1AKVA

D95a semiquinone flavodoxin mutant from d. vulgaris
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGASSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystallographic investigation of the role of aspartate 95 in the modulation of the redox potentials of Desulfovibrio vulgaris flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
molecule tags Electron transport
total genus 50
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1akvA00
3FVWA 2MTBA 4DILA 2FCRA 5A4KA 2V5UA 5NULA 4QOJA 3ES9A 3TEMA 3LT5A 1OBVA 2FOXA 1J9ZA 4LTNA 2AMJA 2BMVA 2HNAA 5B3KA 1TIKA 5EMNA 4FGLA 1NNI1 1RLJA 3NLLA 4DIKA 3HR4A 2RG1A 4QOFA 3ESYA 3F90A 4S24A 3U7RA 2OHHA 4ESEA 1AG9A 1D03A 1FLAA 3O2NA 3S2YA 3L9XA 3NHFA 3QFRA 2V9CA 2QWXA 2FX2A 2GSWA 1XYVA 3UXHA 1GG5A 1T0IA 3ZHOA 1FLDA 4ZVMA 2MWMA 5F51A 3W77A 1F4PA 4LTDA 1ZWKA 1RLIA 4NULA 4ZVNA 3P0RA 3NHPA 3U7IA 3KAPA 1JA1A 2FAXA 3QE2A 3N3BC 5JROA 4XDHA 1BVYF 4N65A 4CF6A 1OFVA 3R6WA 3F6RA 5BUCA 1I1OA 4GI5A 5LJLA 1DXOA 2R97A 1X77A 4FX2A 1T5BA 4H6PA 4LAFA 2X2PA 2M6SA 3K20A 4U7FA 3NFRA 3GFSA 3UXEA 4N82A 2QMZA 1RCFA 1OBOA 3NHJA 1AKRA 4DY4A 3N3AC 2FZVA 4YAFA 4YQEA 2QX8A 1QRDA 3NHKA 2HNBA 4F8YA 1D04A 4Y9UA 4M0CA 4C0WA 1QR2A 2MOKA 2XOEA 1YOBA 1JA0A 4C14A 1H66A 3KLBA 3NHSA 4YALA 4OXXA 4D02A 3B6IA 4Y7CA 3GAMA 4YAOA 5LJIA 5LMCA 3OX1A 2D5IA 4R81A 3B6KA 2QMYA 1WSBA 5ULLA 2QR2A 2WC1A 1ZX1A 1AKUA 5LVAA 1D4AA 3QFCA 1CZUA 4XDGA 1E5DA 3L9WA 1CZRA 4H2DA 3RPEA 2BZSA 3KEGA 1AZLA 5FUQA 2QX6A 1YCFA 2FLVA 2Z9BA 3OWXA 2BF4A 3NHRA 5NLLA 1YKGA 3GFQA 3G5MA 1FLNA 3D7NA 1XI2A 3OX3A 4PTYA 4BMOB 1CZKA 1RTTA 1AKQA 2R96A 5EA2A 1XYYA 3OJWA 5B3LA 1KBOA 5TGZA 6NULA 1QBGA 1FLVA 2Q9UA 4LTMA 3W7AA 1C7FA 1AMOA 4ZVKA 4QOGA 2KLBA 2BN4A 3F6SA 2X2OA 1J9EA 3ESXA 4LA4A 2Z9DA 3NHWA 1YCGA 3NHUA 4U7GA 5FX2A 3HA2A 3OJXA 3TE7A 1BU5A 4PU0A 3FX2A 2B3DA 2HPVA 2Q62A 4GQIA 2OHIA 3KAQA 3O73A 1AHNA 5F12A 3NHLA 4YAUA 3N39C 1YRHA 1XT6A 2MT9A 2OYSA 3TZBA 3W79A 1J8QA 3HLYA 1SQSA 3OVMA 3FW1A 1AKVA 3W78A 5F4BA 2XODA 5FA6A 3OWHA 5EAIA 3JSXA 2FVXA 3LCMA 2Z98A 1FTGA 2QX4A 1CZHA 3B6MA 4BMPB 4HS4A 1KBQA 5LLDA 4Y9RA 1V4BA 4QODA 2KQUA 1CZNA 3EYWA 4YAWA 3SVLA 1ZWLA 1C7EA 4CETA 2FZ5A 4PTZA 3OX2A 3GFRA 2BPOA 1YDGA 4J8PA 4N9QA 5LBUA 1YCHA 4HEQA 2N1MA 1AKWA 2ZKIA 3FJOA 1DXQA 1CZLA 2Z9CA 2ARKA 2V5VA 5LBTA 2F1OA 1AKTA 4U7HA 1FVXA 1CZOA 1QHEA 4QOEA 1H69A 1FUEA 3ESZA 1FX1A 4FGKA 4GR9A 3B6JA 1B1CA 4NLLA 1SG0A 1WSWA 3EDOA 4FGJA 1TLLA 1VMEA 2OHJA 1DX9A 4ICIA 4C0XA 2QX9A 2FDXA 2W5UA 3F2VA 3NHYA 4ZVLA 2M6RA 4QOHA 3FNIA 3K1YA 4QOIA 4C76A 2A5LA 1J9GA
chains in the Genus database with same CATH superfamily
2HTEA 3EGWA 4N5HX 3CBGA 3EDYA 2G17A 4GI3A 3CS3A 3CNOA 3OLVA 3WZ2A 5BVGB 4QPDA 2V8BA 1RW4A 2GBCA 3T1HB 5I9SA 1QYVA 1YQ9A 3UV6A 5JJLA 4C1NA 3CLRC 1H1DA 4PC7A 1GN9A 3ND8A 2JIOA 3HADA 1XLTC 1FIUA 4MO9A 2EJBA 1PL6A 4ND3A 2VDMB 4DW8A 3R24A 5KTPA 1KAHA 2TMKA 3CUTA 2DKFA 1U0JA 2OCBA 4KYTA 5D84A 1LK7A 1NVBA 4BN4A 1COWA 3W3AD 3WYFA 4CWAA 4TQGA 4JT8A 3EISA 1ZLXA 1L8QA 3QF7A 2XAAA 1COWD 1KXJA 2YNMC 4H7IA 1E59A 1TM4E 5DXFA 2IPNA 2QVGA 2WDPA 1ODKA 4M6WB 3ZUPA 4ENTA 4FFNA 2HRRA 2A5JA 3R74A 2WMDA 2I91A 2Z8XA 3O7WA 1A97A 4TTSA 4EUKA 4IWXA 3I9MA 4HATA 4W6QA 3HR4A 1RXUA 2O3SA 3PHIA 1L7OA 4QGHA 1E6WA 1R0YA 2FF5A 3R5KA 4EGJA 2I4IA 4Q12A 1RJDA 4QU0A 1JEYB 2WZBA 3REGA 1REQB 4FT2A 4KXVA 4D6YA 4X6UA 1T9GS 4DDTA 4HYYA 1MB4A 4RHTA 1D03A 3C1UA 3P9XA 1KE2A 4ED9A 3LUDA 4C4OA 5L51A 1Q15A 3JZMA 3OLCX 4Y0AA 4NBTA 1JEAA 3FDIA 4LXIA 2WRZA 3Q5DA 4KXXA 3M82A 4US0R 5FWDA 4L5JA 3TLZA 5JR3A 1LPSA 1M8GA 1F8UA 2FV8A 3O26A 1RZRD 3L7YA 4X1KA 4O1HA 3A1NA 1Z45A 2AFHA 2OZVA 1JZTA 4Y98A 4AS2A 3DV2A 2XVAA 3ND9A 4QASA 3FIJA 1R8XA 1A3CA 3LUCA 4AMBA 3BFVA 4JJ7A 2XNDD 2QMQA 5JH7F 1TXGA 2FFJA 3IPAA 1IDN1 3AR5A 4CM6A 1L5ZA 3HNOA 3KUUA 5H02A 1IPHA 3WJ2A 3EVGA 3IPLA 4O8ZA 4H4CA 3ZYCA 4D8XA 1K4MA 2PGDA 3COJA 4C2TA 5LN1A 2GDZA 4U8HA 4YRBA 1Q7EA 2H2AA 3R6LA 4F2DA 3WFIA 1TFRA 2JGIA 3PKZA 2LNDA 2YWEA 4PX9A 3SQLA 3VZDA 1D8AA 2YWDA 4AY4A 3S44A 2OGZA 5ARDA 4COKA 3AFHA 4M1TA 2HMSA 1UBGA 4EG5A 2WNSA 5EE0A 5EEHA 1RWKA 5DMXA 4K6CA 2OQVA 4U00A 5I7SA 3QY0A 1Z12A 1K8ZB 5DP2A 4QTTB 4S1OA 3PE6A 3ITKA 3FFXA 1D2HA 2FZWA 4UC0A 1TCVA 1V4NA 4LCJA 5AI5A 3PYXA 4C0SA 1GZ7A 1OKKA 5A02A 3BERA 2R4UA 4H08A 4QXRA 1W76A 2IPAB 2FR1A 1ORWA 5E38A 3I9V1 4IJQA 1G20A 1MOZA 5KJFA 2VO1A 4JB3A 5AR1A 4E5DA 4MVJM 5E3IA 3H1EA 1BW9A 5CG1A 5GZ6A 1XQYA 4QPZA 2I2CA 4ZALA 2Q7XA 4G36A 1NVGA 3H5RA 5GJBA 1TF2A 3QI7A 3STUA 4GOKA 4C43A 1SQ6A 4YXWD 2G0NA 3FCCA 1T5BA 2QRMA 1JQ3A 2FXVA 1S9DA 3D6VA 3I4FA 2NYRA 2QZSA 4LBZA 3CB2A 5DNDA 3OTWA 4HXYA 4YHHB 1IJKA 1R8SA 4B87A 4CKEA 2HUPA 4CUJA 2Q4EA 4OEHA 2LVBA 5EJMA 3E9ZA 3MXTA 3EDMA 3DM9B 3JQ7B 3WL4A 2VF4X 5DYGA 1IQRA 3T0GA 4F5ZA 1RC0A 4NZOA 4B40A 1YULA 3NM4A 5BT8A 4LOAA 4FGUA 5ICFA 1Q12A 1YE3A 4AN0A 5K3FB 2I4LA 1SXIA 3EFEA 4UQOA 2J3QA 1ATIA 1NW3A 1QC5B 4JIMA 4MARA 1TKBA 2PKQP 1EEHA 2XQVA 2EJTA 1VM6A 4JLAA 3CZMA 3BMCB 4LXGA 3TM5A 3RSLA 1E9SA 2OBXA 3GJ6A 1A4XA 1JNXX 5A5VA 1IMJA 3FYCA 1JLMA 3MQ2A 1QIEA 2PEYA 1E5TA 4AXXA 5K09A 3KV3O 4DQ0A 1NTOA 