1AKSB

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
b'SSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA TRYPSIN
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
total genus 16
structure length 98
sequence length 98
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksB00
1GMDF 1GMHG 1BOQA 1L1JA 1VJAU 3VB4A 1ABIH 1GMCG 4BAMB 2TRMA 4B2CA 2VJ1A 4MPUA 2ZGJA 4H6TA 1HIAB 1GBDA 1RIWC 3FP8E 1HPGA 3MU8A 3K9XB 4FUHA 3UIRA 3LH3A 1O2PA 2CV3A 4ZHMU 2ZZUH 3HK6B 1V2JT 2GKVE 1O3CA 1C2GA 2VIWA 1N8OC 1GJ8B 2Y5GA 2O8WA 1SGNE 3KGPA 1KXEA 2DE8A 7ESTE 1RGQA 1O32A 1O3FA 2VU8E 1FY8E 5FX5A 4CREA 3FZDA 4BNRA 1O5FH 1QY6A 1GBJA 4JZEH 2AH4X 2D26C 1GHXH 2QYIA 2OQ5A 1J14A 4JCNA 3ZVCA 5JBTA 2ZHEH 1O2QA 1UVUH 1C5YB 4M7GA 2Y7XA 1TNLA 4E06H 1P3CA 1P10A 2ZO3H 1AIXH 2QXIA 3D23A 3W95A 4X2WA 1A5HA 2VNTA 1C5VA 2OQUA 2XBYA 3RXMA 3ZZ7A 4CRGA 2XBVA 4K2YA 3SV2H 4D7GA 1O2SA 2SGEE 1QA0A 2XYAA 1G32B 2XTTB 4OS5A 3M3TA 3TIUA 2NU2E 2W3IA 4NA9H 1UCYE 4UFEH 1QJ7B 1TRMA 4AN7A 2PFEA 2VIPA 1YPHC 1SGQE 1UTLM 1UHBA 1SGFG 3LIWA 3QX5H 2HGTH 2BVXH 3D49H 5T3HA 3ZVDA 1MMJN 2Z3CA 1FUJA 1QL9A 2CF8H 1AVGH 1DWCH 3DD2H 1ACBE 3MFJA 4HZHA 3TU7H 3ZZ4A 1P02A 3OY6U 4BTIB 1EZSC 1YKTA 5FPYA 1YF4A 2VVVA 2Y6TA 1C1WH 1ELTA 2HRVA 1QHRB 3PYHA 1CHGA 1NN6A 2WINI 3D65E 3JZ2B 2G81E 2H5CA 4FXGH 1GHBG 1KXCA 3A7TA 4MG3A 3E3TA 1BJVA 2PR3A 1XUJA 2F91A 1D3QB 2A5IA 1AN1E 3MI4A 1THSH 3BG4C 2WPMS 3ZZBA 1C5MD 4MVNA 4X6MA 3LONA 3I78A 1CHOF 1C5WB 4IGDA 3BIUH 4OGYA 2BD2A 1FV9A 2B8OH 2ZDLA 5ETXA 1NFXA 3T5FH 1NRPH 5HXFA 4ISLA 1V2TT 2ZPQA 1W3CA 2V0BA 5JDUB 1D6RA 3E6PH 5EXNA 1Y8TA 1GVZA 3EE0B 1HDTH 3ZV8A 1G36A 5DP7A 3CENA 3PMJA 2FODA 2OCVB 3KEEA 3KF2A 1DWEH 1O38A 1QJ6B 3KQDA 4X6PA 1V2OT 1W10U 1X7AC 1O3IA 1VJ9U 2CF9H 2BQ6B 3VGCB 3UFAA 2ZC9H 4NIVA 3RXCA 1BT7A 2W5EA 3A89A 4UEHH 2GDDA 1WTGH 1KDQA 3FFGA 2OC1A 5LPEA 1TBZH 1P2KA 2ANMH 3V0XA 4AB8A 4JYVH 1KLTA 1TQ7B 2G51A 3P95A 2VWOA 4WMEA 4Y0ZE 3ZVFA 2WYJA 1VCPA 1THPB 5FBIA 1KY9A 1ELFA 2FOCA 4FUCA 3RXHA 4AB9A 5L30H 1INCA 1WQSA 3M7TA 2ZHDA 3ATMA 1UVSH 3RMOH 1C2IA 2Z6BD 3BTEE 3A80A 1J9CH 1RTFB 2J95A 2GV6A 4ZXYH 5C2ZA 1O3DA 2H5DA 1VGCC 3F9HA 2HPQH 1A46H 4FVDA 2XW9A 1BTPA 1AFQC 3TPIZ 1QR3E 1NRNH 1O30A 1SLXB 2BD5A 2ZGBH 4I8HA 2BDGA 5I25A 4K8BA 2ZHWH 2ZPSA 1LVBA 1TX6A 1L2EA 4X1NU 1A0HB 2OD3B 3PMHB 1IQMA 1TNGA 4ASHA 1SGPE 4OS2A 1RTLA 2UWOA 1D9IA 1DS2E 1RFNA 2ZCLP 1SGTA 3RDZA 1PQAA 3B9FH 1MTWA 2BDYA 2ZU4A 1MKWK 5J4SA 1DDJA 3SNAA 1BRBE 1DXWA 3A83A 3RMLH 1OXGA 3E8LA 4ABHA 5EPNA 1H9LB 1O33A 4AG1A 4MNYA 3BTKE 2ANWA 1FY1A 1ELGA 4FUDA 3QTVH 1NO9H 1JRSA 1P3EA 3F9EA 1CO7E 3SOSA 3M37A 3AW0A 5FXLA 1C1PA 3LGYA 1T7CA 1SG8B 2UUKB 1KTSB 2BZAA 4JYTA 1G37A 4I33A 4UE7H 1ZOMA 3RXDA 2QV1A 4U2WA 3QK1A 1VCQA 3MYWA 1IQIA 2CMYA 1ARBA 4R0IA 2GMTB 2BXTH 4K1TA 3GDUA 4OS1A 2BLVA 1ZR0A 1XUGA 1C1MA 1EZUC 4KTSA 3GY6A 3SGBE 5L2YH 1EOLA 3S9BA 2TBSA 3DFLA 3EA8A 3F9FA 1SFIA 1J16A 4ZHAA 1ELAA 1EUFA 3E91A 1JBUH 4A1XA 3KHVA 3NUMA 3ZZ8A 4GSOA 1A5GH 1CGHA 1HAVB 2IOTA 4A1VA 1T4VH 3T62A 2R2MB 2OC0A 5CHAB 3TGJE 1FIZA 2EEKA 2FYRA 2PLXA 4K5ZA 2BY6X 3PM3A 2XC0A 1EPTC 3IG6B 3FP6E 1TMBH 1C5RA 1C5TA 1QRXA 2HALA 5JBBS 2EA3A 3RXGA 1ARCA 1MQ5A 1ZPCA 4GCHF 4OGXA 4JZFH 2ZGXH 2F9OA 1FN8A 1LHCH 1GHAF 1SPJA 4XBDA 1S83A 1ZSJA 1SOTA 2THFB 3FVFB 1LHGH 1MBMA 2DE9A 2V3OH 1NFUA 2F9UA 1HAZB 3SZNA 8ESTE 4X8VH 2TPIZ 2ZFSA 5EXMA 1CU1A 1FNIA 3SU2A 1QURH 1ELVA 1A0LA 2PWXA 2QC2A 2O8LA 1GBTA 3TITA 1QBNA 5LGOA 1HAGE 3FZZA 4TWWA 1Y3YA 3BTFE 1O2YA 1BHXF 1MD7A 2NU0E 5EGMA 1YYY1 3LGWA 1GBCA 1CA0B 1K1IA 1SSXA 5T6GA 1SGDE 2AGEX 1GPZA 1GVKB 1P06A 5EXLA 2ZTYA 4DG4A 4B2AA 3A8BA 4B71A 4LK4A 1O35A 5F8TA 4B76A 2A5KA 1DICA 1AWFH 4F4OC 1JRTA 2C3SA 1DPOA 6CHAB 2JH6D 1PQ5A 2FDAA 1O5BB 1OPHB 1Y5UT 3FAOA 3RM2H 4I8GA 4WJG2 1FONA 4OS4A 2C8ZB 3RU4T 4AFQA 1G9IE 4CBOA 1ANCA 1RS0A 4X6OA 3A8AA 5IDKA 3TJVA 3RXEA 3PLPA 3ENSB 1B7XB 1K1JA 3T29A 2BY7X 4KGAA 2SFAA 3CP7A 1V2PT 1GI8B 1YPGH 1Z8IB 3ATLA 1K28D 5K7RA 2Q1JA 1C1QA 1O3NA 4UDWH 3U9AH 1S0QA 4JK6A 4Y71A 5DP5A 3URCA 1LQEA 1Z8GA 2C93B 1LTOA 2BLWA 2BTCE 2QCYA 3GY3A 2ZDAH 1GI6A 4JZIA 3E0NB 5A0BA 1D6WA 2ASUB 1GJ9B 4SGAE 1GDUA 4CH2B 2FOEA 1SOZA 1QRWA 1CT4E 1JIRA 1BMAA 3T27A 1HGTH 2TGDA 1O34A 3ATIA 1CSOE 2FI5E 3MOCA 3TK5A 1ZRBA 4QT8C 5A8ZA 1T8MA 2UUYA 1YCPM 2WUBA 2FOGA 2PSYA 4ABIA 3ELAH 1UK2A 4Q7YA 5CMXH 4XBCA 1TALA 1S6FA 1SR5C 3UQOA 2BDCA 4Y7AA 2ZU5A 2VH0A 3ESTA 1UJ1A 2A31A 1WU1A 3ZVBA 1E35B 2ZFQH 3M7UA 1ANDA 1AU8A 1HAHH 1ZMLA 1DVAH 3LGTA 5E2OA 1DLEA 1HRTH 1L1NA 2WPJS 1O2VA 2J2UA 5A0CA 1F5KU 5T6DA 1TAWA 1A3EH 1TGTA 4NA8A 4ISOA 5DG6A 1HJ9A 3PB1E 4K69A 1BTXA 2OBOA 3SV7A 1BTHH 3MO3A 1O2GH 4X8UH 3SBKA 1QQUA 3F6UH 2GZ7A 1ZMJA 1AKSA 3UWIA 4ZMAH 1OWDA 1ESBA 4X0WU 2Q6DA 1NFWA 1YLCA 2AERH 2LNCA 1P2JA 1DM4B 1CA8B 4NZLA 3SU0A 4B73A 1SGIB 1Z8JB 1S6HA 2ALPA 1ELCA 2YNAA 3I29A 5ABWA 1TX7A 1Y5AT 3PO1C 5C20A 1UVTH 2BZ6H 4IBLH 2QY0B 3LC3A 2OLGA 1TGBA 5AVDA 3QLPH 4ABGA 1ZJDA 4DT7B 3SNCA 1AUJA 1MKXH 4X2XA 1O5CB 3UNQA 2G8TA 5F8ZA 1LHDH 1W0ZU 1Y3XA 1O2TA 1EJNA 1VR1H 3NKKA 1HNEE 4NSVA 1C4Y2 3QGJA 3Q77A 4KTUA 3PLBA 2OINA 5DK1A 