1AL3A

Cofactor binding fragment of cysb from klebsiella aerogenes
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
237
structure length
237
Chain Sequence
TWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEDIEAMFKDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the cofactor-binding fragment of the LysR family member, CysB: a familiar fold with a surprising subunit arrangement.
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Transcription regulation
molecule keywords CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
total genus 71
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 1997-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1al3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1al3A01
3KN7A 4YMAA 4IGRA 2PT2A 3T22A 5B7DA 3ILTB 3PPQA 1UIUA 3VE1B 3TTMA 4C1TA 4OFLA 3MPKA 2Y7PA 3O28A 3QK6A 4KQPA 4RYAA 1BP5A 4U2RA 4KFQA 1QUIA 1AL3A 1J1NA 1URGA 4XIGQ 3UIFA 2DYXA 2I3WA 2NWJA 1UIVA 2XXIA 1UTHB 3TAJA 4U1ZA 1NNTA 3RTWB 4KHZE 1H43A 1CE2A 4JSOA 4PQJA 1N04A 3CRBA 3TUSA 3B7DA 3H6VA 1MXUA 2O51A 3HN0A 3KBRA 1B4ZA 1DSNA 1MM6A 3KG2A 3TMGA 3PPPA 3MW0A 4E0XA 2H25A 4IO5A 1O64A 2B3BA 2PBWA 3SEUA 3PPNA 1MY2A 2ANJA 3QUFA 4F18A 4LZ7A 2I4BA 2V93A 5BWJA 4QFOA 4G77A 4MH5A 4PFYA 1MRPA 4F39A 3D4CA 2O6AA 3MP8A 2DE4A 2VGQA 2QS2A 4DXCA 3RGYA 1QULA 1MXVA 4BDMA 1CB6A 1PBPA 2O7UA 2ZMBA 1A8FA 3O29A 1NFTA 4EQ7A 4X1DA 4FAJA 2I48A 3EPEA 4HTGA 4X9TA 5HPQA 5ELVA 1B3GA 1MH4A 3K1MA 5LOMA 4MF3A 2AYSA 3GZGA 3H6TA 3FJGA 5IKBA 1B3HA 2Y7KA 4F29A 1URDA 1EU8A 1LFIA 1LSTA 2XXQA 1B1XA 2D3IA 4FE8A 5CRYA 1Y4CA 2ONKE 2UVHA 4GF8A 5I84A 4P0IA 3T66A 3DP6A 3HSTA 5JTYB 3VLUA 3F11A 3O6HA 3W9VA 1LFHA 5I58B 4LONB 3OO9A 1TFAA 3I5OA 2UYEA 3LSLA 4RK2A 3S4UA 2REGA 1FQDA 3IO6A 1ZLQA 2ONRA 3MPLA 2GHAA 3PUWE 1SQYA 3R7XA 1B5HA 1ELJA 3JZJA 1GTKA 2ZYOA 4DCXA 3S9MC 3EHSA 3JV9A 3Q28A 3TCHA 1MQGA 2RKMA 2V3UA 1BIYA 1N7WA 3IAZA 4FIMA 3TQLA 1AOVA 5AE4A 3MZ1A 3RY3A 1MS7A 4G8NA 4ONYA 3G3HA 4ESWA 2RCBA 2I4CA 2XXVA 4ZDMA 2VD3A 1MH3A 3PU5A 5CI5A 2P0SA 5JTYA 5KZTA 1NH7A 3FD3A 3L6HA 4F3PA 1B7ZA 1I69A 3IJOB 5EHSA 1T0KA 3OO7A 2NVUB 2F6GA 1Z7ME 1JEVA 2F7BA 1B3LA 1Z7NE 2QJEA 3EF7A 3K1NA 4I8CA 4OFOA 4G8HA 4FECA 2Q2CA 3U94A 5K2XA 4IY6A 5M2VA 2R6GE 2QMXA 1NKXA 4YU0A 2REJA 3SEVA 5CMBA 4KYDA 4E0WA 4PETA 2XHDA 1SD3A 2O84X 1MXZA 3OENA 1VSOA 1ZJLA 2DE3A 5BUUA 2F8DA 3G3KA 1DTZA 4R75A 2QL3A 2FNCA 1R1NA 5EHMA 1A99A 4C0RA 4LZ8A 4F2OA 2VHAA 4H0WA 1WDNA 3FVGA 4F22A 5TPAA 1WODA 3V83A 4G4PA 1P1QA 3RPWA 5I59B 3FVKA 4MFIA 4YKKA 4JXIA 2QS1A 2Q88A 5J1DA 2DXRA 4ZS9A 2GH9A 4QFLA 1ZU0A 3MVWA 1MPCA 1BKAA 2XXWA 3TQWA 3OO6A 4QFPA 1Y20A 3E3KA 2Z8DA 3MZ9A 1M5FA 4ZECA 2Q9TA 3CVGA 1B5IA 1URSA 1DPPA 4IGTA 4YKPA 3R26A 3OD7A 3ILUB 2X7QA 1OLCA 2B65A 2OBGA 2V84A 3PUYE 4R6KA 3FUZA 1B7UA 4GFRA 5DVIA 3CSGA 4RPNA 2YPNA 5CM6A 5KCJA 5I59A 1N84A 1MY4A 2GRVA 3P7IA 4GD5A 2XX8A 4DIGA 4BDNA 1P1WA 2I0CA 3PV0E 3EHTA 3GBBA 3TTKA 4ZEDA 1LAGE 1FQCA 2O1MA 4LA9A 5AA2A 5I2NB 4FJPA 4PE5B 4PFTA 1POTA 3O9PA 2RC9A 1MQDA 2F34A 3KN3A 4G68A 3C36A 3M8UA 4M4GA 3K01A 2DSFA 2Q89A 4BLAA 4R6HA 5B70A 3IJXB 1MY0A 3OOAA 1MQHA 2D5WA 1LAXA 2QRYA 1JW1A 1LBBA 1B46A 1LAFE 1PB7A 3IOTA 3OSQA 4LUBA 3VLVA 2HZLA 2XXHA 4FORA 3SDFA 4WKMA 3WAEA 4U22A 4IO4A 4XKNA 4O3BA 2I6EA 2Z22A 3T9XB 4EXLA 4F3BA 1KWHA 5FHNA 5KCJB 1D9VA 4IO2A 5TU0A 1N0TA 4IO7A 1A8EA 4LQ5A 4OETA 2CZLA 2ZNUA 3HO7A 2XD3A 3OELA 1D4NA 1UQWA 3A3UA 5I2NA 1US4A 1ATGA 1OLAA 3KGCA 4OFJA 2V3QA 3VV5A 4KCDA 4BDOA 3CIJA 3B6TA 4UA8A 3E4RA 3N5LA 1A40A 1IEJA 2XXTA 1VFEA 4ZZAA 1XT8A 2DQVA 1ZMGA 4KYEA 3O2AA 3K6VA 4IY5A 2HCAA 3KJ7A 4ZEKA 2PX1A 2X7PA 3U72A 1Q1KA 1YTVA 4RK9A 5TPAB 3VXCA 3WAFA 3B6QA 3GBAA 2RCAA 3KOSA 1YCJA 3LSFB 3TKDA 3UN6A 4MLQA 5A5XA 2XD2A 4R2BA 4EDPA 1S9TA 3RT8A 4LQ2A 2YJPA 1OVBA 1H76A 2F7CA 1NH8A 2RC7A 3PMVA 1BTJA 3A09A 1FQBA 4H67A 1B32A 4NE4A 3H6UA 4GL8A 3S2VA 3UORA 5ICQA 3PGFA 1PB8A 3MUQA 3PUVE 2G93A 3KJTA 2ZXTA 4O3AA 4DXBA 3LBSA 4NF5A 1AMFA 4R74A 1L5TA 4GLIA 2DWIA 3IB1A 4YB5A 1FTMA 2OLBA 4OTEA 3DM0A 2P1SA 2DS9A 3EN3A 1B1HA 3H03A 5AA3A 1H3DA 1NNFA 3PUZE 3QSLA 1Y4TA 2Z23A 2R9JA 4RY1A 4X48A 4MLVA 3QXMA 1B40A 5A5XB 2NUVA 2GHBA 2HFBA 1PDAA 1JVYA 3S9NC 1FQFA 4RPOA 1BLFA 4H1XA 5L9MA 5AA1A 4GOTA 1B3EA 1QUKA 1SDXA 3RT6B 3V5AA 2QSXA 3FV1A 3TCFA 1MXXA 3S9EA 2FYIA 4G68B 1USYH 4U4SA 4NTLA 1MQIA 4NF4A 1MM7A 1ZBMA 4XKRA 1DOTA 3KFMA 3LSWA 2W7YA 3PD9A 4ZZEA 3W9WA 2IA4A 2V25A 2I49A 1EZOA 2QS3A 2UVJA 1IUDA 2ONSA 4K3FA 2OCUA 1HSLA 1D3KA 3TODA 3BFTA 3TFLA 3K6UA 4Q0CA 3KN8A 4TLLB 4R9GA 4WEPA 3K6XA 4F1YA 5AA4A 4F19A 2KLFA 3FATA 3QUJA 2NXOA 4Z0IA 1B58A 4GL0A 4HS7A 4OQOA 3GLBA 3TELA 5CMCA 1LLSA 5DYHA 1B5JA 2RC8A 2AIXA 4H6DA 4KI0E 1XVYA 1HSEA 2IEEA 3N94A 3LR1A 2E0SA 3M3LA 3G3IA 3IO4A 1AH5A 5ICTA 4JDFA 3D4GA 2Y7IA 1NNPA 4OHNA 5DVFA 1LB8A 3U1OA 4EF1A 2M8CA 3OEKA 5CMKA 1US5A 3UGWA 3V89B 4GXSB 4M1VA 5CBSA 3K02A 4KR5A 1RYOA 2A5SA 2F5XA 2XX9A 1I6BA 3CFZA 1XS5A 5AA4B 1II5A 5I56B 4X1BA 2UVIA 3DP4A 3UA8A 2F97A 3KZGA 5F1QA 1S7YA 3EHUA 4OESA 2CMOA 2OZZA 1TT1A 2HZKA 3FVOA 4GIZA 2HQ0A 2DE2A 1B0LA 4NF5B 4FATA 1RKMA 2XXUA 4ELRA 5CBRA 3S9LC 3TEPA 1OQHA 2THIA 3TTRA 1TFDA 1F9BA 1VR5A 3OSRA 2O7IA 2HEUA 4P11A 4HCWA 4NF6A 3LSXA 3MVYA 2Y7RA 3OMBA 3SETA 4XTCQ 3CSBA 2I0BA 1FCKA 1H45A 1VFDA 1ZKBA 2V3TA 1OIBA 1XVXA 4G8MA 4GQOA 4Q30B 3ZKKA 2PVUA 5I2KA 2Z8EA 5I56A 2XXYA 3KSJA 2VOZA 2VP1A 2Z8FA 3MVXA 4IO6A 3LC8A 4NF8A 1NL5A 4ZEBA 3SEWA 1FTJA 4F1VA 4PFWA 1IXHA 4TLMB 3A3CA 1IQ7A 4NF4B 3MP6A 1USYE 4JSDA 3T93B 3TZAA 3CR9A 1DTGA 2DXYA 2G29A 3HV1A 3IOUA 3H06B 4EUOA 4ZE9A 1QKAA 3GXAA 2DVCA 4I1DA 4LP2B 1UTBB 1IIWA 3IB2A 3IOWA 1OVTA 5AA2B 2H98A 3H3GA 1WVJA 1H44A 3VVDA 4EXKA 4N13A 1TWYA 4Z7EA 4OXVA 4UACA 5DVJA 1IITA 1P99A 1M5EA 4NWCA 5DT6A 4YB7A 3FV2A 1O7TA 3K1PA 1N3WA 3O66A 5K2YA 4ZEFA 4OZ9A 1QJMA 