 5C0UA 2EA3A 2ODQA 5F53A 1D9IA 2NU4E 1W3CA 2F4LA 2VNTA 4MPUA 2BVSH 1ELEE 3UR6A 2WYGA 3MNXA 2GGVB 3UWIA 1HIAA 3A7YA 4ZKOU 1OXGA 4ZHLU 1GJ6A 2ZF0H 1C1QA 4OS1A 1GBLA 2WYJA 1QIXB 1WQVH 1A3BH 1O2RA 1SQAA 4BOHA 1GHAF 2A5AA 2JETC 1GBAA 2PSYA 3N7DA 4ZXXH 2FWWA 4KTCA 3P95A 3M36A 1ABIH 1RIWC 1YYY1 2ZGHA 5FPYA 4CR5A 1BMFD 4RKJB 4K69A 1C9TA 2ZI2H 1GL0E 1GBCA 2J97A 5HXFA 1C5NH 1GI1A 1P2KA 1PPZA 2BY7X 1QY6A 2BOHB 3NK8A 1UMAH 4DOQA 2F9VA 3NPSA 3E0NB 5C1UA 3EA9A 2HNTE 1H8ED 3Q00A 5KECA 1KXCA 5GDSH 1A5GH 1AWFH 5HM2A 2NU3E 3QLPH 4LZ4B 4U2WA 1H1BA 3WWFA 1J16A 1MTNB 1GI9B 1P9UA 2HALA 1O2KA 2BHGA 3ATLA 1OP0A 2ZFTA 4E7NA 4TPIZ 2OQUA 2V3MA 3QDZB 2ZU1A 3AW0A 4Q7XA 1O32A 1OP2A 4FUCA 2W7UA 4NA8A 1ZMLA 3ODFA 1HV7A 2ZU3A 1C2MA 1MQ6A 1MTVA 1J8AA 1L0ZA 2ZIQH 3EYDA 1SGDE 1D3TB 3E3TA 5GWZA 2BD4A 1WXRA 2TIOA 1YM0A 2ZQ2A 3SYJA 4KP0A 3PMAB 1ELGA 1T8LA 3MH5A 3SQHE 2A32A 3MOCA 1MKWK 4IMZA 3CNRA 1VGCC 1DWEH 3RMNH 7ESTE 1P05A 2VIWA 2WV9A 1J15A 1O2OA 2ZO3H 1MH0A 4NIYA 1ANBA 3M37A 2F83A 1VCPA 4CH8B 2PW8H 3BTKE 1O5BB 4O97A 2VU8E 4DT7B 3HKJB 1SG8B 3T5FH 2IN2A 3SUFA 1YF4A 2JETB 4WH6A 4J2YB 3UR9A 1OYQA 3PV5A 1O3OA 3BIVH 1OYTH 1XUHA 3I77A 3T26A 3NUMA 2C8XB 3GCHC 4GHTA 2BZ6H 3GY8A 1QHRB 2ESTE 1EP5A 2CHAB 1XVOA 2QF3A 2ZECA 3KNXA 1HDTH 1QGFA 2OC7A 3FN8A 3MO6A 3F1SB 2ANKH 1ANDA 4ACBA 3GY6A 5DSFA 2Y7ZA 4INLA 2VIDA 1BUIA 2WPJS 3FZDA 3LH1A 5CHAC 2A4QA 3S9AA 2P8OB 3A8AA 3ZYDA 1P9SA 1S85A 2ZGJA 1O3IA 4TY6A 1O2JA 4ZHMU 2H9EH 3QZRA 3SU0A 7GCHF 3RUOA 3PLKA 1P3EA 1O34A 3LC5A 1SGEE 1EAIA 5F03A 1G30B 1UTKA 2LP6A 1MD8A 3MU1A 4AX9H 1HFDA 2A7JA 3EE0B 1J14A 3SJ9A 2TBSA 1VGCB 1ESBA 1TA2A 3A82A 1C1NA 3M5OA 4Y0YE 4YM9A 1DICA 1GVLA 1MZDA 1UCYE 1XUFA 1YPHC 4CHAB 5BRRE 1FPHH 1F0TA 1V2WT 1C1WH 2XBVA 4NZQA 2QXHA 1FJSA 4CBNA 4FVDA 1WCZA 1Z6JH 4ZKNU 1YPLH 4XBCA 4ABFA 2ZHWH 5A8YA 1EJNA 1AI8H 1KXAA 5HYOA 1O3JA 1DANH 1ZTLA 5C5OA 2UUFB 1O5FH 5F8XA 1Y3UA 4FETA 4YTAA 1OWIA 3M7QA 1BTYA 1EJAA 2DE8A 5JBTA 1AFQB 5DP5A 3O8DA 1G2MA 2JDID 3N99A 2B8OH 2XOKD 3MQKC 5FPTA 2RFKC 