1W52X 5SICE 4URWR 2FEAA 3WL3A 2GFHA 1QF6A 4AQYB 3KEQA 2Q50A 4N3NA 4O08A 3MRVA 4R1NA 3WGQA 3W5AA 5I8ZA 3R7DA 1XCLA 2MOKA 1MQSA 4W1RA 3UKDA 3UMCA 4JD5A 3CR7A 4L6CA 2QA5A 4F91B 5IKEA 3AUFA 2YC2C 3E6AA 2QV7A 1P1CA 2AH5A 1FFWA 1MJGM 2GLXA 3MJRA 4QFMA 2GZ1A 2ZR0A 4RV5A 2H4XA 2ZG6A 4ZTBA 4D1YA 3PEEA 3ELDA 2OXCA 3OF2A 3P97A 3HU5A 1SWVA 2W2LA 4NCKA 1E2HA 2AI2A 2V58A 3OZWA 4RLSA 1IY2A 2OAP1 2XNCA 1W88B 3PC2A 4WKNA 5CLQA 4Y2JA 1RM4A 3EUAA 2WU4A 1RYZA 3CPEA 4TQAA 1DQSA 2XMPA 3PPYA 5FOSA 2O1XA 2I4NA 3AF4A 5AJWA 3RGGA 5AFSA 4O5OA 4KWTA 4X20A 1QP7A 2B5OA 4JQOA 2ZUFA 2N47A 4DDUA 1EFAA 1DAMA 1UR5A 1J8YF 4MQ6A 1J2RA 3B6KA 3WA6A 2Q0HA 3BIWA 1OGJA 3WTCA 1GO2A 4F38A 1LSOA 3PQ4A 4I9FA 1CUYA 1FMCA 4W9NA 2Q2QA 4BVJA 2PGIA 4LW8A 3GJXC 3ZHZA 4WXMA 1TVCA 3R9IA 3ZHCA 3WB9A 3ANTA 1XPJA 3KHSA 2QTVB 4ZQFA 5ELXA 2WWIA 2W7TA 4DL9A 4DHEA 1ISFA 4LHWA 2GA8A 3WK8A 3R6DA 2X0EA 3HXMA 3ICEA 1NJ1A 4YASA 3K0CA 4CJXA 4R8SA 1MABA 1JQEA 1QIHA 3L6OO 3D3WB 1L1QA 4Y6OA 3T7SA 4E5PA 3V32A 2XEDA 4ZVRA 2GLTA 2QJWA 3BIJA 1E1DA 3LC2O 1HE8B 4E08A 2X2EA 4F7WA 3N0WA 2WB2A 1JIJA 1MB9A 3MAJA 2PPLA 3A28A 4M0KA 1R3DA 5FADA 2HMWA 3FDXA 1IY1A 1U3WA 1Y1SA 3H4IA 3RABA 4HEA6 4Q34A 3G3EA 4M7PA 2ECQA 2HWYA 3RPEA 5JNUA 2PL1A 5DM4A 1ZXLA 3TD9A 3TR6A 1OZ0A 4IQFA 2IEGA 3WG9A 5JEDA 2PQ2A 3GPLA 4B3BA 3THYB 3E18A 3VR4A 1G21A 3ICWA 4C7KA 2JHCA 2YWFA 2CNKA 3A04A 2IZZA 4KOAA 4MWGA 3GFQA 2W6JA 1N5JA 3G5MA 2ODEA 1N5KA 2Y71A 3ZUGA 4BFXA 5AUOB 3JYQA 2HJSA 2HPZA 1WCWA 5JCOA 4CF5A 2O7NA 2R96A 3PJFA 3WNDA 1YF3A 2Y92A 5C80A 3JQBC 3OPVA 1A82A 1VL6A 4M9SA 1T5LA 3COVA 1DOHA 1KH2A 3K2IA 1F2TB 2P2GA 4BE7B 5ADWA 3JWHA 3FG9A 1YMVA 2PFKA 1FQOA 3DYVA 1KY5A 4X97A 4PFQA 3GZNA 5FH9A 4D0NA 3BEDA 1A1SA 1MBZA 2FXIA 2BGGA 1VBMA 2I3ZA 2XCUA 1BW9B 4I8IA 4A26A 3V34A 4OKIA 2WICA 2NG1A 4UHDA 3HXOA 4DR6B 2DPYA 4OUDA 2X2OA 1ZA2A 4GX0A 3WGOA 1PZFA 1GHTA 1X15A 3NXSA 3ONWA 3E1GA 2FFAA 2BKVA 1QIFA 1PDOA 3NKFA 5ALIA 2V03A 5CW2A 1EI9A 4I66A 4YV1A 4X7RA 1R5BA 1N0IA 4IGAA 1YI8A 3Q3HA 1G7SA 5IARA 1JDTA 2ZRDA 4DJFC 4DV1B 2FEXA 3FCEA 1DT3A 3FX2A 4ALNA 1VZ2A 3RE1A 5KNCD 1KO7A 3QMWA 3R20A 1VA5A 1OILA 3PC6A 3WA7A 2V1XA 1A69A 3GRAA 1C8KA 4HAXA 5F1OA 4EI8A 1KK1A 1GPJA 3BK2A 4HDMA 2PM8A 3I9KA 2PLRA 2CLKB 4ETWA 1LBHA 1TOAA 1OHHA 4NIMA 3UGJA 3DDNA 1C3JA 2BIFA 2AMFA 1T0JB 3W05A 2AZXA 2G77B 1OHHD 2ZE8A 1FDWA 3GT7A 3KJIA 5ALDA 3ZVNA 1Y8ZA 1NXXA 1QK4A 1X87A 2OD2A 1J6UA 3ND6A 4CGYA 3IDOA 1OF1A 4M86A 1EGMB 4QBIA 4EIWA 4RJ2A 2FZGA 5GINE 3CNEA 4YP0A 1O6GA 1RPZA 4INAA 4B7ZA 5D7NA 1DG3A 1KFKB 1XF1A 3HLTA 4TLLB 5AVWA 4F6RA 5KOIA 1DEXA 3MJHA 1E1MA 4X65B 3ZJ5A 3DUFB 2PEZA 3AJDA 3W78A 4F7DA 1ECCA 3NIDB 3O90A 4IZ6A 1M0EA 2D5LA 4G9GA 4J0KA 3IODA 3JQAB 3PVSA 4LJRA 3V4LA 3ZK9A 2BFEB 4TL9A 1PFYA 4EG7A 4WLNA 4WIAA 1XJQA 2GARA 3VVLA 1SQGA 1L4YA 1T1RA 3B6MA 3VNAA 2Y1WA 4R9NA 5C3MA 2HQOA 3JSAA 3OPYB 4WPGA 5JS2A 5ALVA 2YHIA 4IZOA 1QOZA 4P81A 5GVSA 2NX2A 5LA6A 2XYRA 2B8JA 1BJRE 2PRZA 2D1SA 1E2BA 5L3SA 1IUOA 2FWMX 1PDWA 3LWBA 3OMLA 5JSKA 3RYFB 4B4WA 5BPFA 5J1TB 2O7VA 3M4ZA 1JTEA 4ARZB 1ULZA 2HJ9A 5A3VA 3CLUD 1L8AA 4L8VA 4YRPA 3VKWA 3DZIA 1YFKA 1ENOA 1ZEJA 4B3JA 5EXEA 2E21A 3MTEA 1TD1A 2ZRHA 4CKBA 5CNKA 1GPWB 3QELB 3EVBA 4C4YA 2N9UA 2MHCA 1QANA 3TR5A 1XDBA 3EWAA 5EPEA 1AKMA 1U63A 3DBHA 1M2HA 4D4IA 5FKJA 5AJYA 3BH7A 3RYCA 2CV1A 3HO1A 2POQX 4KWHA 3E03A 4QPCA 4R7GA 3UB4A 1CJVC 2OZLA 3OQIB 2R2AA 5I9LA 2A1UA 1P4JA 2AN3A 1KA9H 2HHHB 1D2MA 1UXIA 1W36C 1G3UA 3ZE7A 2Y66A 4CQNA 4BLUA 2DEUA 4A15A 3T7KA 2VNAA 3ZYZA 1LBQA 2A92A 2HSJA 3C3KA 2ATEA 3GAAA 4KH1A 3KQLA 3QX3A 4F6LA 5K20A 4B31A 4QLOA 5BVHA 3AHIA 5BSHA 4CCAA 1PNOA 3BSSA 3T7EA 4RIGA 1KMMA 2JA2A 4HFRA 2YYYA 5JCJA 3ERCA 3H4MA 1ATZA 2QXTA 3ZQKA 1IZ9A 5CLIA 1OT3A 4JLNA 4ZT5A 5I4CA 4XVRA 2YMQA 1CZLA 1FNMA 2HHAA 3BH0A 2DQKA 3O92A 4JJ8A 3TUJC 5I51A 1E3SA 2HXYA 3OUZA 3CRRA 2FMIA 2IFTA 3GARA 4J91A 1AOXA 2QN3A 4CF7A 1OA0A 3IAFA 3VHXA 5C2JB 1NG9A 1EP3B 4TWIA 3GUUA 3M34A 2Y4NA 1QTNA 2FSPA 2G7MC 4OMDA 3W4KA 2WEKA 4AJ4A 3M9WA 1D4ZA 1GNSA 1NXVA 1K0FA 1QP8A 4BEWA 3RFVA 1YVDA 2HRBA 2FZ4A 1UQRA 4TROA 2Y05A 2IWHA 4M21A 4EEKA 2PKWA 2N46A 5CIYA 2VWPA 5H16A 3WKBA 2WAXA 5I4KA 4S1NA 1UK7A 2NV6A 5D87A 3K96A 2O59A 1LY1A 1A9YA 1WP4A 2XAUA 5JAZA 1HETA 3RNOA 4AS3A 4L2IB 2PSDA 1OTHA 1RADA 2A88A 3MW8A 4FZJA 1MPTA 4OHMA 5T67A 3ZE9A 3U19A 2XD4A 4Q48A 1JG2A 2E6UX 4N54A 4TZ0A 2XTJA 4JYZA 4DV5B 1QDLB 2QN7A 1KSJA 3KYCA 5BR4A 4OHYA 1IZ8A 2QVZX 4JMLA 5AVQA 4ZV9A 4BNFA 2WTUA 2WKWA 4HFMA 1AF7A 2BI8A 2DUUA 1P2VA 3SF0A 3SOPA 4AG6A 1TK9A 2EP5A 4LSGA 1XTQA 5CFQA 3IULA 2UZAA 4M0MA 4RU1A 2R6CA 5HNKA 2QQ0A 2ZYAA 3EGDB 1O77A 3FHOA 5CCBA 4FFBA 3HC7A 4PYQA 4C87A 3GXBA 1Z7EA 4K8OA 4FW8A 2HT6A 3I01A 3PGMA 1ZITA 3U48A 2OENG 3DONA 2DCMA 3IDAA 3FY4A 3KDPA 2V1UA 2HXSA 2DTXA 5A1JA 1LH0A 3IJPA 1LX6A 2NT4A 3H19A 3N0RA 3QXSA 2XNKA 4XQ9A 2VYVD 1G41A 1UMKA 5J2UF 1FSGA 4CYMA 5DM70 4JL8A 3KUXA 4TTRA 3NAMA 4XFDA 1PWXA 2ZWPA 3U3ZA 2AL7A 4MMZB 2ZITA 4J75A 3ESQA 2AB0A 3WQHA 3DVLA 1LJ8A 1ZOLA 3AR4A 4WJZA 1G8MA 1EVKA 1KETA 4TYNA 3AB7A 3I09A 1JDBB 2V9ZA 4HWOA 2E4ZA 4FMCB 4KN9S 1FQKA 4X92A 4DNFA 