1IXCA 4RJZA 3I6VA 5L8DA 2XXRA 2A5TA 4KCCA 4DCYA 5KDTB 2E1SA 3G3GA 5IAIA 3M3FA 1LAHE 4QRZA 1VE4A 3FJ7A 4R73A 2NOOA 1GVCA 3VFJA 1MQJA 2ZYNA 4F1UA 4Q8RA 2FA7A 2H9BA 4QFKA 3VVEA 1R9QA 1UTBA 3RN8A 3IL1B 4LVQA 2X26A 4I62A 5DEXA 4ZE8A 3SEXA 3O6IA 2WKYA 5JK4A 4RA1A 3SEYA 1SI1A 2YLNA 3IOVA 1ZTYA 3RQTA 1M5DA 3IX1A 5FTHA 3OXNA 1POY1 3TYHA 1N3XA 2F36A 2OWTA 4IB2A 4HCYA 2DWAA 4ESXA 3K0VA 2ZNSA 3FGSA 3VXBA 1A55A 3H7MA 3ZSFA 1LFGA 1S50A 3CI8A 3R6UA 4RXLA 2Q8JA 2ABHA 1YAEA 3ZS6A 1Y3NA 5FTIA 3BKIB 4F3SA 4NF6B 3E9XA 1MY1A 1LCTA 1LBCA 1MPDA 2UVGA 4ZEIA 1D9YA 2H5YA 5DEXB 3BFUA 5I2KB 4GVOA 5H8QB 3HHGA 1DPEA 5FHOA 4L17A 4NF8B 4JB7A 5EYFA 4EQ9A 1TXFA 3G3FA 2DWJA 3H4ZA 3DELB 4KYSA 1Y9UA 1A7LA 4U1OA 2DP8A 4XXUA 4AQ4A 1JNFA 1JEUA 3CG3A 3KEIA 3QYTA 4DDDA 1GV8A 1FTKA 5F7VA 3OO8A 2LAOA 2O1LA 2PT1A 4ELOA 1JVXA 1EZPA 3B6WA 1OQGA 2GFEA 4P0GA 3TCGA 4QSCA 3VDFA 1MPBA 1NNKA 3ODBA 3AXFA 3RNNA 2HXWA 3DP8A 4KD5A 4QSEA 1RYXA 2QPQA 4OEUA 1SW2A 1O63A 3C32A 3K00A 4R6YA 2F6PA 4FEBA 4U4XA 3C31A 3KOTA 3H6WA 5H8SA 3U93A 2R71A 2RF1A 1FQEA 4AB5A 4DE8A 3E13X 1P1OA 3TTLA 3U8QA 2F35A 4HW8A 2A5TB 4ELPA 4F31B 5KDTA 2XXPA 5JEIA 2F78A 4YAHX 5ISUA 1I6AA 3MZBA 1B05A 3CG1A 4U21A 2VD2A 3RTFB 1QVSA 4POXA 1PEBA 2B3FA 1Y3QA 4N6PA 3FASA 1B51A 3FVNA 2ZNTA 1R9LA 3FXQA 3HPIA 4WXJA 3G7WA 3K6WA 3MBPA 3CFXA 1SYHA 2BJJX 3TDJA 1SVXB 3C4MA 3K2DA 3MQ9A 4RNSA 4YICA 3SERA 3T96B 1EH3A 1NMUA 1SW5A 2DVZA 3IB0A 5ITOA 2PYYA 3PMWA 1FTOA 4QF9A 3FZVA 1N7XA 5FHMA 3G3JA 4AB6A 2XXXA 3OEMA 3FJMA 1MXYA 3PD8A 4GRKA 4N07A 4YMBA 3IORA 4OYVA 4OWDA 3N6UA 2UYFA 5H8NB 4YKJA 3HHFA 2HAUA 2QS4A 2UXAA 1YPNA 3UK4A 2AL4A 4I9DA 4NEDA 3Q29A 1LGBC 2AL5A 4NMYA 3FXUA 3TPAA 3VLWA 3QAXA 4OENA 5H8QA 1M5CA 2PMSA 3IR1A 3KSXA 3PMXA 3USDA 5L9SA 4ISUA 5I57B 5HM4B 1GR2A 3PPOA 3PUXE 3Q25A 4LATA 4QHQA 1LCFA 4JWXA 1SW4A 2OK2A 2P2AA 3MWBA 2Y84A 3O6GA 4OEVA 4OERA 2ZYMA 4TQUQ 5CMMA 1PC3A 5HBCA 2ALUA 1JQFA 4R72A 3Q26A 4ELQA 1PB9A 4ND9A 5H8NA 3ONMA 3C35A 4BDLA 4YKIA 1MY3A 2I3VA 3DLNA 5DTBA 1QKBA 1FQAA 1P1UA 2D21A 4YZZA 4H5GA 1AIVA 4GXAA 1R6ZA 3ZKLA 1UTHA 4BDQA 2I58A 3I3VA 1QUJA 4BDRA 1XC1A 2Y7WA 3QIMA 5L9OA 2O68A 1P1NA 3ECRA 1XOCA 3Q27A 3TTNA 4H65A 3FXRA 4WEDA 1Y3PA 4DZ1A 4EQBA 1B3FA 1ZIUA 3SKPA 3VVFA 1EZ9A 1GGGA 3MJNA 1B6HA 5ITPA 2HAVA 2Q2AA 4JBZA 1MDQA 4JWOA 1A54A 1IZ1A 3CFLA 3C9HA 1HSJA 4THIA 3RLFE 3W15C 2ZYKA 3THIA 4OMBA 1B9JA 4IO3A 4Q5TA 4F3GA 1I6QA 2H4IA 3BBRA 4R2FA 1IXGA 1Y1ZA 2QMWA 1OMPA 3LUYA 2H99A 4G68C 4PFUA 3IK6B 4GWOA 1FTLA 4QFNA 4XKQA 5TP9B 3V8XB 1B2HA 4MBPA 5H8FA 4H5FA 3N26A 4FEDA 1Y1MA 4YB6A 1SBPA 1B4HA 2O69A 3SESA 3U92A 4DLDA 1LB9A 1FW0A 4OVJA 3MC2A 4EF2A 5H8HA 4F2QA 1IXIA 1N76A 3C33A 2DWHA 3M3KA 4G2ZA 4U23A 2OJTA 4XKPA 4KPTA 3T9HB 4ECFA 1XHYA 3PPRA 4NWDA 4R9FA 3FIRA 3HCQA 1SI0A 3JYRA 3MVZA 3T9UA 1JETA 1DMBA 2ESNA 2F7AA 3C34A 4POWA 4TOZA 1Q35A 4QSDA 1MXWA 2RINA 1ANFA 1B0HA 2OWSA 4H8IA 4JWYA 3UP9A 5AA2D 1MG1A 1M5BA 3EQ1A 4LZ5A 1SYIA 5TP9A 1SW1A 4C1UA 5H8FB 1MDP1 1PBQA 3MAMA 4DXUA 5I58A 3O97A 1B7HA 3N6TA 4O3CA 1JW4A 3T9VA 5I57A 3L6GA 4H8JA 1JW5A 2XX7A 1B52A 2DOJA 3K4UA 3MP1A 5H8HB 5CC2A 3RUMA 1QW0A 4PP0A
chains in the Genus database with same CATH superfamily
5B7DA 2Y7PA 3O28A 4RYAA 4IR8A 2XXIA 1UTHB 1H43A 1CE2A 4JSOA 3CRBA 1IMFA 3H6VA 2O51A 5I3SA 1MM6A 3KG2A 3BIGA 4E0XA 2XA5A 4PFYA 1MRPA 3LV0A 4BDMA 2ZMBA 1A8FA 1NFTA 3RYDA 4HE2A 1B3HA 1IMBA 1LSTA 1B1XA 2D3IA 4GF8A 3OO9A 1TFAA 3LSLA 4MCOA 1ZLQA 2ONRA 4PC9A 3R7XA 3JZJA 2V3UA 3IAZA 3TQLA 3MZ1A 3RY3A 1MS7A 4ONYA 3G3HA 2RCBA 2XXVA 4ZDMA 3PU5A 5JTYA 5KZTA 1NH7A 3L6HA 1I69A 3OO7A 1Z7ME 2F7BA 4GWYA 2Y5KA 4G8HA 4FECA 5M2VA 4MIJA 2F3DA 4E0WA 3OENA 5BUUA 2F8DA 4O7MA 2QL3A 2FNCA 5EHMA 4LZ8A 3V83A 4H0WA 1P1QA 1DBZA 4QFLA 1MPCA 3TQWA 2Q9TA 4PBHA 3R26A 3OD7A 3ILUB 2V84A 2OBGA 5DVIA 1N84A 2GRVA 2XX8A 1P1WA 2I0CA 1FQCA 4LA9A 1POTA 4G68A 3KN3A 3M8UA 3K01A 4R6HA 3OOAA 2D5WA 2QRYA 4LUBA 1JW1A 1LBBA 1B46A 1LAFE 4IO4A 4XKNA 4F3BA 4EXLA 5KCJB 4NX1A 4IO7A 2ZZWA 1FBDA 1US4A 4OFJA 3VV5A 4KCDA 1A40A 1XT8A 2HCAA 2X7PA 1D9QA 1YTVA 4RK9A 3WAFA 3UN6A 1NV0A 2XD2A 3RT8A 2YJPA 1FBFA 4H67A 1BTJA 4NE4A 1FQBA 5LTCA 3PGFA 1PB8A 4NF5A 4R74A 4GLIA 2DWIA 1FTMA 2OLBA 2P1SA 2Z23A 4RY1A 2GHBA 1PDAA 2DDKA 4XEQA 3ZKLA 1B3EA 2QSXA 2L5VA 1USYH 4X8RA 2QS3A 2ONSA 4K3FA 1HSLA 4OVQA 3TFLA 3K6UA 4TLLB 4R9GA 3K6XA 3FATA 3QUJA 5EQ8A 5DYHA 4KI0E 5DVFA 3U1OA 2M8CA 3OEKA 5CMKA 3V89B 5CBSA 3K02A 4N8GA 2XX9A 1FBPA 3EHUA 2CMOA 2HZKA 3FVOA 3CHGA 1B0LA 1OQHA 4NQ8A 1TFDA 4P11A 2HEUA 4HCWA 4G61A 3LSXA 3MVYA 2Y7RA 2I0BA 1OIBA 4GQOA 3ZKKA 1NUXA 2Z8EA 3KSJA 1NL5A 4ZEBA 3IFAA 1DTGA 2DXYA 3H06B 4ZE9A 4OANA 3GXAA 4I1DA 2H98A 4Z7EA 4OXVA 5DVJA 1IITA 4YB7A 3K1PA 4OZ9A 1IXCA 2A5TA 2E1SA 5IAIA 2KQZA 2QFLA 4QRZA 1GVCA 1MQJA 2FA7A 2H9BA 5DEXA 2WBBA 4RA1A 2YLNA 3RQTA 3OXNA 3TYHA 4IB2A 4HCYA 2DWAA 3K0VA 4RXLA 4HE1A 5IZZA 3BKIB 4NF6B 1MY1A 1MPDA 2Q74A 1DPEA 4NF8B 1LBXA 5EYFA 3G3FA 2DWJA 4EF1A 4XXUA 1JEUA 1FTKA 2CZKA 3RNNA 3E79A 4NGUA 3KBZA 4GX6A 2QPQA 4JVDA 5IZ3B 4FEBA 3H6WA 4AB5A 4NHBA 4YAHX 5ISUA 1Y3QA 3FASA 3FXQA 3HPIA 2CZHA 3K6WA 3MBPA 3C4MA 1FBGA 3SERA 2DVZA 5ITOA 2PYYA 4AB6A 5ET7A 4PFBA 4YMBA 3N6UA 2UYFA 2HAUA 2Q8MA 3UK4A 3Q29A 3QAXA 4OENA 1M5CA 3RPLB 1GR2A 3MWBA 3O6GA 1CNQA 4ND9A 1MY3A 2I3VA 5DTBA 1AIVA 4YZZA 4GXAA 1UTHA 1QUJA 3QIMA 2O68A 1P1NA 2XWKA 4MNIA 4H65A 4WEDA 1Y3PA 4JWOA 1MDQA 1IZ1A 3CFLA 3W15C 2ZYKA 3THIA 4OMBA 4F3GA 3IFCA 3BBRA 3ROJA 2CEXA 2QMWA 4XKQA 1FTLA 1Y1MA 3SESA 4DLDA 1LB9A 3B8BA 2DWHA 4ECFA 2OJTA 3PPRA 4NWDA 3FIRA 3JYRA 3T9UA 1DMBA 4TOZA 1MXWA 4H8IA 1SYIA 1G0IA 1PBQA 4GX4A 1B7HA 4H8JA 3MP1A 3K4UA 2DOJA 4I3YA 4IGRA 2PT2A 3VE1B 3MPKA 3QK6A 1BP5A 4U2RA 1AL3A 1J1NA 4O8MA 4NF0A 2NWJA 4PQJA 1MXUA 2WEFA 3KBRA 3MW0A 4IO5A 1O64A 1MY2A 4LZ7A 2V93A 3D4CA 2O6AA 2WX9A 4PBQA 1NUZA 2O7UA 4FAJA 2I48A 