3D23A 1QJ7B 2ZHFH 3MI4A 3MH6A 1O39A 3DSGA 5JB9S 2STAE 1MU6B 1QL8A 4FUDA 2OBQA 4UFFH 4B71A 4X0WU 4XE4A 3F0PA 1JOUB 2NWNA 5E2OA 4KKDA 4O3UA 1C5QA 4ABHA 3RXEA 3TIUA 1UTQA 3RLWH 3P8OA 1PYTD 3LGYA 1P8VC 2BDAA 2HVXA 2KCPA 3A89A 3DA9B 1QTFA 4JMYA 3SZEA 1A5IA 3MO9A 2QA9E 4XBBA 1GMDG 1LHEH 1NRRH 1Z7KA 2XW9A 4YZUA 1AFEH 2CXVA 2FTMA 2H1UA 1O3FA 2FX6A 1RRKA 1GMDF 1O3GA 2V3HH 2RCEA 2XRCA 3EA7A 2ZTYA 1K22H 6GCHF 1CT2E 3S7KB 3EQ0H 4ABDA 2A2QH 1GI2A 4AFUA 4DG4A 4ZXYH 1QBNA 2GZ7A 3L3TA 5JBCS 2ZNKH 1LHCH 1HLTH 1P2IA 9LPRA 1C2EA 5FL7D 2SNWA 3F9HA 5EOKA 1GI4A 4DGJA 3BF6H 2GVFA 2VIVA 3ZZ8A 1EB1H 2G5NA 4X8UH 4ZKSU 1DWBH 1AGJA 1UCYH 2OINA 3ZVEA 1GGDB 2TGTA 3RXVA 1K1LA 3HGPA 1PQ7A 4WY3A 1DY8A 4WF8A 1O5CB 1C2LA 1GJ4H 4X6NA 4WH8A 2GCTC 5DG6A 2P3FH 5L2ZH 1UVPA 3SJKA 1KXDA 5JDUB 1HJAB 1NBMD 2HGTH 5C0TA 1DUEA 4VGCB 1SPJA 3RXPA 1A2CH 1QB1A 5JBBS 3RXSA 4JYUH 1GDUA 1EKBB 4KTUA 3UNSA 1EPTB 2Q6GA 5AHGH 2GCHF 4K3JA 2FMJA 2I6QA 3A8CA 1W0KD 2CN0H 1W2KH 3B8JA 1QQUA 1UO6A 3F2GA 1YCPK 4NIVA 1TAWA 4KGAA 2GTBA 2FS9A 4ABBA 1OS8A 4IN2A 1FMGA 1Q2WA 1CVWH 2B7DH 1JWTA 4Y0ZE 1AY6H 2J38A 1BTUA 4B2BA 1KLTA 3LDXH 1GI8B 3VG8A 2D1JA 2M5TA 3B9FH 3KQBA 3EAJA 1BTPA 4FU8A 3V7TA 2AH4X 5C17A 3TGJE 2QY0B 2Z9GA 4UE7H 1GHYH 5F8TA 5ESBA 4AGJA 4ZH8A 3VB6A 2XCFA 4RSPA 3MU5A 3OY6U 1GMHG 1T4VH 2BD5A 2SGQE 1Z8JB 1XUGA 1EOJA 3QO6A 3KQDA 5A8XA 1C4Y2 1RGQA 1HIAB 5F6MA 2CF8H 2BX4A 1AD8H 1TBZH 3UOUA 1FY5A 1IQGA 2STBE 5HMAA 4MNXA 1QRWA 2Z9JA 1LHGH 2BMGB 3SV7A 1XKBC 1YCPH 3SQEE 5EW1H 1L1NA 3M61U 5DPAA 2C8WB 3FANA 5GPIB 4IMQA 1SC8U 1FAXA 2ZTXA 2H2ZA 3A8BA 3RXAA 5HIZA 1KSNA 1QFKH 2VWNA 1VR1H 2YMSD 1NROH 3T27A 5FBIA 1C2IA 1TPPA 1XVMA 4YESB 2WV5A 2GX4A 2XC4A 1FDPA 2Y6TA 5EG4A 1NTPA 4NG9H 1GJ5H 4AG1A 1GCTB 4ABIA 2A5IA 1VITH 1DITH 3KYGA 1AE5A 2VIPA 1F2SE 1P03A 2A1DB 3K6ZA 4Y79A 1K1MA 3GY4A 1SLVB 2TGDA 1K1IA 2QXIA 5EXLA 1BMAA 3KF2A 1A1RA 4X1RU 3U9AH 3AAVA 4TYDA 1B7XB 3DCLA 4ABGA 4MNYA 3MNBA 1RTKA 1C1VH 1GJBB 2QN5T 5HKKD 4E05H 4GPGA 4AFZA 3OU0A 1MBQA 1THSH 1X7AC 2BTCE 