1AL3A

Cofactor binding fragment of cysb from klebsiella aerogenes
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
237
structure length
237
Chain Sequence
TWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEDIEAMFKDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
publication title The structure of the cofactor-binding fragment of the LysR family member, CysB: a familiar fold with a surprising subunit arrangement.
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Transcription regulation
total genus 71
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 1997-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1al3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1al3A01
3DP6A 3K00A 1SVXB 1ZU0A 2O68A 3QUFA 2GRVA 2OBGA 3H4ZA 1CB6A 3FD3A 1PB9A 3C35A 1Y3NA 3U72A 3UORA 1ZKBA 2Z8FA 4H6DA 1MH4A 2Y7KA 5K2YA 2AIXA 4ZEKA 5ISUA 4G8HA 2VP1A 2PYYA 4ONYA 1B3FA 2H5YA 1WVJA 2O1LA 2W7YA 4KHZE 3IJXB 5H8HA 2YLNA 3O6GA 2O51A 4QFKA 1F9BA 5H8FB 3OXNA 4NF6B 1AOVA 4GXSB 3IORA 3FVGA 3BFTA 1EU8A 2QMWA 5FTHA 4WKMA 3K1NA 1LCTA 4R9FA 5IAIA 4FIMA 2I4CA 4N13A 1B6HA 3A09A 2O6AA 5I84A 5FHOA 3A3CA 3K0VA 1US5A 1IIWA 1SD3A 1DPPA 3C4MA 2NWJA 4MLQA 1H76A 3KBRA 2PVUA 1Y3PA 4YKKA 2RC8A 3S9NC 2Y84A 2F7AA 4HW8A 4F3BA 3VVDA 1MDQA 1RYXA 2P1SA 1GTKA 4F19A 4YMBA 1L5TA 2OJTA 3IOVA 1D9VA 4LZ5A 4OFJA 2H25A 3FV1A 5FHNA 2ZYNA 3UK4A 3Q25A 1P1QA 3ONMA 4JXIA 4IB2A 2HCAA 4DXCA 1XC1A 1POY1 3MZ9A 4DZ1A 1KWHA 4U4XA 3PGFA 1IXHA 5TPAA 4OVJA 2XXTA 3RT8A 5DEXA 2DOJA 4KQPA 2UVGA 5TU0A 3C32A 3TELA 3H6UA 4HTGA 4EDPA 4F1YA 3A3UA 3QSLA 4ZZAA 1VR5A 2F5XA 3PD9A 2NVUB 3G7WA 1FQFA 5TP9A 1POTA 3KG2A 1Y20A 1NL5A 3FUZA 2ZNUA 2G29A 2ONSA 2ZNTA 5H8NA 3F11A 1FTOA 3KGCA 5JTYB 4X1DA 3IL1B 3V83A 3LSLA 4H8JA 4NWDA 5AE4A 3T22A 1IXGA 1EH3A 2QS3A 1AIVA 3TODA 1TWYA 5AA4B 4BDLA 3E13X 4YU0A 1Y9UA 4U1ZA 4QSEA 2ZYMA 1FCKA 1XVXA 4OZ9A 2DXYA 2Y7WA 4UA8A 1MY2A 4Z0IA 2QS1A 3EHSA 3IX1A 2DP8A 3VLUA 3ZKKA 3W15C 1S50A 4JWXA 1MXVA 2OWTA 1URSA 4H1XA 5BUUA 1QVSA 2HXWA 4DE8A 4PETA 5H8FA 4GFRA 1QW0A 4F1UA 1S7YA 4POXA 4U2RA 1FQBA 4I1DA 4NF8B 4FEDA 3FATA 3IB2A 4ELPA 3C33A 2DWHA 3HCQA 1MS7A 2F78A 3TTLA 2E0SA 2RC9A 4LA9A 4KR5A 1SDXA 1FQDA 3HHFA 3H6VA 3Q28A 4GIZA 4L17A 2ONRA 2KLFA 4I8CA 5EHSA 4R9GA 1YAEA 3THIA 3OENA 3KN7A 4LUBA 5I56B 1FTLA 3IOWA 3K1PA 1NKXA 5DVFA 3O6IA 3TTNA 3FVOA 3UN6A 1SW4A 1NNKA 3G3GA 2Z8EA 3MPKA 2QRYA 4NF4B 1B9JA 4MLVA 3TMGA 1M5CA 4OFOA 3CFLA 1JVXA 1B1HA 4LQ2A 2H99A 3U1OA 4OETA 4AB6A 1BTJA 3IJOB 3WAEA 4QFOA 2DE2A 3ILTB 4X1BA 1MXZA 5JEIA 3H6WA 1LGBC 3FXUA 5KCJB 3QXMA 2NOOA 2ONKE 3TCFA 1H44A 3FV2A 3HO7A 3IOTA 3S9EA 2I49A 2DVCA 4M4GA 1IZ1A 1SQYA 3LC8A 3RGYA 3FVKA 2VOZA 2PT2A 1RYOA 4FJPA 2IEEA 1Y4CA 3MVWA 4PFWA 1MH3A 5JTYA 4ND9A 3O6HA 2V93A 2FNCA 5AA2D 2V25A 1B2HA 2UYFA 3BBRA 4EXKA 3G3FA 1MY4A 3SKPA 2UVIA 4R6YA 2WKYA 1ZTYA 4F2QA 1SI0A 4N07A 1N7XA 5DTBA 1USYE 3EPEA 4WEDA 3K2DA 1LFIA 3K02A 1B7ZA 3QIMA 4P0GA 2DXRA 4RPNA 3BFUA 5CC2A 4TLMB 5DT6A 4BDNA 1PEBA 2R71A 4X48A 1NNPA 4KI0E 4HCWA 2CZLA 4JBZA 2HAUA 4NF8A 3R6UA 4KCCA 2O69A 1PDAA 2H98A 1B5HA 1H3DA 1OMPA 2XHDA 3N94A 3CRBA 1B7UA 5IKBA 3D4GA 5H8QB 2XXUA 5DEXB 5EHMA 4JWOA 3TFLA 1D3KA 1N84A 4F3GA 3KSXA 1P1OA 5L8DA 3LSFB 3MWBA 3MPLA 4OQOA 4DCYA 4JSDA 5I56A 3C34A 2ABHA 3ZKLA 2BJJX 3TEPA 5TP9B 4BDMA 1GR2A 5ITOA 3RTWB 3DLNA 2DE4A 1M5EA 2DVZA 3IB1A 4IY6A 4NF4A 1PBQA 3MVXA 4Q5TA 4OYVA 2DSFA 1B1XA 3T9UA 2RKMA 4OTEA 1N76A 1ELJA 4F18A 3IK6B 4RXLA 1QUIA 2REGA 4EF1A 3E4RA 3B7DA 4POWA 1HSJA 1OIBA 2FYIA 4N6PA 2Y7IA 5KCJA 3KJTA 1CE2A 3R26A 1B0LA 4NTLA 3CIJA 4R72A 1A55A 1QUKA 1SI1A 1MXUA 3KOSA 4GVOA 1LAFE 2XXIA 3T9VA 3ZS6A 2HQ0A 1A99A 2PBWA 2H9BA 2F6PA 3QUJA 4EF2A 1MPDA 2Q2CA 3H06B 1ZLQA 4TQUQ 4QSCA 2ALUA 3PMXA 1OLAA 4IO7A 4QSDA 2ZYOA 4IO5A 4R6KA 1D9YA 1O64A 5K2XA 5BWJA 3G3KA 4R6HA 4UACA 5F1QA 1BP5A 4PFTA 1B58A 4GF8A 1B4ZA 4R2FA 3UGWA 3C31A 2XXHA 5CMCA 4GL0A 1LB8A 3K6WA 5B7DA 4LATA 2V3TA 4K3FA 3U8QA 4QF9A 3DM0A 5A5XB 3SERA 1MDP1 1Z7ME 4AB5A 4RK2A 3B6QA 4R2BA 5L9MA 2I0CA 3K6VA 1XVYA 3VVFA 4EXLA 2Q88A 4QFLA 3PUXE 3CFZA 4ZEDA 4F22A 3TKDA 4OWDA 2X7QA 1FTJA 1B51A 4OHNA 1MY1A 3I3VA 2DYXA 1LAGE 4Q0CA 4PQJA 1Q1KA 1JNFA 2V3QA 1MG1A 3SEVA 1Y4TA 3O28A 5H8QA 1GVCA 1M5BA 1LFHA 1VFEA 4IO3A 1Y1MA 1LB9A 4R75A 1UTHA 5ELVA 1A8FA 5I57B 4IGRA 2PMSA 4XKNA 1XHYA 4YKIA 1SW2A 3CVGA 2VD3A 2QPQA 3K01A 1B05A 4YMAA 5HBCA 2QL3A 3CR9A 2UVHA 4DDDA 3CG1A 3OEKA 1S9TA 1MM7A 1I69A 2I3VA 5CMMA 1P1UA 3FVNA 3V5AA 4DLDA 2AL4A 2NXOA 4IGTA 5KZTA 1XT8A 4JDFA 1T0KA 1OQGA 4OXVA 4ZEFA 3V89B 4WXJA 2VGQA 2D3IA 3RNNA 4ESWA 1ATGA 4OMBA 5I2KB 3K6UA 1J1NA 4C1TA 2ZYKA 2M8CA 3OD7A 1HSEA 3C36A 4QFPA 1BKAA 5I2NB 2XXPA 1MQJA 3OO8A 3WAFA 3OOAA 5HM4B 2AYSA 4OERA 5ICQA 3TPAA 3ZSFA 4RJZA 1YCJA 4ZDMA 2UXAA 2OCUA 3DELB 3H6TA 4OENA 1URDA 3JV9A 4MF3A 5KDTB 1YPNA 1NNFA 4M1VA 5M2VA 4RA1A 3S4UA 5CM6A 4RY1A 4H0WA 3PPPA 3LSXA 4YZZA 4YKPA 3Q29A 4BDRA 1DMBA 3UP9A 1I6BA 3OELA 3Q26A 4ZE8A 4ISUA 1VFDA 3D4CA 3ILUB 3MVYA 2V3UA 4YB6A 3MBPA 5A5XA 1N3WA 4F2OA 3N26A 1SW5A 5ITPA 3SETA 3VXBA 1MM6A 4FECA 1LBCA 2XD3A 3GLBA 2A5TB 1B0HA 5ICTA 3VV5A 3MW0A 3MQ9A 3SEYA 4QHQA 1H45A 3U94A 4F29A 3L6GA 4P0IA 2AL5A 4PE5B 3MC2A 3O97A 1ZBMA 2I3WA 1D4NA 1NMUA 4U4SA 3PPOA 3VLVA 3IAZA 1HSLA 2NUVA 3KFMA 1LAXA 3CI8A 1LSTA 1IITA 2RF1A 5DVJA 1DPEA 5I57A 5CI5A 2XXRA 3TCHA 4I62A 4KYEA 5AA1A 4XXUA 2RINA 3T66A 4IO4A 3CSGA 4OEUA 5CBSA 4HS7A 2Q2AA 1GGGA 1P1WA 2HAVA 4O3CA 4C1UA 1TT1A 3FZVA 3V8XB 1B5IA 4H5GA 1B7HA 4EQ9A 3FGSA 1QKBA 4E0XA 4H8IA 3KEIA 1PC3A 2F34A 4U21A 3OO6A 3DP4A 4FE8A 2ZXTA 3EHTA 4I9DA 3OEMA 5I2KA 4X9TA 2GH9A 3OO7A 4ZEIA 5I2NA 3T96B 1JEVA 2Y7PA 2XXWA 3SESA 1B5JA 1DSNA 3G3HA 1XS5A 3TZAA 3K4UA 1FQEA 4ZEBA 2XXVA 2VHAA 1MXXA 1JETA 4XKRA 2B3FA 5KDTA 1LAHE 2GHAA 3PUVE 1ZIUA 1LFGA 4EUOA 5L9SA 4DIGA 2Z23A 3P7IA 4OFLA 4IY5A 1ANFA 3KJ7A 4KCDA 3GBAA 3FIRA 4LZ7A 1PB8A 2X26A 4G77A 1UTHB 5L9OA 3HN0A 3FJ7A 1UQWA 5I59B 2OLBA 1EZOA 3EF7A 4U22A 3RPWA 3DP8A 4P11A 5HPQA 1MQHA 2XXQA 4LZ8A 3O29A 3EHUA 2A5TA 3MAMA 3PPQA 3UA8A 3PV0E 3VDFA 1N04A 1VE4A 2IA4A 1MPCA 1Q35A 2XXYA 3KN3A 1QULA 1I6QA 1I6AA 3MVZA 3U93A 2XX8A 2X7PA 4ECFA 2XXXA 3G3JA 4XIGQ 3MJNA 3AXFA 4GXAA 1JW5A 4R73A 3KSJA 4ZS9A 1TFAA 3R7XA 2HEUA 3EQ1A 1DOTA 1R1NA 2A5SA 3QYTA 3SDFA 4XKPA 2XX9A 1FTMA 2G93A 3GBBA 1B46A 5B70A 1BIYA 3RLFE 5EYFA 4JWYA 4ZE9A 3S9MC 4IO6A 2REJA 2O7IA 1ZJLA 2UYEA 3HPIA 4YICA 2Q8JA 4G2ZA 3TQLA 3M3KA 2H4IA 4NWCA 4R74A 3CFXA 1B3LA 5FTIA 3I5OA 1RKMA 1SYHA 1B3EA 3TTKA 1XOCA 1N7WA 4XTCQ 4DCXA 3TCGA 3ODBA 3MP8A 3T9XB 2Y7RA 1FQCA 1GV8A 1AMFA 4G8MA 1VSOA 3SEUA 4TOZA 4YKJA 3VE1B 4YAHX 4TLLB 3H3GA 4BDQA 3FJGA 1MQDA 2O1MA 4MFIA 3O66A 4U23A 4ELQA 2Z8DA 3VFJA 2YJPA 3LSWA 1IEJA 2B65A 4FORA 4MBPA 4F3PA 3TQWA 1PB7A 4EQBA 3M8UA 3PUWE 5LOMA 3E3KA 4GL8A 2P0SA 3RT6B 3PU5A 1R9QA 1OVBA 1UTBB 1TFDA 2D21A 2ESNA 2F6GA 1R9LA 5F7VA 1O63A 1FQAA 4PFUA 3CG3A 2QMXA 2ZNSA 3IO4A 1JVYA 2DWAA 4ESXA 4KYSA 3PPRA 3MP6A 3HV1A 3M3FA 2I48A 1B40A 4YB7A 3QAXA 3MZ1A 1JW4A 2QSXA 5I59A 2RCBA 3IR1A 1PBPA 2Z22A 2R9JA 2D5WA 2HZLA 1LBBA 1Y3QA 4EQ7A 3U92A 1MQIA 4G68C 1LLSA 3RTFB 3OO9A 2OZZA 3MUQA 3I6VA 2DQVA 1Y1ZA 3N6UA 2QS2A 3RUMA 4Q8RA 4FATA 4F31B 1IQ7A 1A54A 1II5A 4QRZA 3K6XA 5J1DA 3ECRA 1EZ9A 3GXAA 2XD2A 2UVJA 1IXIA 2O84X 4PP0A 3TTRA 4GD5A 4NF5B 4G68B 1DTZA 4RPOA 1JW1A 3W9WA 1Z7NE 3GZGA 1UIUA 5CBRA 4F1VA 1MY3A 2DWJA 4FEBA 1MXWA 2VD2A 2I0BA 2F7CA 1OVTA 3TTMA 2HFBA 3N5LA 3Q27A 2I4BA 2PT1A 5H8SA 4KYDA 2P2AA 3PMWA 4WEPA 4GQOA 4LONB 4H67A 1FW0A 3MP1A 1A40A 1LCFA 2F8DA 4LP2B 4GWOA 2Q89A 1SYIA 3RQTA 4NF6A 4MH5A 2E1SA 1B32A 1QUJA 3LR1A 5JK4A 1MQGA 4JSOA 1R6ZA 1URGA 1OLCA 4HCYA 4H5FA 2DS9A 2F35A 2O7UA 2LAOA 3HSTA 3O9PA 2DE3A 1USYH 2GFEA 3KOTA 3FXQA 5FHMA 5CMKA 3E9XA 1OQHA 3RY3A 3LBSA 3S2VA 1BLFA 5DVIA 1IXCA 4NE4A 3BKIB 4C0RA 4E0WA 5AA2B 2YPNA 1UTBA 2F7BA 4Z7EA 5I58B 2THIA 3VXCA 1AL3A 3KZGA 3MZBA 2F97A 3C9HA 4NMYA 1NH8A 2R6GE 3N6TA 2RC7A 3B6TA 1TXFA 3PUZE 4F3SA 4G8NA 1ZMGA 2I58A 5DYHA 3OMBA 3H03A 4THIA 4KFQA 4ZZEA 1B4HA 4ELOA 4XKQA 3TYHA 3TDJA 3SEXA 1M5FA 1MPBA 3LUYA 4KPTA 4OEVA 5H8HB 5AA3A 4DXBA 4PFYA 1NNTA 3OSQA 3PUYE 3FXRA 3IB0A 3VLWA 1AH5A 3CSBA 3SEWA 4F39A 3UIFA 4ELRA 3PD8A 2XX7A 4GRKA 1UIVA 4NF5A 4G68A 1P99A 3H7MA 3VVEA 1MXYA 4IO2A 1FTKA 2OK2A 2GHBA 1IUDA 4LQ5A 1A7LA 3W9VA 4JB7A 1JQFA 1QKAA 5AA4A 3S9LC 4AQ4A 3B6WA 5CRYA 4GLIA 1MY0A 1A8EA 4O3AA 1O7TA 3G3IA 1DTGA 2FA7A 1WDNA 1US4A 3IOUA 3TUSA 2F36A 1QJMA 2CMOA 1M5DA 2RCAA 4NEDA 1SW1A 2ZMBA 4YB5A 2B3BA 4U1OA 3EN3A 4H65A 4FAJA 1EZPA 3USDA 3L6HA 3M3LA 2V84A 3FASA 1NH7A 3QK6A 1N0TA 3IO6A 4RK9A 4KD5A 3RN8A 4GOTA 1B52A 2OWSA 1MRPA 5TPAB 4RYAA 2ANJA 3K1MA 1SBPA 2PX1A 1P1NA 4BLAA 3OSRA 2QS4A 4LVQA 5CMBA 2QJEA 1WODA 4BDOA 3HHGA 1B3HA 4RNSA 3KN8A 4QFNA 3O2AA 4Q30B 3JZJA 1JEUA 3T9HB 3PPNA 2HZKA 2Q9TA 1N3XA 5AA2A 1H43A 5H8NB 3FJMA 3TAJA 2DWIA 3PMVA 4OESA 5I58A 1YTVA 4DXUA 4ZECA 4G4PA 3JYRA 1NFTA 1B3GA 4O3BA 3T93B 2I6EA