4HTGA 4X9TA 1B3GA 1MH4A 3K1MA 5I7IA 4MF3A 1FJ6A 4F29A 2Y7KA 1URDA 1EU8A 1LFIA 5DW8A 4FE8A 3HSTA 3W9VA 5JTYB 5I58B 4LONB 3I5OA 1FPBA 2REGA 1B5HA 4DCXA 3EHSA 3JV9A 3TCHA 3ISPA 1FBCA 1BIYA 4FIMA 2I4CA 4JVIA 2HXRA 3FD3A 4F3PA 3IJOB 2NVUB 2F6GA 3K1NA 1NV7A 5K2XA 2R6GE 2WYKA 1NKXA 4PETA 4MAGA 2JJKA 2QVRA 3FBPA 4F2OA 4F22A 5I59B 1FPJA 2QS1A 2Q88A 2DXRA 4ZS9A 2XXWA 1BKAA 1Y20A 3QMFA 3CVGA 1URSA 4IGTA 3PUYE 1OLCA 3CSGA 2YPNA 1LBYA 5I59A 2XWVA 1MY4A 4N81A 3PV0E 3GBBA 4PTKA 4ZEDA 1LAGE 2Q89A 1MQHA 1LAXA 1PB7A 2XXHA 5EQ7A 4WKMA 4O3BA 3T9XB 1KWHA 4PAFA 4IO2A 5TU0A 1N0TA 2CZLA 2XD3A 3OELA 3KGCA 5LDZA 3T0JA 1VFEA 1ZMGA 1Q1KA 5T3JA 3KOSA 2RCAA 3LSFB 3TKDA 5A5XA 4MLQA 4AS4A 4R2BA 4LQ2A 1OVBA 1NH8A 3PMVA 3S2VA 3UORA 3H6UA 4GL8A 3LBSA 3IB1A 2XWOA 4OTEA 2DS9A 1B1HA 3H03A 1Y4TA 2QVVA 2R9JA 3QXMA 1FBEA 3LUZA 3S9NC 4PDHA 4H1XA 5AA1A 5L9MA 4GOTA 3TCFA 3S9EA 4GBWA 2FYIA 4MEVA 4XFEA 4U4SA 1MQIA 4NF4A 1MM7A 3KFMA 2W7YA 4ZZEA 3PTYA 5J16A 5EQAA 1K9YA 1D3KA 3TODA 3BFTA 4WEPA 5AA4A 2NXOA 4HS7A 4OQOA 3GLBA 3RTWB 4OVTA 2RC8A 2AIXA 1XVYA 1HSEA 3N94A 3IO4A 1AH5A 2FVZA 1NV4A 2VPOA 2Y7IA 4GXSB 4M1VA 5AA4B 3CFZA 5I56B 5F1QA 1S7YA 1INPA 1TT1A 2HQ0A 2HPGA 1RKMA 4ELRA 1VR5A 2QVUA 4NF6A 3OMBA 3SETA 2V3TA 1ZKBA 1XVXA 2XWIA 2Z8FA 3MVXA 4PAKA 3SEWA 1FTJA 4PFWA 1IXHA 4TLMB 3A3CA 4PDDA 4GX3A 1H44A 4N4UA 1IMCA 1P99A 4NWCA 1O7TA 1N3WA 4ZEFA 5IGAA 5L8DA 2XXRA 5KDTB 1LAHE 5LOMA 4F1UA 2NOOA 4Q8RA 3RN8A 5JK4A 1SI1A 1POY1 2F36A 4O94A 4X04A 4N6DA 1A55A 3H7MA 3CI8A 4OVRA 3ZS6A 1NI9A 2B4MA 4F3SA 3E9XA 1LBCA 2UVGA 2H5YA 4NN3A 3HHGA 5FHOA 1FPLA 2P3NA 1TXFA 1IMEA 3DELB 1Y9UA 4U1OA 2DP8A 3S9MC 3CG3A 3QYTA 3KEIA 2LAOA 1MPBA 1NNKA 3AXFA 4KD5A 4OEUA 4U4XA 4PFRA 3E13X 1P1OA 3TTLA 2B4LA 4F31B 4ELPA 5KDTA 4P1EA 5JEIA 1I6AA 1B05A 3CG1A 1QVSA 3FVNA 4WXJA 3G7WA 4PGNA 1K9ZA 3MQ9A 4RNSA 1NMUA 3PMWA 4QF9A 4OA4A 2FHYA 4GRKA 3OEMA 1MXYA 4N07A 2UXAA 4I9DA 4NEDA 4NMYA 3FXUA 4P8BA 3PMXA 4ISUA 4LATA 2OX3A 4QHQA 1LCFA 5ET5A 1SW4A 2P2AA 4OERA 4OEVA 2ZYMA 1FPKA 3ECRA 3HFUA 4EQBA 1B3FA 3VVFA 1EZ9A 5ITPA 3RLFE 2H4IA 2ZZXA 3LUYA 1OMPA 4G68C 3V8XB 4GWOA 4H5FA 1SBPA 3KC1A 1FW0A 3MC2A 3M3KA 4G2ZA 4XKPA 4KXPA 4P3LA 2F7AA 2ESNA 4POWA 4JVCA 4QSDA 1M5BA 4LZ5A 1SW1A 5H8FB 1NV5A 3MAMA 3O97A 3N6TA 3T9VA 5I57A 1B52A 2V4CA 5H8HB 3T22A 3ILTB 3PPQA 4XF5A 1UIUA 4OFLA 4XIGQ 3UIFA 1URGA 2DYXA 2I3WA 3TAJA 4U1ZA 1NNTA 4KHZE 1NUYA 1N04A 3B7DA 1DSNA 3PPPA 2H25A 3SEUA 2I4BA 5BWJA 4QFOA 4F39A 3MP8A 3RGYA 1QULA 1MXVA 1CB6A 1PBPA 3O29A 5HPQA 4X1DA 3EPEA 5ELVA 2AYSA 3H6TA 4N91A 2XXQA 5CRYA 2ONKE 2UVHA 4N15A 3S4UA 5EQ9A 1FQDA 3PUWE 1GTKA 2ZYOA 3Q28A 2RKMA 1AOVA 1NV3A 4ESWA 4G8NA 4O7IA 2P0SA 1T0KA 4C0RA 2QJEA 1JEVA 1B3LA 1Z7NE 5EYHA 4H46A 3U94A 2QMXA 4YU0A 2XHDA 2O84X 1MXZA 4UABA 2DE3A 3G3KA 4PF6A 1A99A 2VHAA 1WDNA 5TPAA 4G4PA 3FVKA 4MFIA 4JXIA 3E3KA 1Q9DA 4GWXA 1B5IA 1DPPA 2B65A 4R6KA 4GFRA 4RPNA 5CM6A 5KCJA 2PFZA 4GD5A 3EHTA 5A5LA 4FJPA 2RC9A 1MQDA 3C36A 5B70A 4BLAA 4KYDA 3OSQA 3IOTA 2HZLA 4FORA 3WAEA 1D9VA 4OETA 3HO7A 1UQWA 1ATGA 1OLAA 2BJIA 4BDOA 3E4RA 2P3VA 4ZZAA 4KYEA 3O2AA 4IY5A 3U72A 4MNCA 1BK4A 3GBAA 1YCJA 2F7CA 5ICQA 4H45A 2G93A 2ZXTA 1EYKA 4DXBA 1AMFA 1L5TA 4YB5A 3DM0A 5AA3A 1H3DA 1IMDA 4MLVA 5ESYA 2HFBA 2R8TA 1FQFA 3E78A 1BLFA 1SDXA 1QUKA 3V5AA 4AS5A 1MXXA 4G68B 5FBPA 4NTLA 1ZBMA 4XKRA 1DOTA 2IA4A 2I49A 1EZOA 1KZ8A 4Q0CA 3KN8A 4F1YA 4QXDA 4F19A 2KLFA 4Z0IA 1LLSA 2IEEA 5IM2A 5ICTA 4JDFA 3D4GA 1NNPA 1RYOA 2A5SA 2F5XA 1I6BA 1II5A 4X1BA 3DP4A 3KZGA 4NF5B 5CBRA 2XXUA 3S9LC 4FBPA 3TEPA 2THIA 3TTRA 2KR0A 4XTCQ 3CSBA 1H45A 4Q30B 5I2KA 5I56A 2XXYA 2VOZA 4IO6A 4NF8A 3LC8A 4F1VA 2HHMA 3MP6A 1USYE 4JSDA 1LBWA 3CR9A 2G29A 3HV1A 3IOUA 1QKAA 1IIWA 3IB2A 4DI4B 1WVJA 1VDWA 4EXKA 1TWYA 4UACA 4RJZA 3SZPA 4KCCA 4DCYA 3G3GA 1RDXA 3M3FA 3VFJA 1VE4A 2ZYNA 1FPFA 3T1BA 1UTBA 3IL1B 2X26A 3O6IA 3SEYA 1ZTYA 1M5DA 5FTHA 2PFYA 2ZNSA 3NOHA 1LFGA 1S50A 2Q8JA 3R6UA 1YAEA 1Y3NA 3A29A 1LCTA 2PCRA 3BFUA 4GVOA 5H8QB 4JB7A 3H4ZA 4KYSA 4MHFA 1GV8A 1FPGA 3OO8A 2O1LA 2PT1A 4ELOA 1EZPA 4P0GA 1OQGA 2GFEA 4QSCA 3ODBA 2HXWA 5ET6A 1RYXA 1O63A 3C32A 3K00A 3KOTA 3U93A 2R71A 4DE8A 3U8QA 2A5TB 2XXPA 3MZBA 4U21A 3RTFB 2WYPA 1PEBA 2ZNTA 5IZ1A 4YICA 3T96B 4AQ4A 3IB0A 1KA0A 3FZVA 3G3JA 3PD8A 4OYVA 4OWDA 5H8NB 3HHFA 4MNPA 4NAPA 1DCUA 1LGBC 3TPAA 4GWSA 3FXBA 3PUXE 1EYJA 3Q25A 4JWXA 5CMMA 5HBCA 1LBVA 2ALUA 1JQFA 3Q26A 1PB9A 5H8NA 3ONMA 4BDLA 3TELA 3U65A 1FQAA 1P1UA 2D21A 1R6ZA 2I58A 3BIHA 4BDRA 2Y7WA 1YXIA 3Q27A 1XOCA 5IZ3A 4P1LA 1ZIUA 1GGGA 3C9HA 1HSJA 4THIA 4IO3A 4Q5TA 1I6QA 1RDZA 1Y1ZA 4PFUA 2H99A 3IK6B 4PCDA 5H8FA 4MBPA 4YB6A 4OVJA 4EF2A 5H8HA 1IXIA 3C33A 4KPTA 1XHYA 3HCQA 1SI0A 3MVZA 1JETA 2RINA 4JWYA 2OWSA 3UP9A 1MG1A 2F3BA 1MDP1 4DXUA 3D1RA 5I58A 3RPLA 2FIEA 2XX7A 5CC2A 1QW0A 3KN7A 4YMAA 5F24A 4C1TA 3TTMA 1YZ0A 4KQPA 4KFQA 1QUIA 1UIVA 2WBDA 3TUSA 5ET8A 4PF8A 3HN0A 1B4ZA 3TMGA 2PBWA 2B3BA 2Y5LA 3PPNA 2ANJA 3QUFA 4F18A 4G77A 4MH5A 4P47A 2DE4A 2VGQA 2QS2A 4PFIA 4DXCA 4EQ7A 3GZGA 3FJGA 5IKBA 4DI3D 2VT5A 1Y4CA 5I84A 4P0IA 3T66A 3DP6A 1LFHA 3VLUA 3F11A 3O6HA 3B50A 2UYEA 4RK2A 2VPNA 3IO6A 3MPLA 2GHAA 1SQYA 1ELJA 1MQGA 1N7WA 5AE4A 2FIXA 2VD3A 1MH3A 5CI5A 1B7ZA 5EHSA 4I8CA 3UGWA 1AWBA 3EF7A 4OFOA 2Q2CA 1YYZA 4IY6A 3SEVA 2REJA 5CMBA 1SD3A 1VSOA 1ZJLA 1DTZA 4R75A 1R1NA 3FVGA 1WODA 1NV2A 3RPWA 4N6KA 4YKKA 4I3EA 4N17A 5J1DA 2GH9A 1ZU0A 3EKIA 3MVWA 3OO6A 4QFPA 2Z8DA 3MZ9A 1M5FA 4OVSA 4ZECA 4YKPA 2X7QA 3FUZA 1B7UA 3P7IA 4DIGA 4BDNA 3TTKA 2O1MA 3MSTA 5AA2A 5I2NB 4PFTA 4PE5B 2XXKA 3O9PA 2F34A 4M4GA 2DSFA 3IJXB 1MY0A 3VLVA 3SDFA 4PE3A 4U22A 2I6EA 2Z22A 5FHNA 4LQ5A 1A8EA 2GQ1A 2ZNUA 1D4NA 3A3UA 5I2NA 2V3QA 3CIJA 3B6TA 4UA8A 3N5LA 1IEJA 2XXTA 2DQVA 3K6VA 3KJ7A 4ZEKA 2PX1A 3VXCA 5TPAB 1FRPA 3B6QA 1IMAA 4EDPA 1S9TA 1H76A 2RC7A 3A09A 1B32A 1SPIA 