4N18A 2GJ8A 1OBVA 2QR3A 4YJDA 4RVOA 1IJFA 1UIMA 5HGJA 4A91A 2EHJA 2O8CB 2ONYA 4MQLA 2WF8A 4MA0A 5AM4A 1DIBA 4H15A 3CF4A 1U02A 2PZGA 2VR1A 1I5OA 3BF8A 4ZI2A 1PTKA 1XQ9A 1S2MA 4V0ME 4ZEOA 1Q6YA 4NH4A 4BUZA 4YMHA 3CUEF 3ITEA 4PCAA 4FSXA 3PLAE 2XCQA 1Z5NA 4C0AC 1YJAA 4CL3A 5B7QA 3HKEB 2GM5A 4EYQA 1GL7A 5JNTA 2FE4A 1DC8A 1LQUA 3EJ6A 3VSAA 4KR6A 5EKXA 2PGLA 2X0NA 2F3QA 4P3XA 2CHVA 4UPVA 4X1IA 1EBFA 2GM3A 3WO0A 1FUIA 3FKSA 1GGHA 4L28A 2V0CA 5FPTA 4CV0A 2GBLA 2OHHA 1OI7A 3LKDA 5A4DA 1R0CA 3KQHA 1TLTA 1E60A 2H17A 3LDAA 4BNVA 4P4TA 1KZGB 4R68A 2V6GA 1A96A 3F6YA 2ASEA 3ZWPA 2GAJA 1SMKA 4IDDA 3A11A 4LC1A 3PCTA 1PN3A 1SB9A 1ZLYA 2VP0A 4TT3A 3R8CA 3SWWA 2A1UB 2NNLD 3R3HA 2PN1A 3C8ZA 4Y2SA 2GZ2A 4WLEA 3UXHA 1AX9A 3GCWA 3IAAA 5BQFA 5MDHA 4UTNA 3V1TC 5B1YA 1Y8QA 2FA9A 2IPLA 3ABRB 3I3OA 3B85A 3EWSA 2AYXA 4LDJA 5GV8A 4RVCA 4B79A 1F4PA 1SG6A 1ZUHA 4QAJA 1ZOSA 4MAAA 2FETA 1N2BA 4Q7QA 1AIPA 4OXYA 1RBYA 1JDSA 1TT5B 3GA7A 1YHYA 1UUFA 2IXGA 4PRZA 1ZIDA 4LXYA 2YUIA 1WB9A 1T5OA 1L5MA 2AD5A 4KN8A 4TYQA 2WTMA 4OHXA 3MCAA 4I9UA 4R2LA 1II0A 2O8BB 5CYPA 1E98A 4E1AA 4AJ1A 3AL2A 2EDCA 3NIWA 1QRUA 4D5EA 4WD3A 1JWLA 3ULKA 4WXRA 3Q8MA 2IS4A 1HRKA 1WHTB 1SBNE 1XKQA 2O2SA 4URFA 3QE2A 3VMMA 1VLLA 4QVGA 1KEWA 1V16B 1KARA 5JH7B 3DDWA 4Q01A 4B32A 2IEDA 3TLBA 1C14A 4RA9A 1UDBA 2IS6A 3QNWA 2G63A 3DH0A 4RKQA 1N2CE 3AB8A 1X1DA 1YJ8A 3H5IA 5EXDA 4MV8A 3LT0A 1BVYF 3REFA 2OB1A 2F43B 1PQ4A 5DM60 2GHIA 1L4KA 2JHGA 4UD2A 1Y3CE 3UK7A 5IZCC 3UT5A 5BW5A 1JHMA 2GAFA 1JLSA 2I2XB 1UCFA 2W11A 2Q4DA 2FMXA 4PXSA 4YJ3F 5ADUS 4CZ2A 1Q44A 3KYCB 4BFSA 5GADl 2FLKA 4EABA 3FF4A 3AXSA 5GPBA 2X9NA 3ET4A 2A78A 2JAHA 2V6IA 1HNWB 1UMCA 4G1EB 5DFAA 1KI8A 3Q12A 2ICAA 1Q2XA 3ZH9B 4BWFB 1OI2A 2JFHA 1QHYA 1YS2X 4YRQA 4H0FA 4CM1A 5H9WA 3IPXA 2BUCA 4EDFA 1H3FA 4QE3A 1G8YA 4BAUA 4WCFA 5L3QB 1R2QA 3LC1O 3QPAA 2HQRA 2RIPA 4DG9A 1YDFA 1G4UR 3GRYA 1EX6A 5ALRA 2QN2A 2C4WA 2REXB 2ZAYA 4NXNB 3HB0A 4PZCA 4OQMA 5C5EA 1KAMA 3EIEA 2JI8A 2W90A 2XHEA 1C1DA 3AP2A 3UHJA 3WWOA 4DTIA 3FOZA 4ZAWA 1EFCA 1ORIA 1O0CA 3WRVA 2DFTA 2I3DA 4UAVA 1G3RA 1POXA 3ZCSA 5FV7A 4EVSA 4MUMA 3CQ9A 5A9SA 4RTNA 1NQXA 3LRPA 4YT5A 2BEVA 2Q5FA 5BV2P 4EPXA 2P9ZA 5P21A 3EMVA 3IQHX 4I46A 5K99A 3IA7A 3OE7A 2PU5A 4MSUA 3GEDA 2ANBA 4RM3A 3SLKA 4M1SA 1SUAA 2FN8A 4D3YA 4UM8B 1FEZA 3B9RA 4W4TA 5FTKA 1BIFA 5HILA 1VLMA 4TTVA 3RS8A 4BMZA 3F7OA 4NCBA 2ZT5A 3GAZA 3OE7D 4FDLA 4HAOA 4MROA 5A4MS 2G4VA 5KOHB 3PWSA 3ZHXA 1UDAA 2RI6A 5A4AA 2TMYA 3FBWA 3K6SB 1UPCA 1RQGA 3NT4A 4DVGA 3UAWA 4QJ5A 4DM7A 3HCFA 3DZKA 1G8GA 3A9VA 3KRTA 2GT1A 5JSQA 4CG1A 3JS5A 3COZA 3N2IA 3ICOA 4QGBA 1UWKA 3AKYA 2W2KB 4JENA 5CVEA 3T3DA 3RG8A 4L22A 3FB4A 1TPYA 1WMFA 1SJ9A 2R6FA 4G8BA 2AX4A 3TTWA 3DMFA 2JAPA 2HIGA 2OKGA 2VF8A 2CZGA 4IXWA 4TRNA 4F46A 5K7SA 3TRIA 4I14A 4PN7A 5B30A 2XUAA 3AHGA 1ACJA 4HRXA 4TL7A 4FXOA 4RDXA 4TSKA 2XDAA 4RUKA 2ZI7A 3GOHA 2CNDA 1XKXA 4PHCA 3GGCA 3RRXA 1ODCA 3NYQA 3EGVA 1M73E 5ULLA 3CEMA 4M22A 4DYVA 4FZ5A 4G81A 2VNHA 2J9XB 2HTFA 2NTJA 1QE0A 4DR1B 4IL5A 4NBLA 1X19A 5HCNA 3VPCA 3BORA 5FQOA 3ZY3A 1J0XO 4CCYA 1E1KA 4XGNA 1I0IA 5E7JA 5MHTA 3AM5A 1IXYA 3L1VA 3H17A 1YE5A 5IAOA 2QW1A 2WAYA 4LUCA 3ZY2A 5LWHA 2UXDB 2VH2A 3HV2A 5IVHA 3UMSA 2OD9A 3MLBA 1FK8A 3OZVA 1IZ0A 4R69A 2VBCA 1JU9A 5IZ4A 4DPLA 1EUCB 5JDIA 1L7NA 3ASZA 4YT2A 2XSZA 3UPDA 1E5DA 1DS6A 1XK7A 1U0TA 5F77A 3CUUA 1Z8DA 1U6JA 3QUSA 5H81A 1C80A 3JU3A 3ROGA 2PZKA 2QVBA 4MNTA 4PC6A 2QYSA 3NHBA 8ABPA 3G9ZA 2WA2A 4XLTA 1BJTA 5FUQA 3GLGE 4ZU6X 4KXMA 4V3BA 2VOJA 3AJAA 3OPMA 4BNZA 1KYYA 1CQJA 4JBWA 2IPXA 4HQFA 1RS0A 4PSUA 4XYGA 1DRJA 3EZ7A 4FIZA 3FZQA 3RTDA 4IQGA 4BYMA 2ID4A 2FN4A 3AP3A 2R2GA 4O3MA 1OX4A 5KHLB 4GZ5A 1CZKA 1T9ZA 4PRLA 5IDYA 1HE4A 4RMGA 1SD5A 2GETA 2YY7A 5D1HA 2AD1A 3RLFA 2NQ2C 3WNVA 1H0RA 1KBOA 1YA4A 5CYFA 1VE1A 3PL5A 1RHRA 3LCUA 4NRDA 3UJ8A 5CD9A 1AQUA 1YZKA 3MXOA 4L4XA 4NK4A 4ZZ0A 3RSFA 3W7AA 1JTFA 4Y2TA 4YPFA 4E09A 4F06A 1XNQB 1TMYA 3A3YA 4B8WA 1PJTA 1RT9A 4LNHA 2ZBGA 2Q3LA 2P6MA 4RV4A 1NZDA 2Q4BA 5ES3A 4RETA 4C3OB 2I2BA 4UVGA 1E6MA 3A9RA 1SEVA 1P9LA 2YICA 3QFHA 4ZDIA 4B3SB 1Y4DE 3HN2A 1IM8A 4MHSA 2GYWA 1BA3A 2ISSD 1ZIXA 4M8IA 3BGWA 5EOVA 3ZLTA 4JLUA 1T9KA 1RWMA 1VKJA 1IHUA 4L0QA 4CNBA 3OQJA 5DHFA 2GUWA 4Y2XA 5DWVA 5KYUB 3RYHB 2PX8A 2JIRA 4GMFA 5BN3B 2HU5A 1T13A 2CKMA 2PH7A 1C4WA 1P80A 5JXJA 2CF6A 3O21A 4NJEA 1U8XX 1MHPA 1P1RA 4NARA 3LOQA 1TCBA 4EJSC 3SSNA 1FS6A 1E1CA 2AN9A 1NF9A 2QN1A 2FPUA 2H8KA 3QQPA 5ESXA 3UV7A 2WBLC 1DC4A 5G0SA 3D4LA 5IAGA 4G26A 1Z0SA 4MS1B 5IJAA 2VBGA 4JJKA 2G25A 4KZKA 2FPPA 4KG7A 2BEUB 2R6AA 2ZJAA 1GRRA 3COYA 3SG0A 2GEVA 5HKLA 5KYGA 4QPJC 3GRPA 4KNYA 3Q9UA 5FUXA 1GV0A 2X0FA 3AWDA 4KYVA 2OHFA 3GZTB 2G40A 1R4MA 2JGFA 4EDHA 1KY2A 1JHAA 3LNTA 3EZYA 2H2GA 2OYSA 2IQIA 1XZQA 3IRUA 4WKOA 1XQ1A 3CJTA 1DJLA 1N7HA 2H1CA 4BS9A 2WOOA 3PXDA 3DPSA 1WBDA 5YASA 1UZAA 2VBFA 5EG5A 3H1FA 1Q50A 4R9VA 5GWXA 4C08A 4OI2A 4JEHA 1NW5A 2I7TA 3HBNA 3F78A 4ZVTA 3QU9A 3FRIA 2OYCA 4LOIA 3V4VB 3OM1A 5LMNB 3UK6A 5JPIA 2XTZA 4JUCA 5DKFA 5KVVA 3G5LA 4W7HA 3ZEAA 1JFFA 1EFLA 1VPWA 1W6UA 3QYJA 4GP6A 4C78A 1NJ6A 2FFRA 