chains in the Genus database with same CATH superfamily
3DP6A 3K00A 1SVXB 1ZU0A 2O68A 3QUFA 2GRVA 2OBGA 3H4ZA 2Q74A 1CB6A 3FD3A 1PB9A 3C35A 1Y3NA 3U72A 3UORA 1ZKBA 2Z8FA 2P3NA 4H6DA 1MH4A 2Y7KA 4PE3A 5K2YA 2AIXA 4ZEKA 5ISUA 4G8HA 2VP1A 2PYYA 4ONYA 1B3FA 2H5YA 1WVJA 2O1LA 2W7YA 4KHZE 3U65A 3IJXB 5H8HA 2YLNA 3O6GA 2O51A 1FTAA 4QFKA 1F9BA 5H8FB 3OXNA 4NF6B 4PBQA 1AOVA 2XWKA 4GXSB 3IORA 2CZKA 3FVGA 3QMFA 3BFTA 2VT5A 1EU8A 1RDZA 2QMWA 5FTHA 1IMBA 4WKMA 3K1NA 1LCTA 4R9FA 5IAIA 4FIMA 2I4CA 4N13A 1B6HA 3A09A 2O6AA 5I84A 5FHOA 3A3CA 3K0VA 5I5PA 1US5A 1IIWA 1SD3A 1DPPA 2F3DA 3C4MA 2NWJA 4MLQA 1H76A 3KBRA 2PVUA 1Y3PA 2KQZA 2RC8A 4YKKA 3S9NC 2Y84A 2F7AA 4HW8A 4F3BA 3VVDA 1MDQA 1RYXA 2P1SA 1GTKA 4F19A 4YMBA 1L5TA 1DK4A 2OJTA 3IOVA 1D9VA 4LZ5A 4OFJA 1G0IA 2ZZXA 2H25A 1FBCA 1LBZA 3FV1A 5FHNA 2ZYNA 3UK4A 3Q25A 1P1QA 3ONMA 1LBXA 4HXVA 4JXIA 4IB2A 2HCAA 4PFIA 4DXCA 4GX3A 1XC1A 5EQ7A 1POY1 3MZ9A 4DZ1A 3EKIA 1KWHA 4U4XA 3PGFA 1IXHA 5TPAA 4MCOA 4OVJA 2XXTA 3RT8A 5DEXA 1SPIA 2B4LA 2DOJA 4KQPA 2UVGA 5TU0A 3C32A 3TELA 3H6UA 4HTGA 4EDPA 4F1YA 3A3UA 2GQ1A 3QSLA 4ZZAA 1VR5A 1FPGA 2F5XA 3PD9A 2NVUB 3G7WA 1FQFA 5TP9A 1POTA 3KG2A 4MHFA 1Y20A 1NL5A 3FUZA 2ZNUA 2G29A 1NUXA 5IGAA 2ONSA 2ZNTA 5H8NA 3F11A 1FTOA 3KGCA 5JTYB 4X1DA 2P3VA 3IL1B 3V83A 3LSLA 4H8JA 2FIXA 4DI4B 4NWDA 5AE4A 4LN5A 3T22A 1IXGA 1EH3A 2QS3A 1AIVA 3TODA 1TWYA 3KC1A 5AA4B 4BDLA 1FBFA 3E13X 4YU0A 1Y9UA 4U1ZA 1KA1A 4QSEA 2ZYMA 1FCKA 1XVXA 4OZ9A 2DXYA 2Y7WA 4UA8A 1MY2A 2QS1A 3IX1A 3EHSA 4Z0IA 2DP8A 3VLUA 3ZKKA 3W15C 4MMPA 4PC9A 1S50A 4JWXA 1MXVA 2OWTA 1URSA 4H1XA 5BUUA 1QVSA 2HXWA 4DE8A 4PETA 1FPJA 4QBAA 5H8FA 4GFRA 1QW0A 2FIEA 4F1UA 1S7YA 4POXA 4U2RA 1FQBA 4I1DA 4NF8B 4FEDA 4P3LA 3FATA 3IB2A 4ELPA 3C33A 2DWHA 3HCQA 1MS7A 2F78A 3TTLA 2E0SA 2RC9A 4LA9A 4KR5A 1SDXA 1FQDA 1VDWA 3HHFA 3H6VA 3Q28A 4GIZA 4L17A 2ONRA 2KLFA 4I8CA 5EHSA 4R9GA 2JJKA 1YAEA 3THIA 3OENA 3KN7A 4LUBA 5I56B 1FTLA 3IOWA 3K1PA 1NKXA 5DVFA 2HPGA 3O6IA 3TTNA 3FVOA 3UN6A 1SW4A 1NNKA 3G3GA 2Z8EA 3MPKA 2QRYA 4NF4B 1B9JA 4MLVA 3TMGA 1M5CA 4OFOA 5ET8A 3CFLA 1JVXA 1B1HA 4LQ2A 2H99A 3U1OA 4OETA 4AB6A 2R8TA 5EYGA 1BTJA 1NV7A 3IJOB 3WAEA 4QFOA 2DE2A 3ILTB 4X1BA 1MXZA 5JEIA 4OVQA 3H6WA 1LGBC 3FXUA 5KCJB 3QXMA 3E78A 2NOOA 2ONKE 4HE1A 3TCFA 1H44A 3FV2A 3HO7A 1FPBA 3IOTA 3S9EA 2I49A 2DVCA 4M4GA 1IZ1A 1SQYA 3LC8A 3NOHA 3RGYA 4N4UA 3FVKA 4N15A 2VOZA 3MSTA 2PT2A 1RYOA 1EYIA 4FJPA 2IEEA 4KXPA 4G61A 1Y4CA 3MVWA 4PFWA 1MH3A 5JTYA 4ND9A 3O6HA 2V93A 4OANA 2FNCA 4GWSA 5AA2D 2V25A 1B2HA 2UYFA 3BBRA 4EXKA 3G3FA 1MY4A 3SKPA 2UVIA 4R6YA 2F3BA 2WKYA 5F24A 1ZTYA 4F2QA 1SI0A 4I3YA 4N07A 1NUZA 1N7XA 2OWZA 5DTBA 1USYE 3EPEA 4WEDA 3K2DA 1LFIA 3K02A 4P9KA 4PAKA 1B7ZA 3QIMA 4P0GA 2DXRA 4RPNA 4FBPA 3BFUA 5CC2A 3FXBA 4PAIA 4TLMB 5DT6A 4BDNA 1PEBA 2R71A 4X48A 1NNPA 4O94A 4KI0E 4HCWA 2CZLA 4JBZA 2HAUA 4NF8A 3R6UA 4KCCA 2O69A 1AWBA 1PDAA 2H98A 1B5HA 1H3DA 1RDYA 4X04A 1OMPA 2XHDA 3N94A 2V4CA 3CRBA 1B7UA 4NF0A 5IKBA 3D4GA 5H8QB 2XXUA 5DEXB 5EHMA 4JWOA 3TFLA 1D3KA 1N84A 1YYZA 3A29A 4F3GA 3KSXA 1P1OA 5L8DA 3LSFB 3MWBA 3MPLA 4OQOA 4DCYA 4JSDA 5I56A 5ESYA 4JVCA 2KR0A 3C34A 2ABHA 3ZKLA 2BJJX 2Y5LA 3TEPA 5TP9B 4BDMA 4PGNA 1GR2A 5ITOA 3RTWB 3DLNA 2DE4A 1M5EA 2DVZA 3IB1A 2WBBA 4IY6A 4O7MA 3E79A 4NF4A 5LTCA 1PBQA 3MVXA 4Q5TA 4OYVA 2DSFA 1B1XA 3T9UA 2RKMA 4OTEA 1IMAA 1N76A 1ELJA 4F18A 4N8GA 3IK6B 4RXLA 1QUIA 2REGA 4EF1A 3E4RA 3B7DA 4POWA 1HSJA 1OIBA 2FYIA 4N6PA 2Y7IA 5KCJA 3KJTA 1CE2A 3R26A 1B0LA 4NTLA 3CIJA 1G0HA 4R72A 1A55A 1QUKA 1SI1A 1MXUA 3KOSA 4GVOA 1LAFE 2XXIA 1JP4A 3T9VA 3ZS6A 2XWIA 2HQ0A 1A99A 1KZ8A 4PDDA 2PBWA 2H9BA 1NV1A 3LV0A 2F6PA 3QUJA 4EF2A 1MPDA 1NV6A 2Q2CA 3H06B 4MNIA 1ZLQA 4TQUQ 4QSCA 2ALUA 3PMXA 2CEXA 1OLAA 4IO7A 4QSDA 2ZYOA 4IO5A 4R6KA 1D9YA 4IR8A 1O64A 5K2XA 5BWJA 3G3KA 4R6HA 3ISPA 4UACA 5F1QA 1BP5A 4PFTA 1B58A 4GF8A 1B4ZA 4NHBA 4R2FA 3UGWA 3C31A 4H46A 2B4MA 2XXHA 5CMCA 4GL0A 1LB8A 3K6WA 5B7DA 4LATA 2V3TA 4K3FA 3U8QA 4QF9A 3RPLB 3DM0A 5A5XB 5EQ8A 1CNQA 3SERA 1MDP1 1Z7ME 4AB5A 4RK2A 5EQ9A 3B6QA 4R2BA 4OVSA 5L9MA 2I0CA 5J16A 3K6VA 1XVYA 3VVFA 4EXLA 2Q88A 4QFLA 3PUXE 4GBWA 3CFZA 4ZEDA 4F22A 3TKDA 4OWDA 2X7QA 1FTJA 1B51A 4OHNA 1MY1A 3I3VA 2DYXA 2QFLA 1LAGE 4Q0CA 4PQJA 1Q1KA 4JVIA 1JNFA 2V3QA 1MG1A 1NV5A 2QVRA 3SEVA 5ET6A 1Y4TA 3O28A 5H8QA 1GVCA 1M5BA 1LFHA 1VFEA 4IO3A 1FSAA 1Y1MA 1LB9A 4R75A 1UTHA 5ELVA 1A8FA 5I57B 4IGRA 2PMSA 4XKNA 1XHYA 4YKIA 4OA4A 4PFBA 1SW2A 4MAGA 3CVGA 2VD3A 2QPQA 3K01A 1B05A 2HXRA 4YMAA 4PCDA 5HBCA 2QL3A 3CR9A 2UVHA 4DDDA 1QGXA 3CG1A 3OEKA 5A5LA 1S9TA 1MM7A 1I69A 2I3VA 5CMMA 1P1UA 3FVNA 3V5AA 4DLDA 2AL4A 2NXOA 4IGTA 5KZTA 1XT8A 4JDFA 1T0KA 1OQGA 4OXVA 4ZEFA 5IZ1A 3GYYA 3V89B 4WXJA 2VGQA 2D3IA 3RNNA 4ESWA 1ATGA 1K9YA 4OMBA 5I2KB 3K6UA 1J1NA 4C1TA 2ZYKA 2M8CA 3OD7A 1HSEA 3C36A 3KBZA 4QFPA 1BKAA 5DW8A 5I2NB 2XXPA 1MQJA 3OO8A 2CZHA 3WAFA 3OOAA 5HM4B 2AYSA 4OERA 5ICQA 3TPAA 3ZSFA 5IZZA 4RJZA 1YCJA 4ZDMA 3B8BA 2UXAA 2OCUA 3DELB 3H6TA 4OENA 1URDA 3JV9A 4MF3A 5KDTB 1YPNA 1NNFA 4GWWA 2WYKA 4M1VA 2MKZA 5M2VA 4RA1A 1FBDA 3S4UA 5CM6A 4RY1A 4H0WA 3PPPA 3LSXA 3T0JA 4YZZA 4YKPA 3Q29A 4BDRA 1DMBA 4OVTA 3UP9A 1I6BA 3OELA 3Q26A 4ZE8A 4ISUA 1VFDA 3D4CA 1FPIA 3B50A 3ILUB 4MNCA 2WX9A 4XFEA 3MVYA 2V3UA 3RPLA 4YB6A 3MBPA 5A5XA 4AS4A 4HE0A 2Q8MA 3T1BA 1N3WA 4F2OA 3N26A 1DBZA 1SW5A 5ITPA 3SETA 3VXBA 1MM6A 4FECA 1LBCA 2XD3A 3GLBA 2A5TB 1B0HA 3BIGA 4NN3A 3MW0A 3MQ9A 3VV5A 5ICTA 3SEYA 4QHQA 1H45A 3U94A 4F29A 3L6GA 4P0IA 1Q9DA 2AL5A 4PE5B 1FBHA 2FVZA 3MC2A 3O97A 1ZBMA 2I3WA 1D4NA 1NMUA 4DI3D 4U4SA 3PPOA 3VLVA 1NV3A 3IAZA 1HSLA 2NUVA 3KFMA 1LAXA 3CI8A 1LSTA 1IITA 2RF1A 5DVJA 1DPEA 1FPLA 5CI5A 5I57A 2XXRA 3TCHA 4I62A 4KYEA 1FPFA 4XXUA 2RINA 5AA1A 3T66A 4IO4A 3CSGA 4OEUA 5CBSA 4HS7A 2Q2AA 1GGGA 1P1WA 2HAVA 4NG7A 4O3CA 5IZ3B 4C1UA 1TT1A 3FZVA 3V8XB 4N81A 1B5IA 4H5GA 1B7HA 4EQ9A 3FGSA 1QKBA 4E0XA 4H8IA 3KEIA 1PC3A 2F34A 4U21A 3OO6A 3DP4A 4FE8A 2ZXTA 3EHTA 4I9DA 3OEMA 4I3EA 5I2KA 2HHMA 4X9TA 2GH9A 3OO7A 4ZEIA 4P1LA 5I2NA 3T96B 1JEVA 2Y7PA 4N6KA 2XXWA 3SESA 4O8MA 3HFUA 1B5JA 1DSNA 3G3HA 1XS5A 2PFYA 3TZAA 3K4UA 1FQEA 2DDKA 4ZEBA 2XXVA 2VHAA 1MXXA 1JETA 4XKRA 2XWOA 2B3FA 5KDTA 5EYHA 4PF6A 1LAHE 2GHAA 3PUVE 1ZIUA 4N6DA 1LFGA 4EUOA 5L9SA 1FPKA 4DIGA 4PTKA 2Z23A 3P7IA 4OFLA 4IY5A 1EYKA 1ANFA 3KJ7A 4PGPA 4KCDA 3BIHA 3GBAA 3FIRA 4LZ7A 1PB8A 2X26A 4G77A 1UTHB 5L9OA 1YXIA 4PDHA 3HN0A 4UABA 3FJ7A 1UQWA 5I59B 1YZ0A 2OLBA 1EZOA 2WEFA 3EF7A 4U22A 3RPWA 3DP8A 4P11A 5HPQA 1MQHA 2XXQA 4LZ8A 3O29A 3EHUA 3LUZA 2A5TA 3MAMA 3PPQA 3UA8A 3PV0E 3VDFA 1N04A 1VE4A 2IA4A 1MPCA 1Q35A 2XXYA 3KN3A 1FRPA 1QULA 4N8YA 1I6QA 1I6AA 3MVZA 3U93A 2XX8A 4GBVA 2X7PA 4XF5A 2CZIA 4ECFA 2XXXA 4XEQA 3G3JA 4XIGQ 3CHGA 2FBPA 3MJNA 4N17A 3AXFA 4GXAA 1JW5A 4R73A 3KSJA 4ZS9A 1TFAA 3R7XA 2HEUA 3EQ1A 1DOTA 1R1NA 2A5SA 3QYTA 4O7IA 3SDFA 4XKPA 4OVRA 2XX9A 1FTMA 2G93A 3GBBA 1B46A 2L5VA 1BIYA 5B70A 3RLFE 5EYFA 2ZZWA 4JWYA 4ZE9A 3S9MC 4P47A 4IO6A 5IZ3A 1IMFA 2REJA 2O7IA 1ZJLA 5I7IA 2UYEA 3HPIA 1LBYA 4YICA 2Q8JA 2ZZVA 4G2ZA 2XA5A 3TQLA 3ROJA 1FBEA 2OX3A 3M3KA 4JVDA 5T3JA 2H4IA 4NWCA 4R74A 3CFXA 1B3LA 5FTIA 3I5OA 1RKMA 1SYHA 1B3EA 3TTKA 1XOCA 1KA0A 1N7WA 4XTCQ 4DCXA 3TCGA 3ODBA 3MP8A 3T9XB 2Y7RA 1FQCA 1GV8A 1AMFA 4G8MA 1VSOA 3SEUA 4TOZA 4YKJA 3VE1B 1BK4A 4NAPA 4YAHX 4TLLB 3H3GA 4BDQA 3FJGA 1MQDA 1IMEA 2O1MA 4MFIA 3O66A 4U23A 4AS5A 3RYDA 4ELQA 2Z8DA 3VFJA 5ET7A 2YJPA 2FHYA 3LSWA 1IEJA 2B65A 4FORA 4MBPA 4F3PA 3TQWA 1FBGA 1PB7A 4EQBA 3M8UA 3PUWE 5LOMA 3E3KA 1NI9A 2PFZA 4GL8A 2P0SA 4H45A 3RT6B 3PU5A 1R9QA 1OVBA 1UTBB 1TFDA 2D21A 2ESNA 2F6GA 1R9LA 5F7VA 1O63A 1FQAA 4PFUA 3CG3A 2QMXA 2WBDA 2ZNSA 3IO4A 1JVYA 2DWAA 4ESXA 4GWUA 4KYSA 3PPRA 3MP6A 5EQAA 3HV1A 3M3FA 2I48A 1B40A 4YB7A 1RDXA 3QAXA 3MZ1A 1NV2A 1JW4A 2QSXA 5I59A 2RCBA 3IR1A 1PBPA 2Z22A 3MYUA 2R9JA 2D5WA 2HZLA 1LBBA 1Y3QA 4GWZA 4EQ7A 