3PUVE 3MUQA 3KJTA 4O3AA 1LBZA 4GWZA 3EN3A 3QSLA 1NNFA 3PUZE 4X48A 4HE0A 1B40A 5A5XB 2NUVA 1JVYA 4NG7A 4RPOA 5AA2B 3RT6B 3FV1A 3LSWA 3PD9A 3W9WA 2V25A 2UVJA 1IUDA 2OCUA 1B58A 4N8YA 4GL0A 4GWWA 5CMCA 1B5JA 4H6DA 3LR1A 2E0SA 3M3LA 3G3IA 4OHNA 1LB8A 1US5A 4KR5A 1XS5A 1NUWA 3KC0A 2UVIA 1NV1A 3UA8A 2F97A 4OESA 2OZZA 4GIZA 1NV6A 2DE2A 4FATA 1FTAA 1F9BA 3OSRA 2O7IA 4MMPA 1LEVA 4GWUA 1FCKA 1VFDA 4G8MA 1EYIA 2PVUA 2VP1A 4HXVA 1IQ7A 4NF4B 1FPIA 4MJOA 3T93B 3TZAA 4EUOA 2DVCA 4LP2B 1UTBB 3IOWA 1OVTA 3H3GA 3VVDA 4N13A 1KA1A 1M5EA 1G0HA 5DT6A 3FV2A 3O66A 2FBPA 5K2YA 1QJMA 4LN5A 3I6VA 4OVPA 5I5PA 3FJ7A 4R73A 4QFKA 3VVEA 1R9QA 3MYUA 4LVQA 4I62A 4ZE8A 3SEXA 1FJ9A 2WKYA 3IOVA 3IX1A 1N3XA 2OWTA 4ESXA 4MX6A 3FGSA 3VXBA 3ZSFA 2ABHA 5FTIA 4ZEIA 1D9YA 5DEXB 4I40A 5I2KB 4L17A 4EQ9A 1RDYA 1A7LA 1JNFA 4DDDA 5F7VA 1JVXA 2CZIA 1FSAA 3B6WA 3TCGA 3VDFA 3DP8A 4QSEA 1SW2A 4R6YA 2F6PA 3C31A 5H8SA 2RF1A 1FQEA 4HW8A 2F35A 2F78A 2VD2A 4POXA 2B3FA 4N6PA 1B51A 1R9LA 3CFXA 1SYHA 2BJJX 3TDJA 1SVXB 3K2DA 2CEYA 1EH3A 1SW5A 1FTOA 1N7XA 5FHMA 2OWZA 2XXXA 3FJMA 1FBHA 2ZZVA 4GBVA 3IORA 4YKJA 2QS4A 1YPNA 2AL4A 1QGXA 5EYGA 3VLWA 2AL5A 5H8QA 3USDA 4P56A 2PMSA 1XI6A 3IR1A 3KSXA 5L9SA 5I57B 5HM4B 3PPOA 2OK2A 4TQUQ 2Y84A 1DK4A 1PC3A 1FPEA 1JP4A 4R72A 4ELQA 3C35A 4YKIA 3DLNA 1QKBA 4H5GA 4P9KA 4BDQA 2MKZA 3I3VA 1XC1A 5L9OA 3TTNA 3FXRA 4DZ1A 3SKPA 3MJNA 1B6HA 2HAVA 2Q2AA 4JBZA 1A54A 3GYYA 1B9JA 4R2FA 1IXGA 5TP9B 4QFNA 1FPDA 1B2HA 4QBAA 3N26A 4FEDA 4PAIA 1B4HA 2O69A 3U92A 4F2QA 1N76A 4U23A 3T9HB 4PGPA 4R9FA 3C34A 1Q35A 1ANFA 1B0HA 5AA2D 3EQ1A 5TP9A 4C1UA 4O3CA 1JW4A 3L6GA 1JW5A 3RUMA 4PP0A
chains in the Genus database with same CATH topology
3KN7A 4YMAA 4IGRA 2PT2A 3T22A 5B7DA 3ILTB 3PPQA 1UIUA 3VE1B 3TTMA 4C1TA 4OFLA 3MPKA 2Y7PA 3O28A 3QK6A 4KQPA 4RYAA 1BP5A 4U2RA 4KFQA 1QUIA 1AL3A 1J1NA 1URGA 4XIGQ 3UIFA 2DYXA 2I3WA 2NWJA 1UIVA 2XXIA 1UTHB 3TAJA 4U1ZA 1NNTA 3RTWB 4KHZE 1H43A 1CE2A 4JSOA 4PQJA 1N04A 3CRBA 3TUSA 3B7DA 3H6VA 1MXUA 2O51A 3HN0A 3KBRA 1B4ZA 1DSNA 1MM6A 3KG2A 3TMGA 3PPPA 3MW0A 4E0XA 2H25A 4IO5A 1O64A 2B3BA 2PBWA 3SEUA 3PPNA 1MY2A 2ANJA 3QUFA 4F18A 4LZ7A 2I4BA 2V93A 5BWJA 4QFOA 4G77A 4MH5A 4PFYA 1MRPA 4F39A 3D4CA 2O6AA 3MP8A 2DE4A 2VGQA 2QS2A 4DXCA 3RGYA 1QULA 1MXVA 4BDMA 1CB6A 1PBPA 2O7UA 2ZMBA 1A8FA 3O29A 1NFTA 4EQ7A 4X1DA 4FAJA 2I48A 3EPEA 4HTGA 4X9TA 5HPQA 5ELVA 1B3GA 1MH4A 3K1MA 5LOMA 4MF3A 2AYSA 3GZGA 3H6TA 3FJGA 5IKBA 1B3HA 2Y7KA 4F29A 1URDA 1EU8A 1LFIA 1LSTA 2XXQA 1B1XA 2D3IA 4FE8A 5CRYA 1Y4CA 2ONKE 2UVHA 4GF8A 5I84A 4P0IA 3T66A 3DP6A 3HSTA 5JTYB 3VLUA 3F11A 3O6HA 3W9VA 1LFHA 5I58B 4LONB 3OO9A 1TFAA 3I5OA 2UYEA 3LSLA 4RK2A 3S4UA 2REGA 1FQDA 3IO6A 1ZLQA 2ONRA 3MPLA 2GHAA 3PUWE 1SQYA 3R7XA 1B5HA 1ELJA 3JZJA 1GTKA 2ZYOA 4DCXA 3S9MC 3EHSA 3JV9A 3Q28A 3TCHA 1MQGA 2RKMA 2V3UA 1BIYA 1N7WA 3IAZA 4FIMA 3TQLA 1AOVA 5AE4A 3MZ1A 3RY3A 1MS7A 4G8NA 4ONYA 3G3HA 4ESWA 2RCBA 2I4CA 2XXVA 4ZDMA 2VD3A 1MH3A 3PU5A 5CI5A 2P0SA 5JTYA 5KZTA 1NH7A 3FD3A 3L6HA 4F3PA 1B7ZA 1I69A 3IJOB 5EHSA 1T0KA 3OO7A 2NVUB 2F6GA 1Z7ME 1JEVA 2F7BA 1B3LA 1Z7NE 2QJEA 3EF7A 3K1NA 4I8CA 4OFOA 4G8HA 4FECA 2Q2CA 3U94A 5K2XA 4IY6A 5M2VA 2R6GE 2QMXA 1NKXA 4YU0A 2REJA 3SEVA 5CMBA 4KYDA 4E0WA 4PETA 2XHDA 1SD3A 2O84X 1MXZA 3OENA 1VSOA 1ZJLA 2DE3A 5BUUA 2F8DA 3G3KA 1DTZA 4R75A 2QL3A 2FNCA 1R1NA 5EHMA 1A99A 4C0RA 4LZ8A 4F2OA 2VHAA 4H0WA 1WDNA 3FVGA 4F22A 5TPAA 1WODA 3V83A 4G4PA 1P1QA 3RPWA 5I59B 3FVKA 4MFIA 4YKKA 4JXIA 2QS1A 2Q88A 5J1DA 2DXRA 4ZS9A 2GH9A 4QFLA 1ZU0A 3MVWA 1MPCA 1BKAA 2XXWA 3TQWA 3OO6A 4QFPA 1Y20A 3E3KA 2Z8DA 3MZ9A 1M5FA 4ZECA 2Q9TA 3CVGA 1B5IA 1URSA 1DPPA 4IGTA 4YKPA 3R26A 3OD7A 3ILUB 2X7QA 1OLCA 2B65A 2OBGA 2V84A 3PUYE 4R6KA 3FUZA 1B7UA 4GFRA 5DVIA 3CSGA 4RPNA 2YPNA 5CM6A 5KCJA 5I59A 1N84A 1MY4A 2GRVA 3P7IA 4GD5A 2XX8A 4DIGA 4BDNA 1P1WA 2I0CA 3PV0E 3EHTA 3GBBA 3TTKA 4ZEDA 1LAGE 1FQCA 2O1MA 4LA9A 5AA2A 5I2NB 4FJPA 4PE5B 4PFTA 1POTA 3O9PA 2RC9A 1MQDA 2F34A 3KN3A 4G68A 3C36A 3M8UA 4M4GA 3K01A 2DSFA 2Q89A 4BLAA 4R6HA 5B70A 3IJXB 1MY0A 3OOAA 1MQHA 2D5WA 1LAXA 2QRYA 1JW1A 1LBBA 1B46A 1LAFE 1PB7A 3IOTA 3OSQA 4LUBA 3VLVA 2HZLA 2XXHA 4FORA 3SDFA 4WKMA 3WAEA 4U22A 4IO4A 4XKNA 4O3BA 2I6EA 2Z22A 3T9XB 4EXLA 4F3BA 1KWHA 5FHNA 5KCJB 1D9VA 4IO2A 5TU0A 1N0TA 4IO7A 1A8EA 4LQ5A 4OETA 2CZLA 2ZNUA 3HO7A 2XD3A 3OELA 1D4NA 1UQWA 3A3UA 5I2NA 1US4A 1ATGA 1OLAA 3KGCA 4OFJA 2V3QA 3VV5A 4KCDA 4BDOA 3CIJA 3B6TA 4UA8A 3E4RA 3N5LA 1A40A 1IEJA 2XXTA 1VFEA 4ZZAA 1XT8A 2DQVA 1ZMGA 4KYEA 3O2AA 3K6VA 4IY5A 2HCAA 3KJ7A 4ZEKA 2PX1A 2X7PA 3U72A 1Q1KA 1YTVA 4RK9A 5TPAB 3VXCA 3WAFA 3B6QA 3GBAA 2RCAA 3KOSA 1YCJA 3LSFB 3TKDA 3UN6A 4MLQA 5A5XA 2XD2A 4R2BA 4EDPA 1S9TA 3RT8A 4LQ2A 2YJPA 1OVBA 1H76A 2F7CA 1NH8A 2RC7A 3PMVA 1BTJA 3A09A 1FQBA 4H67A 1B32A 4NE4A 3H6UA 4GL8A 3S2VA 3UORA 5ICQA 3PGFA 1PB8A 3MUQA 3PUVE 2G93A 3KJTA 2ZXTA 4O3AA 4DXBA 3LBSA 4NF5A 1AMFA 4R74A 1L5TA 4GLIA 2DWIA 3IB1A 4YB5A 1FTMA 2OLBA 4OTEA 3DM0A 2P1SA 2DS9A 3EN3A 1B1HA 3H03A 5AA3A 1H3DA 1NNFA 3PUZE 3QSLA 1Y4TA 2Z23A 2R9JA 4RY1A 4X48A 4MLVA 3QXMA 1B40A 5A5XB 2NUVA 2GHBA 2HFBA 1PDAA 1JVYA 3S9NC 1FQFA 4RPOA 1BLFA 4H1XA 5L9MA 5AA1A 4GOTA 1B3EA 1QUKA 1SDXA 3RT6B 3V5AA 2QSXA 3FV1A 3TCFA 1MXXA 3S9EA 2FYIA 4G68B 1USYH 4U4SA 4NTLA 1MQIA 4NF4A 1MM7A 1ZBMA 4XKRA 1DOTA 3KFMA 3LSWA 2W7YA 3PD9A 4ZZEA 3W9WA 2IA4A 2V25A 2I49A 1EZOA 2QS3A 2UVJA 1IUDA 2ONSA 4K3FA 2OCUA 1HSLA 1D3KA 3TODA 3BFTA 3TFLA 3K6UA 4Q0CA 3KN8A 4TLLB 4R9GA 4WEPA 3K6XA 4F1YA 5AA4A 4F19A 2KLFA 3FATA 3QUJA 2NXOA 4Z0IA 1B58A 4GL0A 4HS7A 4OQOA 3GLBA 3TELA 5CMCA 1LLSA 5DYHA 1B5JA 2RC8A 2AIXA 4H6DA 4KI0E 1XVYA 1HSEA 2IEEA 3N94A 3LR1A 2E0SA 3M3LA 3G3IA 3IO4A 1AH5A 5ICTA 4JDFA 3D4GA 2Y7IA 1NNPA 4OHNA 5DVFA 1LB8A 3U1OA 4EF1A 2M8CA 3OEKA 5CMKA 1US5A 3UGWA 3V89B 4GXSB 4M1VA 5CBSA 