4OQPA 1VMIA 4FWBA 2WKPA 2Z5LA 3V55A 3Q10A 1P4RA 5E2BA 1C8BA 2GAAA 4DQUA 2DWQA 2GZDA 3HKCA 1CYEA 2VKTA 3OZGA 4RTSA 2G3YA 3NNDA 1K4YA 1XZGA 5AI8A 2ZGVA 3F5DA 1BS1A 2BHSA 3V6MA 2YJ5A 5LZ4A 3RK0A 1KEEB 1SXJC 2R1ZA 4J2HA 4YP6A 4D96A 4DA8A 4EA6A 4RACA 2O4UX 3RUCA 4FKMA 4JP3A 3ONDA 5DTEA 4AX4A 1NWHA 3O8CA 3T7IA 1KQGA 1FU8A 2A9PA 4Q9NA 3ANXA 1I3CA 4OQXA 2O5VA 2B36A 4J90A 2WMYA 2O2XA 1QH1B 1P6UA 3C3JA 3P2KA 3WLHA 5CB4F 5CPBA 5JNSA 5TMDA 5KNBD 4EWLA 5IMBA 4E46A 2Y0PA 1BDJA 1SCDA 4UMEA 4K9NA 4P58A 3KYIB 2MU1A 1FUKA 4K3UA 2ATVA 2P9JA 5LBUA 4ZRMA 1Y8RA 4RK4A 2X0JA 4FHFA 1J0BA 5JV5A 2H92A 3MGAA 1HDEA 2AOUA 3LYUA 1AKWA 1CDEA 2PUCA 4OI0A 4HO1X 1A9OA 4TUYF 2DHRA 4QIHA 1HA3A 1T4MA 1TZKA 4KAAA 1XD9A 4LISA 1YTUA 1EFUA 2J7PD 3HJGA 2D54A 1PX0A 1L7BA 5CTJA 2FPGB 3AEQB 3CR3C 1JEQA 4NYMQ 1T5DX 3TOSA 4DA0A 5A9TA 2V5VA 1JILA 4BTEA 1J49A 2OORA 1NBMD 2ZTLA 1Z0UA 4HLUC 4PNZA 1SVNA 2WWFA 3M6XA 3EGIA 4Y6GB 1W19A 3LLVA 1Q3KA 5HKKA 4A36A 1D2EA 2VNKA 2B7BA 3HVRA 3BD8A 5BPHA 1OX4B 2IXEA 4TSFA 1JL3A 2ZRBA 4LJ7A 4NU0A 1QHHA 4TLAA 4YV7A 1GZDA 3TQFA 2FSIA 5I4BA 2G67A 4JP2A 4BPBA 1TZCA 4TKVA 3P5BA 4DR2B 3ZD7A 1C29B 3LNCA 3G49A 5AW2A 1NUPA 3BK1A 3Q3CA 2YDYA 3VTKA 2WIFA 1E0DA 4HPWA 3LA6A 1UXJA 5EJIA 2WWVD 4AJLA 2GHRA 2FPXA 1LB1B 3LPCA 4NNJA 3DG9A 2JFUA 3NWJA 4RF5A 5KJEA 4DMRA 3UZUA 4ZV4A 3DDCA 3ELWA 3CCBA 3FZYA 1IBSA 1RWVA 2DM6A 3QTLA 2VT7A 5CA1F 4IH9A 3AP1A 1XEXB 2G71A 2LKDA 3A37A 1BVHA 1FNBA 4Z1MA 3T5BA 4XX0A 3PTZA 3G7NA 5E6RA 5M2QA 1V41E 3RD5A 1T9CA 3DMDA 1DC5A 1O97D 1YQWA 2DJ5A 3RBZA 5JSHA 3VDMA 4EZIA 2VP3A 5JWRA 2O54A 2AIRA 3HYLA 3FDFA 1NY5A 4OXIA 4GC9A 1D2CA 2QDKA 4NY1A 2PT5A 3H3FA 4OM7A 4Z1OA 3HUFA 5JXHA 2Z5VA 3GDOA 4D44A 1YA8A 1MR3F 1MEJA 1JPVA 4W9MC 2X6RA 3L04A 1F12A 3F2VA 2QBYB 4TTPA 3LK6A 5KQSA 2J5KA 4Q5IA 4R54A 2Y1CA 3RAEC 1A2BA 3DV0B 3QKRA 4XM2A 1AN9A 2HRCA 2O3UA 3I4LA 3PC7A 3R6GA 1KO4A 5B53A 4BNNA 2OUIA 4U63A 2VJKA 2VAXA 4KBGA 1Z2EA 5DLPA 2IHYA 2KB0A 3DNFA 3M1LA 4HLCA 1NVFA 3LXMA 5F1YA 3QWBA 2GB4A 3QPCA 5DM0A 1UEJA 4XEHA 5A06A 3V8EA 4DIFA 4EGSA 5A4KA 4JWKA 4Z0HO 1MIHA 1K98A 1MOSA 1TM7E 2FPWA 3ROXA 4K1XA 4AWBA 2L82A 4JLVA 1P1FA 2DZDA 4HH4A 3ETJA 2HRZA 1RYDA 5E1BA 4EX6A 2LDBA 4HOYA 2IYTA 4NFSA 3I5MA 1DI0A 2YFQA 1H8HA 2DFLA 1W36B 4B45A 4J7AA 4UMDA 3LT5A 5KQMA 3T3OA 1T0HB 2BTEA 2PL5A 2RGXA 2PRSA 3PHCA 3UTCA 5FLEX 1VJCA 5K0CA 5KTKA 4MB2A 2K7FA 3KSRA 4PZUA 3ZU3A 1GU0A 3IIMA 4UHFA 5KU7A 1CE8B 4DJTA 3PUZA 1P31A 1DFIA 1XZFA 2YFKA 3UXYA 3QITA 1N6KA 3AI3A 3KZCA 4HGOA 4FFLA 5EMNA 5J2UB 4OA8A 2QUIA 4L6IA 3FCUB 4FGLA 1QG4A 1MJHA 1P1BA 1WB5A 1YTLA 2R44A 3IHLA 3L0IB 4YIKA 1ZM3A 1DC6A 2SKEA 4B2LA 5CDFE 1S2IA 3SMVA 1SCUA 4KGXA 2QRLA 3GEHA 1ZC4A 2VJDA 5E4YA 4FILA 4WXPA 2Z3ZA 4MJLA 1SUIA 3KHTA 4L95C 4BKUA 1APBA 1X8JA 4QOFA 2PH5A 1BX3A 3CUWA 5KU1A 2ZKLA 1E20A 2E4AA 2IYNA 3FFTA 4L9RA 3P9ZA 1DADA 4S24A 5D3MB 5ICEA 1JECA 1A9TA 2P4EA 5F76A 4YJFA 1F6BA 1YH3A 3ETHA 3FMVA 5CXXA 3GVHA 1NUQA 4E2XA 4ARSA 4QLBA 3RV4A 3QWAA 1HK7A 2H7YA 3NV7A 4RQTA 1FJXA 4LDAA 1O54A 2BH2A 3GPBA 5CHYA 1UBMS 2YFYA 3BFXA 3E2IA 4EFNA 2ZSAA 4L8YA 3SXPA 3SKXA 5KO2A 4QRDA 4NVRA 4RMJA 2QQFA 4OAPA 3UYLA 4LQ4A 4ZOLA 1FUYB 5G02A 3V48A 4YAKA 5LU9A 1NXWA 3G1WA 3JASA 4BWVA 3UMVA 5EP1A 4WBSA 2FP3A 3NOVA 3QGMA 1JBEA 4AZ0A 3B78A 3BHMA 3ORRA 4LC0A 4HEA1 5F51A 1Z6TA 1WY7A 1XQ6A 4XWOA 3EZNA 4KQGA 2W6CX 3CGWA 2YKGA 4EHAA 4DLKA 1UBUS 1QRRA 4EL5A 1IN6A 4R6WA 3GMIA 1Z6QA 3T5TA 4A8JC 1RI5A 3A26A 3OM8A 1JQLB 4ARBA 1WM1A 2QVXX 3KV1A 1ZUNB 3U3KA 3T4UA 3B9QA 1WPQA 5E95A 5CFLA 4BLRA 1MIOA 1PTJC 3UW3A 1H05A 3FLMA 4DBVO 1R10A 5K6AA 4Z51A 1BS9A 5T8KC 3D3EA 3KAPA 4A27A 4ZXFA 4F1JA 5DVZA 2EZ8A 1XVVA 4ZCQA 4QG3A 4PQGA 4MUYA 2HF7A 2DVMA 3AU9A 1R0SA 4OHFA 4B8YA 1NUSA 2NO6A 5IULC 1L7DA 3CKLA 3HBLA 4Y2RA 3L7DA 4CDGA 1E4YA 5GQSA 3IVXA 4W5QA 1Q1NA 3P9SA 4GEKA 4J1SA 3H6HA 1CUWA 1A04A 1WV1A 4TKVB 4WGGA 3BRWD 2JKYA 3W3AH 3OCYA 2FWRA 2B4KA 2I8CA 3IBTA 1OLXB 5KSZA 4NWIA 1XO1A 4CF6A 3LHFA 3PFKA 4ER3A 1RZUA 5BRAA 2E7ZA 3RVMA 3HVUA 5EHIA 2QGNA 2Z83A 4TYMA 3S2FA 1VJGA 1P9WA 3DDUA 1T6NA 4W82A 2CY0A 3DOEA 4J0IA 4YP5A 3TLJA 4M9QA 4KQ9A 4PAGA 3HJFA 3GRZA 1V7CA 1TPZA 2BP7A 2G04A 2VSYA 4I8XA 4D9EA 2H7XA 3S2ZA 4L5IA 3CF2A 3Q0EA 1X3LA 3HHPA 2Q29A 4HHEA 3QIVA 1HLGA 1F0PA 2WHRA 3FETA 4IDPA 4TV9B 1XDUA 1XZJA 4H4DA 1B15A 2V74B 3HZOA 3NFRA 4LJ6A 2ZZMA 1V48A 3LOPA 4E07A 3QF4A 2P90A 4I0WB 3RROA 2V3WA 2XZDA 3HS3A 1IOVA 2WKRA 2WYHA 1W47A 3EQ2A 4D74A 1ETHA 1SKQA 3DPUA 1CWUA 3OCCA 1VG0B 5FWXB 1ILEA 3EXHA 4MW0A 1YHNA 3EK2A 4GW3A 3RJTA 5HF8A 5AVZA 4YJ3B 3S7TA 1Y7PA 1WETA 5B37A 3DMHA 4QXMA 4ZQCB 1OIVA 4DYDA 4HUJA 1W1IA 5LU8A 3OU7A 3MWDB 3IEIA 1XZKA 4CU5A 1XMPA 2GN1A 3OE4A 1E9VA 3GZ4A 2XUQA 2P9EA 1II8A 3GEEA 4FNOA 2G5PA 3MSXA 3TSAA 3ZW9A 4TTTS 3KQNA 1GPMA 3DVQX 3V2GA 4TRMA 5B2ZA 1BWRA 1H6DA 1M1NB 1GGNA 3CZRA 3MEQA 1UT8A 2MMCA 1KI6A 2F8TA 3EXFA 3ST7A 4OXKA 4XM1A 3GD7A 1YQQA 2X5JO 3T1NA 1OV4A 1Z5VA 3ZZ0A 1Z2PX 4KXYA 5K8JB 3P9CA 2K87A 4LRYA 3ZWQA 4B0OA 3A6ZA 1MTOA 1EUZA 5CX4A 1QG0A 5B6IA 1PP4A 3OPYI 2XOKD 1BXGA 3URKA 1Y4SA 4M83A 1MNAA 4QGSA 2RHLA 2IL1A 4U8GA 3MJFA 1Z33A 