3U92A 1MQIA 4G68C 1LLSA 3RTFB 3OO9A 2OZZA 3MUQA 5IM2A 3I6VA 2DQVA 1FJ9A 1Y1ZA 3N6UA 5LDZA 2QS2A 3RUMA 4X8RA 4Q8RA 4FATA 4F31B 1IQ7A 1A54A 1II5A 4HE2A 1NV0A 4QRZA 3K6XA 5J1DA 3ECRA 1EZ9A 3GXAA 2XD2A 2UVJA 4GWXA 2WYPA 1IXIA 2O84X 4PP0A 3TTRA 4NQ8A 4GD5A 4NF5B 4G68B 1DTZA 4RPOA 1JW1A 2PCRA 3W9WA 1FPDA 3KC0A 1Z7NE 4GX4A 4PAFA 3GZGA 1UIUA 5CBRA 4F1VA 1MY3A 2DWJA 4FEBA 1MXWA 2VD2A 2I0BA 2F7CA 1OVTA 3TTMA 2HFBA 3N5LA 3Q27A 2I4BA 2PT1A 5H8SA 4KYDA 2P2AA 3PMWA 4WEPA 4GQOA 4LONB 1FBPA 4H67A 1FW0A 2QVUA 3MP1A 4MEVA 1A40A 1LCFA 2F8DA 4LP2B 4GWOA 2Q89A 1SYIA 2VPOA 3RQTA 4NF6A 4MH5A 4MX6A 2E1SA 1B32A 1QUJA 3LR1A 4NGUA 5JK4A 4OVPA 1MQGA 4JSOA 1R6ZA 1URGA 1OLCA 4HCYA 4H5FA 2DS9A 2F35A 2O7UA 2LAOA 2Y5KA 3HSTA 3O9PA 2DE3A 1USYH 5FBPA 2GFEA 4N91A 4NX1A 3KOTA 4I40A 3FXQA 5FHMA 5CMKA 3E9XA 1OQHA 3RY3A 4MIJA 3LBSA 3S2VA 1BLFA 4PF8A 5DVIA 1LEVA 1LBVA 1IXCA 4NE4A 3BKIB 4C0RA 4E0WA 5AA2B 1DCUA 2YPNA 1UTBA 3FBPA 2F7BA 4Z7EA 5I58B 2THIA 1INPA 3VXCA 1AL3A 3KZGA 1IMDA 3MZBA 2F97A 2QVVA 1FPEA 4MNPA 3C9HA 5I3SA 2CEYA 4NMYA 1IMCA 1NH8A 2R6GE 3N6TA 2RC7A 3SZPA 3B6TA 1TXFA 2VPNA 3PUZE 4F3SA 4G8NA 1ZMGA 2I58A 5DYHA 3OMBA 3H03A 4THIA 4KFQA 4ZZEA 1B4HA 4ELOA 4XKQA 3TYHA 3TDJA 3SEXA 1M5FA 1MPBA 3LUYA 4KPTA 2XXKA 4OEVA 5H8HB 3IFCA 4P1EA 5AA3A 4DXBA 4PFYA 1NNTA 3OSQA 3PUYE 3FXRA 3IB0A 3VLWA 1AH5A 1NV4A 4PBHA 3CSBA 3SEWA 4F39A 3UIFA 4ELRA 3PD8A 4PFRA 2XX7A 4GRKA 1UIVA 4NF5A 4G68A 1P99A 3H7MA 5ET5A 1MXYA 3VVEA 4IO2A 1FTKA 2OK2A 2GHBA 1IUDA 4LQ5A 1A7LA 3W9VA 4JB7A 1JQFA 1QKAA 5AA4A 3S9LC 4AQ4A 3B6WA 3IFAA 4GX6A 5CRYA 4GLIA 4P8BA 1MY0A 1A8EA 4GWYA 4O3AA 1LBWA 1O7TA 3G3IA 1DTGA 2FA7A 1WDNA 2XWVA 1US4A 3IOUA 3TUSA 2BJIA 2F36A 1QJMA 2CMOA 1M5DA 2RCAA 4NEDA 1SW1A 2ZMBA 4YB5A 2B3BA 4U1OA 1FJ6A 3EN3A 4H65A 4FAJA 1EZPA 3USDA 3L6HA 3M3LA 2V84A 3FASA 1NH7A 3QK6A 1N0TA 3IO6A 4RK9A 4KD5A 3RN8A 4GOTA 1B52A 4QXDA 2OWSA 1MRPA 5TPAB 4RYAA 1K9ZA 2ANJA 3K1MA 1SBPA 2PX1A 1P1NA 1EYJA 4BLAA 3OSRA 2QS4A 4LVQA 5CMBA 2QJEA 1D9QA 1WODA 4BDOA 3HHGA 1B3HA 4MJOA 4RNSA 1NUYA 3KN8A 4QFNA 3O2AA 4Q30B 3JZJA 1JEUA 1NUWA 3T9HB 3PPNA 2HZKA 2Q9TA 1N3XA 4P56A 5AA2A 1H43A 1XI6A 5H8NB 3FJMA 3TAJA 2DWIA 3PMVA 4OESA 5I58A 1YTVA 4DXUA 4ZECA 4G4PA 3JYRA 1NFTA 1B3GA 3D1RA 4O3BA 3T93B 3PTYA 2I6EA
chains in the Genus database with same CATH topology
3DP6A 3K00A 1SVXB 1ZU0A 2O68A 3QUFA 2GRVA 2OBGA 3H4ZA 1CB6A 3FD3A 1PB9A 3C35A 1Y3NA 3U72A 3UORA 1ZKBA 2Z8FA 4H6DA 1MH4A 2Y7KA 5K2YA 2AIXA 4ZEKA 5ISUA 4G8HA 2VP1A 2PYYA 4ONYA 1B3FA 2H5YA 1WVJA 2O1LA 2W7YA 4KHZE 3IJXB 5H8HA 2YLNA 3O6GA 2O51A 4QFKA 1F9BA 5H8FB 3OXNA 4NF6B 1AOVA 4GXSB 3IORA 3FVGA 3BFTA 1EU8A 2QMWA 5FTHA 4WKMA 3K1NA 1LCTA 4R9FA 5IAIA 4FIMA 2I4CA 4N13A 1B6HA 3A09A 2O6AA 5I84A 5FHOA 3A3CA 3K0VA 1US5A 1IIWA 1SD3A 1DPPA 3C4MA 2NWJA 4MLQA 1H76A 3KBRA 2PVUA 1Y3PA 4YKKA 2RC8A 3S9NC 2Y84A 2F7AA 4HW8A 4F3BA 3VVDA 1MDQA 1RYXA 2P1SA 1GTKA 4F19A 4YMBA 1L5TA 2OJTA 3IOVA 1D9VA 4LZ5A 4OFJA 2H25A 3FV1A 5FHNA 2ZYNA 3UK4A 3Q25A 1P1QA 3ONMA 4JXIA 4IB2A 2HCAA 4DXCA 1XC1A 1POY1 3MZ9A 4DZ1A 1KWHA 4U4XA 3PGFA 1IXHA 5TPAA 4OVJA 2XXTA 3RT8A 5DEXA 2DOJA 4KQPA 2UVGA 5TU0A 3C32A 3TELA 3H6UA 4HTGA 4EDPA 4F1YA 3A3UA 3QSLA 4ZZAA 1VR5A 2F5XA 3PD9A 2NVUB 3G7WA 1FQFA 5TP9A 1POTA 3KG2A 1Y20A 1NL5A 3FUZA 2ZNUA 2G29A 2ONSA 2ZNTA 5H8NA 3F11A 1FTOA 3KGCA 5JTYB 4X1DA 3IL1B 3V83A 3LSLA 4H8JA 4NWDA 5AE4A 3T22A 1IXGA 1EH3A 2QS3A 1AIVA 3TODA 1TWYA 5AA4B 4BDLA 3E13X 4YU0A 1Y9UA 4U1ZA 4QSEA 2ZYMA 1FCKA 1XVXA 4OZ9A 2DXYA 2Y7WA 4UA8A 1MY2A 4Z0IA 2QS1A 3EHSA 3IX1A 2DP8A 3VLUA 3ZKKA 3W15C 1S50A 4JWXA 1MXVA 2OWTA 1URSA 4H1XA 5BUUA 1QVSA 2HXWA 4DE8A 4PETA 5H8FA 4GFRA 1QW0A 4F1UA 1S7YA 4POXA 4U2RA 1FQBA 4I1DA 4NF8B 4FEDA 3FATA 3IB2A 4ELPA 3C33A 2DWHA 3HCQA 1MS7A 2F78A 3TTLA 2E0SA 2RC9A 4LA9A 4KR5A 1SDXA 1FQDA 3HHFA 3H6VA 3Q28A 4GIZA 4L17A 2ONRA 2KLFA 4I8CA 5EHSA 4R9GA 1YAEA 3THIA 3OENA 3KN7A 4LUBA 5I56B 1FTLA 3IOWA 3K1PA 1NKXA 5DVFA 3O6IA 3TTNA 3FVOA 3UN6A 1SW4A 1NNKA 3G3GA 2Z8EA 3MPKA 2QRYA 4NF4B 1B9JA 4MLVA 3TMGA 1M5CA 4OFOA 3CFLA 1JVXA 1B1HA 4LQ2A 2H99A 3U1OA 4OETA 4AB6A 1BTJA 3IJOB 3WAEA 4QFOA 2DE2A 3ILTB 4X1BA 1MXZA 5JEIA 3H6WA 1LGBC 3FXUA 5KCJB 3QXMA 2NOOA 2ONKE 3TCFA 1H44A 3FV2A 3HO7A 3IOTA 3S9EA 2I49A 2DVCA 4M4GA 1IZ1A 1SQYA 3LC8A 3RGYA 3FVKA 2VOZA 2PT2A 1RYOA 4FJPA 2IEEA 1Y4CA 3MVWA 4PFWA 1MH3A 5JTYA 4ND9A 3O6HA 2V93A 2FNCA 5AA2D 2V25A 1B2HA 2UYFA 3BBRA 4EXKA 3G3FA 1MY4A 3SKPA 2UVIA 4R6YA 2WKYA 1ZTYA 4F2QA 1SI0A 4N07A 1N7XA 5DTBA 1USYE 3EPEA 4WEDA 3K2DA 1LFIA 3K02A 1B7ZA 3QIMA 4P0GA 2DXRA 4RPNA 3BFUA 5CC2A 4TLMB 5DT6A 4BDNA 1PEBA 2R71A 4X48A 1NNPA 4KI0E 4HCWA 2CZLA 4JBZA 2HAUA 4NF8A 3R6UA 4KCCA 2O69A 1PDAA 2H98A 1B5HA 1H3DA 1OMPA 2XHDA 3N94A 3CRBA 1B7UA 5IKBA 3D4GA 5H8QB 2XXUA 5DEXB 5EHMA 4JWOA 3TFLA 1D3KA 1N84A 4F3GA 3KSXA 1P1OA 5L8DA 3LSFB 3MWBA 3MPLA 4OQOA 4DCYA 4JSDA 5I56A 3C34A 2ABHA 3ZKLA 2BJJX 3TEPA 5TP9B 4BDMA 1GR2A 5ITOA 3RTWB 3DLNA 2DE4A 1M5EA 2DVZA 3IB1A 4IY6A 4NF4A 1PBQA 3MVXA 4Q5TA 4OYVA 2DSFA 1B1XA 3T9UA 2RKMA 4OTEA 1N76A 1ELJA 4F18A 3IK6B 4RXLA 1QUIA 2REGA 4EF1A 3E4RA 3B7DA 4POWA 1HSJA 1OIBA 2FYIA 4N6PA 2Y7IA 5KCJA 3KJTA 1CE2A 3R26A 1B0LA 4NTLA 3CIJA 4R72A 1A55A 1QUKA 1SI1A 1MXUA 3KOSA 4GVOA 1LAFE 2XXIA 3T9VA 3ZS6A 2HQ0A 1A99A 2PBWA 2H9BA 2F6PA 3QUJA 4EF2A 1MPDA 2Q2CA 3H06B 1ZLQA 4TQUQ 4QSCA 2ALUA 3PMXA 1OLAA 4IO7A 4QSDA 2ZYOA 4IO5A 4R6KA 1D9YA 1O64A 5K2XA 5BWJA 3G3KA 4R6HA 4UACA 5F1QA 1BP5A 4PFTA 1B58A 4GF8A 1B4ZA 4R2FA 3UGWA 3C31A 2XXHA 5CMCA 4GL0A 1LB8A 3K6WA 5B7DA 4LATA 2V3TA 4K3FA 3U8QA 4QF9A 3DM0A 5A5XB 3SERA 1MDP1 1Z7ME 4AB5A 4RK2A 3B6QA 4R2BA 5L9MA 2I0CA 3K6VA 1XVYA 3VVFA 4EXLA 2Q88A 4QFLA 3PUXE 3CFZA 4ZEDA 4F22A 3TKDA 4OWDA 2X7QA 1FTJA 1B51A 4OHNA 1MY1A 3I3VA 2DYXA 1LAGE 4Q0CA 4PQJA 1Q1KA 1JNFA 2V3QA 1MG1A 3SEVA 1Y4TA 3O28A 5H8QA 1GVCA 1M5BA 1LFHA 1VFEA 4IO3A 1Y1MA 1LB9A 4R75A 1UTHA 5ELVA 1A8FA 5I57B 4IGRA 2PMSA 4XKNA 1XHYA 4YKIA 1SW2A 3CVGA 2VD3A 2QPQA 3K01A 1B05A 4YMAA 5HBCA 2QL3A 3CR9A 2UVHA 4DDDA 3CG1A 3OEKA 1S9TA 1MM7A 1I69A 2I3VA 5CMMA 1P1UA 3FVNA 3V5AA 4DLDA 2AL4A 2NXOA 4IGTA 5KZTA 1XT8A 4JDFA 1T0KA 1OQGA 4OXVA 4ZEFA 3V89B 4WXJA 2VGQA 2D3IA 3RNNA 4ESWA 1ATGA 4OMBA 5I2KB 3K6UA 1J1NA 4C1TA 2ZYKA 2M8CA 3OD7A 1HSEA 3C36A 4QFPA 1BKAA 5I2NB 2XXPA 1MQJA 3OO8A 3WAFA 3OOAA 5HM4B 2AYSA 4OERA 5ICQA 3TPAA 3ZSFA 4RJZA 1YCJA 4ZDMA 2UXAA 2OCUA 3DELB 3H6TA 4OENA 1URDA 3JV9A 4MF3A 5KDTB 1YPNA 1NNFA 4M1VA 5M2VA 4RA1A 3S4UA 5CM6A 4RY1A 4H0WA 3PPPA 3LSXA 4YZZA 4YKPA 3Q29A 4BDRA 1DMBA 3UP9A 1I6BA 3OELA 3Q26A 4ZE8A 4ISUA 1VFDA 3D4CA 3ILUB 3MVYA 2V3UA 4YB6A 3MBPA 5A5XA 1N3WA 4F2OA 3N26A 1SW5A 5ITPA 3SETA 3VXBA 1MM6A 4FECA 1LBCA 2XD3A 3GLBA 2A5TB 1B0HA 5ICTA 3VV5A 3MW0A 3MQ9A 3SEYA 4QHQA 1H45A 3U94A 4F29A 3L6GA 4P0IA 2AL5A 4PE5B 3MC2A 3O97A 1ZBMA 2I3WA 1D4NA 1NMUA 4U4SA 3PPOA 3VLVA 3IAZA 1HSLA 2NUVA 3KFMA 1LAXA 3CI8A 1LSTA 1IITA 2RF1A 5DVJA 1DPEA 5I57A 5CI5A 2XXRA 3TCHA 4I62A 4KYEA 5AA1A 4XXUA 2RINA 3T66A 4IO4A 3CSGA 4OEUA 5CBSA 4HS7A 2Q2AA 1GGGA 1P1WA 2HAVA 4O3CA 4C1UA 1TT1A 3FZVA 3V8XB 1B5IA 4H5GA 1B7HA 4EQ9A 3FGSA 1QKBA 4E0XA 4H8IA 3KEIA 1PC3A 2F34A 4U21A 3OO6A 3DP4A 4FE8A 2ZXTA 3EHTA 4I9DA 3OEMA 5I2KA 4X9TA 2GH9A 3OO7A 4ZEIA 5I2NA 3T96B 1JEVA 2Y7PA 2XXWA 3SESA 1B5JA 1DSNA 3G3HA 1XS5A 3TZAA 3K4UA 1FQEA 4ZEBA 2XXVA 2VHAA 1MXXA 1JETA 4XKRA 2B3FA 5KDTA 1LAHE 2GHAA 3PUVE 1ZIUA 1LFGA 4EUOA 5L9SA 4DIGA 2Z23A 3P7IA 4OFLA 4IY5A 1ANFA 3KJ7A 4KCDA 3GBAA 3FIRA 4LZ7A 1PB8A 2X26A 4G77A 1UTHB 5L9OA 3HN0A 3FJ7A 1UQWA 5I59B 2OLBA 1EZOA 3EF7A 4U22A 3RPWA 3DP8A 4P11A 5HPQA 1MQHA 2XXQA 4LZ8A 3O29A 3EHUA 2A5TA 3MAMA 3PPQA 3UA8A 3PV0E 3VDFA 1N04A 1VE4A 2IA4A 1MPCA 1Q35A 2XXYA 3KN3A 1QULA 1I6QA 1I6AA 3MVZA 3U93A 2XX8A 2X7PA 4ECFA 2XXXA 3G3JA 4XIGQ 3MJNA 3AXFA 4GXAA 1JW5A 4R73A 3KSJA 4ZS9A 1TFAA 3R7XA 2HEUA 3EQ1A 1DOTA 1R1NA 2A5SA 3QYTA 3SDFA 4XKPA 2XX9A 1FTMA 2G93A 3GBBA 1B46A 5B70A 1BIYA 3RLFE 5EYFA 4JWYA 4ZE9A 3S9MC 4IO6A 2REJA 2O7IA 1ZJLA 2UYEA 3HPIA 4YICA 2Q8JA 4G2ZA 3TQLA 3M3KA 2H4IA 4NWCA 4R74A 3CFXA 1B3LA 5FTIA 3I5OA 1RKMA 1SYHA 1B3EA 3TTKA 1XOCA 1N7WA 4XTCQ 4DCXA 3TCGA 3ODBA 3MP8A 3T9XB 2Y7RA 1FQCA 1GV8A 1AMFA 4G8MA 1VSOA 3SEUA 4TOZA 4YKJA 3VE1B 4YAHX 4TLLB 3H3GA 4BDQA 3FJGA 1MQDA 2O1MA 4MFIA 3O66A 4U23A 4ELQA 2Z8DA 3VFJA 2YJPA 3LSWA 1IEJA 2B65A 4FORA 4MBPA 4F3PA 3TQWA 1PB7A 4EQBA 3M8UA 3PUWE 5LOMA 3E3KA 4GL8A 2P0SA 3RT6B 3PU5A 1R9QA 