3K02A 4KR5A 1RYOA 2A5SA 2F5XA 2XX9A 1I6BA 3CFZA 1XS5A 5AA4B 1II5A 5I56B 4X1BA 2UVIA 3DP4A 3UA8A 2F97A 3KZGA 5F1QA 1S7YA 3EHUA 4OESA 2CMOA 2OZZA 1TT1A 2HZKA 3FVOA 4GIZA 2HQ0A 2DE2A 1B0LA 4NF5B 4FATA 1RKMA 2XXUA 4ELRA 5CBRA 3S9LC 3TEPA 1OQHA 2THIA 3TTRA 1TFDA 1F9BA 1VR5A 3OSRA 2O7IA 2HEUA 4P11A 4HCWA 4NF6A 3LSXA 3MVYA 2Y7RA 3OMBA 3SETA 4XTCQ 3CSBA 2I0BA 1FCKA 1H45A 1VFDA 1ZKBA 2V3TA 1OIBA 1XVXA 4G8MA 4GQOA 4Q30B 3ZKKA 2PVUA 5I2KA 2Z8EA 5I56A 2XXYA 3KSJA 2VOZA 2VP1A 2Z8FA 3MVXA 4IO6A 3LC8A 4NF8A 1NL5A 4ZEBA 3SEWA 1FTJA 4F1VA 4PFWA 1IXHA 4TLMB 3A3CA 1IQ7A 4NF4B 3MP6A 1USYE 4JSDA 3T93B 3TZAA 3CR9A 1DTGA 2DXYA 2G29A 3HV1A 3IOUA 3H06B 4EUOA 4ZE9A 1QKAA 3GXAA 2DVCA 4I1DA 4LP2B 1UTBB 1IIWA 3IB2A 3IOWA 1OVTA 5AA2B 2H98A 3H3GA 1WVJA 1H44A 3VVDA 4EXKA 4N13A 1TWYA 4Z7EA 4OXVA 4UACA 5DVJA 1IITA 1P99A 1M5EA 4NWCA 5DT6A 4YB7A 3FV2A 1O7TA 3K1PA 1N3WA 3O66A 5K2YA 4ZEFA 4OZ9A 1QJMA 1IXCA 4RJZA 3I6VA 5L8DA 2XXRA 2A5TA 4KCCA 4DCYA 5KDTB 2E1SA 3G3GA 5IAIA 3M3FA 1LAHE 4QRZA 1VE4A 3FJ7A 4R73A 2NOOA 1GVCA 3VFJA 1MQJA 2ZYNA 4F1UA 4Q8RA 2FA7A 2H9BA 4QFKA 3VVEA 1R9QA 1UTBA 3RN8A 3IL1B 4LVQA 2X26A 4I62A 5DEXA 4ZE8A 3SEXA 3O6IA 2WKYA 5JK4A 4RA1A 3SEYA 1SI1A 2YLNA 3IOVA 1ZTYA 3RQTA 1M5DA 3IX1A 5FTHA 3OXNA 1POY1 3TYHA 1N3XA 2F36A 2OWTA 4IB2A 4HCYA 2DWAA 4ESXA 3K0VA 2ZNSA 3FGSA 3VXBA 1A55A 3H7MA 3ZSFA 1LFGA 1S50A 3CI8A 3R6UA 4RXLA 2Q8JA 2ABHA 1YAEA 3ZS6A 1Y3NA 5FTIA 3BKIB 4F3SA 4NF6B 3E9XA 1MY1A 1LCTA 1LBCA 1MPDA 2UVGA 4ZEIA 1D9YA 2H5YA 5DEXB 3BFUA 5I2KB 4GVOA 5H8QB 3HHGA 1DPEA 5FHOA 4L17A 4NF8B 4JB7A 5EYFA 4EQ9A 1TXFA 3G3FA 2DWJA 3H4ZA 3DELB 4KYSA 1Y9UA 1A7LA 4U1OA 2DP8A 4XXUA 4AQ4A 1JNFA 1JEUA 3CG3A 3KEIA 3QYTA 4DDDA 1GV8A 1FTKA 5F7VA 3OO8A 2LAOA 2O1LA 2PT1A 4ELOA 1JVXA 1EZPA 3B6WA 1OQGA 2GFEA 4P0GA 3TCGA 4QSCA 3VDFA 1MPBA 1NNKA 3ODBA 3AXFA 3RNNA 2HXWA 3DP8A 4KD5A 4QSEA 1RYXA 2QPQA 4OEUA 1SW2A 1O63A 3C32A 3K00A 4R6YA 2F6PA 4FEBA 4U4XA 3C31A 3KOTA 3H6WA 5H8SA 3U93A 2R71A 2RF1A 1FQEA 4AB5A 4DE8A 3E13X 1P1OA 3TTLA 3U8QA 2F35A 4HW8A 2A5TB 4ELPA 4F31B 5KDTA 2XXPA 5JEIA 2F78A 4YAHX 5ISUA 1I6AA 3MZBA 1B05A 3CG1A 4U21A 2VD2A 3RTFB 1QVSA 4POXA 1PEBA 2B3FA 1Y3QA 4N6PA 3FASA 1B51A 3FVNA 2ZNTA 1R9LA 3FXQA 3HPIA 4WXJA 3G7WA 3K6WA 3MBPA 3CFXA 1SYHA 2BJJX 3TDJA 1SVXB 3C4MA 3K2DA 3MQ9A 4RNSA 4YICA 3SERA 3T96B 1EH3A 1NMUA 1SW5A 2DVZA 3IB0A 5ITOA 2PYYA 3PMWA 1FTOA 4QF9A 3FZVA 1N7XA 5FHMA 3G3JA 4AB6A 2XXXA 3OEMA 3FJMA 1MXYA 3PD8A 4GRKA 4N07A 4YMBA 3IORA 4OYVA 4OWDA 3N6UA 2UYFA 5H8NB 4YKJA 3HHFA 2HAUA 2QS4A 2UXAA 1YPNA 3UK4A 2AL4A 4I9DA 4NEDA 3Q29A 1LGBC 2AL5A 4NMYA 3FXUA 3TPAA 3VLWA 3QAXA 4OENA 5H8QA 1M5CA 2PMSA 3IR1A 3KSXA 3PMXA 3USDA 5L9SA 4ISUA 5I57B 5HM4B 1GR2A 3PPOA 3PUXE 3Q25A 4LATA 4QHQA 1LCFA 4JWXA 1SW4A 2OK2A 2P2AA 3MWBA 2Y84A 3O6GA 4OEVA 4OERA 2ZYMA 4TQUQ 5CMMA 1PC3A 5HBCA 2ALUA 1JQFA 4R72A 3Q26A 4ELQA 1PB9A 4ND9A 5H8NA 3ONMA 3C35A 4BDLA 4YKIA 1MY3A 2I3VA 3DLNA 5DTBA 1QKBA 1FQAA 1P1UA 2D21A 4YZZA 4H5GA 1AIVA 4GXAA 1R6ZA 3ZKLA 1UTHA 4BDQA 2I58A 3I3VA 1QUJA 4BDRA 1XC1A 2Y7WA 3QIMA 5L9OA 2O68A 1P1NA 3ECRA 1XOCA 3Q27A 3TTNA 4H65A 3FXRA 4WEDA 1Y3PA 4DZ1A 4EQBA 1B3FA 1ZIUA 3SKPA 3VVFA 1EZ9A 1GGGA 3MJNA 1B6HA 5ITPA 2HAVA 2Q2AA 4JBZA 1MDQA 4JWOA 1A54A 1IZ1A 3CFLA 3C9HA 1HSJA 4THIA 3RLFE 3W15C 2ZYKA 3THIA 4OMBA 1B9JA 4IO3A 4Q5TA 4F3GA 1I6QA 2H4IA 3BBRA 4R2FA 1IXGA 1Y1ZA 2QMWA 1OMPA 3LUYA 2H99A 4G68C 4PFUA 3IK6B 4GWOA 1FTLA 4QFNA 4XKQA 5TP9B 3V8XB 1B2HA 4MBPA 5H8FA 4H5FA 3N26A 4FEDA 1Y1MA 4YB6A 1SBPA 1B4HA 2O69A 3SESA 3U92A 4DLDA 1LB9A 1FW0A 4OVJA 3MC2A 4EF2A 5H8HA 4F2QA 1IXIA 1N76A 3C33A 2DWHA 3M3KA 4G2ZA 4U23A 2OJTA 4XKPA 4KPTA 3T9HB 4ECFA 1XHYA 3PPRA 4NWDA 4R9FA 3FIRA 3HCQA 1SI0A 3JYRA 3MVZA 3T9UA 1JETA 1DMBA 2ESNA 2F7AA 3C34A 4POWA 4TOZA 1Q35A 4QSDA 1MXWA 2RINA 1ANFA 1B0HA 2OWSA 4H8IA 4JWYA 3UP9A 5AA2D 1MG1A 1M5BA 3EQ1A 4LZ5A 1SYIA 5TP9A 1SW1A 4C1UA 5H8FB 1MDP1 1PBQA 3MAMA 4DXUA 5I58A 3O97A 1B7HA 3N6TA 4O3CA 1JW4A 3T9VA 5I57A 3L6GA 4H8JA 1JW5A 2XX7A 1B52A 2DOJA 3K4UA 3MP1A 5H8HB 5CC2A 3RUMA 1QW0A 4PP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KN7 A;  4YMA A;  4IGR A;  2PT2 A;  3T22 A;  5B7D A;  3ILT B;  3PPQ A;  1UIU A;  3VE1 B;  3TTM A;  4C1T A;  4OFL A;  3MPK A;  2Y7P A;  3O28 A;  3QK6 A;  4KQP A;  4RYA A;  1BP5 A;  4U2R A;  4KFQ A;  1QUI A;  1AL3 A;  1J1N A;  1URG A;  4XIG Q;  3UIF A;  2DYX A;  2I3W A;  2NWJ A;  1UIV A;  2XXI A;  1UTH B;  3TAJ A;  4U1Z A;  1NNT A;  3RTW B;  4KHZ E;  1H43 A;  1CE2 A;  4JSO A;  4PQJ A;  1N04 A;  3CRB A;  3TUS A;  3B7D A;  3H6V A;  1MXU A;  2O51 A;  3HN0 A;  3KBR A;  1B4Z A;  1DSN A;  1MM6 A;  3KG2 A;  3TMG A;  3PPP A;  3MW0 A;  4E0X A;  2H25 A;  4IO5 A;  1O64 A;  2B3B A;  2PBW A;  3SEU A;  3PPN A;  1MY2 A;  2ANJ A;  3QUF A;  4F18 A;  4LZ7 A;  2I4B A;  2V93 A;  5BWJ A;  4QFO A;  4G77 A;  4MH5 A;  4PFY A;  1MRP A;  4F39 A;  3D4C A;  2O6A A;  3MP8 A;  2DE4 A;  2VGQ A;  2QS2 A;  4DXC A;  3RGY A;  1QUL A;  1MXV A;  4BDM A;  1CB6 A;  1PBP A;  2O7U A;  2ZMB A;  1A8F A;  3O29 A;  1NFT A;  4EQ7 A;  4X1D A;  4FAJ A;  2I48 A;  3EPE A;  4HTG A;  4X9T A;  5HPQ A;  5ELV A;  1B3G A;  1MH4 A;  3K1M A;  5LOM A;  4MF3 A;  2AYS A;  3GZG A;  3H6T A;  3FJG A;  5IKB A;  1B3H A;  2Y7K A;  4F29 A;  1URD A;  1EU8 A;  1LFI A;  1LST A;  2XXQ A;  1B1X A;  2D3I A;  4FE8 A;  5CRY A;  1Y4C A;  2ONK E;  2UVH A;  4GF8 A;  5I84 A;  4P0I A;  3T66 A;  3DP6 A;  3HST A;  5JTY B;  3VLU A;  3F11 A;  3O6H A;  3W9V A;  1LFH A;  5I58 B;  4LON B;  3OO9 A;  1TFA A;  3I5O A;  2UYE A;  3LSL A;  4RK2 A;  3S4U A;  2REG A;  1FQD A;  3IO6 A;  1ZLQ A;  2ONR A;  3MPL A;  2GHA A;  3PUW E;  1SQY A;  3R7X A;  1B5H A;  1ELJ A;  3JZJ A;  1GTK A;  2ZYO A;  4DCX A;  3S9M C;  3EHS A;  3JV9 A;  3Q28 A;  3TCH A;  1MQG A;  2RKM A;  2V3U A;  