1DXPA 1PYTD 1EP6A 2UWPA 2BOHB 1LKAA 3R0FA 1C2JA 1XUIA 1TBQH 2XRCA 1GBFA 4UFDH 4UONA 4YLUA 4IMQA 1P9UA 1LCYA 4WXVA 1FJSA 4NG9H 2HNTC 5GCHG 1XKBC 1ZHMA 3DFJA 2EC9H 1SFQB 4VGCC 4NIYA 4CRCA 4J2YB 1HAPH 2WPLS 3SUGA 1BBRK 1TPPA 1AD8H 2FS8A 4Y0YE 2AFQB 4TWYA 2ZFRH 5CHAC 1SHHB 4U30A 3PMBB 3A8CA 1GHYH 5LH8A 3MNCA 2FX4A 1OWKA 2RA0A 1K1PA 1Q31A 3L3TA 4KTCA 1HBTH 4YOGA 2R3UA 3A85A 2TGTA 2W3KA 1TGCA 1MTNC 1TYNA 3EA7A 4FUGA 1W2KH 1P01A 4FUIA 4DY7B 2ESTE 3QZRA 2TGAA 2QAAA 1CVWH 4ABJA 2RCEA 1GGDB 3TNTA 1S84A 1QB9A 1W7GH 7LPRA 1LPKB 1O3MA 1BDAA 1P09A 1QQ4A 1FY4A 3QGNB 2PGQB 1T8NA 1HYLA 2VB0A 1VITH 3VB5A 3SO3A 1WBGB 2A0QB 1TPAE 1UTKA 5E0HA 1XX9A 1HJAC 1G3BA 1PPCE 1F5RA 5GDSH 1CGJE 4ABDA 1ESAA 3A87A 2Y7ZA 1AUTC 1ETRH 2PSXA 3ZYEA 3SV6A 1KXBA 2FI3E 2H2ZA 2EI8A 1S85A 3VFEA 1E0FD 2O9QA 5L2ZH 1RD3B 1MZDA 1O36A 1XMNB 3K2UA 5T6FA 1SLUB 3LKWA 1HAYB 4XE4A 3RXUA 2F9VA 6GCHG 2VIQA 1P04A 1A5IA 5AHGH 2ZWLH 3BF6H 1H9HE 1EB2A 3ZZDA 3NCLA 1TOMH 4I8KA 1AGJA 1KTTB 2QXJA 1HJ8A 2FXRA 1DWBH 1V3XA 4UFGH 1GL1A 1LVYA 5GJ4B 4H4FA 2ZU2A 3LDXH 1O0DH 1K2I1 5ESBA 1C2FA 2BD3A 3RXVA 3A88A 4MNVA 4O97A 3UR9A 4MQAA 4MTBA 5FCRA 1H8DH 5EQQA 1GI4A 3ATWA 5E2PA 3A7XA 3AVZA 1NS3A 3U1JB 3UR6A 5A2MH 1O3LA 1OWHA 2BYAX 3BEIB 3FP7E 1EX3A 2AGIX 2Z3EA 1KDQB 2WYGA 2NU1E 3RUOA 1Z6EA 1CBWC 4YM9A 1ZLRA 2JETB 2VWMA 1YCPK 1LPGB 1D3TB 1XUHA 2PKSC 3P6ZB 2BQ7B 1EATA 1TOCB 2J94A 2VIVA 1EAWA 2BOKA 4JK5A 4DCDA 4ISIH 5EG4A 5TJXA 1ANBA 1EPTA 3M5OA 4H42U 2GCTB 1TLDA 1IQJA 3L6PA 1FPCH 3ZZ9A 3Q3YA 4LZ4B 1GJ5H 3ZV9A 3HATH 1BIOA 1LHFH 1FPHH 1PQ7A 2PGBB 2TGPZ 1AZ8A 2VIOA 2IN2A 2BX4A 3TGIE 1O2KA 1V2RT 1W7XH 3T25A 1AWHB 1J15A 2G55A 3K6YA 1XXFA 3QDZB 1XXDA 2C8WB 4AFZA 2SNVA 2WV4A 4HTCH 2W7SA 2FOMB 1QB6A 2JH5D 3LT3A 3SNBA 2FS9A 1FN6A 1GI7B 2YOLA 2HVXA 2BDIA 3SJKA 1QFKH 2BVSH 3MU1A 1EAUA 2QXHA 2FOFA 1GMDG 1GCTB 1FZZA 2J34A 5A09A 1H9IE 2R9PA 3AAUA 5E0JA 1S5SA 3U8TH 1V6DA 2QGRA 2ZCKP 1F92A 1IQEA 1JMOH 1HAIH 1Z71A 1TA2A 1V2LT 2D1JA 1VZQH 3UOPA 8GCHF 1TBRH 4X1QU 5F8XA 5DKMA 1HCGA 2AMQA 2FX6A 3Q3KA 4LZ1H 1C4U2 1YBWA 1MBQA 1O2JA 4NA7A 1O2WA 2BHGA 3GY4A 2AIPA 2XWBI 1TNIA 4F49A 1HXFH 1C2KA 4INHA 3GDVA 1TX8A 4IS5A 1DUAA 2WPKS 2R0LA 2PTNA 1F7ZA 1G3CA 4K60A 1UCYK 1D4PB 1OP2A 1Z1JA 1AQ7A 3VB7A 3UUZA 1LKBA 1QRZA 2GDEH 1GBAA 3Q00A 2ZFFH 1Y3WA 3NPSA 2WUCA 4RN6A 3SGAE 4A6LA 4CR5A 4DURA 1GG6B 3RXBA 3GCTF 3RXLA 1BMMH 3A8DA 1XUKA 3GY5A 1Q2WA 3MH6A 2WPIS 2BD4A 1XVMA 3M7QA 4NIXA 2NU3E 3TJNA 1NU7B 1C2HA 3TLOA 3K6ZA 1BRAA 3QUMP 4WH6A 4CRAA 3SORA 4ABFA 1Y59T 1GI3A 2FMJA 1PPZA 2BB4A 4AX9H 1GBKA 4ZAEA 2OUAA 2BX3A 3BEUA 4NIWA 1OKXA 3GYMA 2A1DB 1C1OA 1AB9B 4O03A 1BCUH 1UVOA 2A7HA 4YT7H 1Y5BT 2ANYA 1C5OH 4X2VA 3EDXB 1NT1A 2FWWA 1W0YH 4A92A 5C1XA 2G00A 2ZTZA 1BMLA 1AY6H 5A0AE 4J1YA 3BTTE 4IC6A 4CBNA 3SW2B 2VGCB 5FPTA 4ESTE 1F0UA 3GY8A 2OC7A 2P59A 4ZHLU 2ANKH 1GGDC 1LO6A 2HPPH 4MPVA 5FAHA 2ZGHA 4RKJB 4Y6DA 5E8EH 1B0FA 3EQ0H 4WXIA 1O3OA 1TE0A 1GJ7B 1MKWH 3O8DA 4I8LA 3K65B 5CE1A 1DITH 1NRSH 1ZGIA 3A7YA 5FCKA 3Q76A 1CHOG 1UTJA 1GL0E 2SGPE 1ZJKA 2BDHA 2V35A 4IW4E 3GY2A 3KQCA 4UD9H 2FESH 4R8TB 2HNTF 3LPRA 4ZKRU 1QB1A 3M5NA 1Z8RA 1BTZA 3SU4A 1K1NA 2XXLA 1GDNA 4WMFA 4ABAA 2V3HH 1JWTA 5HYOA 1QBOA 1MU6B 4IN1A 4NSYA 2BLQA 5GXPA 3ZYDA 2GD4B 1GHVH 1C2LA 3SJ8A 1CE5A 4U01A 2D8WA 2ZDKA 1T31A 3GYLB 4UFFH 1UTOA 5DGJA 2Z9GA 4BANB 1TNJA 3T2NA 1N6YA 1A7SA 2C8YB 1T4UH 1C1SA 1FY5A 1P8VC 2ALVA 1FMGA 4FUBA 3KCGH 3B23B 2TIOA 1A2CH 3ZZ3A 2P93A 1L4ZA 1S82A 1QIXB 1TRYA 1WQVH 4CRFA 3KIDU 2K1QA 1TB6H 3SN8A 1TPOA 1P57B 2ZEBA 3A84A 1BTUA 3NK8A 3V12A 4B74A 7KMEH 4MPWA 1V2QT 2R0KA 1TGSZ 4Z0KA 3SV8A 1P2QA 1DLKB 1N8OB 4Y8YA 3KQEA 4Z6AH 3DUXH 1SMFE 1HAVA 1GJCB 3QZQA 1MD8A 3S0NA 1AMHA 1FQ3A 1WAYB 1DANH 2JETC 2J38A 1BTYA 2XCNA 4NWLA 1ZSLA 3MTYA 4Y76A 3RXKA 1GJ6A 2VINA 3PTNA 1L1GA 3BN9A 4CR9A 1O3JA 1O2OA 4JMYA 4ISNA 1ZRKA 3ZVAA 1OYTH 2CN0H 4KELA 3RMNH 1HXEH 1MTUA 2R3YA 2PKAB 1A1RA 3CS0A 1GJDB 3PV4A 1D3DB 1HLTH 2HWLB 1O3KA 2I6QA 2GCHG 2ZA5A 1UTNA 1E34B 2PHBA 1O5GH 1YGCH 4BAHB 1UK3A 4MDSA 2WPHS 3RXSA 1SHYA 1O2NA 1TMTH 2F9BH 1PPEE 2KAIB 2A7JA 1SLWB 5H4IB 1ZZZA 2Y81A 1H1BA 3VGCC 3BTWE 1YPKH 3EAJA 1TABE 2GT7A 1W8BH 3A82A 1TNKA 1CT2E 2SGAA 3JZ1B 9LPRA 2Y5HA 3TH2H 4NCYA 4Y10E 2QN5T 1EJAA 1J17T 1GMHF 4ZROA 1ESTA 1AO5A 4MLFB 1PPFE 1ZTLA 1GMCF 3BEFB 2F9PA 3GCHB 2O8UA 5HM2A 1KIGH 3SQHE 4DIIH 4B1TA 1UTMA 3UY9A 3NZIA 3Q3XA 2ZG0H 1O2XA 3BG4B 1DUEA 2B9LA 1EXFA 1HAXB 1KSNA 7GCHG 1YPJH 2PW8H 1YPHE 1AVWA 1P0SH 3DT0H 2GV7A 1MU8B 1QNJA 4BXWA 2W7UA 1NRRH 1HV7A 4CHAB 5FPSA 2H6MA 2A5AA 2FOAA 1NY22 4AGJA 2XCFA 4JYUH 3OTJE 1P2IA 4RKOB 2F9NA 3KL6A 1EP5A 1ID5H 2P3UB 2ODYB 3STJA 4GCHG 4YO9A 4HI3A 4CH8B 3GY7A 5EW1H 1GHAG 1IHSH 4IMZA 3SHCH 2NU4E 1GJBB 1WCZA 1N1LA 1SQOA 4BXSA 5DP6A 1THRH 2FLRH 2P94A 2O8TA 2FP7B 2SGQE 2FM2A 3SU6A 2RA3A 1IQKA 2A4QA 2A2QH 1DE7H 2QF3A 4TYDA 2Z94A 4FU8A 4Y11E 1MCVA 8KME2 3HPTB 4D9RA 4MNWA 3OX7U 2FO9A 1AB9C 4K8YA 2AGGX 1D3PB 1BMNH 3UPEA 1GVLA 2BD7A 3U1IB 4LOYH 1B5GH 5AF9H 3E1XB 1BZXE 1VGCB 3RXPA 3MNXA 5DP9A 3GISB 4RSPA 2GMTC 1C1NA 1ELDE 3P8NA 2VGCC 3SU1A 5TCCA 1T8OA 1EB1H 