1OVBA 1UTBB 1TFDA 2D21A 2ESNA 2F6GA 1R9LA 5F7VA 1O63A 1FQAA 4PFUA 3CG3A 2QMXA 2ZNSA 3IO4A 1JVYA 2DWAA 4ESXA 4KYSA 3PPRA 3MP6A 3HV1A 3M3FA 2I48A 1B40A 4YB7A 3QAXA 3MZ1A 1JW4A 2QSXA 5I59A 2RCBA 3IR1A 1PBPA 2Z22A 2R9JA 2D5WA 2HZLA 1LBBA 1Y3QA 4EQ7A 3U92A 1MQIA 4G68C 1LLSA 3RTFB 3OO9A 2OZZA 3MUQA 3I6VA 2DQVA 1Y1ZA 3N6UA 2QS2A 3RUMA 4Q8RA 4FATA 4F31B 1IQ7A 1A54A 1II5A 4QRZA 3K6XA 5J1DA 3ECRA 1EZ9A 3GXAA 2XD2A 2UVJA 1IXIA 2O84X 4PP0A 3TTRA 4GD5A 4NF5B 4G68B 1DTZA 4RPOA 1JW1A 3W9WA 1Z7NE 3GZGA 1UIUA 5CBRA 4F1VA 1MY3A 2DWJA 4FEBA 1MXWA 2VD2A 2I0BA 2F7CA 1OVTA 3TTMA 2HFBA 3N5LA 3Q27A 2I4BA 2PT1A 5H8SA 4KYDA 2P2AA 3PMWA 4WEPA 4GQOA 4LONB 4H67A 1FW0A 3MP1A 1A40A 1LCFA 2F8DA 4LP2B 4GWOA 2Q89A 1SYIA 3RQTA 4NF6A 4MH5A 2E1SA 1B32A 1QUJA 3LR1A 5JK4A 1MQGA 4JSOA 1R6ZA 1URGA 1OLCA 4HCYA 4H5FA 2DS9A 2F35A 2O7UA 2LAOA 3HSTA 3O9PA 2DE3A 1USYH 2GFEA 3KOTA 3FXQA 5FHMA 5CMKA 3E9XA 1OQHA 3RY3A 3LBSA 3S2VA 1BLFA 5DVIA 1IXCA 4NE4A 3BKIB 4C0RA 4E0WA 5AA2B 2YPNA 1UTBA 2F7BA 4Z7EA 5I58B 2THIA 3VXCA 1AL3A 3KZGA 3MZBA 2F97A 3C9HA 4NMYA 1NH8A 2R6GE 3N6TA 2RC7A 3B6TA 1TXFA 3PUZE 4F3SA 4G8NA 1ZMGA 2I58A 5DYHA 3OMBA 3H03A 4THIA 4KFQA 4ZZEA 1B4HA 4ELOA 4XKQA 3TYHA 3TDJA 3SEXA 1M5FA 1MPBA 3LUYA 4KPTA 4OEVA 5H8HB 5AA3A 4DXBA 4PFYA 1NNTA 3OSQA 3PUYE 3FXRA 3IB0A 3VLWA 1AH5A 3CSBA 3SEWA 4F39A 3UIFA 4ELRA 3PD8A 2XX7A 4GRKA 1UIVA 4NF5A 4G68A 1P99A 3H7MA 3VVEA 1MXYA 4IO2A 1FTKA 2OK2A 2GHBA 1IUDA 4LQ5A 1A7LA 3W9VA 4JB7A 1JQFA 1QKAA 5AA4A 3S9LC 4AQ4A 3B6WA 5CRYA 4GLIA 1MY0A 1A8EA 4O3AA 1O7TA 3G3IA 1DTGA 2FA7A 1WDNA 1US4A 3IOUA 3TUSA 2F36A 1QJMA 2CMOA 1M5DA 2RCAA 4NEDA 1SW1A 2ZMBA 4YB5A 2B3BA 4U1OA 3EN3A 4H65A 4FAJA 1EZPA 3USDA 3L6HA 3M3LA 2V84A 3FASA 1NH7A 3QK6A 1N0TA 3IO6A 4RK9A 4KD5A 3RN8A 4GOTA 1B52A 2OWSA 1MRPA 5TPAB 4RYAA 2ANJA 3K1MA 1SBPA 2PX1A 1P1NA 4BLAA 3OSRA 2QS4A 4LVQA 5CMBA 2QJEA 1WODA 4BDOA 3HHGA 1B3HA 4RNSA 3KN8A 4QFNA 3O2AA 4Q30B 3JZJA 1JEUA 3T9HB 3PPNA 2HZKA 2Q9TA 1N3XA 5AA2A 1H43A 5H8NB 3FJMA 3TAJA 2DWIA 3PMVA 4OESA 5I58A 1YTVA 4DXUA 4ZECA 4G4PA 3JYRA 1NFTA 1B3GA 4O3BA 3T93B 2I6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DP6 A;  3K00 A;  1SVX B;  1ZU0 A;  2O68 A;  3QUF A;  2GRV A;  2OBG A;  3H4Z A;  1CB6 A;  3FD3 A;  1PB9 A;  3C35 A;  1Y3N A;  3U72 A;  3UOR A;  1ZKB A;  2Z8F A;  4H6D A;  1MH4 A;  2Y7K A;  5K2Y A;  2AIX A;  4ZEK A;  5ISU A;  4G8H A;  2VP1 A;  2PYY A;  4ONY A;  1B3F A;  2H5Y A;  1WVJ A;  2O1L A;  2W7Y A;  4KHZ E;  3IJX B;  5H8H A;  2YLN A;  3O6G A;  2O51 A;  4QFK A;  1F9B A;  5H8F B;  3OXN A;  4NF6 B;  1AOV A;  4GXS B;  3IOR A;  3FVG A;  3BFT A;  1EU8 A;  2QMW A;  5FTH A;  4WKM A;  3K1N A;  1LCT A;  4R9F A;  5IAI A;  4FIM A;  2I4C A;  4N13 A;  1B6H A;  3A09 A;  2O6A A;  5I84 A;  5FHO A;  3A3C A;  3K0V A;  1US5 A;  1IIW A;  1SD3 A;  1DPP A;  3C4M A;  2NWJ A;  4MLQ A;  1H76 A;  3KBR A;  2PVU A;  1Y3P A;  4YKK A;  2RC8 A;  3S9N C;  2Y84 A;  2F7A A;  4HW8 A;  4F3B A;  3VVD A;  1MDQ A;  1RYX A;  2P1S A;  1GTK A;  4F19 A;  4YMB A;  1L5T A;  2OJT A;  3IOV A;  1D9V A;  4LZ5 A;  4OFJ A;  2H25 A;  3FV1 A;  5FHN A;  2ZYN A;  3UK4 A;  3Q25 A;  1P1Q A;  3ONM A;  4JXI A;  4IB2 A;  2HCA A;  4DXC A;  1XC1 A;  1POY 1;  3MZ9 A;  4DZ1 A;  1KWH A;  4U4X A;  3PGF A;  1IXH A;  5TPA A;  4OVJ A;  2XXT A;  3RT8 A;  5DEX A;  2DOJ A;  4KQP A;  2UVG A;  5TU0 A;  3C32 A;  3TEL A;  3H6U A;  4HTG A;  4EDP A;  4F1Y A;  3A3U A;  3QSL A;  4ZZA A;  1VR5 A;  2F5X A;  3PD9 A;  2NVU B;  3G7W A;  1FQF A;  5TP9 A;  1POT A;  3KG2 A;  1Y20 A;  1NL5 A;  3FUZ A;  2ZNU A;  2G29 A;  2ONS A;  2ZNT A;  5H8N A;  3F11 A;  1FTO A;  3KGC A;  5JTY B;  4X1D A;  3IL1 B;  3V83 A;  3LSL A;  4H8J A;  4NWD A;  5AE4 A;  3T22 A;  1IXG A;  1EH3 A;  2QS3 A;  1AIV A;  3TOD A;  1TWY A;  5AA4 B;  4BDL A;  3E13 X;  4YU0 A;  1Y9U A;  4U1Z A;  4QSE A;  2ZYM A;  1FCK A;  1XVX A;  4OZ9 A;  2DXY A;  2Y7W A;  4UA8 A;  1MY2 A;  4Z0I A;  2QS1 A;  3EHS A;  3IX1 A;  2DP8 A;  3VLU A;  3ZKK A;  3W15 C;  1S50 A;  4JWX A;  1MXV A;  2OWT A;  1URS A;  4H1X A;  5BUU A;  1QVS A;  2HXW A;  4DE8 A;  4PET A;  5H8F A;  4GFR A;  1QW0 A;  4F1U A;  1S7Y A;  4POX A;  4U2R A;  1FQB A;  4I1D A;  4NF8 B;  4FED A;  3FAT A;  3IB2 A;  4ELP A;  3C33 A;  2DWH A;  3HCQ A;  1MS7 A;  2F78 A;  3TTL A;  2E0S A;  2RC9 A;  4LA9 A;  4KR5 A;  1SDX A;  1FQD A;  3HHF A;  3H6V A;  3Q28 A;  4GIZ A;  4L17 A;  2ONR A;  2KLF A;  4I8C A;  5EHS A;  4R9G A;  1YAE A;  3THI A;  3OEN A;  3KN7 A;  4LUB A;  5I56 B;  1FTL A;  3IOW A;  3K1P A;  1NKX A;  5DVF A;  3O6I A;  3TTN A;  3FVO A;  3UN6 A;  1SW4 A;  1NNK A;  3G3G A;  2Z8E A;  3MPK A;  2QRY A;  4NF4 B;  1B9J A;  4MLV A;  3TMG A;  1M5C A;  4OFO A;  3CFL A;  1JVX A;  1B1H A;  4LQ2 A;  2H99 A;  3U1O A;  4OET A;  4AB6 A;  1BTJ A;  3IJO B;  3WAE A;  4QFO A;  2DE2 A;  3ILT B;  4X1B A;  1MXZ A;  5JEI A;  3H6W A;  1LGB C;  3FXU A;  5KCJ B;  3QXM A;  2NOO A;  2ONK E;  3TCF A;  1H44 A;  3FV2 A;  3HO7 A;  3IOT A;  3S9E A;  2I49 A;  2DVC A;  4M4G A;  1IZ1 A;  1SQY A;  3LC8 A;  3RGY A;  3FVK A;  2VOZ A;  2PT2 A;  1RYO A;  4FJP A;  2IEE A;  1Y4C A;  3MVW A;  4PFW A;  1MH3 A;  5JTY A;  4ND9 A;  3O6H A;  2V93 A;  2FNC A;  5AA2 D;  2V25 A;  1B2H A;  2UYF A;  3BBR A;  4EXK A;  3G3F A;  1MY4 A;  3SKP A;  2UVI A;  4R6Y A;  2WKY A;  1ZTY A;  4F2Q A;  1SI0 A;  4N07 A;  1N7X A;  5DTB A;  1USY E;  3EPE A;  4WED A;  3K2D A;  1LFI A;  3K02 A;  1B7Z A;  3QIM A;  4P0G A;  2DXR A;  4RPN A;  3BFU A;  5CC2 A;  4TLM B;  5DT6 A;  4BDN A;  1PEB A;  2R71 A;  4X48 A;  1NNP A;  4KI0 E;  4HCW A;  2CZL A;  4JBZ A;  2HAU A;  4NF8 A;  3R6U A;  4KCC A;  2O69 A;  1PDA A;  2H98 A;  1B5H A;  1H3D A;  1OMP A;  2XHD A;  3N94 A;  3CRB A;  1B7U A;  5IKB A;  3D4G A;  5H8Q B;  2XXU A;  5DEX B;  5EHM A;  4JWO A;  3TFL A;  1D3K A;  1N84 A;  4F3G A;  3KSX A;  1P1O A;  5L8D A;  3LSF B;  3MWB A;  3MPL A;  4OQO A;  4DCY A;  4JSD A;  5I56 A;  3C34 A;  2ABH A;  3ZKL A;  2BJJ X;  3TEP A;  5TP9 B;  4BDM A;  1GR2 A;  5ITO A;  3RTW B;  3DLN A;  2DE4 A;  1M5E A;  2DVZ A;  3IB1 A;  4IY6 A;  4NF4 A;  1PBQ A;  3MVX A;  4Q5T A;  4OYV A;  2DSF A;  1B1X A;  3T9U A;  2RKM A;  4OTE A;  1N76 A;  1ELJ A;  4F18 A;  3IK6 B;  4RXL A;  1QUI A;  2REG A;  4EF1 A;  3E4R A;  3B7D A;  4POW A;  1HSJ A;  1OIB A;  2FYI A;  4N6P A;  2Y7I A;  5KCJ A;  3KJT A;  1CE2 A;  3R26 A;  1B0L A;  4NTL A;  3CIJ A;  4R72 A;  1A55 A;  1QUK A;  1SI1 A;  1MXU A;  3KOS A;  4GVO A;  1LAF E;  2XXI A;  3T9V A;  3ZS6 A;  2HQ0 A;  1A99 A;  2PBW A;  2H9B A;  2F6P A;  3QUJ A;  4EF2 A;  1MPD A;  2Q2C A;  3H06 B;  1ZLQ A;  4TQU Q;  4QSC A;  2ALU A;  3PMX A;  1OLA A;  4IO7 A;  4QSD A;  2ZYO A;  4IO5 A;  4R6K A;  1D9Y A;  1O64 A;  5K2X A;  5BWJ A;  3G3K A;  4R6H A;  4UAC A;  5F1Q A;  1BP5 A;  4PFT A;  1B58 A;  4GF8 A;  1B4Z A;  4R2F A;  3UGW A;  3C31 A;  2XXH A;  5CMC A;  4GL0 A;  1LB8 A;  3K6W A;  5B7D A;  4LAT A;  2V3T A;  4K3F A;  3U8Q A;  4QF9 A;  3DM0 A;  5A5X B;  3SER A;  1MDP 1;  1Z7M E;  4AB5 A;  4RK2 A;  3B6Q A;  4R2B A;  5L9M A;  2I0C A;  3K6V A;  1XVY A;  3VVF A;  4EXL A;  2Q88 A;  4QFL A;  3PUX E;  3CFZ A;  4ZED A;  4F22 A;  3TKD A;  4OWD A;  2X7Q A;  1FTJ A;  1B51 A;  4OHN A;  1MY1 A;  3I3V A;  2DYX A;  1LAG E;  4Q0C A;  4PQJ A;  1Q1K A;  1JNF A;  2V3Q A;  1MG1 A;  3SEV A;  1Y4T A;  3O28 A;  5H8Q A;  1GVC A;  1M5B A;  1LFH A;  1VFE A;  4IO3 A;  1Y1M A;  1LB9 A;  4R75 A;  1UTH A;  5ELV A;  1A8F A;  5I57 B;  4IGR A;  2PMS A;  4XKN A;  1XHY A;  4YKI A;  1SW2 A;  3CVG A;  2VD3 A;  2QPQ A;  3K01 A;  1B05 A;  4YMA A;  5HBC A;  2QL3 A;  3CR9 A;  2UVH A;  4DDD A;  3CG1 A;  3OEK A;  1S9T A;  1MM7 A;  1I69 A;  2I3V A;  5CMM A;  1P1U A;  3FVN A;  3V5A A;  4DLD A;  2AL4 A;  2NXO A;  4IGT A;  5KZT A;  1XT8 A;  4JDF A;  1T0K A;  1OQG A;  4OXV A;  4ZEF A;  3V89 B;  4WXJ A;  2VGQ A;  2D3I A;  3RNN A;  4ESW A;  1ATG A;  4OMB A;  5I2K B;  3K6U A;  1J1N A;  4C1T A;  2ZYK A;  2M8C A;  3OD7 A;  1HSE A;  3C36 A;  4QFP A;  1BKA A;  5I2N B;  2XXP A;  1MQJ A;  3OO8 A;  3WAF A;  3OOA A;  5HM4 B;  2AYS A;  4OER A;  5ICQ A;  3TPA A;  3ZSF A;  4RJZ A;  1YCJ A;  4ZDM A;  2UXA A;  2OCU A;  3DEL B;  3H6T A;  4OEN A;  1URD A;  3JV9 A;  4MF3 A;  5KDT B;  1YPN A;  1NNF A;  4M1V A;  5M2V A;  4RA1 A;  3S4U A;  5CM6 A;  4RY1 A;  4H0W A;  3PPP A;  3LSX A;  4YZZ A;  4YKP