3ENSB 3ZZ4A 1TNIA 4JK5A 2AMPA 1QA0A 1MUEB 4HI3A 3GISB 3RLYH 4YXWD 3UAIC 2ZU4A 1NESE 4MLFB 7LPRA 1FPCH 1S5SA 2EI6A 1EFRD 1GPZA 2QYIA 1C5UA 2FLRH 4NA7A 1E34B 3EE7A 1BTWA 1YGCH 3K2UA 3RXTA 3QK1A 4NCYA 1RTLA 1NO9H 3BG4B 3GDUA 4OGXA 1VKYA 3RU4D 3LT3A 1N1LA 1O36A 3MWIU 1NRQH 4FUJA 2UUJB 1C9PA 2F9UA 1A0JA 1ZYOA 4X6PA 1CHOG 3PLBA 4WXVA 2ZFFH 3A88A 1ZJKA 1GBIA 4P02A 1GHAG 1MTUA 2WPKS 5I46H 1P2JA 1G2LA 2VH0A 3TK9A 1FIZA 4I8JA 3ESTA 2BD7A 1O37A 1SLWB 3PV4A 1ZRKA 1YBWA 1C5TA 5AVDA 5A8ZA 1BHXB 4NIXA 1W8BH 1TABE 2W7SA 1ELTA 2CK3D 4VGCC 7GCHG 4LOYH 1DM4B 1QCPA 1DOJA 4FU9A 5GJ4B 1UCYK 4JZIA 1BB0B 1ZPCA 1GHVH 2BLVA 3FP8E 1GHBF 4FUFA 3RXQA 4GLYA 3Q3XA 2QXGA 2RDEA 1H8DH 4NWKA 3GY5A 3A86A 2P94A 1CA8B 1AN1E 1IAUA 3MU0A 1W11U 1C1PA 2FOAA 5HIYA 4BAOB 1NT1A 2BDHA 1CBWC 5AFZH 1SHHB 3QTVH 2Q6DA 2ZU5A 2ILNA 1AVGH 1KTSB 2PSXA 2Y81A 3RXDA 2CMYA 4XD7D 5LH8A 2JJ2D 1DLEA 2K8IA 2J9NA 2V7QD 1KXBA 2XCNA 2OXSA 1SLUB 3PTBA 1V6DA 5ESTE 1CT0E 5AFYH 3MH7A 4MG3A 1YPJH 2OCVB 2ZGXH 1FN8A 1EJMA 3GICB 2GP9B 4E7RG 3RXMA 4I86A 1G37A 2F9BH 1MMJN 2BY9X 4XDEA 1BRUP 2OBOA 4WMEA 5C67A 1YP9A 1TNHA 1EZQA 3SUEA 1O0DH 1SVPA 2AIQA 2QV1A 2RA0A 1V2LT 1TE0A 2PGBB 1VZQH 4MNWA 1SB1H 1G3CA 3MHWU 2H5CA 1C5SA 1O3NA 1Z8RA 1SGPE 4BXWA 1CHGA 2O8WA 2J2UA 4JZ1A 2VINA 2JH6D 4TT3D 1FXYA 2GJGA 4B73A 3SNDA 2GZ8A 4H6SB 1O2WA 2O8UA 1NM6A 2SGPE 4A5TS 1O3BA 4IS5A 1XUJA 3F9EA 2EI7A 1NFXA 4I32A 1C2DA 1LCYA 5FAHA 1IQKA 1PFXC 3SJIA 1SGFG 2FOFA 1RS0A 3GYLB 1BOQA 5BPEA 1BITA 1IQNA 3B23B 4IC5A 1G3BA 1IQIA 1OWEA 3BTME 4ABEA 4ISLA 1Z8IB 3NCLA 1UK3A 1V2RT 1SL3A 4FOUC 4B6FA 3LGIA 2OD3B 1ZSLA 2ZDAH 9ESTA 4UFGH 2F43B 3GS9A 2FYQA 3O8BA 1AZ8A 1PPCE 2J4IA 1O3MA 2F3CE 4I8HA 5DKMA 3SU2A 4NA9H 1EXFA 2PHBA 3HPTB 2LPRA 4ISIH 5T6DA 3I78A 1E1QD 4F4OC 4CR9A 1HGTH 4BTUB 1UK4A 2A7CA 3SU4A 1EAXA 1Q31A 2BD2A 2SGEE 2VVVA 3FO8D 4GUXA 1QBOA 1W0YH 2PFEA 1RIWB 2CF9H 2RA3A 1P09A 3RC5A 1AUTC 1H4WA 1W7GH 5A0BA 4B74A 1BTHH 2ODPA 4ZHAA 5DP3A 2BM2A 3SGBE 1UVOA 2XBWA 4MTBA 1O2IA 2ZEBA 1LVOA 3OTJE 