1AFQB 1PQ8A 4GPGA 1C5SA 3MH7A 1GHBF 1XVOA 3MHWU 4ABEA 1Z6JH 5EQRA 5C5NA 5C1YA 3RXAA 5C1UA 5L6NH 4FUFA 4MNXA 1IHTH 5FBEA 2STAE 3UNRA 2FI4E 4MPXA 3BTQE 3W94A 1ELBA 2GVFA 3MH4A 1K21H 1VITG 1QL7A 2GX4A 1SGFA 4NFFA 1CGIE 1WTHD 2Z9KA 5A8YA 1RTKA 1PFXC 2I6SA 1XUFA 3BV9B 1DFPA 3S9CA 1K1OA 2J9NA 3GICB 2VWNA 1EJMA 3OSYA 1RXPA 2BY8X 1AFEH 3H5CB 1TWXB 4ZUHA 1EAXA 1P11E 3QTOH 4INKA 1O2UA 3VB6A 4X2YA 2VVUA 2ZDNA 4LXBH 4WMDA 4WY3A 1H8IH 4DIHH 1SBWA 2FLBH 1MCTA 1C5NH 1M9UA 3TJOA 4AGKA 3SJ9A 2V6NA 4KP0A 5A8XA 3ODDA 1UHBB 2AIQA 1AZZA 3KQBA 2AS9A 1BB0B 3NWUA 4YOIA 3BSQA 5TCAA 5BPEA 1O37A 1F0RA 3MMGA 1A4WH 1CQQA 3ZZCA 1BA8B 2UUJB 1BBRH 3M3SA 1DY8A 1CA0C 3P8FA 5DP3A 1O5EH 4I7YH 1EZXC 2BDAA 2IJOB 5EOKA 3ZZ6A 3URDA 1JXPA 2NWNA 3MWIU 5EPYA 3MU4A 2B7DH 2Y80A 3LGUA 3RXTA 2ZGCA 3RM0H 1FXYA 1O3GA 2ZIQH 1SQTA 1SI5H 3RC6A 3E0PB 3BTDE 6CHAC 1EPTB 3GCOA 5C67A 2FPZA 1G2LA 1WV7H 2J92A 4JZ1A 1DSUA 5AFZH 4GUXA 4O3UA 4GVUA 1F5LA 4GAWA 1L4DA 5B6OA 2SGDE 3UOUA 1FY3A 4THNH 2XC4A 1C5XB 1ZTJA 2B0FA 1C2MA 1ZSKA 2STBE 3U98H 4ZXXH 1HFDA 4Y79A 3SNDA 3TH4H 2P8OB 3PWBA 1E37B 2ZDVH 1HIAA 2BMGB 1GI5A 2Z9JA 2D2DA 2FTMA 1AI8H 2G4UA 2ZHFH 1T8LA 3PTBA 3HK3B 3A86A 3TNSA 1W11U 2ILNA 3GOVB 1TA6A 1Q3XA 1H4WA 1K1LA 3N7OA 1SVPA 3KNXA 4DVAU 4NWKA 2FZZA 1QBVH 3M35A 1V2WT 1YC0A 2ZDMA 4O9VA 1A3BH 1LVOA 1N6XA 2ZCHP 1NC6A 3A81A 2A7CA 1EKBB 1HUTH 1DOJA 3S69A 4OS7A 3GCHC 3MO6A 5J4QA 1IQNA 4BAKB 3D62A 4A5TS 2GTBA 4I31A 2Z7FE 2A4GA 4XDEA 3B8JA 3UNSA 1DX5M 4WF8A 1GI0A 3RP2A 2B5TB 2C90B 1GBMA 2RDLA 3LGIA 1W12U 3ZVEA 4ABBA 3L33A 2BM2A 1C5UA 2FYQA 2LPRA 3OY5U 4YZUA 2XWAA 3ZZ5A 3RMMH 2EI6A 4BTUB 2G52A 2QA9E 4X8TH 4CHAC 4FUJA 3RC4A 2ZP0H 1KYNA 2FEQH 5JBCS 2ZU3A 2VVCA 1FAKH 4X8SH 3SUDA 2EI7A 2G5NA 1F0TA 3RLWH 1MAXA 2GGVB 1YCPH 5AFYH 2F3CE 5JYIA 1QCPA 1AE8H 4I32A 4Q2KA 1AE5A 3S7KB 2FOBA 2UUFB 1ZMNA 3HGNA 1V2VT 4U32A 2GP9B 1EAIA 2SGFE 4WWYA 4TY6A 3SV9A 2XC5A 2CJIA 1GBLA 3HGPA 1O2LA 5JBAS 4NZQA 1GJ4H 3M3VA 1EQ9A 2BY9X 1EOJA 1ABJH 1SB1H 4SGBE 1ORFA 3M5LA 1NESE 4WH8A 8LPRA 3MH5A 2P16A 5BRRE 3RXFA 2BXUH 2CHAB 2PV9B 3TJUA 2XNIA 4XFQA 5DPAA 4A7IB 1FDPA 1LQDB 2PUQH 4B2BA 1BTWA 1C1RA 1OS8A 2AMDA 4K3JA 2AEIH 4X1SU 3VXFH 3P70B 1G3EA 1C5LH 4ZKSU 1SC8U 3LJOA 1TONA 1IQLA 3AASA 1NFYA 1O3EA 1MUEB 5EW2H 1Z1IA 1O2RA 4H6SB 5DO4H 5HM9A 4YESB 1TRNA 1PYTC 4GLYA 4B75A 3M36A 3TH3H 3H7OA 3RXRA 1W14U 5ESTE 1WYKA 1P2OA 1YP9A 4DOQA 3MU0A 3M61U 1G3DA 2A45B 4FU7A 5HGGA 1GBIA 1DY9A 2OC8A 3IITA 1L0ZA 2BLOA 3PO1B 1K22H 1C5QA 3PROA 2GCHF 2OXSA 4D76A 2AMPA 2W26A 1NZQH 2ZNKH 5GWZA 1IOEA 1UCYH 1GI9B 1C1TA 2Z9IA 1MH0A 1OOKB 2ZHQH 3CS7A 3R3GB 3P92A 3PLKA 3O8RA 3UQVA 1RRKA 1QJ1B 1TNHA 4ZKNU 3FANA 3PWCA 2VIDA 4BTTB 2ZFTA 4CRDA 2HOBA 1EASA 1UTPA 4DGJA 1O5DH 3SNEA 2UWLA 5JB9S 4YTAA 1G2MA 2A2XH 3SU5A 3EA9A 3GDSA 1CT0E 4E7NA 1MAYA 4FUEA 1ETSH 5DJ7A 2Z9LA 4D9QA 1MTSA 1DSTA 3HKIB 2BDBA 4YT6H 2H9EH 2WV5A 1HB0B 1A61H 2OP9A 1GI1A 4VGCB 1UVPA 4FVBA 2M5TA 4AZ2B 1S0RA 1KXFA 3QO6A 5DP8A 1FI8A 3HKJB 1F0SA 7GCHF 1OWIA 1IAUA 1OP0A 3SU3A 2CGAA 1ZTKA 4OS6A 2H1UA 2QIQA 1P05A 1ZPBA 2SNWA 2JH0D 4XBBA 4YLQH 1UTQA 1TGNA 2FOHA 3QN7A 3RXQA 1MTNB 3BTGE 1NRQH 1PPGE 4INLA 1O3PB 1ZPZA 4AFUA 4D8NA 2HNTE 3RXOA 1YPLH 3AW1A 1V2KT 3BTHE 4TPYA 1BHXB 2ULLA 2VH6A 3U8RH 1SLVB 1C1VH 1O31A 4Q80A 1ZYOA 1GWAA 3SQEE 1O3HA 3SI4H 2ZKSA 3A7WA 1WOFA 1DT2A 4JZDH 1RIWB 8GCHG 5C5OA 3LU9B 1V2ST 1MTVA 1C1UH 4HFPB 1C2EA 2OTVA 1V2MT 3LJJA 1SGYE 2P8OC 1QTFA 4A1TA 4IN2A 1J8AA 1GI2A 1O2HA 4GHQA 4AOQA 4YOJA 1U6QA 5K0HA 1TPSA 3H7TA 1HJAB 3RU4D 4AORA 4DJZB 4BOHA 3SJOA 1T32A 1YLDA 4GHTA 3G01A 3DHKH 2ZQ2A 4ZH8A 1AHTH 1EZQA 5GPIB 2ZECA 1HAOH 2ZTXA 2P3TB 4AYYB 1LVMA 2C8XB 1ETTH 1BJUA 1UK4A 2GCTC 3GCTG 3OYPA 2Q6GA 1XKAC 5GCHF 4K1SA 4Y8XA 4Y7BA 3I77A 5HMAA 1C2DA 3RLYH 2Z3DA 1P03A 1PPHE 1IQGA 3C1KA 4Q7ZA 4Y8ZA 3OU0A 1BQYA 1OX1A 3P8GA 4WVPE 3P8OA 2PTCE 3BG8A 1K1MA 3STIA 3P17H 3NXPA 1WUNH 3PMAB 1TMUH 3VEQB 2ODPA 3VB3A 4BAQB 2HLCA 2H9TH 3GCNA 1O5AB 1P2NA 1VITF 3SUFA 1DWDH 1O3BA 1OP8A 2BQWB 1RJXB 3IWMA 1BUIA 2GT8A 3LGVA 5FHTA 2Q6FA 4D7FA 4NFEA 5G4BA 1AKSB 1GCTC 3BTME 2XBWA 2ODQA 4E7RG 1WSSH 1BRCE 1E38B 1MZAA 3UWJH 3RU4E 1OWJA 1SGRE 1CBWB 3DA9B 1NPMA 4AG2A 2A4RA 1LPZB 1BITA 3ITIA 2CXVA 1FLEE 3LC5A 3ZVGA 1GBHA 3ZZAA 4AYVB 2JKHA 3U8OH 1BBRE 3VXEH 2PKSB 2BY5X 2RG3A 1YM0A 2YNBA 5LPRA 5JB8S 1JIMA 1JOUB 1PJPA 4XOJA 1SL3A 3TVJB 1E36B 1TIOA 1NM6A 3A7VA 1FAXA 9ESTA 3F68H 1KLJH 2ZPRA 4XSKU 1MKXK 4K1EA 6ESTA 1P9SA 2ZU1A 3EGKH 5F03A 3ATKA 3O8BA 3LOXA 2PKAA 1FIWA 2CHAC 1F2SE 1V2UT 3EYDA 3MO9A 3TK6A 5LPFA 4KKDA 3SI3H 1B0EA 4ISHH 5JPMH 5EU8A 5PTPA 4ZKOU 2OBQA 1GHWH 1O2IA 5C3NA 1G30B 1O3AA 4BAOB 2G5VA 1GG6C 1AVXA 2FIRH 5I46H 1SGCA 3VPKA 1MQ6A 3M5MA 3F9GA 1BRUP 6GCHF 1C4V2 2IPHA 3S9AA 4X1PU 2ZI2H 1KXDA 2KAIA 2ZF0H 1GHZA 1PPBH 5GIBA 4E05H 1NROH 1SQAA 1V2NT 3MNSA 1XM1A 3UREA 5EODA 3BIVH 2BD9A 4AFSA 3QWCH 2G4TA 2QXGA 2F83A 1SGEE 2PUXB 2FTLE 1GBEA 2BD8A 3TK9A 2GZ9A 1Y3VA 3SUEA 3E16B 1S81A 1YPEH 1A0JA 1UO6A 4Q7XA 2ZQ1A 1P2MA 3AAVA 1W13U 4DW2U 2GZ8A 1IQFA 2C4FH 1P12E 2VWLA 4FU9A 1K9OE 1QGFA 2Y82A 4I8JA 3O8CA 1NU9A 3F1SB 3SGQE 5DP4A 1OYQA 1KXAA 2J4IA 6LPRA 1ZHRA 1LDTT 4IC5A 4NGAH 3T26A 1O2ZA 3RC5A 5EQSA 3T28A 2P3FH 1C9TA 1ELEE 2A32A 3C27B 3WY8A 3TGKE 1GBBA 2Y5FA 1IQHA 3SHAH 2DUCA 4X1RU 2A4OA 1UMAH 5SGAE 1GCDA 1GDQA 3A7ZA 1QL8A 1O2MA 2O8MA 4O3TA 4TY7A 3U69H 1C5ZB 1ZHPA 3UTUH 2XBXA 1C5PA 1TQ0B 4PROA 3E90B 5FX6A 3MU5A 1O39A 1LHEH 3SJIA 1OWEA 4HGCA 3S7HB 4TPIZ 5F6MA 2AYWA 2ZFPH 3RXIA 1LMWB 1TFXA 1VCWA 2P95A 2R2WU 1YPMH 1GJAB 5E0GA 4CRBA 1NTPA 2BVRH 3V3MA 3V13A 1ZGVA 1QA7A 3MNBA 3ODFA 1OSSA 3V7TA 3RXJA 3KN2A 3LH1A 5IYTA 1ANEA 1KLIH 2QF0A 1C9PA 1Y3UA 2H9HA 4X6NA 1Z7KA