A;  3Q29 A;  4BDR A;  1DMB A;  3UP9 A;  1I6B A;  3OEL A;  3Q26 A;  4ZE8 A;  4ISU A;  1VFD A;  3D4C A;  3ILU B;  3MVY A;  2V3U A;  4YB6 A;  3MBP A;  5A5X A;  1N3W A;  4F2O A;  3N26 A;  1SW5 A;  5ITP A;  3SET A;  3VXB A;  1MM6 A;  4FEC A;  1LBC A;  2XD3 A;  3GLB A;  2A5T B;  1B0H A;  5ICT A;  3VV5 A;  3MW0 A;  3MQ9 A;  3SEY A;  4QHQ A;  1H45 A;  3U94 A;  4F29 A;  3L6G A;  4P0I A;  2AL5 A;  4PE5 B;  3MC2 A;  3O97 A;  1ZBM A;  2I3W A;  1D4N A;  1NMU A;  4U4S A;  3PPO A;  3VLV A;  3IAZ A;  1HSL A;  2NUV A;  3KFM A;  1LAX A;  3CI8 A;  1LST A;  1IIT A;  2RF1 A;  5DVJ A;  1DPE A;  5I57 A;  5CI5 A;  2XXR A;  3TCH A;  4I62 A;  4KYE A;  5AA1 A;  4XXU A;  2RIN A;  3T66 A;  4IO4 A;  3CSG A;  4OEU A;  5CBS A;  4HS7 A;  2Q2A A;  1GGG A;  1P1W A;  2HAV A;  4O3C A;  4C1U A;  1TT1 A;  3FZV A;  3V8X B;  1B5I A;  4H5G A;  1B7H A;  4EQ9 A;  3FGS A;  1QKB A;  4E0X A;  4H8I A;  3KEI A;  1PC3 A;  2F34 A;  4U21 A;  3OO6 A;  3DP4 A;  4FE8 A;  2ZXT A;  3EHT A;  4I9D A;  3OEM A;  5I2K A;  4X9T A;  2GH9 A;  3OO7 A;  4ZEI A;  5I2N A;  3T96 B;  1JEV A;  2Y7P A;  2XXW A;  3SES A;  1B5J A;  1DSN A;  3G3H A;  1XS5 A;  3TZA A;  3K4U A;  1FQE A;  4ZEB A;  2XXV A;  2VHA A;  1MXX A;  1JET A;  4XKR A;  2B3F A;  5KDT A;  1LAH E;  2GHA A;  3PUV E;  1ZIU A;  1LFG A;  4EUO A;  5L9S A;  4DIG A;  2Z23 A;  3P7I A;  4OFL A;  4IY5 A;  1ANF A;  3KJ7 A;  4KCD A;  3GBA A;  3FIR A;  4LZ7 A;  1PB8 A;  2X26 A;  4G77 A;  1UTH B;  5L9O A;  3HN0 A;  3FJ7 A;  1UQW A;  5I59 B;  2OLB A;  1EZO A;  3EF7 A;  4U22 A;  3RPW A;  3DP8 A;  4P11 A;  5HPQ A;  1MQH A;  2XXQ A;  4LZ8 A;  3O29 A;  3EHU A;  2A5T A;  3MAM A;  3PPQ A;  3UA8 A;  3PV0 E;  3VDF A;  1N04 A;  1VE4 A;  2IA4 A;  1MPC A;  1Q35 A;  2XXY A;  3KN3 A;  1QUL A;  1I6Q A;  1I6A A;  3MVZ A;  3U93 A;  2XX8 A;  2X7P A;  4ECF A;  2XXX A;  3G3J A;  4XIG Q;  3MJN A;  3AXF A;  4GXA A;  1JW5 A;  4R73 A;  3KSJ A;  4ZS9 A;  1TFA A;  3R7X A;  2HEU A;  3EQ1 A;  1DOT A;  1R1N A;  2A5S A;  3QYT A;  3SDF A;  4XKP A;  2XX9 A;  1FTM A;  2G93 A;  3GBB A;  1B46 A;  5B70 A;  1BIY A;  3RLF E;  5EYF A;  4JWY A;  4ZE9 A;  3S9M C;  4IO6 A;  2REJ A;  2O7I A;  1ZJL A;  2UYE A;  3HPI A;  4YIC A;  2Q8J A;  4G2Z A;  3TQL A;  3M3K A;  2H4I A;  4NWC A;  4R74 A;  3CFX A;  1B3L A;  5FTI A;  3I5O A;  1RKM A;  1SYH A;  1B3E A;  3TTK A;  1XOC A;  1N7W A;  4XTC Q;  4DCX A;  3TCG A;  3ODB A;  3MP8 A;  3T9X B;  2Y7R A;  1FQC A;  1GV8 A;  1AMF A;  4G8M A;  1VSO A;  3SEU A;  4TOZ A;  4YKJ A;  3VE1 B;  4YAH X;  4TLL B;  3H3G A;  4BDQ A;  3FJG A;  1MQD A;  2O1M A;  4MFI A;  3O66 A;  4U23 A;  4ELQ A;  2Z8D A;  3VFJ A;  2YJP A;  3LSW A;  1IEJ A;  2B65 A;  4FOR A;  4MBP A;  4F3P A;  3TQW A;  1PB7 A;  4EQB A;  3M8U A;  3PUW E;  5LOM A;  3E3K A;  4GL8 A;  2P0S A;  3RT6 B;  3PU5 A;  1R9Q A;  1OVB A;  1UTB B;  1TFD A;  2D21 A;  2ESN A;  2F6G A;  1R9L A;  5F7V A;  1O63 A;  1FQA A;  4PFU A;  3CG3 A;  2QMX A;  2ZNS A;  3IO4 A;  1JVY A;  2DWA A;  4ESX A;  4KYS A;  3PPR A;  3MP6 A;  3HV1 A;  3M3F A;  2I48 A;  1B40 A;  4YB7 A;  3QAX A;  3MZ1 A;  1JW4 A;  2QSX A;  5I59 A;  2RCB A;  3IR1 A;  1PBP A;  2Z22 A;  2R9J A;  2D5W A;  2HZL A;  1LBB A;  1Y3Q A;  4EQ7 A;  3U92 A;  1MQI A;  4G68 C;  1LLS A;  3RTF B;  3OO9 A;  2OZZ A;  3MUQ A;  3I6V A;  2DQV A;  1Y1Z A;  3N6U A;  2QS2 A;  3RUM A;  4Q8R A;  4FAT A;  4F31 B;  1IQ7 A;  1A54 A;  1II5 A;  4QRZ A;  3K6X A;  5J1D A;  3ECR A;  1EZ9 A;  3GXA A;  2XD2 A;  2UVJ A;  1IXI A;  2O84 X;  4PP0 A;  3TTR A;  4GD5 A;  4NF5 B;  4G68 B;  1DTZ A;  4RPO A;  1JW1 A;  3W9W A;  1Z7N E;  3GZG A;  1UIU A;  5CBR A;  4F1V A;  1MY3 A;  2DWJ A;  4FEB A;  1MXW A;  2VD2 A;  2I0B A;  2F7C A;  1OVT A;  3TTM A;  2HFB A;  3N5L A;  3Q27 A;  2I4B A;  2PT1 A;  5H8S A;  4KYD A;  2P2A A;  3PMW A;  4WEP A;  4GQO A;  4LON B;  4H67 A;  1FW0 A;  3MP1 A;  1A40 A;  1LCF A;  2F8D A;  4LP2 B;  4GWO A;  2Q89 A;  1SYI A;  3RQT A;  4NF6 A;  4MH5 A;  2E1S A;  1B32 A;  1QUJ A;  3LR1 A;  5JK4 A;  1MQG A;  4JSO A;  1R6Z A;  1URG A;  1OLC A;  4HCY A;  4H5F A;  2DS9 A;  2F35 A;  2O7U A;  2LAO A;  3HST A;  3O9P A;  2DE3 A;  1USY H;  2GFE A;  3KOT A;  3FXQ A;  5FHM A;  5CMK A;  3E9X A;  1OQH A;  3RY3 A;  3LBS A;  3S2V A;  1BLF A;  5DVI A;  1IXC A;  4NE4 A;  3BKI B;  4C0R A;  4E0W A;  5AA2 B;  2YPN A;  1UTB A;  2F7B A;  4Z7E A;  5I58 B;  2THI A;  3VXC A;  1AL3 A;  3KZG A;  3MZB A;  2F97 A;  3C9H A;  4NMY A;  1NH8 A;  2R6G E;  3N6T A;  2RC7 A;  3B6T A;  1TXF A;  3PUZ E;  4F3S A;  4G8N A;  1ZMG A;  2I58 A;  5DYH A;  3OMB A;  3H03 A;  4THI A;  4KFQ A;  4ZZE A;  1B4H A;  4ELO A;  4XKQ A;  3TYH A;  3TDJ A;  3SEX A;  1M5F A;  1MPB A;  3LUY A;  4KPT A;  4OEV A;  5H8H B;  5AA3 A;  4DXB A;  4PFY A;  1NNT A;  3OSQ A;  3PUY E;  3FXR A;  3IB0 A;  3VLW A;  1AH5 A;  3CSB A;  3SEW A;  4F39 A;  3UIF A;  4ELR A;  3PD8 A;  2XX7 A;  4GRK A;  1UIV A;  4NF5 A;  4G68 A;  1P99 A;  3H7M A;  3VVE A;  1MXY A;  4IO2 A;  1FTK A;  2OK2 A;  2GHB A;  1IUD A;  4LQ5 A;  1A7L A;  3W9V A;  4JB7 A;  1JQF A;  1QKA A;  5AA4 A;  3S9L C;  4AQ4 A;  3B6W A;  5CRY A;  4GLI A;  1MY0 A;  1A8E A;  4O3A A;  1O7T A;  3G3I A;  1DTG A;  2FA7 A;  1WDN A;  1US4 A;  3IOU A;  3TUS A;  2F36 A;  1QJM A;  2CMO A;  1M5D A;  2RCA A;  4NED A;  1SW1 A;  2ZMB A;  4YB5 A;  2B3B A;  4U1O A;  3EN3 A;  4H65 A;  4FAJ A;  1EZP A;  3USD A;  3L6H A;  3M3L A;  2V84 A;  3FAS A;  1NH7 A;  3QK6 A;  1N0T A;  3IO6 A;  4RK9 A;  4KD5 A;  3RN8 A;  4GOT A;  1B52 A;  2OWS A;  1MRP A;  5TPA B;  4RYA A;  2ANJ A;  3K1M A;  1SBP A;  2PX1 A;  1P1N A;  4BLA A;  3OSR A;  2QS4 A;  4LVQ A;  5CMB A;  2QJE A;  1WOD A;  4BDO A;  3HHG A;  1B3H A;  4RNS A;  3KN8 A;  4QFN A;  3O2A A;  4Q30 B;  3JZJ A;  1JEU A;  3T9H B;  3PPN A;  2HZK A;  2Q9T A;  1N3X A;  5AA2 A;  1H43 A;  5H8N B;  3FJM A;  3TAJ A;  2DWI A;  3PMV A;  4OES A;  5I58 A;  1YTV A;  4DXU A;  4ZEC A;  4G4P A;  3JYR A;  1NFT A;  1B3G A;  4O3B A;  3T93 B;  2I6E A; 
#chains in the Genus database with same CATH topology
 3DP6 A;  3K00 A;  1SVX B;  1ZU0 A;  2O68 A;  3QUF A;  2GRV A;  2OBG A;  3H4Z A;  2Q74 A;  1CB6 A;  3FD3 A;  1PB9 A;  3C35 A;  1Y3N A;  3U72 A;  3UOR A;  1ZKB A;  2Z8F A;  2P3N A;  4H6D A;  1MH4 A;  2Y7K A;  4PE3 A;  5K2Y A;  2AIX A;  4ZEK A;  5ISU A;  4G8H A;  2VP1 A;  2PYY A;  4ONY A;  1B3F A;  2H5Y A;  1WVJ A;  2O1L A;  2W7Y A;  4KHZ E;  3U65 A;  3IJX B;  5H8H A;  2YLN A;  3O6G A;  2O51 A;  1FTA A;  4QFK A;  1F9B A;  5H8F B;  3OXN A;  4NF6 B;  4PBQ A;  1AOV A;  2XWK A;  4GXS B;  3IOR A;  2CZK A;  3FVG A;  3QMF A;  3BFT A;  2VT5 A;  1EU8 A;  1RDZ A;  2QMW A;  5FTH A;  1IMB A;  4WKM A;  3K1N A;  1LCT A;  4R9F A;  5IAI A;  4FIM A;  2I4C A;  4N13 A;  1B6H A;  3A09 A;  2O6A A;  5I84 A;  5FHO A;  3A3C A;  3K0V A;  5I5P A;  1US5 A;  1IIW A;  1SD3 A;  1DPP A;  2F3D A;  3C4M A;  2NWJ A;  4MLQ A;  1H76 A;  3KBR A;  2PVU A;  1Y3P A;  2KQZ A;  2RC8 A;  4YKK A;  3S9N C;  2Y84 A;  2F7A A;  4HW8 A;  4F3B A;  3VVD A;  1MDQ A;  1RYX A;  2P1S A;  1GTK A;  4F19 A;  4YMB A;  1L5T A;  1DK4 A;  2OJT A;  3IOV A;  1D9V A;  4LZ5 A;  4OFJ A;  1G0I A;  2ZZX A;  2H25 A;  1FBC A;  1LBZ A;  3FV1 A;  5FHN A;  2ZYN A;  3UK4 A;  3Q25 A;  1P1Q A;  3ONM A;  1LBX A;  4HXV A;  4JXI A;  4IB2 A;  2HCA A;  4PFI A;  4DXC A;  4GX3 A;  1XC1 A;  5EQ7 A;  1POY 1;  3MZ9 A;  4DZ1 A;  3EKI A;  1KWH A;  4U4X A;  3PGF A;  1IXH A;  5TPA A;  4MCO A;  4OVJ A;  2XXT A;  3RT8 A;  5DEX A;  1SPI A;  2B4L A;  2DOJ A;  4KQP A;  2UVG A;  5TU0 A;  3C32 A;  3TEL A;  3H6U A;  4HTG A;  4EDP A;  4F1Y A;  3A3U A;  2GQ1 A;  3QSL A;  4ZZA A;  1VR5 A;  1FPG A;  2F5X A;  3PD9 A;  2NVU B;  3G7W A;  1FQF A;  5TP9 A;  1POT A;  3KG2 A;  4MHF A;  1Y20 A;  1NL5 A;  3FUZ A;  2ZNU A;  2G29 A;  1NUX A;  5IGA A;  2ONS A;  2ZNT A;  5H8N A;  3F11 A;  1FTO A;  3KGC A;  5JTY B;  4X1D A;  2P3V A;  3IL1 B;  3V83 A;  3LSL A;  4H8J A;  2FIX A;  4DI4 B;  4NWD A;  5AE4 A;  4LN5 A;  3T22 A;  1IXG A;  1EH3 A;  2QS3 A;  1AIV A;  3TOD A;  1TWY A;  3KC1 A;  5AA4 B;  4BDL A;  1FBF A;  3E13 X;  4YU0 A;  1Y9U A;  4U1Z A;  1KA1 A;  4QSE A;  2ZYM A;  1FCK A;  1XVX A;  4OZ9 A;  2DXY A;  2Y7W A;  4UA8 A;  1MY2 A;  2QS1 A;  3IX1 A;  3EHS A;  4Z0I A;  2DP8 A;  3VLU A;  3ZKK A;  3W15 C;  4MMP A;  4PC9 A;  1S50 A;  4JWX A;  1MXV A;  2OWT A;  1URS A;  