1CGHA 1DT2A 1TB6H 2F9PA 2FOEA 3RXGA 2QE7D 1QRZA 2BY6X 3DT0H 2KX4A 3GOVB 3D65E 1AVWA 1QA7A 3SW2B 2ZFPH 2W3IA 1N6XA 2HPQH 3A7ZA 1ZTKA 4WJG2 3V13A 2G52A 1P01A 5EJ1A 3V12A 3E0PB 3KGPA 3PTNA 4Y7BA 3PRBA 3P6ZB 2ZG0H 3JZ1B 4X1NU 2XYAA 4BXSA 2YOLA 3BEIB 4LXBH 1O2NA 1F7ZA 1BBRE 2Z9KA 1AB9C 3SN8A 1RFNA 1ELCA 1O2TA 4DW2U 3KYFA 1EUFA 2H6MA 2FI4E 1DLKB 2ZCHP 1C4V2 1C5YB 1F5RA 3SJ8A 3UWJH 3PRDA 3PM3A 2HLDD 2XC0A 2IJD1 1N8OC 2G81E 2PKAB 3BTGE 1O35A 1TQ0B 3RXFA 1BDAA 3C1KA 4A92A 6GCHG 4I7YH 2FOHA 2WPMS 5EPYA 4RI0A 5DO4H 1EATA 1NZQH 3MMGA 1HAPH 1ETSH 1L1GA 4I8LA 1DFPA 1TFXA 1PPFE 1W0JD 2NU0E 1UTOA 1G3DA 2Z3DA 3VB3A 5G4BA 1MKXH 4KTSA 5ABWA 3LGWA 3M5NA 5CHAB 2KAIB 2H9TH 1GBFA 4WMDA 3RXLA 2OC8A 2BDGA 1O2UA 1CGJE 2GZ9A 2KM0A 3E90B 1HAZB 1DSUA 4K1EA 2BY5X 3ZV9A 4DT4A 5DJ7A 2Z7FE 5A2MH 1MKWH 1GI5A 3F2HA 3ATMA 1QJ1B 5DGJA 5T6GA 4YOGA 3PROA 3TPIZ 2CV3A 3VB7A 4CRAA 2ZQ1A 3PLPA 3DFLA 2R0KA 3O8CA 3BTTE 5J4QA 1YPGH 4AOQA 2YMSC 1Y8TA 1TQ7B 3RMLH 4OS4A 3PMHB 2PKAA 4ISNA 1UTJA 2P8OC 3OYPA 1BRAA 1TALA 1S82A 3VXEH 2W6JD 1YLCA 1GJDB 1HJ8A 2PKSC 2WINI 3M7UA 2OC0A 4XOJA 3W95A 4GCHG 3SBKA 1S0QA 3SJOA 3C27B 1GDQA 4K5ZA 2KAIA 3Q3KA 1G3EA 5F8ZA 1HAHH 1V2ST 3U8TH 1NFYA 1J9CH 2VIOA 5EJZA 2XBXA 3PMJA 1BA8B 4FXGH 1QBVH 5EQRA 2PLXA 1PQAA 1O2YA 5EJLA 5FCRA 5A0CA 1C1OA 1VCWA 3Q3YA 1ZLRA 2ZCLP 5GCHG 1ARBA 3EDXB 2ZA5A 1BMMH 4ZKRU 1UTMA 1SGFA 4SGAE 2HPPH 1E38B 2AERH 4CRGA 2KZ4A 1W10U 1ELFA 4Y11E 3V0XA 2AGEX 3VPKA 3ZZ7A 1YPKH 3LONA 8ESTE 2AMQA 1H8IH 1SQOA 1V2KT 2OTVA 3BSQA 1O38A 2VBCA 3MO3A 1JXPA 3VB5A 1ETTH 2ZCKP 3VGCC 1GJAB 1E35B 1TGBA 4D76A 3LU9B 1FN6A 5ETXA 2NU2E 1PQ5A 1O2ZA 3SNAA 3RXHA 1ELVA 1F5KU 4NZLA 1FI8A 4TPYA 1NRPH 2EI8A 1S81A 5TCCA 4D7GA 5JBAS 1H9LB 2C8YB 2BDYA 3QGJA 1NU9A 5EXNA 1OKXA 1TNLA 2G5VA 2FP7B 1AHTH 3D49H 1NC6A 2IPHA 4UFDH 4AFQA 2ZKSA 1FIWA 4F49A 5E0JA 4BAMB 1HYLA 2AHME 3TGIE 1TPOA 2K1QA 3S69A 3SV8A 4BTTB 2VWLA 1THRH 4ZAEA 5GNDA 1EZXC 1SKYE 4JYTA 1MCTA 1IHSH 2J94A 2Q6FA 1OOKB 1ORFA 3U69H 3RXCA 3M3VA 4Q63A 2GD4B 4AFSA 5T6FA 3VXFH 3U1IB 1P2MA 2ANWA 1KYNA 3N7EA 1IHTH 1S6LA 2A2XH 1SGTA