chains in the Genus database with same CATH superfamily
1GMDF 2YMSB 1GMHG 1BOQA 1L1JA 1VJAU 3VB4A 1ABIH 1GMCG 4BAMB 2TRMA 4B2CA 2VJ1A 4MPUA 2ZGJA 4H6TA 1HIAB 1GBDA 1RIWC 5HIZA 3FP8E 1HPGA 3MU8A 3K9XB 1S6LA 4FUHA 3UIRA 3LH3A 1O2PA 2CV3A 4ZHMU 2ZZUH 2KCOA 3HK6B 1V2JT 2GKVE 1O3CA 1C2GA 2VIWA 1N8OC 1GJ8B 2Y5GA 3DSOA 2O8WA 1SGNE 3KGPA 1KXEA 2DE8A 7ESTE 1RGQA 1O32A 1O3FA 2VU8E 1FY8E 5FX5A 4CREA 3FZDA 4BNRA 1O5FH 1QY6A 1GBJA 4JZEH 2AH4X 2D26C 1GHXH 2QYIA 2OQ5A 1J14A 4JCNA 4M9FA 3ZVCA 5JBTA 2ZHEH 1O2QA 1UVUH 1C5YB 4M7GA 2Y7XA 1TNLA 4E06H 1P3CA 5GNDA 4ZCNA 1P10A 2ZO3H 1AIXH 2QXIA 3D23A 3F3BA 3W95A 4X2WA 1A5HA 2VNTA 1C5VA 2OQUA 2XBYA 3RXMA 3ZZ7A 4CRGA 2XBVA 4K2YA 3SV2H 4D7GA 1O2SA 2SGEE 1QA0A 2XYAA 1G32B 2XTTB 4OS5A 1BMFD 3M3TA 2KCAA 3TIUA 2NU2E 2W3IA 4NA9H 1UCYE 4UFEH 1QJ7B 1TRMA 1H8ED 4AN7A 2PFEA 2VIPA 1YPHC 1SGQE 1UTLM 5C0TA 1UHBA 1SGFG 3LIWA 3QX5H 2HGTH 2BVXH 3D49H 5T3HA 4RI0A 3ZVDA 1MMJN 2JJ2D 2Z3CA 1FUJA 1QL9A 2CF8H 1AVGH 1DWCH 3DD2H 1ACBE 3MFJA 4HZHA 3TU7H 3ZZ4A 1P02A 3OY6U 4BTIB 1EZSC 1YKTA 5FPYA 1YF4A 2VVVA 2Y6TA 1C1WH 1ELTA 2HRVA 1QHRB 3PYHA 1CHGA 1NN6A 2WINI 3D65E 3JZ2B 4RT0A 2G81E 2H5CA 4FXGH 1GHBG 1KXCA 3A7TA 4MG3A 3E3TA 1BJVA 2PR3A 3N7EA 1XUJA 2F91A 1D3QB 2A5IA 1AN1E 3MI4A 1THSH 3BG4C 2WPMS 3ZZBA 1C5MD 4MVNA 4X6MA 3LONA 2V3MA 3I78A 5IK2D 1CHOF 3OAAD 1C5WB 4IGDA 3BIUH 4OGYA 2BD2A 1FV9A 2B8OH 2ZDLA 5ETXA 1NFXA 3T5FH 1NRPH 5HXFA 4ISLA 1V2TT 2ZPQA 1W3CA 2V0BA 5JDUB 1D6RA 3E6PH 5EXNA 1Y8TA 1GVZA 3EE0B 1HDTH 3ZV8A 1G36A 5DP7A 3CENA 1E1QD 2FODA 2OCVB 3PMJA 3KEEA 3KF2A 1DWEH 1O38A 1QJ6B 3DSPA 3KQDA 4X6PA 1V2OT 1W10U 1X7AC 1O3IA 1VJ9U 2CF9H 2BQ6B 3VGCB 3UFAA 2ZC9H 4NIVA 3RXCA 1BT7A 4Q63A 2W5EA 3A89A 4UEHH 2GDDA 1WTGH 1KDQA 5EJLA 3FFGA 2OC1A 5LPEA 1TBZH 1P2KA 2ANMH 3V0XA 4AB8A 4JYVH 1KLTA 1TQ7B 2G51A 3P95A 2VWOA 4WMEA 4Y0ZE 2VBCA 3ZVFA 2WYJA 1VCPA 1THPB 5FBIA 4Q4LA 1KY9A 1ELFA 1YY3A 2FOCA 4XD7D 4FUCA 3RXHA 4AB9A 5L30H 1INCA 1WQSA 3PV2A 3M7TA 2ZHDA 3ATMA 1UVSH 3RMOH 1C2IA 2Z6BD 3BTEE 3A80A 1J9CH 3KYFA 1RTFB 2J95A 2GV6A 4ZXYH 5C2ZA 1O3DA 2H5DA 1VGCC 3F9HA 2HPQH 1A46H 3OE7D 4FVDA 2XW9A 1BTPA 1AFQC 3TPIZ 1QR3E 1NRNH 1O30A 1SLXB 2BD5A 2ZGBH 4I8HA 2BDGA 5I25A 4K8BA 2ZHWH 2ZPSA 1LVBA 1TX6A 1L2EA 4X1NU 1A0HB 2OD3B 3PMHB 1IQMA 1TNGA 4ASHA 1SGPE 4OS2A 1RTLA 2UWOA 1D9IA 1DS2E 1RFNA 2ZCLP 1SGTA 3RDZA 1PQAA 3B9FH 1MTWA 2BDYA 2ZU4A 1MKWK 5J4SA 1DDJA 3SNAA 1BRBE 1DXWA 3A83A 3RMLH 1OXGA 3E8LA 4ABHA 5EPNA 1H9LB 1O33A 4AG1A 4MNYA 3BTKE 2ANWA 1FY1A 1ELGA 4FUDA 3QTVH 1NO9H 1JRSA 1P3EA 3F9EA 1CO7E 3SOSA 3M37A 4P02A 3AW0A 5FXLA 1C1PA 3LGYA 1T7CA 1SG8B 2UUKB 1KTSB 2BZAA 4JYTA 1G37A 4I33A 4UE7H 1ZOMA 3RXDA 2QV1A 4U2WA 3QK1A 1VCQA 3MYWA 1IQIA 2YMSC 2CMYA 1ARBA 4R0IA 2GMTB 2BXTH 4K1TA 3GDUA 4OS1A 2BLVA 1ZR0A 1XUGA 1C1MA 1EZUC 4KTSA 3GY6A 3SGBE 5L2YH 1EOLA 3S9BA 2TBSA 3DFLA 3EA8A 3F9FA 1SFIA 1J16A 4ZHAA 1ELAA 1EUFA 3E91A 1JBUH 4A1XA 3KHVA 3NUMA 3ZZ8A 4GSOA 1A5GH 1CGHA 1HAVB 2IOTA 4A1VA 1T4VH 3T62A 2KCYA 2R2MB 1WXRA 2OC0A 5CHAB 3TGJE 1FIZA 2EEKA 2FYRA 2PLXA 2WHXA 4K5ZA 2L6OA 2BY6X 3PM3A 2XC0A 1EPTC 3IG6B 3FP6E 1TMBH 1C5RA 1C5TA 1QRXA 2HALA 5JBBS 2EA3A 3RXGA 1ARCA 1MQ5A 1ZPCA 4GCHF 3DSGA 4OGXA 4JZFH 2ZGXH 2F9OA 1FN8A 1LHCH 1GHAF 1SPJA 4XBDA 4ACBA 1S83A 1ZSJA 1SOTA 2THFB 3FVFB 1LHGH 1MBMA 2DE9A 2V3OH 1NFUA 2F9UA 1HAZB 3SZNA 8ESTE 4X8VH 2TPIZ 2ZFSA 5EXMA 1CU1A 1FNIA 3SU2A 1QURH 1ELVA 1A0LA 2PWXA 2QC2A 2O8LA 1GBTA 4RT1A 1QBNA 3TITA 5LGOA 1HAGE 3FZZA 4TWWA 1Y3YA 3BTFE 1O2YA 1BHXF 1MD7A 2NU0E 5EGMA 1YYY1 3LGWA 1GBCA 1CA0B 1K1IA 1SSXA 5T6GA 1SGDE 2AGEX 1GPZA 1GVKB 1P06A 5EXLA 2ZTYA 4DG4A 5HKKD 4B2AA 3A8BA 4B71A 4LK4A 1O35A 5F8TA 4B76A 2K8IA 2A5KA 1DICA 1AWFH 4F4OC 1JRTA 2C3SA 1DPOA 6CHAB 2JH6D 1PQ5A 2FDAA 1O5BB 3WWBA 1OPHB 1Y5UT 3FAOA 3RM2H 4I8GA 4WJG2 1MABB 1FONA 5C17A 4OS4A 2C8ZB 3RU4T 4AFQA 1G9IE 4CBOA 1ANCA 1RS0A 4X6OA 3A8AA 5IDKA 3TJVA 3RXEA 3PLPA 3ENSB 1B7XB 1K1JA 3T29A 2BY7X 4KGAA 2SFAA 3CP7A 1V2PT 1GI8B 1YPGH 1Z8IB 2M2AA 3ATLA 1K28D 5K7RA 2Q1JA 1C1QA 1O3NA 4UDWH 3U9AH 1S0QA 4JK6A 4Y71A 5DP5A 3URCA 1LQEA 1Z8GA 2OK5A 2C93B 1LTOA 2BLWA 2BTCE 2QCYA 3GY3A 2ZDAH 1GI6A 4JZIA 3E0NB 5A0BA 1D6WA 2ASUB 1GJ9B 1QZ8A 4SGAE 1GDUA 4CH2B 2FOEA 1SOZA 1QRWA 1CT4E 1JIRA 1BMAA 3T27A 1HGTH 2TGDA 1O34A 3ATIA 1CSOE 2FI5E 3MOCA 3TK5A 1ZRBA 4QT8C 5A8ZA 1T8MA 2UUYA 1YCPM 2WUBA 2FOGA 2PSYA 1FX0B 4ABIA 3ELAH 1UK2A 4Q7YA 5CMXH 4XBCA 1TALA 1S6FA 1SR5C 3UQOA 2BDCA 4Y7AA 2ZU5A 2VH0A 3ESTA 1UJ1A 2A31A 1WU1A 3ZVBA 1E35B 2ZFQH 3M7UA 