4H1X A;  5BUU A;  1QVS A;  2HXW A;  4DE8 A;  4PET A;  1FPJ A;  4QBA A;  5H8F A;  4GFR A;  1QW0 A;  2FIE A;  4F1U A;  1S7Y A;  4POX A;  4U2R A;  1FQB A;  4I1D A;  4NF8 B;  4FED A;  4P3L A;  3FAT A;  3IB2 A;  4ELP A;  3C33 A;  2DWH A;  3HCQ A;  1MS7 A;  2F78 A;  3TTL A;  2E0S A;  2RC9 A;  4LA9 A;  4KR5 A;  1SDX A;  1FQD A;  1VDW A;  3HHF A;  3H6V A;  3Q28 A;  4GIZ A;  4L17 A;  2ONR A;  2KLF A;  4I8C A;  5EHS A;  4R9G A;  2JJK A;  1YAE A;  3THI A;  3OEN A;  3KN7 A;  4LUB A;  5I56 B;  1FTL A;  3IOW A;  3K1P A;  1NKX A;  5DVF A;  2HPG A;  3O6I A;  3TTN A;  3FVO A;  3UN6 A;  1SW4 A;  1NNK A;  3G3G A;  2Z8E A;  3MPK A;  2QRY A;  4NF4 B;  1B9J A;  4MLV A;  3TMG A;  1M5C A;  4OFO A;  5ET8 A;  3CFL A;  1JVX A;  1B1H A;  4LQ2 A;  2H99 A;  3U1O A;  4OET A;  4AB6 A;  2R8T A;  5EYG A;  1BTJ A;  1NV7 A;  3IJO B;  3WAE A;  4QFO A;  2DE2 A;  3ILT B;  4X1B A;  1MXZ A;  5JEI A;  4OVQ A;  3H6W A;  1LGB C;  3FXU A;  5KCJ B;  3QXM A;  3E78 A;  2NOO A;  2ONK E;  4HE1 A;  3TCF A;  1H44 A;  3FV2 A;  3HO7 A;  1FPB A;  3IOT A;  3S9E A;  2I49 A;  2DVC A;  4M4G A;  1IZ1 A;  1SQY A;  3LC8 A;  3NOH A;  3RGY A;  4N4U A;  3FVK A;  4N15 A;  2VOZ A;  3MST A;  2PT2 A;  1RYO A;  1EYI A;  4FJP A;  2IEE A;  4KXP A;  4G61 A;  1Y4C A;  3MVW A;  4PFW A;  1MH3 A;  5JTY A;  4ND9 A;  3O6H A;  2V93 A;  4OAN A;  2FNC A;  4GWS A;  5AA2 D;  2V25 A;  1B2H A;  2UYF A;  3BBR A;  4EXK A;  3G3F A;  1MY4 A;  3SKP A;  2UVI A;  4R6Y A;  2F3B A;  2WKY A;  5F24 A;  1ZTY A;  4F2Q A;  1SI0 A;  4I3Y A;  4N07 A;  1NUZ A;  1N7X A;  2OWZ A;  5DTB A;  1USY E;  3EPE A;  4WED A;  3K2D A;  1LFI A;  3K02 A;  4P9K A;  4PAK A;  1B7Z A;  3QIM A;  4P0G A;  2DXR A;  4RPN A;  4FBP A;  3BFU A;  5CC2 A;  3FXB A;  4PAI A;  4TLM B;  5DT6 A;  4BDN A;  1PEB A;  2R71 A;  4X48 A;  1NNP A;  4O94 A;  4KI0 E;  4HCW A;  2CZL A;  4JBZ A;  2HAU A;  4NF8 A;  3R6U A;  4KCC A;  2O69 A;  1AWB A;  1PDA A;  2H98 A;  1B5H A;  1H3D A;  1RDY A;  4X04 A;  1OMP A;  2XHD A;  3N94 A;  2V4C A;  3CRB A;  1B7U A;  4NF0 A;  5IKB A;  3D4G A;  5H8Q B;  2XXU A;  5DEX B;  5EHM A;  4JWO A;  3TFL A;  1D3K A;  1N84 A;  1YYZ A;  3A29 A;  4F3G A;  3KSX A;  1P1O A;  5L8D A;  3LSF B;  3MWB A;  3MPL A;  4OQO A;  4DCY A;  4JSD A;  5I56 A;  5ESY A;  4JVC A;  2KR0 A;  3C34 A;  2ABH A;  3ZKL A;  2BJJ X;  2Y5L A;  3TEP A;  5TP9 B;  4BDM A;  4PGN A;  1GR2 A;  5ITO A;  3RTW B;  3DLN A;  2DE4 A;  1M5E A;  2DVZ A;  3IB1 A;  2WBB A;  4IY6 A;  4O7M A;  3E79 A;  4NF4 A;  5LTC A;  1PBQ A;  3MVX A;  4Q5T A;  4OYV A;  2DSF A;  1B1X A;  3T9U A;  2RKM A;  4OTE A;  1IMA A;  1N76 A;  1ELJ A;  4F18 A;  4N8G A;  3IK6 B;  4RXL A;  1QUI A;  2REG A;  4EF1 A;  3E4R A;  3B7D A;  4POW A;  1HSJ A;  1OIB A;  2FYI A;  4N6P A;  2Y7I A;  5KCJ A;  3KJT A;  1CE2 A;  3R26 A;  1B0L A;  4NTL A;  3CIJ A;  1G0H A;  4R72 A;  1A55 A;  1QUK A;  1SI1 A;  1MXU A;  3KOS A;  4GVO A;  1LAF E;  2XXI A;  1JP4 A;  3T9V A;  3ZS6 A;  2XWI A;  2HQ0 A;  1A99 A;  1KZ8 A;  4PDD A;  2PBW A;  2H9B A;  1NV1 A;  3LV0 A;  2F6P A;  3QUJ A;  4EF2 A;  1MPD A;  1NV6 A;  2Q2C A;  3H06 B;  4MNI A;  1ZLQ A;  4TQU Q;  4QSC A;  2ALU A;  3PMX A;  2CEX A;  1OLA A;  4IO7 A;  4QSD A;  2ZYO A;  4IO5 A;  4R6K A;  1D9Y A;  4IR8 A;  1O64 A;  5K2X A;  5BWJ A;  3G3K A;  4R6H A;  3ISP A;  4UAC A;  5F1Q A;  1BP5 A;  4PFT A;  1B58 A;  4GF8 A;  1B4Z A;  4NHB A;  4R2F A;  3UGW A;  3C31 A;  4H46 A;  2B4M A;  2XXH A;  5CMC A;  4GL0 A;  1LB8 A;  3K6W A;  5B7D A;  4LAT A;  2V3T A;  4K3F A;  3U8Q A;  4QF9 A;  3RPL B;  3DM0 A;  5A5X B;  5EQ8 A;  1CNQ A;  3SER A;  1MDP 1;  1Z7M E;  4AB5 A;  4RK2 A;  5EQ9 A;  3B6Q A;  4R2B A;  4OVS A;  5L9M A;  2I0C A;  5J16 A;  3K6V A;  1XVY A;  3VVF A;  4EXL A;  2Q88 A;  4QFL A;  3PUX E;  4GBW A;  3CFZ A;  4ZED A;  4F22 A;  3TKD A;  4OWD A;  2X7Q A;  1FTJ A;  1B51 A;  4OHN A;  1MY1 A;  3I3V A;  2DYX A;  2QFL A;  1LAG E;  4Q0C A;  4PQJ A;  1Q1K A;  4JVI A;  1JNF A;  2V3Q A;  1MG1 A;  1NV5 A;  2QVR A;  3SEV A;  5ET6 A;  1Y4T A;  3O28 A;  5H8Q A;  1GVC A;  1M5B A;  1LFH A;  1VFE A;  4IO3 A;  1FSA A;  1Y1M A;  1LB9 A;  4R75 A;  1UTH A;  5ELV A;  1A8F A;  5I57 B;  4IGR A;  2PMS A;  4XKN A;  1XHY A;  4YKI A;  4OA4 A;  4PFB A;  1SW2 A;  4MAG A;  3CVG A;  2VD3 A;  2QPQ A;  3K01 A;  1B05 A;  2HXR A;  4YMA A;  4PCD A;  5HBC A;  2QL3 A;  3CR9 A;  2UVH A;  4DDD A;  1QGX A;  3CG1 A;  3OEK A;  5A5L A;  1S9T A;  1MM7 A;  1I69 A;  2I3V A;  5CMM A;  1P1U A;  3FVN A;  3V5A A;  4DLD A;  2AL4 A;  2NXO A;  4IGT A;  5KZT A;  1XT8 A;  4JDF A;  1T0K A;  1OQG A;  4OXV A;  4ZEF A;  5IZ1 A;  3GYY A;  3V89 B;  4WXJ A;  2VGQ A;  2D3I A;  3RNN A;  4ESW A;  1ATG A;  1K9Y A;  4OMB A;  5I2K B;  3K6U A;  1J1N A;  4C1T A;  2ZYK A;  2M8C A;  3OD7 A;  1HSE A;  3C36 A;  3KBZ A;  4QFP A;  1BKA A;  5DW8 A;  5I2N B;  2XXP A;  1MQJ A;  3OO8 A;  2CZH A;  3WAF A;  3OOA A;  5HM4 B;  2AYS A;  4OER A;  5ICQ A;  3TPA A;  3ZSF A;  5IZZ A;  4RJZ A;  1YCJ A;  4ZDM A;  3B8B A;  2UXA A;  2OCU A;  3DEL B;  3H6T A;  4OEN A;  1URD A;  3JV9 A;  4MF3 A;  5KDT B;  1YPN A;  1NNF A;  4GWW A;  2WYK A;  4M1V A;  2MKZ A;  5M2V A;  4RA1 A;  1FBD A;  3S4U A;  5CM6 A;  4RY1 A;  4H0W A;  3PPP A;  3LSX A;  3T0J A;  4YZZ A;  4YKP A;  3Q29 A;  4BDR A;  1DMB A;  4OVT A;  3UP9 A;  1I6B A;  3OEL A;  3Q26 A;  4ZE8 A;  4ISU A;  1VFD A;  3D4C A;  1FPI A;  3B50 A;  3ILU B;  4MNC A;  2WX9 A;  4XFE A;  3MVY A;  2V3U A;  3RPL A;  4YB6 A;  3MBP A;  5A5X A;  4AS4 A;  4HE0 A;  2Q8M A;  3T1B A;  1N3W A;  4F2O A;  3N26 A;  1DBZ A;  1SW5 A;  5ITP A;  3SET A;  3VXB A;  1MM6 A;  4FEC A;  1LBC A;  2XD3 A;  3GLB A;  2A5T B;  1B0H A;  3BIG A;  4NN3 A;  3MW0 A;  3MQ9 A;  3VV5 A;  5ICT A;  3SEY A;  4QHQ A;  1H45 A;  3U94 A;  4F29 A;  3L6G A;  4P0I A;  1Q9D A;  2AL5 A;  4PE5 B;  1FBH A;  2FVZ A;  3MC2 A;  3O97 A;  1ZBM A;  2I3W A;  1D4N A;  1NMU A;  4DI3 D;  4U4S A;  3PPO A;  3VLV A;  1NV3 A;  3IAZ A;  1HSL A;  2NUV A;  3KFM A;  1LAX A;  3CI8 A;  1LST A;  1IIT A;  2RF1 A;  5DVJ A;  1DPE A;  1FPL A;  5CI5 A;  5I57 A;  2XXR A;  3TCH A;  4I62 A;  4KYE A;  1FPF A;  4XXU A;  2RIN A;  5AA1 A;  3T66 A;  4IO4 A;  3CSG A;  4OEU A;  5CBS A;  4HS7 A;  2Q2A A;  1GGG A;  1P1W A;  2HAV A;  4NG7 A;  4O3C A;  5IZ3 B;  4C1U A;  1TT1 A;  3FZV A;  3V8X B;  4N81 A;  1B5I A;  4H5G A;  1B7H A;  4EQ9 A;  3FGS A;  1QKB A;  4E0X A;  4H8I A;  3KEI A;  1PC3 A;  2F34 A;  4U21 A;  3OO6 A;  3DP4 A;  4FE8 A;  2ZXT A;  3EHT A;  4I9D A;  3OEM A;  4I3E A;  5I2K A;  2HHM A;  4X9T A;  2GH9 A;  3OO7 A;  4ZEI A;  4P1L A;  5I2N A;  3T96 B;  1JEV A;  2Y7P A;  4N6K A;  2XXW A;  3SES A;  4O8M A;  3HFU A;  1B5J A;  1DSN A;  3G3H A;  1XS5 A;  2PFY A;  3TZA A;  3K4U A;  1FQE A;  2DDK A;  4ZEB A;  2XXV A;  2VHA A;  1MXX A;  1JET A;  4XKR A;  2XWO A;  2B3F A;  5KDT A;  5EYH A;  4PF6 A;  1LAH E;  2GHA A;  3PUV E;  1ZIU A;  4N6D A;  1LFG A;  4EUO A;  5L9S A;  1FPK A;  4DIG A;  4PTK A;  2Z23 A;  3P7I A;  4OFL A;  4IY5 A;  1EYK A;  1ANF A;  3KJ7 A;  4PGP A;  4KCD A;  3BIH A;  3GBA A;  3FIR A;  4LZ7 A;  1PB8 A;  2X26 A;  4G77 A;  1UTH B;  5L9O A;  1YXI A;  4PDH A;  3HN0 A;  4UAB A;  3FJ7 A;  1UQW A;  5I59 B;  1YZ0 A;  2OLB A;  1EZO A;  2WEF A;  3EF7 A;  4U22 A;  3RPW A;  3DP8 A;  4P11 A;  5HPQ A;  1MQH A;  2XXQ A;  4LZ8 A;  3O29 A;  3EHU A;  3LUZ A;  2A5T A;  3MAM A;  3PPQ A;  3UA8 A;  3PV0 E;  3VDF A;  1N04 A;  1VE4 A;  2IA4 A;  1MPC A;  1Q35 A;  2XXY A;  3KN3 A;  1FRP A;  1QUL A;  4N8Y A;  1I6Q A;  1I6A A;  3MVZ A;  3U93 A;  2XX8 A;  4GBV A;  2X7P A;  4XF5 A;  2CZI A;  4ECF A;  2XXX A;  4XEQ A;  3G3J A;  4XIG Q;  3CHG A;  2FBP A;  3MJN A;  4N17 A;  3AXF A;  4GXA A;  1JW5 A;  4R73 A;  3KSJ A;  4ZS9 A;  1TFA A;  3R7X A;  2HEU A;  3EQ1 A;  1DOT A;  1R1N A;  2A5S A;  3QYT A;  4O7I A;  3SDF A;  4XKP A;  4OVR A;  2XX9 A;  1FTM A;  2G93 A;  3GBB A;  1B46 A;  2L5V A;  1BIY A;  5B70 A;  3RLF E;  5EYF A;  2ZZW A;  4JWY A;  4ZE9 A;  3S9M C;  4P47 A;  4IO6 A;  5IZ3 A;  1IMF A;  2REJ A;  2O7I A;  1ZJL A;  5I7I A;  2UYE A;  3HPI A;  1LBY A;  4YIC A;  2Q8J A;  2ZZV A;  4G2Z A;  2XA5 A;  3TQL A;  3ROJ A;  1FBE A;  2OX3 A;  3M3K A;  4JVD A;  5T3J A;  2H4I A;  4NWC A;  4R74 A;  3CFX A;  1B3L A;  5FTI A;  3I5O A;  1RKM A;  1SYH A;  1B3E A;  3TTK A;  1XOC A;  1KA0 A;  1N7W A;  4XTC Q;  4DCX