chains in the Genus database with same CATH topology
2BQWB 3SU3A 1SSXA 3SORA 4XBDA 2PTCE 4IBLH 3ATIA 1ZR0A 2W26A 5AF9H 2HNTF 5IDKA 2HWLB 2QAAA 2AMDA 1ELDE 1TRYA 1O3KA 2ODYB 1SGRE 4ABJA 1K1OA 1BJVA 1L4ZA 2FI5E 4OS6A 2SGFE 3IITA 4CHAC 3ODDA 3P92A 1KDQB 1WAYB 1TRMA 1O2GH 2WUBA 1LPKB 1W14U 2FLBH 3MNSA 4LK4A 1DDJA 4UDWH 3U8OH 3URDA 1MTNC 2UUKB 2XTTB 1MAXA 1F92A 3SHCH 2V6NA 3IWMA 5E2PA 5FX6A 5EQQA 2GT8A 1LKBA 3SI3H 4WWYA 2FPZA 4IGDA 4FU7A 1GVZA 5JB8S 3KCGH 2V35A 1WUNH 3ZZ3A 1T4UH 1PPBH 2H9HA 1HAIH 3ZYEA 1ZRBA 1FQ3A 4LZ1H 4AYYB 4A6LA 3WY8A 5EW2H 1BJUA 1S6HA 2CGAA 1TX8A 3SU5A 2TPIZ 3SV6A 2Z9IA 2IJOB 3UY9A 1O2PA 2B0FA 2ZFRH 2ZPQA 3RP2A 3VFEA 2PV9B 3F6UH 2D2DA 2VB0A 1CQQA 1GVKB 1LDTT 1F0SA 1LVBA 1FZZA 5H4IB 2ZU2A 3TJNA 3T28A 4ZUHA 3P17H 2CJIA 4X6OA 4KELA 3NKKA 1BBRH 1NY22 1AO5A 1ZJDA 3UTUH 5CMXH 2VIQA 1S84A 4RN6A 4Y6DA 2ZDKA 1EAUA 4TWWA 3KIDU 1AQ7A 1T8NA 1H9IE 4ZROA 2ANYA 2OQ5A 1MD7A 1UVSH 2BX3A 1YLDA 3BG8A 1L1JA 5B6OA 1N6YA 4K1TA 1OP8A 1UTPA 1M9UA 2DUCA 2G4UA 1P02A 2R2MB 1FY1A 4X8VH 2ZHEH 3QWCH 4B2CA 1P2OA 1C1UH 4JZFH 2BD9A 3IG6B 2ZDMA 1CA0B 1O2VA 3ZVDA 1GHZA 1KLIH 4OS2A 3SGQE 4OGYA 3T62A 2GDEH 1P04A 1B0FA 1OWJA 4X2XA 1BRBE 2A0QB 1ESAA 3SV2H 1OSSA 1FY3A 1GBJA 3F9FA 1MQ5A 3ZZCA 4D9QA 8KME2 1Y5UT 2G8TA 4Y76A 5DP7A 1TIOA 2J92A 4D8NA 2JKHA 1ZGIA 5E0HA 3KL6A 2BOKA 2HRVA 2G00A 2GCHG 1YC0A 1LMWB 1PPEE 2PWXA 3JZ2B 4X8TH 1GMHF 3E16B 1GCTC 1MU8B 5A0AE 6CHAB 1A4WH 3GCTF 4TY7A 4AORA 3RXIA 1FAKH 4ISHH 3R3GB 4Y8XA 1LHFH 3P8NA 2YNBA 4D9RA 1NPMA 1CT4E 1BMLA 3BIUH 1GJ9B 5LPFA 1C1SA 4X2YA 1B0EA 1OWKA 4YT6H 3DHKH 1EX3A 1ZSJA 3A87A 1B5GH 1FLEE 1ZHMA 1MAYA 3E1XB 4JK6A 3H5CB 4NSVA 2C90B 1Z1JA 1EQ9A 4I8KA 1LO6A 1QL7A 4MNVA 1K2I1 5EU8A 3S9CA 3AASA 4JZDH 4CRDA 8LPRA 2Y5GA 1Q3XA 2R3UA 4DJZB 3PMBB 1XMNB 1EP6A 1IQEA 1NRNH 1HAXB 1TA6A 2AS9A 1CA0C 1SI5H 4K60A 3O8RA 3A83A 5FX5A 1C2FA 3HK3B 3NZIA 4O9VA 4OS7A 2ZZUH 5FPSA 5GIBA 1GDNA 1YKTA 1HXFH 3RXUA 3ZVBA 3SUGA 