4R1TA 5K4AA 1QFYA 5IBQA 1IBMB 2PU7A 4Y8VA 3IDSA 3A58B 4DLRA 1YAHA 1K3UB 2BEWA 3B7WA 1WMAA 2WHXA 3L02A 4Y2YA 5TY0A 3WLIA 4I1IA 3IQXA 1BRMA 1VB5A 2P4HX 1FRFS 3GCGA 3GI1A 5E2AA 1EM6A 1HNNA 4EL0A 5I9NA 2BDEA 3OX1A 4KWCA 3ZK7A 1NT4A 1QV9A 2HRQA 3N2NA 2G09A 5CT8A 4GM4A 4UVHA 3ACBA 3PDCA 4D3SA 5DNWA 3IAM6 2DPHA 2ZP1A 3W2IA 4B3GA 5J2TF 1WXIA 4BFUA 5DXJA 2FUEA 4L4YA 2FEPA 3UOWA 3K9CA 1TLFA 5AVXA 1P5FA 4WXYB 3S4YA 5AW1A 1SHLA 1UKEA 3PNPA 1UT6A 1CX9B 3Q15C 4HQKA 5T7BA 2ZSJA 1RDFA 3LXRA 4NZMA 4F21A 4CMIB 3TNJA 1GPYA 1JB9A 3LXUX 4RHUA 3H1BA 4YLYA 4IGEA 4FNMA 2ZM6B 3SICE 3DE2X 1SUCA 1ZI6A 5B1HA 3SEFA 5BMVF 3OPNA 2PJUA 2EL7A 3KQSA 1NSYA 1RQLA 2BOVA 4BX9A 1FW6A 3E9NA 2E82A 2Y9PB 3VX3A 4EFKA 5DDIP 3HGTA 1C3XA 3VH4A 5BRJA 2ADMA 1CVIA 3BE4A 4Z9FA 4QYXA 5JAOA 1CS4C 2BZSA 5GZ3A 1L5YA 5HJ7A 4IIEA 2GPTA 4AN4A 1YCFA 2NXCA 3T34A 5CB0A 4GX1A 1CB0A 2XUIA 1NHWA 1XJWA 2YWCA 3FSRA 1SZJG 4DLPA 1E5VA 3H18A 2JGKA 3PDHA 4Q7KA 3K0SA 2PT7A 1GNRA 4EUFA 4Q16A 4HBGA 3DEIA 1Z5PA 3NATA 4XB1A 2W98A 2BFDA 5EIEA 3HWX1 4G0VA 1I14A 2HD4A 3F1LA 5KYWB 4BMOB 3K09C 1EWVA 1N1MA 2E1PA 2QE7A 2VH5R 3E9QA 3LWNA 3HUTA 2IP4A 3MB5A 4IJ5A 2C8KA 4UE6A 5DSXA 5EZYB 3DTTA 4UATA 4G5YA 1DJMA 3MJSA 3T94A 2C9ZA 2OHGA 3FF1A 4NOJA 4TUYA 2P8JA 4Q9AA 5FYDA 2CDAA 4ENSA 1YRWA 5EJ6A 1WHSA 2PZBA 4FHZA 2Z2YA 1VOTA 4JC0A 4PYRA 1AH2A 2INGX 1QNLA 3B1YA 3VX4A 5GIPE 2NZJA 3O2JA 3FVVA 2R7AA 3E9CA 4LPKA 4BB0A 2EZTA 1QQAA 1S8FA 1IHXA 1YQGA 1TCCA 3KDSE 2WOJA 2O2IA 5AMXA 1C1YA 4ILEA 1RXVA 3WL6A 3FHCB 4BJHB 5TLSA 2C4KA 4GSYA 1HL3A 1LW7A 2GX6A 4DXAA 4QNMA 3PC3A 1HRDA 1CPYA 1KIFA 3COSA 2CJPA 1U0RA 4CEJB 2Z9DA 5H3CA 2J6HA 2ZYSA 1LDNA 1JIIA 3DT8A 1E1QA 3K9GA 1J00A 1I3OA 1RQ2A 2HLPA 2P0AA 3D6FA 2NSYA 2W6NA 2YR0A 3NP9A 1CTQA 1YRYE 4KGDA 1U9IC 2R00A 1YFJA 5J63A 1EFHA 2E5LB 4LY9A 5B6JA 4I9GA 4MW9A 1IOWA 4PU0A 3E5RA 4PZLA 3ZJVA 1P3Y1 2XCIA 1ZH6A 3UUWA 4ZI7F 1UP6A 3IV6A 4DQLA 4Z9BA 5F2OA 3Q85A 2QAGA 2BGUA 3FZNA 1W5SA 2HFJA 3PNBA 3A6KA 4CIWA 4OQEA 3ZR4B 1NVMB 1U1DA 1C1XA 1HLPA 4XXHA 5SZIA 1Q1EA 3M5PA 4C29A 5J4KA 3OO1A 4GSLA 1CUGA 3NIBA 3FAZA 1XMIA 2RHMA 221PA 3KKPA 2JFXA 2VHUA 2CT8A 1AY0A 2CZQA 4EPRA 2O7RA 4GNKA 2W6QA 1EFVA 1Y5NA 2ZYWX 3HYRA 3KJHA 1QG2A 3GRCA 3HJCA 4QFDA 2D5BA 2Q2NA 1ZONA 3CIOA 1EFPA 3I0ZA 1C81A 3K8YA 4P5PA 3RBAA 2GNOA 4RGQA 4TMVA 2EZ9A 1DARA 3TOCA 3URMA 3OTQA 1J8QA 1VP3A 3EA5A 5KWEA 3KXLA 1GFWA 2GZ3A 4PZAA 4ZODA 1DZIA 2GI4A 4UJ3A 3UMGA 4X60A 2R8BA 4DMUB 2FDRA 4OFBA 4LYDA 4MTCA 5FA5A 3VPGA 2OFXA 2VT2A 2DHCA 3ISVA 3SZUA 2EJCA 1RXSA 3N2KB 4J29A 2BT4A 2OCGA 3AY7A 3TTVA 2WHYA 4B3MB 2O3JA 1O9BA 2VZ0A 3M89A 3O0TA 2JLAA 1YT5A 2ZYDA 4IQ0A 4UDNA 3SJCA 1Z4KA 3O3MB 1S01A 2E4VA 1U5AA 2FVXA 5EZQA 4MRSA 1K6XA 1U98A 3KCQA 4XGRA 3W2FA 2VCHA 2IZ1A 4BNJA 5EI5A 1SCNE 1C41A 3M6LA 5DBOA 3K70D 5IHPA 3ZE1B 1FNDA 1INLA 3EVEA 5ALMA 2BEWB 3AVPA 2WIGA 3V46A 4BZXA 1GPH1 3NC0C 2F1KA 4CDNA 3K8OE 4XYEA 2BR3A 2Q5HA 1N9GA 4IIGA 4L1KA 4JLDA 2QZZA 5HM6A 5DTMA 3O4FA 4DLVA 1ZWLA 1AKYA 4ZJYA 3KQOA 6GPBA 3VZSA 2MSKA 2ZIVB 3V00A 3AV3A 2W6ZA 3ED1A 5J5AA 1KFEB 2X4GA 4DF3A 4F56A 1RE0A 5BXQC 2WFLB 3NOXA 2H1OA 1ZEMA 1LVGA 2AJLI 1E2JA 2NVWA 2R1UA 3E35A 4V02A 2JIZD 3IXLA 4Q9IA 3T9EA 1TO1E 4YR7A 1DOZA 4G0QA 4A0RA 3LY5A 1BQ3A 1AB6A 3RCBA 5EIHA 2ONKA 4TKLA 3UHOA 4BP1A 5AW3A 2X5NA 1L5FA 3VA7A 1DUVG 2J1LA 3H5NA 4B09A 4RLQA 2I3GA 2A9OA 2JNWA 3C97A 5K3AA 3SDSA 1EP9A 2WY2D 2EU8A 5CB8A 4EKYA 1H0HA 3MINB 3TIGA 1V1MA 4BFVA 4BO3A 4TLBA 3IKLA 1KIMA 2ZUUA 2OCKA 1EUYA 5D1NA 3RC8A 1PSDA 1O0BA 1M8FA 4UAJA 2JAXA 4BRUA 5MFZA 5KJCA 1TTPB 4XZ3A 3ZU4A 4ZT7A 3H5AA 2IH2A 1T1GA 4B3IA 1XZMA 3EVCA 3FJ1A 3GNTA 1RKVA 1L5HB 3C3PA 3R4CA 3QFSA 4Q4HA 4TTAA 5B7GA 1VL5A 1E1NA 2O8FA 3MMSA 2G6TA 1GAEO 1GLNA 3IKTA 1Y5LA 3GQBB 3IUPA 4JODA 4NZZA 4RAQA 5GGYA 1BX1A 4CIXA 2WMNB 4EJSB 3IOYA 3PUWA 4FEAA 4JBGA 4J0EA 4JT4A 4ITUA 3K0AA 2XGGA 3SQWA 4DRZA 3U4QB 4WH0A 3W6UA 4MW5A 5F7JA 1BDHA 1VPDA 3VPHA 5K2OA 4S1WA 4AKGA 2UXBB 2VCEA 3GD5A 3CNQS 4U7DA 3GH1A 3ZWOA 1TA9A 2WIAA 2BUBA 3QKSB 2Z3WA 4BO4A 4YMLA 3UB3A 3C7TA 3UB2A 3HA7A 3IKVA 2W0MA 1OJ7A 1AJEA 3RO7A 3O74A 2EG9A 1LNQA 4QX6A 4KQIA 5BT9A 2JJ2D 1JG6A 1I2CA 2OILA 4WKBA 3E0XA 4F04A 5JY6A 3OEEA 1VHLA 4CUKA 2FW6A 2VQ6A 3QM1A 1RWOA 3QHAA 4GR9A 1USKA 3GPIA 1M67A 4FEGA 3BMQA 5KYVA 2GD6A 3P52A 4YH1A 1QP0A 1ECGA 3VYUB 5CVVA 3E9DA 3H2IA 4G56A 3D5QA 3L6CA 3OFKA 1HSOA 3CO5A 3K9QO 5J9FA 4UMVA 1JDVA 2ISQA 1UINA 1ZW6A 2O8DA 1O6CA 1UMDB 3UJBA 4H60A 4M53A 2VYQA 4RFVA 3UAYA 5A1TA 2WKSA 4C6TB 1OQAA 3DZCA 3DWIA 3DUWA 4YY3B 1V5FA 2GRUA 3O1JC 4IKEA 3PXCX 3QX7A 4DA9A 2CNBA 3R5XA 2JGNA 4MVWA 5CA1B 3UFXA 4C76A 3HDYA 1SXJB 3DLCA 1PWEA 4KN5A 3SJZA 1W2WB 4M98A 1JG1A 3HCNA 1VJRA 1LX7A 2BWJA 2H59A 2V5UA 3GLTA 3E4CA 3K9BA 1G64A 4LZLA 5NULA 3X2SA 3O4JA 3ZNOA 3CINA 5BR7A 3RIHA 4LVUA 5BN1A 2Y0CA 2FUNB 4KR2A 3JQAD 3UBTA 2OAQ1 1RHMA 2JGDA 1UMBA 1NLYA 3IV9A 4D8TA 1JHZA 2QN6A 5ADHA 5IF9A 1E6CA 1KVSA 2RI1A 2EW1A 4BQPA 1ZY2A 4B5KA 2UZ3A 2OHXA 2AMJA 2X1LA 3K73O 3R6TA 4HDKB 1TZJA 3WWYA 2BV3A 2JATA 1VBKA 3QPUA 3VMFA 2MYUA 1NDQA 2PCJA 5D51S 1SCIA 4IP0A 5CB6A 4GOND 3TI9A 3JX9A 3X1KA 5TARA 