A;  3TCG A;  3ODB A;  3MP8 A;  3T9X B;  2Y7R A;  1FQC A;  1GV8 A;  1AMF A;  4G8M A;  1VSO A;  3SEU A;  4TOZ A;  4YKJ A;  3VE1 B;  1BK4 A;  4NAP A;  4YAH X;  4TLL B;  3H3G A;  4BDQ A;  3FJG A;  1MQD A;  1IME A;  2O1M A;  4MFI A;  3O66 A;  4U23 A;  4AS5 A;  3RYD A;  4ELQ A;  2Z8D A;  3VFJ A;  5ET7 A;  2YJP A;  2FHY A;  3LSW A;  1IEJ A;  2B65 A;  4FOR A;  4MBP A;  4F3P A;  3TQW A;  1FBG A;  1PB7 A;  4EQB A;  3M8U A;  3PUW E;  5LOM A;  3E3K A;  1NI9 A;  2PFZ A;  4GL8 A;  2P0S A;  4H45 A;  3RT6 B;  3PU5 A;  1R9Q A;  1OVB A;  1UTB B;  1TFD A;  2D21 A;  2ESN A;  2F6G A;  1R9L A;  5F7V A;  1O63 A;  1FQA A;  4PFU A;  3CG3 A;  2QMX A;  2WBD A;  2ZNS A;  3IO4 A;  1JVY A;  2DWA A;  4ESX A;  4GWU A;  4KYS A;  3PPR A;  3MP6 A;  5EQA A;  3HV1 A;  3M3F A;  2I48 A;  1B40 A;  4YB7 A;  1RDX A;  3QAX A;  3MZ1 A;  1NV2 A;  1JW4 A;  2QSX A;  5I59 A;  2RCB A;  3IR1 A;  1PBP A;  2Z22 A;  3MYU A;  2R9J A;  2D5W A;  2HZL A;  1LBB A;  1Y3Q A;  4GWZ A;  4EQ7 A;  3U92 A;  1MQI A;  4G68 C;  1LLS A;  3RTF B;  3OO9 A;  2OZZ A;  3MUQ A;  5IM2 A;  3I6V A;  2DQV A;  1FJ9 A;  1Y1Z A;  3N6U A;  5LDZ A;  2QS2 A;  3RUM A;  4X8R A;  4Q8R A;  4FAT A;  4F31 B;  1IQ7 A;  1A54 A;  1II5 A;  4HE2 A;  1NV0 A;  4QRZ A;  3K6X A;  5J1D A;  3ECR A;  1EZ9 A;  3GXA A;  2XD2 A;  2UVJ A;  4GWX A;  2WYP A;  1IXI A;  2O84 X;  4PP0 A;  3TTR A;  4NQ8 A;  4GD5 A;  4NF5 B;  4G68 B;  1DTZ A;  4RPO A;  1JW1 A;  2PCR A;  3W9W A;  1FPD A;  3KC0 A;  1Z7N E;  4GX4 A;  4PAF A;  3GZG A;  1UIU A;  5CBR A;  4F1V A;  1MY3 A;  2DWJ A;  4FEB A;  1MXW A;  2VD2 A;  2I0B A;  2F7C A;  1OVT A;  3TTM A;  2HFB A;  3N5L A;  3Q27 A;  2I4B A;  2PT1 A;  5H8S A;  4KYD A;  2P2A A;  3PMW A;  4WEP A;  4GQO A;  4LON B;  1FBP A;  4H67 A;  1FW0 A;  2QVU A;  3MP1 A;  4MEV A;  1A40 A;  1LCF A;  2F8D A;  4LP2 B;  4GWO A;  2Q89 A;  1SYI A;  2VPO A;  3RQT A;  4NF6 A;  4MH5 A;  4MX6 A;  2E1S A;  1B32 A;  1QUJ A;  3LR1 A;  4NGU A;  5JK4 A;  4OVP A;  1MQG A;  4JSO A;  1R6Z A;  1URG A;  1OLC A;  4HCY A;  4H5F A;  2DS9 A;  2F35 A;  2O7U A;  2LAO A;  2Y5K A;  3HST A;  3O9P A;  2DE3 A;  1USY H;  5FBP A;  2GFE A;  4N91 A;  4NX1 A;  3KOT A;  4I40 A;  3FXQ A;  5FHM A;  5CMK A;  3E9X A;  1OQH A;  3RY3 A;  4MIJ A;  3LBS A;  3S2V A;  1BLF A;  4PF8 A;  5DVI A;  1LEV A;  1LBV A;  1IXC A;  4NE4 A;  3BKI B;  4C0R A;  4E0W A;  5AA2 B;  1DCU A;  2YPN A;  1UTB A;  3FBP A;  2F7B A;  4Z7E A;  5I58 B;  2THI A;  1INP A;  3VXC A;  1AL3 A;  3KZG A;  1IMD A;  3MZB A;  2F97 A;  2QVV A;  1FPE A;  4MNP A;  3C9H A;  5I3S A;  2CEY A;  4NMY A;  1IMC A;  1NH8 A;  2R6G E;  3N6T A;  2RC7 A;  3SZP A;  3B6T A;  1TXF A;  2VPN A;  3PUZ E;  4F3S A;  4G8N A;  1ZMG A;  2I58 A;  5DYH A;  3OMB A;  3H03 A;  4THI A;  4KFQ A;  4ZZE A;  1B4H A;  4ELO A;  4XKQ A;  3TYH A;  3TDJ A;  3SEX A;  1M5F A;  1MPB A;  3LUY A;  4KPT A;  2XXK A;  4OEV A;  5H8H B;  3IFC A;  4P1E A;  5AA3 A;  4DXB A;  4PFY A;  1NNT A;  3OSQ A;  3PUY E;  3FXR A;  3IB0 A;  3VLW A;  1AH5 A;  1NV4 A;  4PBH A;  3CSB A;  3SEW A;  4F39 A;  3UIF A;  4ELR A;  3PD8 A;  4PFR A;  2XX7 A;  4GRK A;  1UIV A;  4NF5 A;  4G68 A;  1P99 A;  3H7M A;  5ET5 A;  1MXY A;  3VVE A;  4IO2 A;  1FTK A;  2OK2 A;  2GHB A;  1IUD A;  4LQ5 A;  1A7L A;  3W9V A;  4JB7 A;  1JQF A;  1QKA A;  5AA4 A;  3S9L C;  4AQ4 A;  3B6W A;  3IFA A;  4GX6 A;  5CRY A;  4GLI A;  4P8B A;  1MY0 A;  1A8E A;  4GWY A;  4O3A A;  1LBW A;  1O7T A;  3G3I A;  1DTG A;  2FA7 A;  1WDN A;  2XWV A;  1US4 A;  3IOU A;  3TUS A;  2BJI A;  2F36 A;  1QJM A;  2CMO A;  1M5D A;  2RCA A;  4NED A;  1SW1 A;  2ZMB A;  4YB5 A;  2B3B A;  4U1O A;  1FJ6 A;  3EN3 A;  4H65 A;  4FAJ A;  1EZP A;  3USD A;  3L6H A;  3M3L A;  2V84 A;  3FAS A;  1NH7 A;  3QK6 A;  1N0T A;  3IO6 A;  4RK9 A;  4KD5 A;  3RN8 A;  4GOT A;  1B52 A;  4QXD A;  2OWS A;  1MRP A;  5TPA B;  4RYA A;  1K9Z A;  2ANJ A;  3K1M A;  1SBP A;  2PX1 A;  1P1N A;  1EYJ A;  4BLA A;  3OSR A;  2QS4 A;  4LVQ A;  5CMB A;  2QJE A;  1D9Q A;  1WOD A;  4BDO A;  3HHG A;  1B3H A;  4MJO A;  4RNS A;  1NUY A;  3KN8 A;  4QFN A;  3O2A A;  4Q30 B;  3JZJ A;  1JEU A;  1NUW A;  3T9H B;  3PPN A;  2HZK A;  2Q9T A;  1N3X A;  4P56 A;  5AA2 A;  1H43 A;  1XI6 A;  5H8N B;  3FJM A;  3TAJ A;  2DWI A;  3PMV A;  4OES A;  5I58 A;  1YTV A;  4DXU A;  4ZEC A;  4G4P A;  3JYR A;  1NFT A;  1B3G A;  3D1R A;  4O3B A;  3T93 B;  3PTY A;  2I6E A; 
#chains in the Genus database with same CATH homology
 3DP6 A;  3K00 A;  1SVX B;  1ZU0 A;  2O68 A;  3QUF A;  2GRV A;  2OBG A;  3H4Z A;  1CB6 A;  3FD3 A;  1PB9 A;  3C35 A;  1Y3N A;  3U72 A;  3UOR A;  1ZKB A;  2Z8F A;  4H6D A;  1MH4 A;  2Y7K A;  5K2Y A;  2AIX A;  4ZEK A;  5ISU A;  4G8H A;  2VP1 A;  2PYY A;  4ONY A;  1B3F A;  2H5Y A;  1WVJ A;  2O1L A;  2W7Y A;  4KHZ E;  3IJX B;  5H8H A;  2YLN A;  3O6G A;  2O51 A;  4QFK A;  1F9B A;  5H8F B;  3OXN A;  4NF6 B;  1AOV A;  4GXS B;  3IOR A;  3FVG A;  3BFT A;  1EU8 A;  2QMW A;  5FTH A;  4WKM A;  3K1N A;  1LCT A;  4R9F A;  5IAI A;  4FIM A;  2I4C A;  4N13 A;  1B6H A;  3A09 A;  2O6A A;  5I84 A;  5FHO A;  3A3C A;  3K0V A;  1US5 A;  1IIW A;  1SD3 A;  1DPP A;  3C4M A;  2NWJ A;  4MLQ A;  1H76 A;  3KBR A;  2PVU A;  1Y3P A;  4YKK A;  2RC8 A;  3S9N C;  2Y84 A;  2F7A A;  4HW8 A;  4F3B A;  3VVD A;  1MDQ A;  1RYX A;  2P1S A;  1GTK A;  4F19 A;  4YMB A;  1L5T A;  2OJT A;  3IOV A;  1D9V A;  4LZ5 A;  4OFJ A;  2H25 A;  3FV1 A;  5FHN A;  2ZYN A;  3UK4 A;  3Q25 A;  1P1Q A;  3ONM A;  4JXI A;  4IB2 A;  2HCA A;  4DXC A;  1XC1 A;  1POY 1;  3MZ9 A;  4DZ1 A;  1KWH A;  4U4X A;  3PGF A;  1IXH A;  5TPA A;  4OVJ A;  2XXT A;  3RT8 A;  5DEX A;  2DOJ A;  4KQP A;  2UVG A;  5TU0 A;  3C32 A;  3TEL A;  3H6U A;  4HTG A;  4EDP A;  4F1Y A;  3A3U A;  3QSL A;  4ZZA A;  1VR5 A;  2F5X A;  3PD9 A;  2NVU B;  3G7W A;  1FQF A;  5TP9 A;  1POT A;  3KG2 A;  1Y20 A;  1NL5 A;  3FUZ A;  2ZNU A;  2G29 A;  2ONS A;  2ZNT A;  5H8N A;  3F11 A;  1FTO A;  3KGC A;  5JTY B;  4X1D A;  3IL1 B;  3V83 A;  3LSL A;  4H8J A;  4NWD A;  5AE4 A;  3T22 A;  1IXG A;  1EH3 A;  2QS3 A;  1AIV A;  3TOD A;  1TWY A;  5AA4 B;  4BDL A;  3E13 X;  4YU0 A;  1Y9U A;  4U1Z A;  4QSE A;  2ZYM A;  1FCK A;  1XVX A;  4OZ9 A;  2DXY A;  2Y7W A;  4UA8 A;  1MY2 A;  4Z0I A;  2QS1 A;  3EHS A;  3IX1 A;  2DP8 A;  3VLU A;  3ZKK A;  3W15 C;  1S50 A;  4JWX A;  1MXV A;  2OWT A;  1URS A;  4H1X A;  5BUU A;  1QVS A;  2HXW A;  4DE8 A;  4PET A;  5H8F A;  4GFR A;  1QW0 A;  4F1U A;  1S7Y A;  4POX A;  4U2R A;  1FQB A;  4I1D A;  4NF8 B;  4FED A;  3FAT A;  3IB2 A;  4ELP A;  3C33 A;  2DWH A;  3HCQ A;  1MS7 A;  2F78 A;  3TTL A;  2E0S A;  2RC9 A;  4LA9 A;  4KR5 A;  1SDX A;  1FQD A;  3HHF A;  3H6V A;  3Q28 A;  4GIZ A;  4L17 A;  2ONR A;  2KLF A;  4I8C A;  5EHS A;  4R9G A;  1YAE A;  3THI A;  3OEN A;  3KN7 A;  4LUB A;  5I56 B;  1FTL A;  3IOW A;  3K1P A;  1NKX A;  5DVF A;  3O6I A;  3TTN A;  3FVO A;  3UN6 A;  1SW4 A;  1NNK A;  3G3G A;  2Z8E A;  3MPK A;  2QRY A;  4NF4 B;  1B9J A;  4MLV A;  3TMG A;  1M5C A;  4OFO A;  3CFL A;  1JVX A;  1B1H A;  4LQ2 A;  2H99 A;  3U1O A;  4OET A;  4AB6 A;  1BTJ A;  3IJO B;  3WAE A;  4QFO A;  2DE2 A;  3ILT B;  4X1B A;  1MXZ A;  5JEI A;  3H6W A;  1LGB C;  3FXU A;  5KCJ B;  3QXM A;  2NOO A;  2ONK E;  3TCF A;  1H44 A;  3FV2 A;  3HO7 A;  3IOT A;  3S9E A;  2I49 A;  2DVC A;  4M4G A;  1IZ1 A;  1SQY A;  3LC8 A;  3RGY A;  3FVK A;  2VOZ A;  2PT2 A;  1RYO A;  4FJP A;  2IEE A;  1Y4C A;  3MVW A;  4PFW A;  1MH3 A;  5JTY A;  4ND9 A;  3O6H A;  2V93 A;  2FNC A;  5AA2 D;  2V25 A;  1B2H A;  2UYF A;  3BBR A;  4EXK A;  3G3F A;  1MY4 A;  3SKP A;  2UVI A;  4R6Y A;  2WKY A;  1ZTY A;  4F2Q A;  1SI0 A;  4N07 A;  1N7X A;  5DTB A;  1USY E;  3EPE A;  4WED A;  3K2D A;  1LFI A;  3K02 A;  1B7Z A;  3QIM A;  4P0G A;  2DXR A;  4RPN A;  3BFU A;  5CC2 A;  4TLM B;  5DT6 A;  4BDN A;  1PEB A;  2R71 A;  4X48 A;  1NNP A;  4KI0 E;  4HCW A;  2CZL A;  4JBZ A;  2HAU A;  4NF8 A;  3R6U A;  4KCC A;  2O69 A;  1PDA A;  2H98 A;  1B5H A;  1H3D A;  1OMP A;  2XHD A;  3N94 A;  3CRB A;  1B7U A;  5IKB A;  3D4G A;  5H8Q B;  2XXU A;  5DEX B;  5EHM A;  4JWO A;  3TFL A;  1D3K A;  1N84 A;  4F3G A;  3KSX A;  1P1O A;  5L8D A;  3LSF B;  3MWB A;  3MPL A;  4OQO A;  4DCY A;  4JSD A;  5I56 A;  3C34 A;  2ABH A;  3ZKL A;  2BJJ X;  3TEP A;  5TP9 B;  4BDM A;  1GR2 A;  5ITO A;  3RTW B;  3DLN A;  