1ANDA 1AU8A 1HAHH 1ZMLA 1DVAH 3LGTA 5E2OA 1DLEA 1HRTH 1L1NA 2W6ID 2WPJS 1O2VA 2J2UA 5A0CA 1F5KU 5T6DA 1TAWA 1A3EH 1TGTA 4NA8A 4ISOA 5DG6A 1HJ9A 3PB1E 4K69A 1BTXA 2OBOA 3SV7A 1BTHH 3MO3A 1O2GH 4X8UH 2RDEA 3SBKA 1QQUA 3FKSD 2WV9A 3F6UH 2GZ7A 1ZMJA 1AKSA 3UWIA 1COWD 4ZMAH 1OWDA 1ESBA 4X0WU 2Q6DA 3FN8A 1NFWA 1YLCA 2AERH 2LNCA 1P2JA 1DM4B 1CA8B 4NZLA 3SU0A 4B73A 1SGIB 1Z8JB 1S6HA 2ALPA 1ELCA 2YNAA 3I29A 5ABWA 1TX7A 1Y5AT 3PO1C 5C20A 1UVTH 2BZ6H 4IBLH 2QY0B 3LC3A 2OLGA 1TGBA 5AVDA 3QLPH 4ABGA 1ZJDA 2J98B 4DT7B 3SNCA 1AUJA 1MKXH 4X2XA 3WW7A 1O5CB 3UNQA 2G8TA 3N7DA 5F8ZA 1LHDH 1W0ZU 1Y3XA 1O2TA 1EJNA 1VR1H 3NKKA 1HNEE 4NSVA 1C4Y2 3QGJA 3Q77A 4KTUA 3PLBA 2OINA 5DK1A 1DXPA 1PYTD 1EP6A 2UWPA 2BOHB 3F0PA 1LKAA 3R0FA 1C2JA 1XUIA 1TBQH 2XRCA 1GBFA 4UFDH 4UONA 4YLUA 4IMQA 1P9UA 1LCYA 4WXVA 1FJSA 4NG9H 2HNTC 5GCHG 1XKBC 1SKYE 1ZHMA 3DFJA 2EC9H 1SFQB 1SQRA 4VGCC 4NIYA 4CRCA 4J2YB 1HAPH 2WPLS 3SUGA 1BBRK 5EIYA 3FO8D 1TPPA 1AD8H 2FS8A 4Y0YE 2AFQB 4TWYA 2ZFRH 5CHAC 1SHHB 4U30A 3PMBB 3A8CA 1GHYH 3SYJA 5LH8A 3MNCA 2FX4A 1OWKA 1EFRD 1K1PA 1Q31A 2RA0A 3L3TA 4KTCA 1HBTH 4YOGA 2R3UA 3A85A 2WPDD 2TGTA 2W3KA 1TGCA 1MTNC 1TYNA 3EA7A 4FUGA 1W2KH 1P01A 4FUIA 1W0JD 3EE7A 4DY7B 2ESTE 3QZRA 2TGAA 2QAAA 1CVWH 4ABJA 2RCEA 1GGDB 3TNTA 1S84A 1QB9A 1W7GH 7LPRA 1LPKB 1O3MA 1BDAA 1P09A 1QQ4A 1FY4A 3QGNB 2PGQB 1T8NA 1HYLA 2VB0A 1VITH 3VB5A 3SO3A 1WBGB 2A0QB 1TPAE 1UTKA 5E0HA 1XX9A 1HJAC 1G3BA 3KYGA 1PPCE 1F5RA 5GDSH 1CGJE 4ABDA 1ESAA 3A87A 2Y7ZA 1AUTC 1ETRH 2PSXA 3ZYEA 3SV6A 1KXBA 2FI3E 2H2ZA 2EI8A 2K0QA 3W1EA 1S85A 3VFEA 1E0FD 2O9QA 5L2ZH 1RD3B 1MZDA 1O36A 1XMNB 3K2UA 5T6FA 1SLUB 3LKWA 1HAYB 4XE4A 3RXUA 2F9VA 6GCHG 2VIQA 1P04A 1A5IA 5AHGH 2ZWLH 3BF6H 1H9HE 1EB2A 3ZZDA 3NCLA 1TOMH 4I8KA 1AGJA 2QF5A 1KTTB 2QXJA 1HJ8A 2FXRA 1DWBH 1V3XA 4UFGH 1GL1A 2RFKC 1LVYA 5GJ4B 4H4FA 2ZU2A 3LDXH 5KGOA 1O0DH 1K2I1 5ESBA 1C2FA 2BD3A 3RXVA 3A88A 4MNVA 4O97A 3UR9A 4MQAA 4MTBA 5FCRA 1H8DH 5EQQA 1GI4A 3ATWA 5E2PA 3A7XA 3AVZA 1NS3A 3U1JB 3UR6A 5A2MH 1O3LA 1OWHA 2BYAX 3BEIB 3FP7E 1EX3A 2AGIX 2Z3EA 1KDQB 2WYGA 2NU1E 3RUOA 1Z6EA 1CBWC 4YM9A 3VG8A 1ZLRA 2JETB 2VWMA 1YCPK 1LPGB 1D3TB 1XUHA 2PKSC 3P6ZB 2BQ7B 1EATA 1TOCB 2J94A 2VIVA 1EAWA 2BOKA 4JK5A 4DCDA 4ISIH 5EG4A 5TJXA 1ANBA 1EPTA 3DCLA 3M5OA 4H42U 2GCTB 1TLDA 1IQJA 3L6PA 1FPCH 3ZZ9A 3Q3YA 4LZ4B 1GJ5H 3ZV9A 3HATH 1BIOA 1LHFH 1FPHH 1PQ7A 2PGBB 2TGPZ 1AZ8A 2VIOA 2IN2A 2BX4A 3TGIE 1O2KA 1V2RT 1W7XH 3PRBA 3T25A 1AWHB 1J15A 2G55A 3K6YA 1XXFA 3QDZB 1XXDA 2C8WB 4AFZA 2SNVA 2WV4A 4HTCH 2W7SA 2FOMB 1QB6A 2JH5D 3LT3A 3SNBA 2FS9A 1FN6A 1GI7B 2YOLA 2HVXA 2BDIA 3SJKA 1QFKH 2BVSH 3MU1A 1EAUA 2QXHA 2PP6A 2FOFA 1GMDG 1GCTB 1FZZA 2J34A 5A09A 1H9IE 2R9PA 3AAUA 5E0JA 1S5SA 3U8TH 1YLNA 1V6DA 2QGRA 2ZCKP 1F92A 1IQEA 1JMOH 1HAIH 1Z71A 1TA2A 1V2LT 2D1JA 1VZQH 3UOPA 8GCHF 4DT4A 1TBRH 4X1QU 5F8XA 5DKMA 1HCGA 2AMQA 2FX6A 3Q3KA 4LZ1H 1C4U2 3UAIC 1YBWA 1MBQA 1O2JA 4NA7A 1O2WA 2BHGA 3OFND 3GY4A 2AIPA 2XWBI 1TNIA 4F49A 1HXFH 1C2KA 4INHA 3GDVA 1TX8A 5B6LA 4IS5A 1DUAA 2WPKS 2R0LA 2PTNA 1F7ZA 1G3CA 4K60A 1UCYK 1D4PB 1OP2A 1Z1JA 1AQ7A 3VB7A 3UUZA 1LKBA 1QRZA 2GDEH 3WWFA 1GBAA 3Q00A 2ZFFH 1Y3WA 3NPSA 4F55A 2WUCA 4RN6A 3SGAE 4A6LA 4CR5A 4DURA 1GG6B 3RXBA 3GCTF 3RXLA 1BMMH 3A8DA 1XUKA 3GY5A 1Q2WA 3MH6A 2WPIS 2BD4A 1XVMA 3M7QA 4NIXA 2NU3E 3TJNA 1NU7B 1C2HA 3TLOA 3K6ZA 1BRAA 3QUMP 4WH6A 4CRAA 3SORA 4ABFA 1Y59T 2LP6A 1GI3A 2FMJA 2IJD1 1PPZA 2BB4A 4AX9H 1GBKA 4ZAEA 2OUAA 2BX3A 3BEUA 4NIWA 1OKXA 3GYMA 2A1DB 1C1OA 1AB9B 4O03A 1BCUH 1UVOA 2A7HA 3SZEA 4YT7H 1Y5BT 2ANYA 1C5OH 4X2VA 3MQKC 2EY4C 3EDXB 1NT1A 2FWWA 1W0YH 4A92A 5C1XA 2G00A 2ZTZA 1BMLA 1AY6H 5A0AE 4J1YA 3BTTE 4IC6A 4CBNA 3SW2B 2VGCB 5FPTA 4ESTE 1F0UA 3GY8A 2OC7A 2P59A 4ZHLU 2ANKH 3KQ5A 1GGDC 1LO6A 2HPPH 4MPVA 5FAHA 2ZGHA 4RKJB 4Y6DA 5E8EH 1B0FA 3EQ0H 4WXIA 1O3OA 1TE0A 1GJ7B 1MKWH 1VKYA 3O8DA 4I8LA 3K65B 5CE1A 1DITH 1NRSH 1ZGIA 3A7YA 4Z1MD 5FCKA 3Q76A 1CHOG 1UTJA 1GL0E 2SGPE 1ZJKA 2BDHA 2V35A 4IW4E 3GY2A 3KQCA 4UD9H 2FESH 4R8TB 2HNTF 3LPRA 4ZKRU 1QB1A 3M5NA 1Z8RA 1BTZA 3SU4A 1K1NA 2XXLA 1GDNA 4WMFA 4ABAA 4XRNA 2V3HH 1JWTA 5HYOA 1QBOA 1MU6B 4IN1A 3AK5A 4NSYA 2BLQA 5GXPA 3ZYDA 2GD4B 1GHVH 1C2LA 3SJ8A 1CE5A 4U01A 2D8WA 2ZDKA 1T31A 3GYLB 4UFFH 1UTOA 5DGJA 2Z9GA 4BANB 1TNJA 5EJZA 3T2NA 1N6YA 1A7SA 2C8YB 1T4UH 1C1SA 1FY5A 2HVYB 1P8VC 2ALVA 1FMGA 4FUBA 3KCGH 3B23B 2TIOA 1A2CH 3ZZ3A 2P93A 1L4ZA 1S82A 1QIXB 1TRYA 1WQVH 4CRFA 3KIDU 2K1QA 1TB6H 3SN8A 1TPOA 1P57B 2ZEBA 3A84A 1BTUA 3NK8A 3V12A 2KR7A 4B74A 7KMEH 4MPWA 1V2QT 2R0KA 1TGSZ 4Z0KA 3SV8A 1P2QA 1DLKB 1N8OB 4Y8YA 3KQEA 4Z6AH 3DUXH 1SMFE 1HAVA 1GJCB 3QZQA 1MD8A 3S0NA 1AMHA 1FQ3A 1WAYB 2QF4A 1DANH 2JETC 5HIYA 2J38A 1BTYA 2XCNA 4NWLA 1ZSLA 2CK3D 3MTYA 4Y76A 3RXKA 1GJ6A 2VINA 3PTNA 1L1GA 4TSFD 3BN9A 4CR9A 1O3JA 1O2OA 4JMYA 4ISNA 1ZRKA 3ZVAA 1OYTH 2CN0H 4KELA 3RMNH 1HXEH 1MTUA 2R3YA 2PKAB 1A1RA 3PRDA 3CS0A 1GJDB 3PV4A 1D3DB 1HLTH 2HWLB 1O3KA 2I6QA 2GCHG 2ZA5A 1UTNA 1E34B 2PHBA 1O5GH 1YGCH 4BAHB 1UK3A 4MDSA 2WPHS 3RXSA 1SHYA 1O2NA 1TMTH 2F9BH 1PPEE 2KAIB 2A7JA 1SLWB 5H4IB 