1BIY A;  1N7W A;  3IAZ A;  4FIM A;  3TQL A;  1AOV A;  5AE4 A;  3MZ1 A;  3RY3 A;  1MS7 A;  4G8N A;  4ONY A;  3G3H A;  4ESW A;  2RCB A;  2I4C A;  2XXV A;  4ZDM A;  2VD3 A;  1MH3 A;  3PU5 A;  5CI5 A;  2P0S A;  5JTY A;  5KZT A;  1NH7 A;  3FD3 A;  3L6H A;  4F3P A;  1B7Z A;  1I69 A;  3IJO B;  5EHS A;  1T0K A;  3OO7 A;  2NVU B;  2F6G A;  1Z7M E;  1JEV A;  2F7B A;  1B3L A;  1Z7N E;  2QJE A;  3EF7 A;  3K1N A;  4I8C A;  4OFO A;  4G8H A;  4FEC A;  2Q2C A;  3U94 A;  5K2X A;  4IY6 A;  5M2V A;  2R6G E;  2QMX A;  1NKX A;  4YU0 A;  2REJ A;  3SEV A;  5CMB A;  4KYD A;  4E0W A;  4PET A;  2XHD A;  1SD3 A;  2O84 X;  1MXZ A;  3OEN A;  1VSO A;  1ZJL A;  2DE3 A;  5BUU A;  2F8D A;  3G3K A;  1DTZ A;  4R75 A;  2QL3 A;  2FNC A;  1R1N A;  5EHM A;  1A99 A;  4C0R A;  4LZ8 A;  4F2O A;  2VHA A;  4H0W A;  1WDN A;  3FVG A;  4F22 A;  5TPA A;  1WOD A;  3V83 A;  4G4P A;  1P1Q A;  3RPW A;  5I59 B;  3FVK A;  4MFI A;  4YKK A;  4JXI A;  2QS1 A;  2Q88 A;  5J1D A;  2DXR A;  4ZS9 A;  2GH9 A;  4QFL A;  1ZU0 A;  3MVW A;  1MPC A;  1BKA A;  2XXW A;  3TQW A;  3OO6 A;  4QFP A;  1Y20 A;  3E3K A;  2Z8D A;  3MZ9 A;  1M5F A;  4ZEC A;  2Q9T A;  3CVG A;  1B5I A;  1URS A;  1DPP A;  4IGT A;  4YKP A;  3R26 A;  3OD7 A;  3ILU B;  2X7Q A;  1OLC A;  2B65 A;  2OBG A;  2V84 A;  3PUY E;  4R6K A;  3FUZ A;  1B7U A;  4GFR A;  5DVI A;  3CSG A;  4RPN A;  2YPN A;  5CM6 A;  5KCJ A;  5I59 A;  1N84 A;  1MY4 A;  2GRV A;  3P7I A;  4GD5 A;  2XX8 A;  4DIG A;  4BDN A;  1P1W A;  2I0C A;  3PV0 E;  3EHT A;  3GBB A;  3TTK A;  4ZED A;  1LAG E;  1FQC A;  2O1M A;  4LA9 A;  5AA2 A;  5I2N B;  4FJP A;  4PE5 B;  4PFT A;  1POT A;  3O9P A;  2RC9 A;  1MQD A;  2F34 A;  3KN3 A;  4G68 A;  3C36 A;  3M8U A;  4M4G A;  3K01 A;  2DSF A;  2Q89 A;  4BLA A;  4R6H A;  5B70 A;  3IJX B;  1MY0 A;  3OOA A;  1MQH A;  2D5W A;  1LAX A;  2QRY A;  1JW1 A;  1LBB A;  1B46 A;  1LAF E;  1PB7 A;  3IOT A;  3OSQ A;  4LUB A;  3VLV A;  2HZL A;  2XXH A;  4FOR A;  3SDF A;  4WKM A;  3WAE A;  4U22 A;  4IO4 A;  4XKN A;  4O3B A;  2I6E A;  2Z22 A;  3T9X B;  4EXL A;  4F3B A;  1KWH A;  5FHN A;  5KCJ B;  1D9V A;  4IO2 A;  5TU0 A;  1N0T A;  4IO7 A;  1A8E A;  4LQ5 A;  4OET A;  2CZL A;  2ZNU A;  3HO7 A;  2XD3 A;  3OEL A;  1D4N A;  1UQW A;  3A3U A;  5I2N A;  1US4 A;  1ATG A;  1OLA A;  3KGC A;  4OFJ A;  2V3Q A;  3VV5 A;  4KCD A;  4BDO A;  3CIJ A;  3B6T A;  4UA8 A;  3E4R A;  3N5L A;  1A40 A;  1IEJ A;  2XXT A;  1VFE A;  4ZZA A;  1XT8 A;  2DQV A;  1ZMG A;  4KYE A;  3O2A A;  3K6V A;  4IY5 A;  2HCA A;  3KJ7 A;  4ZEK A;  2PX1 A;  2X7P A;  3U72 A;  1Q1K A;  1YTV A;  4RK9 A;  5TPA B;  3VXC A;  3WAF A;  3B6Q A;  3GBA A;  2RCA A;  3KOS A;  1YCJ A;  3LSF B;  3TKD A;  3UN6 A;  4MLQ A;  5A5X A;  2XD2 A;  4R2B A;  4EDP A;  1S9T A;  3RT8 A;  4LQ2 A;  2YJP A;  1OVB A;  1H76 A;  2F7C A;  1NH8 A;  2RC7 A;  3PMV A;  1BTJ A;  3A09 A;  1FQB A;  4H67 A;  1B32 A;  4NE4 A;  3H6U A;  4GL8 A;  3S2V A;  3UOR A;  5ICQ A;  3PGF A;  1PB8 A;  3MUQ A;  3PUV E;  2G93 A;  3KJT A;  2ZXT A;  4O3A A;  4DXB A;  3LBS A;  4NF5 A;  1AMF A;  4R74 A;  1L5T A;  4GLI A;  2DWI A;  3IB1 A;  4YB5 A;  1FTM A;  2OLB A;  4OTE A;  3DM0 A;  2P1S A;  2DS9 A;  3EN3 A;  1B1H A;  3H03 A;  5AA3 A;  1H3D A;  1NNF A;  3PUZ E;  3QSL A;  1Y4T A;  2Z23 A;  2R9J A;  4RY1 A;  4X48 A;  4MLV A;  3QXM A;  1B40 A;  5A5X B;  2NUV A;  2GHB A;  2HFB A;  1PDA A;  1JVY A;  3S9N C;  1FQF A;  4RPO A;  1BLF A;  4H1X A;  5L9M A;  5AA1 A;  4GOT A;  1B3E A;  1QUK A;  1SDX A;  3RT6 B;  3V5A A;  2QSX A;  3FV1 A;  3TCF A;  1MXX A;  3S9E A;  2FYI A;  4G68 B;  1USY H;  4U4S A;  4NTL A;  1MQI A;  4NF4 A;  1MM7 A;  1ZBM A;  4XKR A;  1DOT A;  3KFM A;  3LSW A;  2W7Y A;  3PD9 A;  4ZZE A;  3W9W A;  2IA4 A;  2V25 A;  2I49 A;  1EZO A;  2QS3 A;  2UVJ A;  1IUD A;  2ONS A;  4K3F A;  2OCU A;  1HSL A;  1D3K A;  3TOD A;  3BFT A;  3TFL A;  3K6U A;  4Q0C A;  3KN8 A;  4TLL B;  4R9G A;  4WEP A;  3K6X A;  4F1Y A;  5AA4 A;  4F19 A;  2KLF A;  3FAT A;  3QUJ A;  2NXO A;  4Z0I A;  1B58 A;  4GL0 A;  4HS7 A;  4OQO A;  3GLB A;  3TEL A;  5CMC A;  1LLS A;  5DYH A;  1B5J A;  2RC8 A;  2AIX A;  4H6D A;  4KI0 E;  1XVY A;  1HSE A;  2IEE A;  3N94 A;  3LR1 A;  2E0S A;  3M3L A;  3G3I A;  3IO4 A;  1AH5 A;  5ICT A;  4JDF A;  3D4G A;  2Y7I A;  1NNP A;  4OHN A;  5DVF A;  1LB8 A;  3U1O A;  4EF1 A;  2M8C A;  3OEK A;  5CMK A;  1US5 A;  3UGW A;  3V89 B;  4GXS B;  4M1V A;  5CBS A;  3K02 A;  4KR5 A;  1RYO A;  2A5S A;  2F5X A;  2XX9 A;  1I6B A;  3CFZ A;  1XS5 A;  5AA4 B;  1II5 A;  5I56 B;  4X1B A;  2UVI A;  3DP4 A;  3UA8 A;  2F97 A;  3KZG A;  5F1Q A;  1S7Y A;  3EHU A;  4OES A;  2CMO A;  2OZZ A;  1TT1 A;  2HZK A;  3FVO A;  4GIZ A;  2HQ0 A;  2DE2 A;  1B0L A;  4NF5 B;  4FAT A;  1RKM A;  2XXU A;  4ELR A;  5CBR A;  3S9L C;  3TEP A;  1OQH A;  2THI A;  3TTR A;  1TFD A;  1F9B A;  1VR5 A;  3OSR A;  2O7I A;  2HEU A;  4P11 A;  4HCW A;  4NF6 A;  3LSX A;  3MVY A;  2Y7R A;  3OMB A;  3SET A;  4XTC Q;  3CSB A;  2I0B A;  1FCK A;  1H45 A;  1VFD A;  1ZKB A;  2V3T A;  1OIB A;  1XVX A;  4G8M A;  4GQO A;  4Q30 B;  3ZKK A;  2PVU A;  5I2K A;  2Z8E A;  5I56 A;  2XXY A;  3KSJ A;  2VOZ A;  2VP1 A;  2Z8F A;  3MVX A;  4IO6 A;  3LC8 A;  4NF8 A;  1NL5 A;  4ZEB A;  3SEW A;  1FTJ A;  4F1V A;  4PFW A;  1IXH A;  4TLM B;  3A3C A;  1IQ7 A;  4NF4 B;  3MP6 A;  1USY E;  4JSD A;  3T93 B;  3TZA A;  3CR9 A;  1DTG A;  2DXY A;  2G29 A;  3HV1 A;  3IOU A;  3H06 B;  4EUO A;  4ZE9 A;  1QKA A;  3GXA A;  2DVC A;  4I1D A;  4LP2 B;  1UTB B;  1IIW A;  3IB2 A;  3IOW A;  1OVT A;  5AA2 B;  2H98 A;  3H3G A;  1WVJ A;  1H44 A;  3VVD A;  4EXK A;  4N13 A;  1TWY A;  4Z7E A;  4OXV A;  4UAC A;  5DVJ A;  1IIT A;  1P99 A;  1M5E A;  4NWC A;  5DT6 A;  4YB7 A;  3FV2 A;  1O7T A;  3K1P A;  1N3W A;  3O66 A;  5K2Y A;  