1LQEA 2QGRA 3BTFE 1LKAA 1OX1A 1Y3WA 5GXPA 1DUAA 2BLQA 2BXUH 1P10A 1SLXB 3RC4A 1MZAA 1TWXB 6CHAC 3NWUA 1DSTA 1SHYA 1W7XH 1WOFA 5EXMA 1SGNE 4XFQA 2GMTB 1TX6A 3ZZ6A 3MFJA 3QUMP 2FXRA 1P2QA 1LTOA 1U6QA 1K28D 3L6PA 3FP7E 2VVCA 3ITIA 4MDSA 1ID5H 1JIRA 5TCAA 4Q2KA 3TITA 5A09A 2ZP0H 1ZTJA 4ABAA 1SQTA 5EQSA 1DE7H 1ZMJA 1T7CA 3CENA 5L2YH 5HM9A 3BN9A 3TJVA 1Z6EA 2R9PA 1HAOH 1AIXH 1ABJH 3BV9B 5DP8A 1PPGE 1EAWA 1GI0A 3F9GA 4Y8ZA 3KHVA 1KIGH 3U98H 2A4GA 3M3SA 4JYVH 3HGNA 2BD8A 2SGAA 2A7HA 1O2HA 4GVUA 2WPLS 3MU8A 2SGDE 2GKVE 1OPHB 2B5TB 2D8WA 2VJ1A 4WXIA 2Y7XA 3UNQA 1WSSH 1GCDA 1RD3B 3M5LA 3SI4H 1FV9A 2TRMA 2ZFQH 3GDVA 1ACBE 1ZGVA 4INKA 3RXJA 3RDZA 2FIRH 4B2AA 2BLOA 1T32A 3KQCA 1IQJA 2BDIA 3BTHE 3VGCB 1DPOA 2BD3A 2BDCA 4Z6AH 2WV4A 2Z3EA 4ISOA 1ELBA 1VITG 1ZHPA 3EA8A 1NFWA 5DK1A 2J34A 3SZNA 1O2MA 5C1YA 1P2NA 2D26C 1C5RA 4XSKU 1V2NT 4K8YA 4CRCA 1GHBG 1GJ8B 1IQFA 4Z0KA 1G32B 2GV7A 4MPXA 1THPB 1EZSC 4AB8A 1MCVA 4ESTE 4X1PU 4NWLA 3RMMH 3ZZBA 1NU7B 4Y10E 1VCQA 1C5PA 1O2SA 1O2QA 2C93B 2FODA 4DCDA 2VGCC 4GSOA 2Z94A 1O3HA 4NIWA 2BVXH 3F68H 4SGBE 4X2VA 1L2EA 1ARCA 3M5MA 5CE1A 3AAUA 4MPWA 2ZPSA 4NSYA 1MKXK 2ZDNA 5EPNA 4HTCH 1K9OE 2O8MA 4OS5A 1P3CA 2F91A 5IYTA 4FUGA 1C1TA 5SGAE 1VITF 3RC6A 1ELAA 3OX7U 1ANCA 3GY7A 4GCHF 1A61H 1XX9A 4O3TA 3TJOA 1EZUC 2ZGBH 1QL9A 5LPEA 3TGKE 1K1JA 2NU1E 3W94A 1AU8A 1EASA 3M3TA 1SMFE 4FVBA 2FM2A 1V2PT 1GJ7B 1CO7E 3I29A 1IQMA 3LGUA 1GG6B 1KXEA 1XUKA 2QCYA 4RKOB 4CRBA 1Z1IA 1T8MA 2P3UB 4IC6A 2HNTC 1O5AB 2J95A 4DURA 2THFB 4FUBA 4BAHB 2BZAA 3N7OA 3UPEA 2G51A 3DD2H 5EGMA 1C5LH 1RTFB 2A4RA 2ZHQH 2P93A 2XNIA 2UWOA 1E37B 1EPTA 4R8TB 1GHWH 2Y5HA 4DY7B 3EGKH 3KN2A 3ZZ9A 3P8GA 2CHAC 4I31A 3RU4E 1PQ8A 2XXLA 4A1XA 5FXLA 1A7SA 4GAWA 2A5KA 4Y7AA 3TU7H 1TNJA 2LNCA 2GV6A 3STJA 1ZPZA 3CP7A 4THNH 3A85A 4Y8YA 2EC9H 5C5NA 3ZVCA 1UHBA 1OWDA 2UUYA 3ZZAA 1UTNA 3E6PH 1N8OB 2JH5D 2VGCB 5C1XA 2A31A 1P57B 3G01A 4YLUA 4B1TA 1YPMH 2EEKA 1TPSA 1GI3A 2ASUB 1O2XA 4WVPE 3TH4H 1G36A 2FS8A 1GJCB 4X1SU 5FCKA 4Q7YA 4CH2B 