1Q0QA 5T4EA 4BN5A 4KREA 3JCZA 1J23A 4K46A 3Q7EA 1BCRB 4RGBA 2I1WA 3GLGB 4DR4B 3EOAI 4B3TB 4Y1RB 4MR9B 3NNSA 5I3CA 2GYVA 2H5LA 1V39A 1OU4A 4W1SA 3VR1A 4L16A 4LXTA 1M6HA 1RQRA 3RUPA 2JJQA 4K6FA 4MPDA 1QKJA 4CV1A 3L4SO 4LKOA 1DU4A 2W2VA 4RTKA 2BFPA 1UBLS 1IM2A 2LR0A 4UCWA 3U7RA 1EUQA 2WF7A 1AQIA 1JI0A 1NPYA 5B1IA 1X39A 1J7KA 4YONB 2JK1A 3A6EA 3QOFA 2C04A 3GLHA 1M66A 5DBHX 1NXQA 1N2IA 1TJ4A 4TGLA 3NHFA 4CCSA 2HLNA 3FVTA 3ZJYA 3AINA 3WYAA 1DZ3A 5I7UA 3A32A 3R2JA 1UJ4A 2VG8A 2JEYA 4E5KA 1LK0A 4LRUA 3SBXA 2M32A 5KAMA 3ZDRA 4EMSA 1BHJA 1XYVA 3AY6A 3OZEA 2HT1A 1YVEI 3JR3A 4IMRA 4GEGA 2BGTA 4M0FA 1KZHA 1AK2A 1RJFA 1D4FA 1QGYA 2J31A 2C1EA 3ZTWA 2PX2A 3GMSA 2OA0A 1YZVA 1V1MB 4V0QA 3W2EA 1GQOA 5G0VA 3R7NA 1R27A 5FPHA 1KP9A 1TU4A 3NQ41 2MWMA 3R3WA 1E18A 1X7GA 3JQ8A 1RI2A 5J2TA 1T4CB 3K8ZA 3MFYA 2P3LA 2B69A 3VR3D 3QE4A 4F1KA 2JAWA 2GA9A 3G02A 4KI0A 5C34B 2P4SA 8ADHA 5HFNA 1IY0A 4I4NA 2XV1A 2ZSBA 3GJTA 4ZCLA 3ZE8A 2I8AA 1O9GA 5JQGB 3GR6A 1M34B 1FB5A 1E64A 4NCNA 3OFJA 4EUHA 2IY9A 3AVWA 1X7YB 1EFDN 2L19A 3L7AA 3A3KA 4X3PA 4XR9A 3RHTA 4MVJI 3X1MA 1GSIA 4Z4HA 1EKXA 4MYRA 3ZPXA 4DLYA 1X38A 4QPNA 5BMVA 1DKOA 2BTOA 3LVBA 1H2BA 1QNFA 3FCSB 3L7CA 5JFGA 3N3BC 2HA2A 3IE1A 2ZAIA 3TAHA 1K6IA 2BI7A 4K6GA 1J2TA 3TQOA 5ESDA 5DNAA 1U3TA 1C7JA 4A23A 3A7DA 1YB7A 2WZCA 4O2AA 1V6SA 2N42A 5A0TA 4YJ2F 3L0SA 5C1BA 1L5WA 1FPMA 3ZGXA 3IS3A 1Q77A 2HW8A 2Y9MB 1M6VA 3OHMA 4HDSA 2NMVA 1ZCZA 1L3BA 3ZXXA 3B3JA 1J5XA 1IXRC 1F4LA 2EW8A 2QN9A 1I7DA 4MEBA 2BKEA 3FUCA 4WNIA 4DLBA 3E7DA 2M6SA 3C15C 3NMUF 1PYDA 3F1KA 3AEUB 4KPEC 4U7FA 2GVNA 4N39A 3BOSA 2OR3A 4TTIA 3CJQA 2CJYA 2HV8A 3T9FA 4ASUA 4YUYA 4OGFA 4NG5A 3SS8A 5JNRA 1NXOA 2QQEA 3J81k 2ZDHA 2QX7A 4V39A 4YB8A 4RPJA 4BBJA 4ASUD 1U0HC 3U4IA 4IV5A 5CCDA 5IAAA 4FSDA 3DE0X 4ZCPA 4EF4A 4TN1A 3PI7A 1KAQA 1R15A 2WSYB 4GKAA 1T5IA 4KDRA 3WC4A 3ZWBA 4ERNA 2JCBA 2X0RA 1TAHA 1YZHA 3WLSA 1IWPB 2H1RA 5HQ3B 4NDZA 4BQIA 2OESA 2B37A 2QYOA 2CCKA 5IX8A 4QUGA 3SYLA 2YS6A 3I52A 3UMRA 1EX7A 2VXCA 1QRDA 2OZKA 1VL8A 1H0SA 2X4LA 4RULA 1KPIA 1E2UA 2ILTA 4ESHA 2VUIB 3PX2A 3QKIA 2BSQA 3A4LA 2WD7B 3BXZA 1EZ4A 3DEKA 1TAQA 2XCOA 1U1FA 3CYFA 4UASA 1P0QA 1CUEA 3AR2A 1NF2A 5B4UA 2YJ3A 3CX7A 2BI4A 1NLFA 2B9EA 5C7LO 3P5SA 1QP4A 2AXNA 3D8NA 4F5YA 4K9RA 5GZ1A 4DN6A 1N5DA 3SQNA 1NKTA 2NTVA 3V8RA 4A8JB 2C20A 2BW0A 3THOA 4EPVA 3HGMA 4QT4A 3VR5A 2I9KA 3OT5A 4IVRA 4OXXA 3A6GA 1YNSA 1B8VA 4LWOA 3GJZA 5DPMA 1BEEA 4BKPA 4F96A 4RC9A 5IJXA 3VR5D 2ZDQA 4DCPA 4MKGA 2B5WA 1CUBA 4LY3A 2JFZA 5G3YA 5CFNA 1PFUA 3SR4A 3WYEA 4RCYA 3KZ1E 4UW9A 2J0EA 1QXSA 3K94A 3FYSA 3HVKA 1UP4A 1W0KA 2CJWB 1LWNA 1LPAB 3QVTA 3TBKA 3WMRA 1Y1QA 3OQNA 2J3LA 2QY6A 3OE5A 2JLSA 3CZQA 2B7CA 4FGZA 3BILA 2UXCB 2QG9A 5FNVF 1AXGA 3I6BA 3ZDQA 1XTIA 2E0IA 3V2IA 3C70A 4L3OA 4LXUA 2C94A 4EG8A 1A8IA 4P3YA 1G38A 1KJIA 4EFDA 1HT1E 1XAIA 1I2AA 2C4MA 2PUBA 3C6XA 4AG3A 1ULAA 4I5IA 2D0DA 3ZW8A 1IK4A 4RTOA 2OL4A 2V7VA 1VRCA 3LSYA 4PGFA 5DI3A 1ZH2A 4LWZA 2GS9A 1Z2OX 3VUEA 1F14A 2RJ3A 1T2AA 4TRRA 2EF0A 4BGUA 3QLUC 2FI1A 3QEJA 2DX7A 1M75A 3FGNA 1C9EA 3N7AA 2QRJA 3Q98A 5FR2A 5HXAA 2EHDA 1QGED 1A5SB 2IKSA 2ZIFA 3TRHA 3WJ1A 5C46F 1WCIA 3SKYA 1AZLA 1BH2A 4CBVA 3G0HA 2ZS9A 3I5UA 4DANA 4F11A 721PA 4R9SA 5G1OA 4H3KB 1U94A 5BUZA 4JGIA 2FG7C 2X19A 3L0YA 3MOIA 2Z1MA 4IGFA 4R2JA 3UW1A 5BV1A 4BXOB 4PYMA 4WCDA 3QRWA 5IXYA 2CDBA 3DYIA 3PXUA 3I8XA 2VHQA 5F52A 2R8RA 3GFTA 1XZLA 1P4HA 1RTTA 3L1HA 3JAKB 1NWCA 4Q4AB 2WTAA 4MP3A 4RTPA 3D2AA 4BNDA 3AOGA 4UFOA 1I4OA 2K5UA 4FWTA 3ESCA 4JEUA 4JY7A 1CQIB 1TVMA 3CLRD 2X9VA 3AUAA 5TGZA 3R7AA 4B7XA 3NBAA 4IVNA 5ITWA 5JAIA 1G6KA 5CJPA 3K0EA 2A9VA 3DEAA 1AKNA 2C03A 3PGA1 5FBWB 3QFTA 5ILQA 5JO9A 5IVPA 4YRNA 3BD7A 3LZ6A 1U3VA 4KODA 4KLRA 3V8MA 4E15A 2RBKA 4GGPA 3LQRA 4XRRA 2H9AA 2HADA 4Y2HA 4AYXA 4R5MA 2HH9A 2KLBA 2YV2A 3AZPA 4J76A 5B7PA 3BFKA 2QSJA 2YNMD 1ODJA 3G82C 2PMCA 1R7RA 2E18A 1JALA 4MRVA 4ZCSA 1V6CA 3BUSA 1LLFA 3C16C 1G5FA 4GHWA 1RQNA 4PBRA 1P1HA 1XF9A 2FN9A 3R7LA 4AZVA 4BMSA 1E3DA 4CGZA 2XUGA 4LJAA 3ZTYA 4UU7A 1XTJA 2SCUA 4F5EA 3ORHA 2ZSIA 1NM5A 1L1EA 1RTKA 1AHIA 2FW8A 4WZ6A 3SJUA 1QS0A 2HKIA 3TX2A 5AD1A 4OX9B 1SGWA 2HR1A 4U1RA 2XZPA 3HCBA 4H3SA 1YR9A 2BM8A 2VRCD 4RDHA 4AUEA 4CLHA 1BHSA 2B3DA 4EBFA 4H1TA 3Q3GE 3ROFA 5JLJA 4PZYA 1NMQA 2XMBA 3NKVA 3H8SA 4KYUA 2I6TA 5AKIA 1OFUX 2CYCA 4LMBA 3ZS9A 3KETA 3PC8A 1AGRA 1SCAA 4IH4A 1U2GA 2XUPA 2Z2ZA 5JNLA 2RHHA 2XLCA 1G5PA 4I4LA 3IP5A 5IS2A 1LPMA 4BDTA 2BCJQ 2DBYA 2G1AA 1XT6A 4CI0B 1OB5A 1P75A 2V6JA 4L4ZA 1JEDA 2G0TA 5TXGA 2H57A 2QZPA 3WGLA 1RC1A 2B0CA 1SCBA 3WRYC 5EHGA 3MUFA 4P32A 4BVAA 1XZNA 3QENA 4UTXA 4Q15A 4GF5A 4BQOA 4YJGA 5SYNA 4ZI7B 2B4QA 4ZO4A 1YBAA 4US1R 4DBZA 2OHVA 5L3RA 1WDLA 3F5SA 4JHLA 4QWWA 5THXA 5AUNB 3WIDA 3TBHA 2JGJA 2YWXA 3GFVA 4OIMA 5ENZA 1ODFA 3BCHA 1BO6A 1PG2A 3FTQA 1BGVA 3LCMA 4M1KA 2XMRA 2XOXA 1T36B 2F17A 4PLHA 3R7WA 2CCJA 4KKXB 5TQVA 2VJCA 2WWHA 1CZHA 1DTSA 2OC9A 5KQPA 2JLQA 2PX5A 1OREA 4LNUA 3ZCVA 1EINA 4FNAA 2Z58A 4LV8B 1TUGA 3W5VA 2IODA 4HADA 4Z8XA 3MHPA 2QLJA 3P0IA 1NA5A 4QTZA 4I1PA 2RC6A 2Y6VA 3QLVA 3ZGLA 2C0CA 4J16A 1A5AB 