1ZZZA 2Y81A 1H1BA 3VGCC 3BTWE 1YPKH 2WZQA 3EAJA 1TABE 2GT7A 1W8BH 3A82A 1TNKA 1CT2E 2SGAA 3JZ1B 9LPRA 1NBME 2Y5HA 3TH2H 4NCYA 4Y10E 2QN5T 1EJAA 1J17T 1GMHF 4ZROA 1ESTA 1AO5A 4MLFB 1PPFE 1ZTLA 1GMCF 3BEFB 2F9PA 3GCHB 2O8UA 5HM2A 1KIGH 3SQHE 4DIIH 4B1TA 1UTMA 3UY9A 3NZIA 3Q3XA 2ZG0H 1O2XA 3BG4B 1DUEA 2B9LA 1EXFA 1HAXB 1KSNA 7GCHG 1YPJH 2PW8H 1YPHE 1AVWA 1P0SH 3DT0H 2GV7A 1MU8B 1QNJA 4BXWA 1WDIA 1NRRH 2W7UA 5EJ1A 1HV7A 4CHAB 5FPSA 2H6MA 2A5AA 2FOAA 1NY22 4AGJA 2XCFA 4JYUH 3OTJE 1P2IA 4RKOB 2F9NA 3KL6A 1K0HA 1EP5A 2V7QD 1ID5H 2ODYB 2P3UB 3STJA 4GCHG 4YO9A 4HI3A 4CH8B 3GY7A 5EW1H 1GHAG 1IHSH 4IMZA 3SHCH 2NU4E 1GJBB 1WCZA 1N1LA 1SQOA 2XOKD 4BXSA 5DP6A 1THRH 2FLRH 2P94A 2O8TA 2FP7B 2SGQE 2FM2A 3SU6A 2RA3A 1IQKA 2A4QA 2F4LA 2A2QH 1DE7H 2QF3A 4TYDA 2Z94A 4FU8A 4Y11E 1MCVA 8KME2 3HPTB 4D9RA 4MNWA 3OX7U 2FO9A 1AB9C 2J97A 1W0KD 1H8HD 4K8YA 2AGGX 1D3PB 1BMNH 3UPEA 1GVLA 2BD7A 3U1IB 4LOYH 1B5GH 5AF9H 3E1XB 1BZXE 1VGCB 3RXPA 3MNXA 5DP9A 3GISB 4RSPA 2GMTC 1C1NA 1ELDE 3P8NA 2VGCC 3NRLA 3SU1A 5TCCA 1T8OA 1EB1H 1AFQB 2QE7D 1PQ8A 4GPGA 1C5SA 3MH7A 1GHBF 1XVOA 3MHWU 4ABEA 1Z6JH 5EQRA 5C5NA 5C1YA 3RXAA 5C1UA 5L6NH 1UW7A 4FUFA 4MNXA 1IHTH 5FBEA 2STAE 3UNRA 2FI4E 4MPXA 3BTQE 3W94A 1ELBA 2GVFA 3MH4A 1K21H 1VITG 1QL7A 2GX4A 1SGFA 4NFFA 1CGIE 1WTHD 2Z9KA 5A8YA 2KZ4A 1RTKA 1PFXC 2I6SA 1XUFA 5CDFE 3BV9B 1DFPA 3S9CA 1K1OA 2J9NA 3GICB 2VWNA 1EJMA 3OSYA 1RXPA 2BY8X 2J98A 1AFEH 3H5CB 1TWXB 4ZUHA 1EAXA 1P11E 3QTOH 4INKA 1O2UA 3VB6A 4X2YA 2VVUA 2ZDNA 4LXBH 4WMDA 4WY3A 1H8IH 4DIHH 2J5UA 2KX4A 1SBWA 2FLBH 1MCTA 1C5NH 1M9UA 3TJOA 4AGKA 3SJ9A 2V6NA 4KP0A 5A8XA 3ODDA 1UHBB 2AIQA 1AZZA 3KQBA 2AS9A 1BB0B 3NWUA 4YOIA 3BSQA 5TCAA 5BPEA 1O37A 1F0RA 3MMGA 1A4WH 1CQQA 3ZZCA 1BA8B 2UUJB 1BBRH 3M3SA 1DY8A 1CA0C 3P8FA 5DP3A 1O5EH 3OEHD 4I7YH 1EZXC 2BDAA 2IJOB 1KMHB 5EOKA 3ZZ6A 3URDA 1JXPA 2NWNA 3MWIU 5EPYA 3N99A 3MU4A 2B7DH 2Y80A 3LGUA 3RXTA 2ZGCA 3RM0H 1FXYA 1O3GA 2ZIQH 1SQTA 1SI5H 3RC6A 3E0PB 3BTDE 6CHAC 4I86A 1EPTB 3GCOA 5C67A 2FPZA 1G2LA 1WV7H 2J92A 4JZ1A 1DSUA 5AFZH 4GUXA 4O3UA 4GVUA 1F5LA 4GAWA 1L4DA 5B6OA 4TT3D 2SGDE 3U28C 3UOUA 1FY3A 2KCPA 4THNH 2XC4A 1C5XB 1ZTJA 2B0FA 1C2MA 1ZSKA 2STBE 3U98H 4ZXXH 1HFDA 4Y79A 3SNDA 3TH4H 2P8OB 3PWBA 1E37B 2ZDVH 1HIAA 2BMGB 1GI5A 2Z9JA 2D2DA 2FTMA 1AI8H 2G4UA 2ZHFH 1T8LA 3PTBA 3HK3B 3A86A 3TNSA 5KEDA 1W11U 2ILNA 3GOVB 1TA6A 1Q3XA 1H4WA 1K1LA 3N7OA 1SVPA 3KNXA 4DVAU 4NWKA 2FZZA 1QBVH 3M35A 1V2WT 1YC0A 2ZDMA 4O9VA 1A3BH 1LVOA 1N6XA 2ZCHP 1NC6A 3UB0A 3A81A 2A7CA 1EKBB 1HUTH 1DOJA 3S69A 4OS7A 3GCHC 3MO6A 5J4QA 1IQNA 4BAKB 3D62A 4A5TS 2GTBA 4I31A 2Z7FE 2A4GA 4XDEA 3B8JA 3UNSA 1DX5M 4WF8A 1GI0A 3RP2A 2B5TB 2C90B 1GBMA 2RDLA 2AHME 3LGIA 1W12U 3ZVEA 4ABBA 2GJGA 3L33A 2BM2A 1C5UA 2FYQA 2LPRA 3OY5U 4YZUA 2XWAA 3ZZ5A 3RMMH 2EI6A 4BTUB 2G52A 2QA9E 4X8TH 4CHAC 4FUJA 3RC4A 2ZP0H 1KYNA 2FEQH 5JBCS 2ZU3A 2VVCA 1FAKH 4X8SH 3SUDA 2EI7A 2G5NA 1F0TA 3RLWH 1MAXA 2GGVB 1YCPH 5AFYH 2F3CE 5JYIA 1QCPA 1AE8H 4I32A 4Q2KA 1AE5A 3S7KB 2FOBA 5DN6D 4ASUD 2UUFB 1ZMNA 3HGNA 1V2VT 4U32A 2GP9B 3F2HA 1EAIA 2SGFE 4WWYA 4TY6A 3SV9A 2XC5A 2CJIA 1GBLA 3CNRA 3HGPA 1O2LA 5JBAS 4NZQA 1GJ4H 3M3VA 1EQ9A 2BY9X 1E79D 1EOJA 1ABJH 1SB1H 4SGBE 1ORFA 3M5LA 1NESE 4WH8A 8LPRA 3MH5A 2P16A 5BRRE 3RXFA 2BXUH 2CHAB 2PV9B 3TJUA 3F2FA 2XNIA 4XFQA 5DPAA 4A7IB 1FDPA 1LQDB 2PUQH 4B2BA 1BTWA 1C1RA 1OS8A 2AMDA 4K3JA 2AEIH 4X1SU 3VXFH 3P70B 1G3EA 1C5LH 4ZKSU 1SC8U 3LJOA 1TONA 1IQLA 3AASA 1NFYA 1O3EA 1MUEB 5EW2H 1Z1IA 1O2RA 4H6SB 5DO4H 3OEED 5HM9A 4YESB 1TRNA 1PYTC 4GLYA 4B75A 3M36A 3TH3H 3H7OA 3H09A 3RXRA 1W14U 5ESTE 1WYKA 1P2OA 1YP9A 4DOQA 3MU0A 2JIZD 3M61U 1G3DA 2A45B 4FU7A 5HGGA 1GBIA 1DY9A 2OC8A 3IITA 1L0ZA 2BLOA 3PO1B 1K22H 1C5QA 3PROA 2GCHF 2OXSA 4D76A 2AMPA 2W26A 1NZQH 2ZNKH 5GWZA 1IOEA 1UCYH 1GI9B 1C1TA 2Z9IA 2JDID 1MH0A 1OOKB 2ZHQH 3CS7A 3R3GB 4B6EA 3P92A 3PLKA 3O8RA 3UQVA 1RRKA 1QJ1B 1TNHA 4ZKNU 2XNDD 3FANA 3PWCA 2VIDA 4BTTB 2ZFTA 4CRDA 2HOBA 1EASA 1UTPA 4DGJA 1O5DH 3SNEA 2UWLA 5JB9S 4YTAA 1G2MA 2A2XH 3SU5A 3EA9A 3GDSA 1CT0E 4E7NA 1MAYA 4FUEA 1ETSH 5DJ7A 2Z9LA 4D9QA 1MTSA 1DSTA 3HKIB 2BDBA 4YT6H 2H9EH 2WV5A 1HB0B 1A61H 2OP9A 1GI1A 4VGCB 1UVPA 4FVBA 2M5TA 4AZ2B 1S0RA 1KXFA 3QO6A 5DP8A 5DSFA 1FI8A 3HKJB 1F0SA 7GCHF 1OWIA 2KFWA 5CHBA 1IAUA 1OP0A 3SU3A 2CGAA 3F0OA 1ZTKA 4OS6A 2H1UA 2QIQA 1P05A 1ZPBA 2SNWA 2JH0D 4XBBA 4YLQH 1UTQA 1TGNA 2FOHA 3QN7A 3RXQA 1MTNB 3BTGE 1NRQH 1PPGE 4INLA 1O3PB 1ZPZA 4AFUA 4D8NA 2HNTE 3RXOA 1YPLH 3AW1A 1V2KT 3BTHE 4TPYA 1BHXB 2ULLA 2VH6A 3U8RH 1SLVB 1C1VH 1O31A 4Q80A 1ZYOA 1GWAA 3SQEE 1O3HA 3SI4H 2ZKSA 3A7WA 1WOFA 1DT2A 4JZDH 1RIWB 8GCHG 5C5OA 3LU9B 1V2ST 1MTVA 1C1UH 4HFPB 1C2EA 2OTVA 1V2MT 3LJJA 1SGYE 2P8OC 3GS9A 1NBMD 1QTFA 4A1TA 4IN2A 1J8AA 1GI2A 1O2HA 4GHQA 4AOQA 4YOJA 1U6QA 5K0HA 1TPSA 3H7TA 1HJAB 3RU4D 4AORA 4DJZB 4BOHA 3SJOA 1T32A 1YLDA 4GHTA 2HLDD 3G01A 3DHKH 2ZQ2A 4ZH8A 1AHTH 1EZQA 5GPIB 2ZECA 4FOUC 3ZIAD 1HAOH 2ZTXA 2P3TB 4AYYB 1LVMA 2C8XB 1ETTH 1BJUA 1UK4A 2GCTC 3GCTG 3OYPA 2Q6GA 1XKAC 2EQNA 5GCHF 4K1SA 4Y8XA 4Y7BA 3I77A 5HMAA 1C2DA 3RLYH 