3TLOA 5I25A 4BAQB 1ETRH 1XM1A 1VJAU 3PWBA 3M35A 4H6TA 2TGPZ 4D7FA 1T8OA 2OLGA 1C2KA 4CBOA 4UFEH 3BG4C 2ALPA 1QB9A 3A7TA 1O5GH 1AKSA 4J1YA 4ASHA 2V3OH 3BTDE 4FUIA 3UIRA 3RXKA 1BHXF 1O3DA 1UTLM 2FX4A 2FTLE 2GCTB 3GCNA 1C2HA 4NGAH 3E8LA 1GBHA 1WV7H 4FUHA 4H4FA 3PO1C 1P12E 1GG6C 3Q76A 2ZWLH 3TK6A 4YOJA 1BBRK 3AVZA 4INHA 1CSOE 3SNEA 2I6SA 4K2YA 1BIOA 1TMBH 1V2UT 1Z71A 2ZPRA 1AWHB 2YNAA 2FOGA 1RJXB 3A7WA 1GL1A 1OWHA 2H5DA 1Y3VA 4IW4E 1GHXH 1E0FD 1CU1A 1HRTH 1JBUH 3GCTG 3LJJA 3RU4T 4TWYA 1HAVA 1FUJA 1MBMA 2G55A 1WTHD 4B76A 1E36B 1VJ9U 1ESTA 3UNRA 2BDBA 4UONA 3M7TA 1V2MT 2R2WU 3KEEA 4AB9A 1P11E 1BRCE 1SOTA 1HPGA 1TGCA 1W13U 2PTNA 2ZDLA 1AKSB 1YPEH 3DFJA 4BTIB 8GCHF 5JPMH 4X6MA 1LVMA 1FY8E 1A0LA 1BTZA 4UD9H 3Q77A 1AZZA 1L4DA 2GT7A 1DXPA 3RXBA 1D3DB 1DXWA 1PJPA 1C5MD 1O2LA 1D4PB 2ZC9H 1AVXA 1LHDH 3FAOA 5L6NH 1EB2A 2BVRH 1SR5C 5JYIA 3A7VA 4AN7A 2Z6BD 5C3NA 2OC1A 1FY4A 1HB0B 5LPRA 1C5WB 5L30H 5FHTA 1TBQH 3QN7A 1A5HA 3UFAA 3LKWA 5EODA 3K65B 2ZHDA 1Y5BT 1HUTH 2Z3CA 3GDSA 1DWCH 3LOXA 1O3CA 5DP4A 1TMTH 1QNJA 2P59A 4R0IA 3LIWA 3RXRA 1RXPA 2C4FH 2PGQB 1JRTA 3L33A 2QIQA 3ZZ5A 5GCHF 3URCA 6ESTA 1KXFA 3SU6A 2WUCA 3BEUA 4CREA 4DVAU 3H7OA 2VVUA 1O30A 1LPZB 3H7TA 1SGCA 2FZZA 1GMCG 2P95A 2QC2A 1HAGE 1Y5AT 1H9HE 1UK2A 1WQSA 3K9XB 1DWDH 1V2JT 1J17T 3U1JB 2JH0D 4X2WA 2XC5A 1TMUH 2AYWA 1O3LA 2Z9LA 1GGDC 1EPTC 3TNSA 1C5ZB 3UQVA 2HLCA 1D6RA 2RDLA 2BY8X 3PWCA 2O9QA 4B75A 1TNKA 5PTPA 4AGKA 2AGGX 4O03A 1TONA 2AEIH 4K8BA 2QF0A 2FOBA 4A1VA 1DVAH 3SOSA 3HKIB 1NS3A 1TOCB 1V3XA 4NFFA 3A80A 3MYWA 2WPIS 2VWMA 3LH3A 1ANEA 1GBDA 1SFIA 3QX5H 3R0FA 2UWLA 2C8ZB 4YLQH 4E06H 2QXJA 1S6FA 3RM2H 3TH3H 3TVJB 1YPHE 2XWAA 3VEQB 3GY3A 1JIMA 2VWOA 1AUJA 4DIHH 1C2GA 1A3EH 1WTGH 1XXFA 3LJOA 3SU1A 1V2TT 4U01A 2PUXB 3A84A 1ZOMA 4AYVB 1GBEA 1KY9A 2PR3A 1SFQB 5E0GA 1AMHA 3VB4A 4ZMAH 4JCNA 3RMOH 2BLWA 1F0UA 1AFQC 1HCGA 1INCA 1QB6A 2VH6A 1SGQE 1NN6A 1W0ZU 5C20A 1SBWA 1HJ9A 1C5OH 2SFAA 1P0SH 3GCHB 3QGNB 1O3AA 3A81A 1MTSA 4WMFA 3ZVAA 1YCPM 2BQ7B 1C5VA 