1SUWA 3AETA 1GADO 1K0UA 1R6VA 1PQPA 2YJTD 3BAFA 1SUSA 3EH1A 4FS3A 4HRYA 3B1WA 4IBOA 5EN4A 5AM0A 2OWDA 5L4LA 3VYWA 1X70A 1UBOS 1ULUA 4EHFA 3GCDA 2FK7A 3U7HB 4KWIA 4QXQA 2GN8A 1XEWX 2ZJ5A 4U9HS 3OJCA 4UJ5A 3PUIA 3FCYA 2WLTA 2BSXA 4MW2A 5JPCA 1XXHA 4QKQA 1WX1A 1NASA 5WRFA 1TYBE 3QLEA 4DIOA 2H1WA 3GL9A 1F17A 1VFNA 2W2PA 3NBQA 4DG8A 3QVSA 4J8PA 5HEKA 4CLRB 4KFSA 1I4WA 1OC4A 3WDKA 4ISCA 5HBGA 4D0SA 2XZLA 4L08A 4BEBA 2K2QB 3BGOS 3JZAA 4HTFA 4HEQA 4LDQA 3WMGA 4KR3A 3W7BA 4C7OB 3AONB 1JLHA 1WJGA 5AYVA 5U4XA 4LI0A 5E9AA 5AUPB 2BTQB 5BSWA 2BHNA 2BGKA 4IDGA 1GL6A 2WSLA 4JOQA 4FDAA 5CU7A 2O2DA 4C4RA 1TKCA 3GH3A 3L6UA 1MG5A 3P2EA 4TXJA 4D79A 4CKWA 2ZJ8A 1YOVB 1SC9A 3I1YA 3QUBA 1MP0A 2GFIA 3DO5A 2ZT7A 1ZR2A 1X8KA 3MAGA 1MNQA 4HS9A 4MI9A 4X24A 3SBDA 4D4KA 2VT6A 1CJTC 4MVJD 5EIFA 2AJTA 2G9VA 3CT6A 4ZC8A 3QXJA 3M1IA 4GWKA 3R7FA 4P4SB 5I01A 3H3JA 4GZ3A 4NOMA 3LDUA 4G1MB 1DAEA 2W4IA 2I65A 4HSEA 4AO8A 3I2FA 3PNMA 4X61A 3K6KA 3PFFA 4I9HA 1CZOA 1EG2A 5DTIA 5DTJA 1CJSA 4GXNA 4N01A 4JELA 3TZLA 121PA 2Z2JA 1NVAA 4H1WA 1LXCA 3KTAB 1YFZA 1O3YA 3IBYA 2Z56A 1E62A 3ITNA 3N74A 4J4BA 4N0MA 3LDGA 5I9IA 4AMVA 2IY8A 1WOYA 5DHQA 4CL0A 3P0HA 4XWWA 1MC1A 1SVKA 3K1AA 4KMOA 1YUBA 4NEGA 4EB6A 2P9YA 1GY8A 2PS0A 1R5OA 4RQBA 1WKBA 5C7OO 4KXWA 2NU8A 2QP9X 2VP5A 4M9XA 1IVNA 2XMCA 3ZNPA 1MX5A 4U9IS 4EA7A 4F45A 4RORA 1I5EA 1DP4A 3RRMA 1K6EA 3DNMA 1KRWA 4PC1A 3Q0TA 4FHGA 4PWZA 1XWIA 1Z34A 2YIDA 3D3QA 4II7A 4B6EA 4QUEA 1OH6A 2F3SA 4RF4A 4BJ6A 1R8YA 4ACAA 4LGMA 3A9TA 4WWHA 1GRNA 3UOGA 4CKZA 3NHYA 1VPLA 4OMUA 5LOVA 2DWUA 2UUPA 4MLZA 4DMHA 4YYZA 1L4FA 3DKVA 5KNBH 4WI1A 1OXMA 1NW4A 4EKGA 5JSUA 5BY2A 3OKCA 2CFIA 1MJGA 4L0MA 1JYEA 4ZICA 1XP8A 2A3RA 4TV8F 2M6KA 4JXZA 4GQBA 1NBWB 1OLUB 5EWMA 1E6KA 5JANA 1YI1A 1JHYA 2E4UA 2FW0A 4ITVA 1I32A 2EBWA 1Y6JA 5EHXA 3WAKA 4GI1A 4II2A 3WB0A 4KLNA 4EW3A 2C7BA 3HPQA 1KNXA 5DBIA 4NBWA 4BVKA 5LDHA 2IV7A 3DZHA 3MRXA 1W85B 1NV8A 1T3SA 3LCRA 4INPA 3SYTA 2B8WA 2B61A 3VZQA 4OHPA 1ANKA 5T5QA 3VZRA 1AZWA 2D74A 3K31A 1YZYA 3EFOA 4PLTA 4DSAA 4HUQA 1X74A 3OIGA 3OZXA 2ZZNA 1DXHA 3N53A 4H6VA 1ZR4A 1EWQA 4P93A 3UGQA 5BN5B 2AQ8A 9GPBA 3BMNB 4DC1A 1E3IA 1C7QA 2JH8A 3R7WB 3U3RA 4H31A 3Q9LA 3JVIA 4MS3B 4ZI5A 3S1SA 4GU5A 1J0AA 2ECPA 5AHOA 3UBMA 3VGPA 3NYRA 4DREA 3LECA 1HBJA 1IAVA 2Z09A 3V4SA 4B81A 3GLFB 4JYBA 4PX5A 4KXUA 3JRXA 4BMYA 2AOTA 2PCLA 3RK1A 3JTEA 3LC0A 2XRYA 1F38A 1NULA 2VHTA 1PNVA 1R0RE 3P0FA 4LJKA 3AETB 1VSBA 2P9FA 1KEKA 1XCBA 1SB8A 4F3NA 4YPOA 3ZGNA 4XEUA 1X1RA 1N2JA 3DO8A 2R11A 3DBLB 3AKZA 4MP6A 4NDNE 2J3KA 4GO1A 1AG9A 1FLAA 3ZWNA 3D43A 4D9MA 5JXWA 4IVQA 3L8HA 4EY8A 2O3TA 2PE5A 4MWZA 4RD6A 3TGWA 2OGSA 2XQJA 1KDYA 1BOOA 1L8OA 4E5SA 2QL9A 1PEDA 3BC1A 4Q21A 4RNDB 4XKJA 2QTAA 1IZYA 3CH5A 3TQQA 3ZN2A 4ALKA 2WZQA 5EUBA 2HWWA 3IP1A 1G8JA 3JALB 1RR6A 3TW0A 4D6PA 3DVSX 5CJJA 3HXKA 1QHNA 3LYAA 4OHKA 4BV3A 3U0VA 2HQ1A 2IP2A 3ND5A 3Q8WA 5FT9A 1FLDA 4JKIA 4ND1A 3EG9B 1PJBA 1ZG3A 5AXBA 2J0QA 2VPXA 4K9DA 2EEPA 1VSQA 3HEMA 4TT8A 2C5SA 1KQOA 1U0EA 3L7OA 5FUVA 4DV2B 3L92A 1ELOA 4NBRA 3UA4A 4JSYA 5FNVA 3A1CA 4EZEA 1KJ9A 4WZAB 3SYNA 1HYGA 1LV8A 3U6BA 1KI4A 5JVDA 5KJ6A 2VQSA 3CY6A 3EBLA 3F6BX 3G0OA 3I1IA 1K8XB 2PUFA 3QLJA 4D4GA 4A2PA 4A16A 1XTVA 5L7YA 1B8PA 5CHEA 3NTXA 2GUGA 5BXYA 1NKVA 3U7IA 3ROZA 3LPMA 2SICE 3P9RA 1P61B 2BFFA 1UC5B 3H16A 1T6ZA 2BMFA 2HA6A 3TLXA 3P94A 3WP1B 4MV3A 2XT9A 1BXZA 3DZBA 3BA6A 4OVKA 4YUXA 4AECA 2V4UA 4R8KA 2A5YB 2GHTA 3G2LA 4EHHA 1DSSG 1KVRA 1MZVA 3PWKA 4B6JA 5EXXA 1U5BB 2A58A 3G2PA 2VTBB 2COEA 1AV7A 3K3PA 3L7BA 5DIFA 3TL2A 4L02A 2IZ0A 1V6AA 1EK5A 3HJNA 4ABTA 2WU0A 2XB2A 1HG1A 2PG3A 4HK4A 3M6AA 2X40A 4CXMA 4LIPD 2VFAA 2QMUA 4XPIA 4E6PA 1Q57A 2FR0A 3C4QA 4I6EA 1DWQA 2QNRA 1D5WA 4TMKA 1GZ3A 1VMKA 1XKTA 1D07A 3LBYA 2ZS8A 4BNKA 3V2HA 4PSKA 1P1JA 1PSZA 1TEZA 4ND5A 3FMFA 1FX0B 2F64A 2EZ4A 3R8XA 4WA8A 2RI0A 5KNDD 4MWDA 2XHZA 2FPIB 3OWOA 5ALEA 1DOAA 1UJBA 1H5UA 4A6DA 3UOAB 2PXHA 5FAXA 2WV9A 1OLSB 1JQBA 1TF5A 4IFIA 4EHKA 4YJ2B 2AKEA 3LRTA 4RZSA 3NBKA 1ZM4A 1YS9A 4PPFA 1ICEA 2EKPA 2ORIA 3C43A 3KKMA 4GPD1 4TXMA 1JXQA 3CKKA 4DM4A 2P11A 3QVOA 4GBGA 2IOYA 3VR6H 3VUFA 3OOHA 3TIXB 1VSVA 2YH2A 4BGEA 1W36D 3C4JA 5HJ2A 4YQEA 1GNVA 3T3IA 4EMTA 1G5HA 4DIUA 1B76A 1U0OC 1V8ZA 3NWPA 3JQ6A 2JCXA 3ONVA 4U2FA 5DHRA 3UJ7A 4D43A 1QTQA 4Q1EA 3JZIA 3KWMA 3O91A 2PWAA 1L5GB 2ZCVA 1C0PA 2ATCA 4IV0A 3L8DA 4ZU1X 4AD8A 2VOEA 3F9CA 3FM9A 3S2IA 1FTYA 1X7WA 4C5AA 1Z56C 2I55A 1HT3A 4Q3OA 2XOEA 4NHEA 1ZSYA 5HK9A 3OZRA 2RHWA 2XXBA 1SBIA 1XKLA 4YROA 3NRCA 1DAPA 4P3KA 1G5RA 2GWRA 3IURA 1SK9A 4QA9A 1GAQA 1EQAA 1PR9A 4RX1A 4LNAA 5AM3A 3M3DA 5A3QA 1OTYA 5K0BA 3U44B 4C1BA 2HMVA 1VYVA 1JYFA 3E7PA 3P0JA 3T3GA 5IT9A 1IULA 4PSCA 4X66B 1MFPA 4OY3A 1J1UA 3OBBA 1PBNA 1QPZA 4D5GA 1XVLA 1Q20A 3G13A 4Y2QA 2IZ5A 1QO0A 1THGA 2P67A 3SXUB 2C96A 4HMPA 4NYJR 1LI4A 5KIAA 1NY6A 5LJIA 1JEYA 4CLOB 3PXAA 3RRYA 4PICA 1CCWA 4J2OA 4EQZA 2R7NA 1YDMA 5TS3A 1WSBA 1QCCA 2RSLA 2GEKA 3HDHA 1E0SA 5KSYA 1TTTA 2BMEA 3CO0S 4Q9HA 3W1WA 3HXLA 1GL3A 3LVQE 3G2QA 4N5MA 2BFNA 1P8JA 2P4UA 3EGXB 2WWWA 3V80A 1U3FA 2UV8A 1ZI9A 