4ZEF A;  4OZ9 A;  1QJM A;  1IXC A;  4RJZ A;  3I6V A;  5L8D A;  2XXR A;  2A5T A;  4KCC A;  4DCY A;  5KDT B;  2E1S A;  3G3G A;  5IAI A;  3M3F A;  1LAH E;  4QRZ A;  1VE4 A;  3FJ7 A;  4R73 A;  2NOO A;  1GVC A;  3VFJ A;  1MQJ A;  2ZYN A;  4F1U A;  4Q8R A;  2FA7 A;  2H9B A;  4QFK A;  3VVE A;  1R9Q A;  1UTB A;  3RN8 A;  3IL1 B;  4LVQ A;  2X26 A;  4I62 A;  5DEX A;  4ZE8 A;  3SEX A;  3O6I A;  2WKY A;  5JK4 A;  4RA1 A;  3SEY A;  1SI1 A;  2YLN A;  3IOV A;  1ZTY A;  3RQT A;  1M5D A;  3IX1 A;  5FTH A;  3OXN A;  1POY 1;  3TYH A;  1N3X A;  2F36 A;  2OWT A;  4IB2 A;  4HCY A;  2DWA A;  4ESX A;  3K0V A;  2ZNS A;  3FGS A;  3VXB A;  1A55 A;  3H7M A;  3ZSF A;  1LFG A;  1S50 A;  3CI8 A;  3R6U A;  4RXL A;  2Q8J A;  2ABH A;  1YAE A;  3ZS6 A;  1Y3N A;  5FTI A;  3BKI B;  4F3S A;  4NF6 B;  3E9X A;  1MY1 A;  1LCT A;  1LBC A;  1MPD A;  2UVG A;  4ZEI A;  1D9Y A;  2H5Y A;  5DEX B;  3BFU A;  5I2K B;  4GVO A;  5H8Q B;  3HHG A;  1DPE A;  5FHO A;  4L17 A;  4NF8 B;  4JB7 A;  5EYF A;  4EQ9 A;  1TXF A;  3G3F A;  2DWJ A;  3H4Z A;  3DEL B;  4KYS A;  1Y9U A;  1A7L A;  4U1O A;  2DP8 A;  4XXU A;  4AQ4 A;  1JNF A;  1JEU A;  3CG3 A;  3KEI A;  3QYT A;  4DDD A;  1GV8 A;  1FTK A;  5F7V A;  3OO8 A;  2LAO A;  2O1L A;  2PT1 A;  4ELO A;  1JVX A;  1EZP A;  3B6W A;  1OQG A;  2GFE A;  4P0G A;  3TCG A;  4QSC A;  3VDF A;  1MPB A;  1NNK A;  3ODB A;  3AXF A;  3RNN A;  2HXW A;  3DP8 A;  4KD5 A;  4QSE A;  1RYX A;  2QPQ A;  4OEU A;  1SW2 A;  1O63 A;  3C32 A;  3K00 A;  4R6Y A;  2F6P A;  4FEB A;  4U4X A;  3C31 A;  3KOT A;  3H6W A;  5H8S A;  3U93 A;  2R71 A;  2RF1 A;  1FQE A;  4AB5 A;  4DE8 A;  3E13 X;  1P1O A;  3TTL A;  3U8Q A;  2F35 A;  4HW8 A;  2A5T B;  4ELP A;  4F31 B;  5KDT A;  2XXP A;  5JEI A;  2F78 A;  4YAH X;  5ISU A;  1I6A A;  3MZB A;  1B05 A;  3CG1 A;  4U21 A;  2VD2 A;  3RTF B;  1QVS A;  4POX A;  1PEB A;  2B3F A;  1Y3Q A;  4N6P A;  3FAS A;  1B51 A;  3FVN A;  2ZNT A;  1R9L A;  3FXQ A;  3HPI A;  4WXJ A;  3G7W A;  3K6W A;  3MBP A;  3CFX A;  1SYH A;  2BJJ X;  3TDJ A;  1SVX B;  3C4M A;  3K2D A;  3MQ9 A;  4RNS A;  4YIC A;  3SER A;  3T96 B;  1EH3 A;  1NMU A;  1SW5 A;  2DVZ A;  3IB0 A;  5ITO A;  2PYY A;  3PMW A;  1FTO A;  4QF9 A;  3FZV A;  1N7X A;  5FHM A;  3G3J A;  4AB6 A;  2XXX A;  3OEM A;  3FJM A;  1MXY A;  3PD8 A;  4GRK A;  4N07 A;  4YMB A;  3IOR A;  4OYV A;  4OWD A;  3N6U A;  2UYF A;  5H8N B;  4YKJ A;  3HHF A;  2HAU A;  2QS4 A;  2UXA A;  1YPN A;  3UK4 A;  2AL4 A;  4I9D A;  4NED A;  3Q29 A;  1LGB C;  2AL5 A;  4NMY A;  3FXU A;  3TPA A;  3VLW A;  3QAX A;  4OEN A;  5H8Q A;  1M5C A;  2PMS A;  3IR1 A;  3KSX A;  3PMX A;  3USD A;  5L9S A;  4ISU A;  5I57 B;  5HM4 B;  1GR2 A;  3PPO A;  3PUX E;  3Q25 A;  4LAT A;  4QHQ A;  1LCF A;  4JWX A;  1SW4 A;  2OK2 A;  2P2A A;  3MWB A;  2Y84 A;  3O6G A;  4OEV A;  4OER A;  2ZYM A;  4TQU Q;  5CMM A;  1PC3 A;  5HBC A;  2ALU A;  1JQF A;  4R72 A;  3Q26 A;  4ELQ A;  1PB9 A;  4ND9 A;  5H8N A;  3ONM A;  3C35 A;  4BDL A;  4YKI A;  1MY3 A;  2I3V A;  3DLN A;  5DTB A;  1QKB A;  1FQA A;  1P1U A;  2D21 A;  4YZZ A;  4H5G A;  1AIV A;  4GXA A;  1R6Z A;  3ZKL A;  1UTH A;  4BDQ A;  2I58 A;  3I3V A;  1QUJ A;  4BDR A;  1XC1 A;  2Y7W A;  3QIM A;  5L9O A;  2O68 A;  1P1N A;  3ECR A;  1XOC A;  3Q27 A;  3TTN A;  4H65 A;  3FXR A;  4WED A;  1Y3P A;  4DZ1 A;  4EQB A;  1B3F A;  1ZIU A;  3SKP A;  3VVF A;  1EZ9 A;  1GGG A;  3MJN A;  1B6H A;  5ITP A;  2HAV A;  2Q2A A;  4JBZ A;  1MDQ A;  4JWO A;  1A54 A;  1IZ1 A;  3CFL A;  3C9H A;  1HSJ A;  4THI A;  3RLF E;  3W15 C;  2ZYK A;  3THI A;  4OMB A;  1B9J A;  4IO3 A;  4Q5T A;  4F3G A;  1I6Q A;  2H4I A;  3BBR A;  4R2F A;  1IXG A;  1Y1Z A;  2QMW A;  1OMP A;  3LUY A;  2H99 A;  4G68 C;  4PFU A;  3IK6 B;  4GWO A;  1FTL A;  4QFN A;  4XKQ A;  5TP9 B;  3V8X B;  1B2H A;  4MBP A;  5H8F A;  4H5F A;  3N26 A;  4FED A;  1Y1M A;  4YB6 A;  1SBP A;  1B4H A;  2O69 A;  3SES A;  3U92 A;  4DLD A;  1LB9 A;  1FW0 A;  4OVJ A;  3MC2 A;  4EF2 A;  5H8H A;  4F2Q A;  1IXI A;  1N76 A;  3C33 A;  2DWH A;  3M3K A;  4G2Z A;  4U23 A;  2OJT A;  4XKP A;  4KPT A;  3T9H B;  4ECF A;  1XHY A;  3PPR A;  4NWD A;  4R9F A;  3FIR A;  3HCQ A;  1SI0 A;  3JYR A;  3MVZ A;  3T9U A;  1JET A;  1DMB A;  2ESN A;  2F7A A;  3C34 A;  4POW A;  4TOZ A;  1Q35 A;  4QSD A;  1MXW A;  2RIN A;  1ANF A;  1B0H A;  2OWS A;  4H8I A;  4JWY A;  3UP9 A;  5AA2 D;  1MG1 A;  1M5B A;  3EQ1 A;  4LZ5 A;  1SYI A;  5TP9 A;  1SW1 A;  4C1U A;  5H8F B;  1MDP 1;  1PBQ A;  3MAM A;  4DXU A;  5I58 A;  3O97 A;  1B7H A;  3N6T A;  4O3C A;  1JW4 A;  3T9V A;  5I57 A;  3L6G A;  4H8J A;  1JW5 A;  2XX7 A;  1B52 A;  2DOJ A;  3K4U A;  3MP1 A;  5H8H B;  5CC2 A;  3RUM A;  1QW0 A;  4PP0 A; 
#chains in the Genus database with same CATH topology
 5B7D A;  2Y7P A;  3O28 A;  4RYA A;  4IR8 A;  2XXI A;  1UTH B;  1H43 A;  1CE2 A;  4JSO A;  3CRB A;  1IMF A;  3H6V A;  2O51 A;  5I3S A;  1MM6 A;  3KG2 A;  3BIG A;  4E0X A;  2XA5 A;  4PFY A;  1MRP A;  3LV0 A;  4BDM A;  2ZMB A;  1A8F A;  1NFT A;  3RYD A;  4HE2 A;  1B3H A;  1IMB A;  1LST A;  1B1X A;  2D3I A;  4GF8 A;  3OO9 A;  1TFA A;  3LSL A;  4MCO A;  1ZLQ A;  2ONR A;  4PC9 A;  3R7X A;  3JZJ A;  2V3U A;  3IAZ A;  3TQL A;  3MZ1 A;  3RY3 A;  1MS7 A;  4ONY A;  3G3H A;  2RCB A;  2XXV A;  4ZDM A;  3PU5 A;  5JTY A;  5KZT A;  1NH7 A;  3L6H A;  1I69 A;  3OO7 A;  1Z7M E;  2F7B A;  4GWY A;  2Y5K A;  4G8H A;  4FEC A;  5M2V A;  4MIJ A;  2F3D A;  4E0W A;  3OEN A;  5BUU A;  2F8D A;  4O7M A;  2QL3 A;  2FNC A;  5EHM A;  4LZ8 A;  3V83 A;  4H0W A;  1P1Q A;  1DBZ A;  4QFL A;  1MPC A;  3TQW A;  2Q9T A;  4PBH A;  3R26 A;  3OD7 A;  3ILU B;  2V84 A;  2OBG A;  5DVI A;  1N84 A;  2GRV A;  2XX8 A;  1P1W A;  2I0C A;  1FQC A;  4LA9 A;  1POT A;  4G68 A;  3KN3 A;  3M8U A;  3K01 A;  4R6H