2DE4 A;  1M5E A;  2DVZ A;  3IB1 A;  4IY6 A;  4NF4 A;  1PBQ A;  3MVX A;  4Q5T A;  4OYV A;  2DSF A;  1B1X A;  3T9U A;  2RKM A;  4OTE A;  1N76 A;  1ELJ A;  4F18 A;  3IK6 B;  4RXL A;  1QUI A;  2REG A;  4EF1 A;  3E4R A;  3B7D A;  4POW A;  1HSJ A;  1OIB A;  2FYI A;  4N6P A;  2Y7I A;  5KCJ A;  3KJT A;  1CE2 A;  3R26 A;  1B0L A;  4NTL A;  3CIJ A;  4R72 A;  1A55 A;  1QUK A;  1SI1 A;  1MXU A;  3KOS A;  4GVO A;  1LAF E;  2XXI A;  3T9V A;  3ZS6 A;  2HQ0 A;  1A99 A;  2PBW A;  2H9B A;  2F6P A;  3QUJ A;  4EF2 A;  1MPD A;  2Q2C A;  3H06 B;  1ZLQ A;  4TQU Q;  4QSC A;  2ALU A;  3PMX A;  1OLA A;  4IO7 A;  4QSD A;  2ZYO A;  4IO5 A;  4R6K A;  1D9Y A;  1O64 A;  5K2X A;  5BWJ A;  3G3K A;  4R6H A;  4UAC A;  5F1Q A;  1BP5 A;  4PFT A;  1B58 A;  4GF8 A;  1B4Z A;  4R2F A;  3UGW A;  3C31 A;  2XXH A;  5CMC A;  4GL0 A;  1LB8 A;  3K6W A;  5B7D A;  4LAT A;  2V3T A;  4K3F A;  3U8Q A;  4QF9 A;  3DM0 A;  5A5X B;  3SER A;  1MDP 1;  1Z7M E;  4AB5 A;  4RK2 A;  3B6Q A;  4R2B A;  5L9M A;  2I0C A;  3K6V A;  1XVY A;  3VVF A;  4EXL A;  2Q88 A;  4QFL A;  3PUX E;  3CFZ A;  4ZED A;  4F22 A;  3TKD A;  4OWD A;  2X7Q A;  1FTJ A;  1B51 A;  4OHN A;  1MY1 A;  3I3V A;  2DYX A;  1LAG E;  4Q0C A;  4PQJ A;  1Q1K A;  1JNF A;  2V3Q A;  1MG1 A;  3SEV A;  1Y4T A;  3O28 A;  5H8Q A;  1GVC A;  1M5B A;  1LFH A;  1VFE A;  4IO3 A;  1Y1M A;  1LB9 A;  4R75 A;  1UTH A;  5ELV A;  1A8F A;  5I57 B;  4IGR A;  2PMS A;  4XKN A;  1XHY A;  4YKI A;  1SW2 A;  3CVG A;  2VD3 A;  2QPQ A;  3K01 A;  1B05 A;  4YMA A;  5HBC A;  2QL3 A;  3CR9 A;  2UVH A;  4DDD A;  3CG1 A;  3OEK A;  1S9T A;  1MM7 A;  1I69 A;  2I3V A;  5CMM A;  1P1U A;  3FVN A;  3V5A A;  4DLD A;  2AL4 A;  2NXO A;  4IGT A;  5KZT A;  1XT8 A;  4JDF A;  1T0K A;  1OQG A;  4OXV A;  4ZEF A;  3V89 B;  4WXJ A;  2VGQ A;  2D3I A;  3RNN A;  4ESW A;  1ATG A;  4OMB A;  5I2K B;  3K6U A;  1J1N A;  4C1T A;  2ZYK A;  2M8C A;  3OD7 A;  1HSE A;  3C36 A;  4QFP A;  1BKA A;  5I2N B;  2XXP A;  1MQJ A;  3OO8 A;  3WAF A;  3OOA A;  5HM4 B;  2AYS A;  4OER A;  5ICQ A;  3TPA A;  3ZSF A;  4RJZ A;  1YCJ A;  4ZDM A;  2UXA A;  2OCU A;  3DEL B;  3H6T A;  4OEN A;  1URD A;  3JV9 A;  4MF3 A;  5KDT B;  1YPN A;  1NNF A;  4M1V A;  5M2V A;  4RA1 A;  3S4U A;  5CM6 A;  4RY1 A;  4H0W A;  3PPP A;  3LSX A;  4YZZ A;  4YKP A;  3Q29 A;  4BDR A;  1DMB A;  3UP9 A;  1I6B A;  3OEL A;  3Q26 A;  4ZE8 A;  4ISU A;  1VFD A;  3D4C A;  3ILU B;  3MVY A;  2V3U A;  4YB6 A;  3MBP A;  5A5X A;  1N3W A;  4F2O A;  3N26 A;  1SW5 A;  5ITP A;  3SET A;  3VXB A;  1MM6 A;  4FEC A;  1LBC A;  2XD3 A;  3GLB A;  2A5T B;  1B0H A;  5ICT A;  3VV5 A;  3MW0 A;  3MQ9 A;  3SEY A;  4QHQ A;  1H45 A;  3U94 A;  4F29 A;  3L6G A;  4P0I A;  2AL5 A;  4PE5 B;  3MC2 A;  3O97 A;  1ZBM A;  2I3W A;  1D4N A;  1NMU A;  4U4S A;  3PPO A;  3VLV A;  3IAZ A;  1HSL A;  2NUV A;  3KFM A;  1LAX A;  3CI8 A;  1LST A;  1IIT A;  2RF1 A;  5DVJ A;  1DPE A;  5I57 A;  5CI5 A;  2XXR A;  3TCH A;  4I62 A;  4KYE A;  5AA1 A;  4XXU A;  2RIN A;  3T66 A;  4IO4 A;  3CSG A;  4OEU A;  5CBS A;  4HS7 A;  2Q2A A;  1GGG A;  1P1W A;  2HAV A;  4O3C A;  4C1U A;  1TT1 A;  3FZV A;  3V8X B;  1B5I A;  4H5G A;  1B7H A;  4EQ9 A;  3FGS A;  1QKB A;  4E0X A;  4H8I A;  3KEI A;  1PC3 A;  2F34 A;  4U21 A;  3OO6 A;  3DP4 A;  4FE8 A;  2ZXT A;  3EHT A;  4I9D A;  3OEM A;  5I2K A;  4X9T A;  2GH9 A;  3OO7 A;  4ZEI A;  5I2N A;  3T96 B;  1JEV A;  2Y7P A;  2XXW A;  3SES A;  1B5J A;  1DSN A;  3G3H A;  1XS5 A;  3TZA A;  3K4U A;  1FQE A;  4ZEB A;  2XXV A;  2VHA A;  1MXX A;  1JET A;  4XKR A;  2B3F A;  5KDT A;  1LAH E;  2GHA A;  3PUV E;  1ZIU A;  1LFG A;  4EUO A;  5L9S A;  4DIG A;  2Z23 A;  3P7I A;  4OFL A;  4IY5 A;  1ANF A;  3KJ7 A;  4KCD A;  3GBA A;  3FIR A;  4LZ7 A;  1PB8 A;  2X26 A;  4G77 A;  1UTH B;  5L9O A;  3HN0 A;  3FJ7 A;  1UQW A;  5I59 B;  2OLB A;  1EZO A;  3EF7 A;  4U22 A;  3RPW A;  3DP8 A;  4P11 A;  5HPQ A;  1MQH A;  2XXQ A;  4LZ8 A;  3O29 A;  3EHU A;  2A5T A;  3MAM A;  3PPQ A;  3UA8 A;  3PV0 E;  3VDF A;  1N04 A;  1VE4 A;  2IA4 A;  1MPC A;  1Q35 A;  2XXY A;  3KN3 A;  1QUL A;  1I6Q A;  1I6A A;  3MVZ A;  3U93 A;  2XX8 A;  2X7P A;  4ECF A;  2XXX A;  3G3J A;  4XIG Q;  3MJN A;  3AXF A;  4GXA A;  1JW5 A;  4R73 A;  3KSJ A;  4ZS9 A;  1TFA A;  3R7X A;  2HEU A;  3EQ1 A;  1DOT A;  1R1N A;  2A5S A;  3QYT A;  3SDF A;  4XKP A;  2XX9 A;  1FTM A;  2G93 A;  3GBB A;  1B46 A;  5B70 A;  1BIY A;  3RLF E;  5EYF A;  4JWY A;  4ZE9 A;  3S9M C;  4IO6 A;  2REJ A;  2O7I A;  1ZJL A;  2UYE A;  3HPI A;  4YIC A;  2Q8J A;  4G2Z A;  3TQL A;  3M3K A;  2H4I A;  4NWC A;  4R74 A;  3CFX A;  1B3L A;  5FTI A;  3I5O A;  1RKM A;  1SYH A;  1B3E A;  3TTK A;  1XOC A;  1N7W A;  4XTC Q;  4DCX A;  3TCG A;  3ODB A;  3MP8 A;  3T9X B;  2Y7R A;  1FQC A;  1GV8 A;  1AMF A;  4G8M A;  1VSO A;  3SEU A;  4TOZ A;  4YKJ A;  3VE1 B;  4YAH X;  4TLL B;  3H3G A;  4BDQ A;  3FJG A;  1MQD A;  2O1M A;  4MFI A;  3O66 A;  4U23 A;  4ELQ A;  2Z8D A;  3VFJ A;  2YJP A;  3LSW A;  1IEJ A;  2B65 A;  4FOR A;  4MBP A;  4F3P A;  3TQW A;  1PB7 A;  4EQB A;  3M8U A;  3PUW E;  5LOM A;  3E3K A;  4GL8 A;  2P0S A;  3RT6 B;  3PU5 A;  1R9Q A;  1OVB A;  1UTB B;  1TFD A;  2D21 A;  2ESN A;  2F6G A;  1R9L A;  5F7V A;  1O63 A;  1FQA A;  4PFU A;  3CG3 A;  2QMX A;  2ZNS A;  3IO4 A;  1JVY A;  2DWA A;  4ESX A;  4KYS A;  3PPR A;  3MP6 A;  3HV1 A;  3M3F A;  2I48 A;  1B40 A;  4YB7 A;  3QAX A;  3MZ1 A;  1JW4 A;  2QSX A;  5I59 A;  2RCB A;  3IR1 A;  1PBP A;  2Z22 A;  2R9J A;  2D5W A;  2HZL A;  1LBB A;  1Y3Q A;  4EQ7 A;  3U92 A;  1MQI A;  4G68 C;  1LLS A;  3RTF B;  3OO9 A;  2OZZ A;  3MUQ A;  3I6V A;  2DQV A;  1Y1Z A;  3N6U A;  2QS2 A;  3RUM A;  4Q8R A;  4FAT A;  4F31 B;  1IQ7 A;  1A54 A;  1II5 A;  4QRZ A;  3K6X A;  5J1D A;  3ECR A;  1EZ9 A;  3GXA A;  2XD2 A;  2UVJ A;  1IXI A;  2O84 X;  4PP0 A;  3TTR A;  4GD5 A;  4NF5 B;  4G68 B;  1DTZ A;  4RPO A;  1JW1 A;  3W9W A;  1Z7N E;  3GZG A;  1UIU A;  5CBR A;  4F1V A;  1MY3 A;  2DWJ A;  4FEB A;  1MXW A;  2VD2 A;  2I0B A;  2F7C A;  1OVT A;  3TTM A;  2HFB A;  3N5L A;  3Q27 A;  2I4B A;  2PT1 A;  5H8S A;  4KYD A;  2P2A A;  3PMW A;  4WEP A;  4GQO A;  4LON B;  4H67 A;  1FW0 A;  3MP1 A;  1A40 A;  1LCF A;  2F8D A;  4LP2 B;  4GWO A;  2Q89 A;  1SYI A;  3RQT A;  4NF6 A;  4MH5 A;  2E1S A;  1B32 A;  1QUJ A;  3LR1 A;  5JK4 A;  1MQG A;  4JSO A;  1R6Z A;  1URG A;  1OLC A;  4HCY A;  4H5F A;  2DS9 A;  2F35 A;  2O7U A;  2LAO A;  3HST A;  3O9P A;  2DE3 A;  1USY H;  2GFE A;  3KOT A;  3FXQ A;  5FHM A;  5CMK A;  3E9X A;  1OQH A;  3RY3 A;  3LBS A;  3S2V A;  1BLF A;  5DVI A;  1IXC A;  4NE4 A;  3BKI B;  4C0R A;  4E0W A;  5AA2 B;  2YPN A;  1UTB A;  2F7B A;  4Z7E A;  5I58 B;  2THI A;  3VXC A;  1AL3 A;  3KZG A;  3MZB A;  2F97 A;  3C9H A;  4NMY A;  1NH8 A;  2R6G E;  3N6T A;  2RC7 A;  3B6T A;  1TXF A;  3PUZ E;  4F3S A;  4G8N A;  1ZMG A;  2I58 A;  5DYH A;  3OMB A;  3H03 A;  4THI A;  4KFQ A;  4ZZE A;  1B4H A;  4ELO A;  4XKQ A;  3TYH A;  3TDJ A;  3SEX A;  1M5F A;  1MPB A;  3LUY A;  4KPT A;  4OEV A;  5H8H B;  5AA3 A;  4DXB A;  4PFY A;  1NNT A;  3OSQ A;  3PUY E;  3FXR A;  3IB0 A;  3VLW A;  1AH5 A;  3CSB A;  3SEW A;  4F39 A;  3UIF A;  4ELR A;  3PD8 A;  2XX7 A;  4GRK A;  1UIV A;  4NF5 A;  4G68 A;  1P99 A;  3H7M A;  3VVE A;  1MXY A;  4IO2 A;  1FTK A;  2OK2 A;  2GHB A;  1IUD A;  4LQ5 A;  1A7L A;  3W9V A;  4JB7 A;  1JQF A;  1QKA A;  5AA4 A;  3S9L C;  4AQ4 A;  3B6W A;  5CRY A;  4GLI A;  1MY0 A;  1A8E A;  4O3A A;  1O7T A;  3G3I A;  1DTG A;  2FA7 A;  1WDN A;  1US4 A;  3IOU A;  3TUS A;  2F36 A;  1QJM A;  2CMO A;  1M5D A;  2RCA A;  4NED A;  1SW1 A;  2ZMB A;  4YB5 A;  2B3B A;  4U1O A;  3EN3 A;  4H65 A;  4FAJ A;  1EZP A;  3USD A;  3L6H A;  3M3L A;  2V84 A;  3FAS A;  1NH7 A;  3QK6 A;  1N0T A;  3IO6 A;  4RK9 A;  4KD5 A;  3RN8 A;  4GOT A;  1B52 A;  2OWS A;  1MRP A;  5TPA B;  4RYA A;  2ANJ A;  3K1M A;  1SBP A;  2PX1 A;  1P1N A;  4BLA A;  3OSR A;  2QS4 A;  4LVQ A;  5CMB A;  2QJE A;  1WOD A;  4BDO A;  3HHG A;  1B3H A;  4RNS A;  3KN8 A;  4QFN A;  3O2A A;  4Q30 B;  3JZJ A;  1JEU A;  3T9H B;  3PPN A;  2HZK A;  2Q9T A;  1N3X A;  5AA2 A;  1H43 A;  5H8N B;  3FJM A;  3TAJ A;  2DWI A;  3PMV A;  4OES A;  5I58 A;  1YTV A;  4DXU A;  4ZEC A;  4G4P A;  3JYR A;  1NFT A;  1B3G A;  4O3B A;  3T93 B;  2I6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...