5LP6C 4BNMA 1GV1A 2OSBA 4W1PA 3UJNA 3NH9A 3AEZA 4RY8A 2HHJA 2H48A 4D8YA 3BHJA 2PLAA 4IDOA 1K5PA 4UZEA 2PK3A 3GEGA 4F9TA 1WCYA 3GPDG 3DHEA 5LVAA 3O9MA 3BT7A 3NBZC 4EW1A 2BDUA 2FR8C 4MX8A 3WGHA 5IDWA 1JFVA 1PK8A 2ZIWB 3KUKA 1JWAB 2PLFA 2QQGA 1F2VA 2WSMA 3GZJA 3O1IC 3T1TA 2HO5A 2ZAGA 1LBTA 1S2GA 3ZLVA 2P9HA 3MT8A 2HGZA 1BMQA 4C7BA 4PSVA 1CZRA 4HPXB 3L4KA 2C7QA 4FPXA 1WU7A 1ZL2A 1Q19A 4H27A 3KSBC 1F0KA 1F8FA 4GI7A 3SNHA 1VKHA 1L3CA 4L5BA 1L9KA 1Z0ZA 2OG1A 4LYGA 3TZKA 1WF3A 4FD3A 1UQTA 4BU0A 4ND6A 3AUXA 3OCVA 1Z29A 1NLUA 3PRHA 1RYHA 1EB8A 3H75A 3GWZA 5EGSA 4RKWA 3TXXA 4LV6A 1CJBA 1HR0B 1JN0A 2HMTA 3QWHA 4DXDA 2G4LA 4W63A 5MF6A 1PWYE 5EINA 3ZX5A 1GNQA 4L3WA 1XVUA 2NZYA 1QQTA 4G5QA 2Q9CA 3GK3A 2BFFB 1GUAA 3QVWA 2BLLA 3L41A 2A59A 3PX3A 4FK8A 3HYTA 4QXOA 1MO4A 5CIWA 2NU9B 4ND7A 1V9CA 1B6RA 3OJWA 1R5NA 4YTEA 4XOUA 3PGKA 3E3LA 5AESA 3SHWA 1GIAA 4ZTZB 4UHJA 1RBQA 4FXPA 5IJWA 3HBJA 3E3AA 2CMHA 3WVNA 1Z5WA 2E4XA 3PG5A 3T3PB 4X64B 4LTMA 3RADC 1NE2A 2WTBA 4G25A 3BD6A 5LXTF 4JJIA 2GQ0A 4HGPA 3RFUA 3OT1B 1SOWA 1IYZA 4JBLA 1GAWA 1YIOA 4L4SA 4AF8A 4M0PA 4OI4A 2BN4A 5JWHA 1M10A 3QXCA 1ZJ5A 5F23A 2ZREA 5F33A 1AQJA 3IKJA 3EEQA 1DCMA 2SKDA 3A4TA 4C30A 3L7KA 2KW5A 1D8TA 3K1JA 3I8OA 4JA2A 3VO2A 1ENYA 4DNOA 2RHGB 2XNSA 3WJAA 5HUJA 7ADHA 3MCWA 2FG5A 1F5SA 2R47A 4GRIA 1QBKC 1RAAA 4KQEA 4C04A 3WGVA 1MB3A 3TE7A 2CHEA 1XZDA 5AVTA 2H2WA 1X1EA 1G16A 1JT9A 3NFYA 3ZE0B 1T2FA 5M34A 1AHPA 1G19A 1Y6FA 4KLZA 3T3EA 3W90A 3EPLA 3LO8A 4M4SA 1IWBB 3HKDB 4Y30A 5B1EA 2BBSA 4DLWA 5LNK6 4KX5A 2CDNA 1JE0A 3K2EA 1BE1A 1NMSA 2L69A 3TMKA 3W4IA 2JI6A 5D8DA 4WKGA 4KDEA 2CNNA 4OHBA 1U3DA 3RQIA 1XTBA 4U5QA 1U8AA 4UZSA 1YRHA 2AUNA 3LHDA 1GEGA 1HTWA 5E4JA 4KGVA 3TZBA 1UFOA 5ALUA 3UJCA 4UU1A 5DEIA 1V47A 2XE7A 3WNBA 1IVSA 3GFOA 2WP8J 2XX3A 2AQKA 1E1YA 3VJLA 1R6UA 1AKVA 1HE5A 3TDMA 5ICGA 3QEOA 1AGXA 5HS6A 4BV9A 2WW8A 2RE8A 1T8PA 3Q6NA 2XODA 1ZDMA 5BQ3A 3VOTA 2F8SA 2R66A 3ZU6A 4JAVC 5E3JA 3TL6A 4IX9A 1ZGAA 2NGRA 2HFKA 4PF1A 4Z4CA 1UBNA 3WWZA 1BE8A 4TV8A 3R9XB 5C8VA 4IX1A 3BKWA 1USWA 1RWNA 3LWZA 4OHUA 1WUYA 1OSNA 4MV1A 4O29A 1HTTA 2A9RA 2BBWA 3DLPX 2DY0A 2RJNA 1QMGA 2EJWA 4JASB 4TMFA 5HUQA 1GT91 2C58A 2A0YA 3RANA 4J1TA 4P2BA 4CM9A 1V8DA 3HGQA 3DFFA 4CT0A 2BSAA 3K15A 4B71A 2A35A 1W5FA 2SECE 3BTSA 3M5WA 3ORSA 4ERXA 3KJGA 2WIJA 4XUDA 2C7PA 3ZLJA 4DCTA 5G4LA 5AICA 1T1EA 3WLKX 4DZTA 5HF5A 3OLXA 2Z30A 1DLIA 1TAGA 2ZIXA 1N8TA 4IIJF 4CDMA 2VLBA 1GQYA 2PRKA 1X8XA 3E1KA 4PTZA 1JWBB 2H1VA 1NZFA 5J1SB 3IAHA 3WXMA 4X44A 2XMDA 1L5OA 4ZEXA 1GN8A 1UBKS 2ZYHA 3OX2A 3LUKA 2CUZA 2EBHX 1A9XA 4MLDA 1ACLA 4ZDJA 1T9GR 4YREA 2AE2A 4P3OA 1DX4A 1NYRA 2I2AA 5TRTA 1N6RA 2XB9A 1W4LA 1FXWF 3EIQA 1SKMA 3EVAA 1JQJC 2MSWA 1JDNA 3ECCA 2B4YA 3RWBA 4WZBB 4W5TA 1THZA 1U9CA 1WIWA 2VDVE 4WBNF 1FDIA 4YT4A 2AQIA 4IIHA 1N7GA 3ORFA 2QRVA 3L8MA 2H7CA 2W37A 3GGPA 3RTAA 3OLZA 1GR1A 2OQ2A 1ZL0A 1YRQA 3OQBA 4YO8A 5EPOA 2PUDA 3UK2A 4L73A 3KSAC 4OFZA 1OJLA 1ICIA 3DMYA 4MUAA 1XCPA 3V8PA 4QREA 4EG0A 4QJIA 2Z8YM 4X1OA 4RHYA 2YJZA 1J39A 1LZKA 9ABPA 1UBSB 5EZSA 4BQRA 3LQ4A 2YS7A 3MT0A 5D5QA 5DGIA 4NFHA 5L3VA 5FIUA 2IY7A 4Z7QB 1R0ZA 2DXIA 2R8YA 5EKUA 4B4KA 3B3QA 3B1JA 4JXXA 3O9VA 4C21A 4P4LA 4NP6A 5A3RA 3O8LA 1QFXA 4UARA 1OFTA 3BN3A 4YUVA 4L9AA 4TSRA 4U5XA 4FYIA 2N0SA 4OMFG 3KBOA 2BRUC 2ZYUX 4RA6B 5A0FA 4YMTA 1RWPA 1LLDA 2B3TA 3IAS6 3V3KA 4O59O 1MX1A 2P9CA 3ER9A 3D6NB 3C1OA 5JCXA 2DSTA 4JQCA 5CA0F 2W22A 4G8JA 3SZMA 4CM8A 4DCMA 2D06A 4GICA 5TPWA 2VJAA 5DNCA 3U5ZB 4NLLA 2NSJA 1EDOA 1G7RA 2XUKA 3EDQA 4V0MA 4Z6KA 4ZCIA 5IHXA 2P3QA 1HY3A 2E6KA 3KQKA 2Q6LA 3U62A 2LIPA 5IYZA 1X92A 2AR7A 2B8TA 2NZ2A 3WNCA 4IY1A 2ROQA 8AT1A 1IQ0A 2A57A 3BJRA 4P08A 2OO7A 1L9XA 3B82A 2PSEA 4YBRA 4ICIA 1HKUA 2DGDA 4URUR 5K3CA 3JVDA 5CX1A 2OB2A 4O4LA 3HRHA 3DL2A 1AV6A 2WFZA 2UYCA 3AGQA 4FYVA 3HSSA 4RK5A 2WE7A 4BKMA 1U2DC 1ZINA 1JR3E 1ZHFA 3HABA 3USCS 3TK1A 3GV0A 2J6BA 1OCEA 3W5JA 4ADSG 3HP7A 1UWLA 4YACA 1I6MA 1B23P 2CL5A 4ZT4A 3EZ2A 4HD8A 4BCBA 4ZCRA 1AQNA 3W5BA 2F55A 1RI3A 1QV6A 2Z95A 3ENQA 3G0BA 3ORYA 5E1OA 2FB9A 3ZGYA 5B4VA 5C8YF 1ZO8A 4KUHA 1OWMA 1ECPA 5CVTA 1T24A 5A7HA 1N8KA 2ZUBA 4UNIA 2NPIA 1IQPA 3FPFA 2PMWB 3V9AA 2A33A 4F3KA 5ALQA 1SG9A 2I6XA 2OBYA 4HQLA 3FCOA 2XYPA 2ZQZA 1TVKA 4O4HB 4QDUA 4TVOA 5A62A 4PGGA 3K32A 1FP4B 5EXPA 4IUBS 3VYSB 2JFGA 3ELUA 3ENZA 5EZ6B 3TEMA 2GK7A 5FP0A 3QVGB 3O31A 1IY9A 2BFMA 1YQEA 3EB9A 3PEFA 1GOTA 1YJQA 1U4NA 3BWDD 3PR1A 4ZV7A 4LVNA 3Q3JB 1CUXA 1WW8A 4COOA 4I1OA 3KYDA 5AI6A 5ETJA 4D9JA 1Y7IA 2HYIC 3AK4A 2GEJA 4LX8A 4EMUA 1HE3A 1Q3TA 1I9CA 3ZV6A 2Y76A 1P72A 2UZIR 4Q0MA 3F74A 4UEJA 4PG6A 2XZOA 2NT3A 5LLTA 1HC7A 4KIJA 4BNIA 5FAKA 4TZTA 5EVJA 3OCJA 2J3IA 4J0QA 4M49A 5M04A 3OFVA 621PA 1PIWA 2C7GA 4JMPA 3GDGA 1B3RA 1ETUA 1WB6A 1RLJA 2QD1A 5LDDC 4XIJA 3IEMA 4QTYA 3JAWB 1L8XA 3WTBA 5TT0A 2ODNA 2B1JA 2W4MA 5DI9A 3O8DA 3RVRA 4EH1A 3O8RA 2PANA 3AR6A 4XD7D 4K86A 5DLEA 3G23A 4ENVA 3B60A 3KVYA 4FONA 5K1ZA 2FFBA 4B3HA 4DABA 3ZDXB 1N2CA 1PG0A 3DFIA 5EYPB 3TYXA 4F2HA 2PGAA 4TX1A 2XE8A 4A8HA 2OM6A 3RS5A 4IZHA 4Q3KA 2O20A 3MWJA 2O23A 2ZTSA 4LEIA 5BN4B