2Z3DA 1P03A 1PPHE 1IQGA 3C1KA 4Q7ZA 4Y8ZA 5KECA 2F43B 3OU0A 1BQYA 1OX1A 3P8GA 4WVPE 3P8OA 2PTCE 3BG8A 1K1MA 3STIA 3P17H 3NXPA 1WUNH 3PMAB 1TMUH 3VEQB 2ODPA 3VB3A 2IPQX 4BAQB 2HLCA 4AC9A 2H9TH 3GCNA 1O5AB 1P2NA 1VITF 3SUFA 2LELA 3OTPA 1DWDH 1O3BA 1OP8A 2BQWB 1RJXB 3IWMA 1BUIA 2GT8A 3LGVA 4P00A 2KM0A 5FHTA 2Q6FA 4D7FA 4NFEA 5G4BA 5T1VA 4OM9A 1AKSB 1GCTC 3BTME 2XBWA 5FL7D 2ODQA 4E7RG 1WSSH 1BRCE 1E38B 1MZAA 3UWJH 2JJ1D 3RU4E 1OWJA 3PV5A 1SGRE 1CBWB 3DA9B 1NPMA 4AG2A 2A4RA 1LPZB 1BITA 3ITIA 2CXVA 1FLEE 3LC5A 3ZVGA 1GBHA 3ZZAA 4AYVB 2JKHA 3U8OH 1BBRE 3VXEH 2PKSB 2BY5X 2RG3A 1YM0A 2YNBA 1OHHD 5LPRA 5JB8S 1JIMA 1JOUB 1PJPA 4XOJA 1SL3A 3TVJB 1E36B 1TIOA 1NM6A 4FETA 3A7VA 1FAXA 9ESTA 3F68H 1KLJH 2ZPRA 4XSKU 4F48B 1MKXK 4K1EA 6ESTA 1P9SA 2ZU1A 3EGKH 5F03A 3ATKA 3O8BA 3LOXA 2PKAA 1FIWA 2CHAC 1F2SE 1V2UT 3EYDA 3MO9A 3TK6A 5LPFA 4KKDA 3SI3H 1B0EA 4ISHH 5JPMH 5EU8A 5PTPA 4ZKOU 2OBQA 1GHWH 1O2IA 5C3NA 1G30B 1O3AA 4BAOB 2G5VA 1GG6C 1AVXA 2FIRH 5I46H 1SGCA 3VPKA 2WSSD 1MQ6A 3M5MA 3F9GA 1BRUP 4B6FA 1C4V2 6GCHF 2IPHA 3S9AA 4X1PU 2ZI2H 1KXDA 2KAIA 2ZF0H 1GHZA 1E1RD 1PPBH 4HG6A 5GIBA 4E05H 1NROH 1SQAA 1V2NT 3MNSA 1XM1A 3UREA 5EODA 3F2GA 4ACAA 3BIVH 2BD9A 4AFSA 1YWUA 2G4TA 2QXGA 3QWCH 2F83A 1SGEE 2PUXB 2FTLE 1GBEA 2BD8A 3TK9A 2L74A 2GZ9A 1Y3VA 3SUEA 3E16B 1S81A 1YPEH 1A0JA 1UO6A 4Q7XA 2ZQ1A 5F53A 1P2MA 3AAVA 4YXWD 1W13U 4DW2U 2GZ8A 1IQFA 2C4FH 1P12E 2VWLA 4FU9A 1K9OE 1QGFA 2Y82A 4I8JA 3O8CA 1NU9A 3F1SB 3SGQE 5DP4A 1OYQA 1KXAA 2J4IA 6LPRA 1ZHRA 1LDTT 4IC5A 4NGAH 3T26A 3FOAA 1O2ZA 3RC5A 5EQSA 3T28A 2P3FH 1C9TA 1ELEE 2A32A 3C27B 3WY8A 3TGKE 1GBBA 2Y5FA 1IQHA 3SHAH 2DUCA 4X1RU 2A4OA 1UMAH 5SGAE 1GCDA 1GDQA 3A7ZA 1QL8A 1O2MA 2O8MA 4O3TA 4TY7A 3U69H 5C94A 1C5ZB 1ZHPA 3UTUH 2XBXA 1C5PA 1TQ0B 4PROA 2YMSD 3E90B 5FX6A 3MU5A 1O39A 1LHEH 3SJIA 1OWEA 4HGCA 3S7HB 4TPIZ 5F6MA 2AYWA 2ZFPH 3RXIA 1LMWB 1TFXA 1VCWA 2P95A 2R2WU 1YPMH 5C0UA 1GJAB 5E0GA 4CRBA 1NTPA 2BVRH 3V3MA 3V13A 1ZGVA 1QA7A 3MNBA 3ODFA 1OSSA 3V7TA 3RXJA 3KN2A 3LH1A 5IYTA 1ANEA 1KLIH 2QF0A 1C9PA 1Y3UA 2H9HA 2W6JD 4X6NA 1Z7KA
chains in the Genus database with same CATH topology
1GMDF 1GMHG 1BOQA 1L1JA 1VJAU 3VB4A 1ABIH 1GMCG 4BAMB 2TRMA 4B2CA 2VJ1A 4MPUA 2ZGJA 4H6TA 1HIAB 1GBDA 1RIWC 3FP8E 1HPGA 3MU8A 3K9XB 4FUHA 3UIRA 3LH3A 1O2PA 2CV3A 4ZHMU 2ZZUH 3HK6B 1V2JT 2GKVE 1O3CA 1C2GA 2VIWA 1N8OC 1GJ8B 2Y5GA 2O8WA 1SGNE 3KGPA 1KXEA 2DE8A 7ESTE 1RGQA 1O32A 1O3FA 2VU8E 1FY8E 5FX5A 4CREA 3FZDA 4BNRA 1O5FH 1QY6A 1GBJA 4JZEH 2AH4X 2D26C 1GHXH 2QYIA 2OQ5A 1J14A 4JCNA 3ZVCA 5JBTA 2ZHEH 1O2QA 1UVUH 1C5YB 4M7GA 2Y7XA 1TNLA 4E06H 1P3CA 1P10A 2ZO3H 1AIXH 2QXIA 3D23A 3W95A 4X2WA 1A5HA 2VNTA 1C5VA 2OQUA 2XBYA 3RXMA 3ZZ7A 4CRGA 2XBVA 4K2YA 3SV2H 4D7GA 1O2SA 2SGEE 1QA0A 2XYAA 1G32B 2XTTB 4OS5A 3M3TA 3TIUA 2NU2E 2W3IA 4NA9H 1UCYE 4UFEH 1QJ7B 1TRMA 4AN7A 2PFEA 2VIPA 1YPHC 1SGQE 1UTLM 1UHBA 1SGFG 3LIWA 3QX5H 2HGTH 2BVXH 3D49H 5T3HA 3ZVDA 1MMJN 2Z3CA 1FUJA 1QL9A 2CF8H 1AVGH 1DWCH 3DD2H 1ACBE 3MFJA 4HZHA 3TU7H 3ZZ4A 1P02A 3OY6U 4BTIB 1EZSC 1YKTA 5FPYA 1YF4A 2VVVA 2Y6TA 1C1WH 1ELTA 2HRVA 1QHRB 3PYHA 1CHGA 1NN6A 2WINI 3D65E 3JZ2B 2G81E 2H5CA 4FXGH 1GHBG 1KXCA 3A7TA 4MG3A 3E3TA 1BJVA 2PR3A 1XUJA 2F91A 1D3QB 2A5IA 1AN1E 3MI4A 1THSH 3BG4C 2WPMS 3ZZBA 1C5MD 4MVNA 4X6MA 3LONA 3I78A 1CHOF 1C5WB 4IGDA 3BIUH 4OGYA 2BD2A 1FV9A 2B8OH 2ZDLA 5ETXA 1NFXA 3T5FH 1NRPH 5HXFA 4ISLA 1V2TT 2ZPQA 1W3CA 2V0BA 5JDUB 1D6RA 3E6PH 5EXNA 1Y8TA 1GVZA 3EE0B 1HDTH 3ZV8A 1G36A 5DP7A 3CENA 3PMJA 2FODA 2OCVB 3KEEA 3KF2A 1DWEH 1O38A 1QJ6B 3KQDA 4X6PA 1V2OT 1W10U 1X7AC 1O3IA 1VJ9U 2CF9H 2BQ6B 3VGCB 3UFAA 2ZC9H 4NIVA 3RXCA 1BT7A 2W5EA 3A89A 4UEHH 2GDDA 1WTGH 1KDQA 3FFGA 2OC1A 5LPEA 1TBZH 1P2KA 2ANMH 3V0XA 4AB8A 4JYVH 1KLTA 1TQ7B 2G51A 3P95A 2VWOA 4WMEA 4Y0ZE 3ZVFA 2WYJA 1VCPA 1THPB 5FBIA 1KY9A 1ELFA 2FOCA 4FUCA 3RXHA 4AB9A 5L30H 1INCA 1WQSA 3M7TA 2ZHDA 3ATMA 1UVSH 3RMOH 1C2IA 2Z6BD 3BTEE 3A80A 1J9CH 1RTFB 2J95A 2GV6A 4ZXYH 5C2ZA 1O3DA 2H5DA 1VGCC 3F9HA 2HPQH 1A46H 4FVDA 2XW9A 1BTPA 1AFQC 3TPIZ 1QR3E 1NRNH 1O30A 1SLXB 2BD5A 2ZGBH 4I8HA 2BDGA 5I25A 4K8BA 2ZHWH 2ZPSA 1LVBA 1TX6A 1L2EA 4X1NU 1A0HB 2OD3B 3PMHB 1IQMA 1TNGA 4ASHA 1SGPE 4OS2A 1RTLA 2UWOA 1D9IA 1DS2E 1RFNA 2ZCLP 1SGTA 3RDZA 1PQAA 3B9FH 1MTWA 2BDYA 2ZU4A 1MKWK 5J4SA 1DDJA 3SNAA 1BRBE 1DXWA 3A83A 3RMLH 1OXGA 3E8LA 4ABHA 5EPNA 1H9LB 1O33A 4AG1A 4MNYA 3BTKE 2ANWA 1FY1A 1ELGA 4FUDA 3QTVH 1NO9H 1JRSA 1P3EA 3F9EA 1CO7E 3SOSA 3M37A 3AW0A 5FXLA 1C1PA 3LGYA 1T7CA 1SG8B 2UUKB 1KTSB 2BZAA 4JYTA 1G37A 4I33A 4UE7H 1ZOMA 3RXDA 2QV1A 4U2WA 3QK1A 1VCQA 3MYWA 1IQIA 2CMYA 1ARBA 4R0IA 2GMTB 2BXTH 4K1TA 3GDUA 4OS1A 2BLVA 1ZR0A 1XUGA 1C1MA 1EZUC 4KTSA 3GY6A 3SGBE 5L2YH 1EOLA 3S9BA 2TBSA 3DFLA 3EA8A 3F9FA 1SFIA 1J16A 4ZHAA 1ELAA 1EUFA 3E91A 1JBUH 4A1XA 3KHVA 3NUMA 3ZZ8A 4GSOA 1A5GH 1CGHA 1HAVB 2IOTA 4A1VA 1T4VH 3T62A 2R2MB 2OC0A 5CHAB 3TGJE 1FIZA 2EEKA 2FYRA 2PLXA 4K5ZA 2BY6X 3PM3A 2XC0A 1EPTC 3IG6B 3FP6E 1TMBH 1C5RA 1C5TA 1QRXA 2HALA 5JBBS 2EA3A 3RXGA 1ARCA 1MQ5A 1ZPCA 4GCHF 4OGXA 4JZFH 2ZGXH 2F9OA 1FN8A 1LHCH 