2Q1JA 4IN1A 1TGNA 2WPHS 5DP6A 4AZ2B 2B9LA 5LGOA 1QR3E 3GY2A 1Z8GA 2Y82A 1TBRH 3GYMA 3HATH 2ANMH 1D3QB 1T31A 2F9NA 1GI7B 1BZXE 3UUZA 1O33A 1PPHE 4BNRA 2RG3A 4YOIA 1CHOF 3QZQA 1TGSZ 1TRNA 3HK6B 1TYNA 3TNTA 4Y71A 1IOEA 2FOCA 3LGTA 4NFEA 3TJUA 1GBTA 1HAYB 1O5DH 3SO3A 1CBWB 3UOPA 1AB9B 2O8TA 5E8EH 3LGVA 1WU1A 2GDDA 2UWPA 3K6YA 3BTEE 1GI6A 1Y3YA 5C2ZA 2OP9A 1GBBA 3TK5A 1G9IE 1QURH 1XKAC 2GMTC 3S0NA 4MQAA 1HNEE 3P8FA 5HGGA 3BTQE 2V0BA 3RXOA 2FEQH 1AE8H 1ZMNA 3FZZA 3SNCA 2BXTH 1CE5A 3AW1A 1JRSA 2SNVA 1NRSH 1IQHA 1TX7A 3A7XA 1SGYE 4A7IB 1HBTH 5FBEA 1F5LA 2A45B 5K7RA 1KTTB 1BTXA 3MU4A 4U30A 1KLJH 3CS7A 5TJXA 2P16A 1QQ4A 3S7HB 4UEHH 4X8SH 1BMNH 1LQDB 3A8DA 5T3HA 3UQOA 3ZV8A 5K0HA 4HZHA 3SNBA 1TOMH 3SUDA 1ZSKA 1TGTA 1BQYA 2Y80A 4GHQA 1S0RA 4DIIH 3BTWE 3ELAH 4HGCA 3NXPA 1QJ6B 6LPRA 1XXDA 3BEFB 4A1TA 2PUQH 1O5EH 1QRXA 3SGAE 3T29A 2XBYA 1K1NA 1PYTC 4FUEA 1FONA 4Q7ZA 1DX5M 1ZPBA 1KDQA 1NFUA 2ZFSA 1O3EA 1K1PA 3DUXH 2A4OA 5DP9A 3FVFB 1ZHRA 2AIPA 3T2NA 2ALVA 2TGAA 1LVYA 3ATWA 4I33A 1P06A 1GBMA 1UVTH 1D6WA 3LPRA 1UHBB 1C5XB 1SOZA 1GMCF 2W5EA 4Q80A 2PKSB 4H42U 2BB4A 2C3SA 3V3MA 1DS2E 1Y59T 1WBGB 4AG2A 1K21H 4MPVA 1MTWA 1JMOH 2BYAX 2HOBA 2R0LA 3QTOH 4HFPB 1C1RA 8GCHG 1C4U2 1GWAA 2XWBI 1IQLA 1A0HB 3ZVFA 4BANB 4K1SA 3GCOA 4U32A 2FDAA 1F0RA 1V2VT 3FP6E 1BCUH 2FI3E 4M7GA 1HXEH 3UREA 1W12U 3PO1B 1CGIE 1TNGA 1TPAE 2DE9A 1TLDA 4YO9A 1C2JA 1SGIB 2BQ6B 4MVNA 4X1QU 2G4TA 2ZTZA 1S83A 7KMEH 1FNIA 2F9OA 3FFGA 4CRFA 3LC3A 1D3PB 1HJAC 4BAKB 2W3KA 3CS0A 3D62A 3SHAH 1DY9A 3MTYA 3ZVGA 3STIA 1UVUH 1V2OT 4QT8C 3PB1E 3OSYA 2P3TB 3MH4A 1ZZZA 1EOLA 4PROA 1LPGB 3U8RH 1A46H 1Y3XA 2FOMB 3TH2H 2FO9A 2ULLA 3E91A 1WYKA 3SV9A 1O31A 3T25A 3ATKA 2OUAA 2R3YA 3S9BA 1XUIA 1GBKA 2ZDVH 3PYHA 2FYRA 3ZZDA 2IOTA 2AGIX 2FESH 3RM0H 1C1MA 3OY5U 2AFQB 4JZEH 1BT7A 1UJ1A 2O8LA 4YT7H 2ZGCA 1HAVB 5J4SA 1O3PB 4I8GA 3MNCA 3KQEA 3P70B 2Y5FA 1V2QT 2EA3A 2ODQA 1D9IA 2NU4E 1W3CA 2VNTA 4MPUA 2BVSH 1ELEE 3UR6A 2WYGA 3MNXA 2GGVB 3UWIA 1HIAA 3A7YA 4ZKOU 1OXGA 4ZHLU