1GHAF 1SPJA 4XBDA 1S83A 1ZSJA 1SOTA 2THFB 3FVFB 1LHGH 1MBMA 2DE9A 2V3OH 1NFUA 2F9UA 1HAZB 3SZNA 8ESTE 4X8VH 2TPIZ 2ZFSA 5EXMA 1CU1A 1FNIA 3SU2A 1QURH 1ELVA 1A0LA 2PWXA 2QC2A 2O8LA 1GBTA 3TITA 1QBNA 5LGOA 1HAGE 3FZZA 4TWWA 1Y3YA 3BTFE 1O2YA 1BHXF 1MD7A 2NU0E 5EGMA 1YYY1 3LGWA 1GBCA 1CA0B 1K1IA 1SSXA 5T6GA 1SGDE 2AGEX 1GPZA 1GVKB 1P06A 5EXLA 2ZTYA 4DG4A 4B2AA 3A8BA 4B71A 4LK4A 1O35A 5F8TA 4B76A 2A5KA 1DICA 1AWFH 4F4OC 1JRTA 2C3SA 1DPOA 6CHAB 2JH6D 1PQ5A 2FDAA 1O5BB 1OPHB 1Y5UT 3FAOA 3RM2H 4I8GA 4WJG2 1FONA 4OS4A 2C8ZB 3RU4T 4AFQA 1G9IE 4CBOA 1ANCA 1RS0A 4X6OA 3A8AA 5IDKA 3TJVA 3RXEA 3PLPA 3ENSB 1B7XB 1K1JA 3T29A 2BY7X 4KGAA 2SFAA 3CP7A 1V2PT 1GI8B 1YPGH 1Z8IB 3ATLA 1K28D 5K7RA 2Q1JA 1C1QA 1O3NA 4UDWH 3U9AH 1S0QA 4JK6A 4Y71A 5DP5A 3URCA 1LQEA 1Z8GA 2C93B 1LTOA 2BLWA 2BTCE 2QCYA 3GY3A 2ZDAH 1GI6A 4JZIA 3E0NB 5A0BA 1D6WA 2ASUB 1GJ9B 4SGAE 1GDUA 4CH2B 2FOEA 1SOZA 1QRWA 1CT4E 1JIRA 1BMAA 3T27A 1HGTH 2TGDA 1O34A 3ATIA 1CSOE 2FI5E 3MOCA 3TK5A 1ZRBA 4QT8C 5A8ZA 1T8MA 2UUYA 1YCPM 2WUBA 2FOGA 2PSYA 4ABIA 3ELAH 1UK2A 4Q7YA 5CMXH 4XBCA 1TALA 1S6FA 1SR5C 3UQOA 2BDCA 4Y7AA 2ZU5A 2VH0A 3ESTA 1UJ1A 2A31A 1WU1A 3ZVBA 1E35B 2ZFQH 3M7UA 1ANDA 1AU8A 1HAHH 1ZMLA 1DVAH 3LGTA 5E2OA 1DLEA 1HRTH 1L1NA 2WPJS 1O2VA 2J2UA 5A0CA 1F5KU 5T6DA 1TAWA 1A3EH 1TGTA 4NA8A 4ISOA 5DG6A 1HJ9A 3PB1E 4K69A 1BTXA 2OBOA 3SV7A 1BTHH 3MO3A 1O2GH 4X8UH 3SBKA 1QQUA 3F6UH 2GZ7A 1ZMJA 1AKSA 3UWIA 4ZMAH 1OWDA 1ESBA 4X0WU 2Q6DA 1NFWA 1YLCA 2AERH 2LNCA 1P2JA 1DM4B 1CA8B 4NZLA 3SU0A 4B73A 1SGIB 1Z8JB 1S6HA 2ALPA 1ELCA 2YNAA 3I29A 5ABWA 1TX7A 1Y5AT 3PO1C 5C20A 1UVTH 2BZ6H 4IBLH 2QY0B 3LC3A 2OLGA 1TGBA 5AVDA 3QLPH 4ABGA 1ZJDA 4DT7B 3SNCA 1AUJA 1MKXH 4X2XA 1O5CB 3UNQA 2G8TA 5F8ZA 1LHDH 1W0ZU 1Y3XA 1O2TA 1EJNA 1VR1H 3NKKA 1HNEE 4NSVA 1C4Y2 3QGJA 3Q77A 4KTUA 3PLBA 2OINA 5DK1A 1DXPA 1PYTD 1EP6A 2UWPA 2BOHB 1LKAA 3R0FA 1C2JA 1XUIA 1TBQH 2XRCA 1GBFA 4UFDH 4UONA 4YLUA 4IMQA 1P9UA 1LCYA 4WXVA 1FJSA 4NG9H 2HNTC 5GCHG 1XKBC 1ZHMA 3DFJA 2EC9H 1SFQB 4VGCC 4NIYA 4CRCA 4J2YB 1HAPH 2WPLS 3SUGA 1BBRK 1TPPA 1AD8H 2FS8A 4Y0YE 2AFQB 4TWYA 2ZFRH 5CHAC 1SHHB 4U30A 3PMBB 3A8CA 1GHYH 5LH8A 3MNCA 2FX4A 1OWKA 2RA0A 1K1PA 1Q31A 3L3TA 4KTCA 1HBTH 4YOGA 2R3UA 3A85A 2TGTA 2W3KA 1TGCA 1MTNC 1TYNA 3EA7A 4FUGA 1W2KH 1P01A 4FUIA 4DY7B 2ESTE 3QZRA 2TGAA 2QAAA 1CVWH 4ABJA 2RCEA 1GGDB 3TNTA 1S84A 1QB9A 1W7GH 7LPRA 1LPKB 1O3MA 1BDAA 1P09A 1QQ4A 1FY4A 3QGNB 2PGQB 1T8NA 1HYLA 2VB0A 1VITH 3VB5A 3SO3A 1WBGB 2A0QB 1TPAE 1UTKA 5E0HA 1XX9A 1HJAC 1G3BA 1PPCE 1F5RA 5GDSH 1CGJE 4ABDA 1ESAA 3A87A 2Y7ZA 1AUTC 1ETRH 2PSXA 3ZYEA 3SV6A 1KXBA 2FI3E 2H2ZA 2EI8A 1S85A 3VFEA 1E0FD 2O9QA 5L2ZH 1RD3B 1MZDA 1O36A 1XMNB 3K2UA 5T6FA 1SLUB 3LKWA 1HAYB 4XE4A 3RXUA 2F9VA 6GCHG 2VIQA 1P04A 1A5IA 5AHGH 2ZWLH 3BF6H 1H9HE 1EB2A 3ZZDA 3NCLA 1TOMH 4I8KA 1AGJA 1KTTB 2QXJA 1HJ8A 2FXRA 1DWBH 1V3XA 4UFGH 1GL1A 1LVYA 5GJ4B 4H4FA 2ZU2A 3LDXH 1O0DH 1K2I1 5ESBA 1C2FA 2BD3A 3RXVA 3A88A 4MNVA 4O97A 3UR9A 4MQAA 4MTBA 5FCRA 1H8DH 5EQQA 1GI4A 3ATWA 5E2PA 3A7XA 3AVZA 1NS3A 3U1JB 3UR6A 5A2MH 1O3LA 1OWHA 2BYAX 3BEIB 3FP7E 1EX3A 2AGIX 2Z3EA 1KDQB 2WYGA 2NU1E 3RUOA 1Z6EA 1CBWC 4YM9A 1ZLRA 2JETB 2VWMA 1YCPK 1LPGB 1D3TB 1XUHA 2PKSC 3P6ZB 2BQ7B 1EATA 1TOCB 2J94A 2VIVA 1EAWA 2BOKA 4JK5A 4DCDA 4ISIH 5EG4A 5TJXA 1ANBA 1EPTA 3M5OA 4H42U 2GCTB 1TLDA 1IQJA 3L6PA 1FPCH 3ZZ9A 3Q3YA 4LZ4B 1GJ5H 3ZV9A 3HATH 1BIOA 1LHFH 1FPHH 1PQ7A 2PGBB 2TGPZ 1AZ8A 2VIOA 2IN2A 2BX4A 3TGIE 1O2KA 1V2RT 1W7XH 3T25A 1AWHB 1J15A 2G55A 3K6YA 1XXFA 3QDZB 1XXDA 2C8WB 4AFZA 2SNVA 2WV4A 4HTCH 2W7SA 2FOMB 1QB6A 2JH5D 3LT3A 3SNBA 2FS9A 1FN6A 1GI7B 2YOLA 2HVXA 2BDIA 3SJKA 1QFKH 2BVSH 3MU1A 1EAUA 2QXHA 2FOFA 1GMDG 1GCTB 1FZZA 2J34A 5A09A 1H9IE 2R9PA 3AAUA 5E0JA 1S5SA 3U8TH 1V6DA 2QGRA 2ZCKP 1F92A 1IQEA 1JMOH 1HAIH 1Z71A 1TA2A 1V2LT 2D1JA 1VZQH 3UOPA 8GCHF 1TBRH 4X1QU 5F8XA 5DKMA 1HCGA 2AMQA 2FX6A 3Q3KA 4LZ1H 1C4U2 1YBWA 1MBQA 1O2JA 4NA7A 1O2WA 2BHGA 3GY4A 2AIPA 2XWBI 1TNIA 4F49A 1HXFH 1C2KA 4INHA 3GDVA 1TX8A 4IS5A 1DUAA 2WPKS 2R0LA 2PTNA 1F7ZA 1G3CA 4K60A 1UCYK 1D4PB 1OP2A 1Z1JA 1AQ7A 3VB7A 3UUZA 1LKBA 1QRZA 2GDEH 1GBAA 3Q00A 2ZFFH 1Y3WA 3NPSA 2WUCA 4RN6A 3SGAE 4A6LA 4CR5A 4DURA 1GG6B 3RXBA 3GCTF 3RXLA 1BMMH 3A8DA 1XUKA 3GY5A 1Q2WA 3MH6A 2WPIS 2BD4A 1XVMA 3M7QA 4NIXA 2NU3E 3TJNA 1NU7B 1C2HA 3TLOA 3K6ZA 1BRAA 3QUMP 4WH6A 4CRAA 3SORA 4ABFA 1Y59T 1GI3A 2FMJA 1PPZA 2BB4A 4AX9H 1GBKA 4ZAEA 2OUAA 2BX3A 3BEUA 4NIWA 1OKXA 3GYMA 2A1DB 1C1OA 1AB9B 4O03A 1BCUH 1UVOA 2A7HA 4YT7H 1Y5BT 2ANYA 1C5OH 4X2VA 3EDXB 1NT1A 2FWWA 1W0YH 4A92A 5C1XA 2G00A 2ZTZA 1BMLA 1AY6H 5A0AE 4J1YA 3BTTE 4IC6A 4CBNA 3SW2B 2VGCB 5FPTA 4ESTE 1F0UA 3GY8A 2OC7A 2P59A 4ZHLU 2ANKH 1GGDC 1LO6A 2HPPH 4MPVA 5FAHA 2ZGHA 4RKJB 4Y6DA 5E8EH 1B0FA 3EQ0H 4WXIA 1O3OA 1TE0A 1GJ7B 1MKWH 3O8DA 4I8LA 3K65B 5CE1A 1DITH 1NRSH 1ZGIA 3A7YA 5FCKA 3Q76A 1CHOG 1UTJA 1GL0E 2SGPE 1ZJKA 2BDHA 2V35A 4IW4E 3GY2A 3KQCA 4UD9H 2FESH 4R8TB 2HNTF 3LPRA 4ZKRU 1QB1A 3M5NA 1Z8RA 1BTZA 3SU4A 1K1NA 2XXLA 1GDNA 4WMFA 4ABAA 2V3HH 1JWTA 5HYOA 1QBOA 1MU6B 4IN1A 4NSYA 2BLQA 5GXPA