A;  3OOA A;  2D5W A;  2QRY A;  4LUB A;  1JW1 A;  1LBB A;  1B46 A;  1LAF E;  4IO4 A;  4XKN A;  4F3B A;  4EXL A;  5KCJ B;  4NX1 A;  4IO7 A;  2ZZW A;  1FBD A;  1US4 A;  4OFJ A;  3VV5 A;  4KCD A;  1A40 A;  1XT8 A;  2HCA A;  2X7P A;  1D9Q A;  1YTV A;  4RK9 A;  3WAF A;  3UN6 A;  1NV0 A;  2XD2 A;  3RT8 A;  2YJP A;  1FBF A;  4H67 A;  1BTJ A;  4NE4 A;  1FQB A;  5LTC A;  3PGF A;  1PB8 A;  4NF5 A;  4R74 A;  4GLI A;  2DWI A;  1FTM A;  2OLB A;  2P1S A;  2Z23 A;  4RY1 A;  2GHB A;  1PDA A;  2DDK A;  4XEQ A;  3ZKL A;  1B3E A;  2QSX A;  2L5V A;  1USY H;  4X8R A;  2QS3 A;  2ONS A;  4K3F A;  1HSL A;  4OVQ A;  3TFL A;  3K6U A;  4TLL B;  4R9G A;  3K6X A;  3FAT A;  3QUJ A;  5EQ8 A;  5DYH A;  4KI0 E;  5DVF A;  3U1O A;  2M8C A;  3OEK A;  5CMK A;  3V89 B;  5CBS A;  3K02 A;  4N8G A;  2XX9 A;  1FBP A;  3EHU A;  2CMO A;  2HZK A;  3FVO A;  3CHG A;  1B0L A;  1OQH A;  4NQ8 A;  1TFD A;  4P11 A;  2HEU A;  4HCW A;  4G61 A;  3LSX A;  3MVY A;  2Y7R A;  2I0B A;  1OIB A;  4GQO A;  3ZKK A;  1NUX A;  2Z8E A;  3KSJ A;  1NL5 A;  4ZEB A;  3IFA A;  1DTG A;  2DXY A;  3H06 B;  4ZE9 A;  4OAN A;  3GXA A;  4I1D A;  2H98 A;  4Z7E A;  4OXV A;  5DVJ A;  1IIT A;  4YB7 A;  3K1P A;  4OZ9 A;  1IXC A;  2A5T A;  2E1S A;  5IAI A;  2KQZ A;  2QFL A;  4QRZ A;  1GVC A;  1MQJ A;  2FA7 A;  2H9B A;  5DEX A;  2WBB A;  4RA1 A;  2YLN A;  3RQT A;  3OXN A;  3TYH A;  4IB2 A;  4HCY A;  2DWA A;  3K0V A;  4RXL A;  4HE1 A;  5IZZ A;  3BKI B;  4NF6 B;  1MY1 A;  1MPD A;  2Q74 A;  1DPE A;  4NF8 B;  1LBX A;  5EYF A;  3G3F A;  2DWJ A;  4EF1 A;  4XXU A;  1JEU A;  1FTK A;  2CZK A;  3RNN A;  3E79 A;  4NGU A;  3KBZ A;  4GX6 A;  2QPQ A;  4JVD A;  5IZ3 B;  4FEB A;  3H6W A;  4AB5 A;  4NHB A;  4YAH X;  5ISU A;  1Y3Q A;  3FAS A;  3FXQ A;  3HPI A;  2CZH A;  3K6W A;  3MBP A;  3C4M A;  1FBG A;  3SER A;  2DVZ A;  5ITO A;  2PYY A;  4AB6 A;  5ET7 A;  4PFB A;  4YMB A;  3N6U A;  2UYF A;  2HAU A;  2Q8M A;  3UK4 A;  3Q29 A;  3QAX A;  4OEN A;  1M5C A;  3RPL B;  1GR2 A;  3MWB A;  3O6G A;  1CNQ A;  4ND9 A;  1MY3 A;  2I3V A;  5DTB A;  1AIV A;  4YZZ A;  4GXA A;  1UTH A;  1QUJ A;  3QIM A;  2O68 A;  1P1N A;  2XWK A;  4MNI A;  4H65 A;  4WED A;  1Y3P A;  4JWO A;  1MDQ A;  1IZ1 A;  3CFL A;  3W15 C;  2ZYK A;  3THI A;  4OMB A;  4F3G A;  3IFC A;  3BBR A;  3ROJ A;  2CEX A;  2QMW A;  4XKQ A;  1FTL A;  1Y1M A;  3SES A;  4DLD A;  1LB9 A;  3B8B A;  2DWH A;  4ECF A;  2OJT A;  3PPR A;  4NWD A;  3FIR A;  3JYR A;  3T9U A;  1DMB A;  4TOZ A;  1MXW A;  4H8I A;  1SYI A;  1G0I A;  1PBQ A;  4GX4 A;  1B7H A;  4H8J A;  3MP1 A;  3K4U A;  2DOJ A;  4I3Y A;  4IGR A;  2PT2 A;  3VE1 B;  3MPK A;  3QK6 A;  1BP5 A;  4U2R A;  1AL3 A;  1J1N A;  4O8M A;  4NF0 A;  2NWJ A;  4PQJ A;  1MXU A;  2WEF A;  3KBR A;  3MW0 A;  4IO5 A;  1O64 A;  1MY2 A;  4LZ7 A;  2V93 A;  3D4C A;  2O6A A;  2WX9 A;  4PBQ A;  1NUZ A;  2O7U A;  4FAJ A;  2I48 A;  4HTG A;  4X9T A;  1B3G A;  1MH4 A;  3K1M A;  5I7I A;  4MF3 A;  1FJ6 A;  4F29 A;  2Y7K A;  1URD A;  1EU8 A;  1LFI A;  5DW8 A;  4FE8 A;  3HST A;  3W9V A;  5JTY B;  5I58 B;  4LON B;  3I5O A;  1FPB A;  2REG A;  1B5H A;  4DCX A;  3EHS A;  3JV9 A;  3TCH A;  3ISP A;  1FBC A;  1BIY A;  4FIM A;  2I4C A;  4JVI A;  2HXR A;  3FD3 A;  4F3P A;  3IJO B;  2NVU B;  2F6G A;  3K1N A;  1NV7 A;  5K2X A;  2R6G E;  2WYK A;  1NKX A;  4PET A;  4MAG A;  2JJK A;  2QVR A;  3FBP A;  4F2O A;  4F22 A;  5I59 B;  1FPJ A;  2QS1 A;  2Q88 A;  2DXR A;  4ZS9 A;  2XXW A;  1BKA A;  1Y20 A;  3QMF A;  3CVG A;  1URS A;  4IGT A;  3PUY E;  1OLC A;  3CSG A;  2YPN A;  1LBY A;  5I59 A;  2XWV A;  1MY4 A;  4N81 A;  3PV0 E;  3GBB A;  4PTK A;  4ZED A;  1LAG E;  2Q89 A;  1MQH A;  1LAX A;  1PB7 A;  2XXH A;  5EQ7 A;  4WKM A;  4O3B A;  3T9X B;  1KWH A;  4PAF A;  4IO2 A;  5TU0 A;  1N0T A;  2CZL A;  2XD3 A;  3OEL A;  3KGC A;  5LDZ A;  3T0J A;  1VFE A;  1ZMG A;  1Q1K A;  5T3J A;  3KOS A;  2RCA A;  3LSF B;  3TKD A;  5A5X A;  4MLQ A;  4AS4 A;  4R2B A;  4LQ2 A;  1OVB A;  1NH8 A;  3PMV A;  3S2V A;  3UOR A;  3H6U A;  4GL8 A;  3LBS A;  3IB1 A;  2XWO A;  4OTE A;  2DS9 A;  1B1H A;  3H03 A;  1Y4T A;  2QVV A;  2R9J A;  3QXM A;  1FBE A;  3LUZ A;  3S9N C;  4PDH A;  4H1X A;  5AA1 A;  5L9M A;  4GOT A;  3TCF A;  3S9E A;  4GBW A;  2FYI A;  4MEV A;  4XFE A;  4U4S A;  1MQI A;  4NF4 A;  1MM7 A;  3KFM A;  2W7Y A;  4ZZE A;  3PTY A;  5J16 A;  5EQA A;  1K9Y A;  1D3K A;  3TOD A;  3BFT A;  4WEP A;  5AA4 A;  2NXO A;  4HS7 A;  4OQO A;  3GLB A;  3RTW B;  4OVT A;  2RC8 A;  2AIX A;  1XVY A;  1HSE A;  3N94 A;  3IO4 A;  1AH5 A;  2FVZ A;  1NV4 A;  2VPO A;  2Y7I A;  4GXS B;  4M1V A;  5AA4 B;  3CFZ A;  5I56 B;  5F1Q A;  1S7Y A;  1INP A;  1TT1 A;  2HQ0 A;  2HPG A;  1RKM A;  4ELR A;  1VR5 A;  2QVU A;  4NF6 A;  3OMB A;  3SET A;  2V3T A;  1ZKB A;  1XVX A;  2XWI A;  2Z8F A;  3MVX A;  4PAK A;  3SEW A;  1FTJ A;  4PFW A;  1IXH A;  4TLM B;  3A3C A;  4PDD A;  4GX3 A;  1H44 A;  4N4U A;  1IMC A;  1P99 A;  4NWC A;  1O7T A;  1N3W A;  4ZEF A;  5IGA A;  5L8D A;  2XXR A;  5KDT B;  1LAH E;  5LOM A;  4F1U A;  2NOO A;  4Q8R A;  3RN8 A;  5JK4 A;  1SI1 A;  1POY 1;  2F36 A;  4O94 A;  4X04 A;  4N6D A;  1A55 A;  3H7M A;  3CI8 A;  4OVR A;  3ZS6 A;  1NI9 A;  2B4M A;  4F3S A;  3E9X A;  1LBC A;  2UVG A;  2H5Y A;  4NN3 A;  3HHG A;  5FHO A;  1FPL A;  2P3N A;  1TXF A;  1IME A;  3DEL B;  1Y9U A;  4U1O A;  2DP8 A;  3S9M C;  3CG3 A;  3QYT A;  3KEI A;  2LAO A;  1MPB A;  1NNK A;  3AXF A;  4KD5 A;  4OEU A;  4U4X A;  4PFR A;  3E13 X;  1P1O A;  3TTL A;  2B4L A;  4F31 B;  4ELP A;  5KDT A;  4P1E A;  5JEI A;  1I6A A;  1B05 A;  3CG1 A;  1QVS A;  3FVN A;  4WXJ A;  3G7W A;  4PGN A;  1K9Z A;  3MQ9 A;  4RNS A;  1NMU A;  3PMW A;  4QF9 A;  4OA4 A;  2FHY A;  4GRK A;  3OEM A;  1MXY A;  4N07 A;  2UXA A;  4I9D A;  4NED A;  4NMY A;  3FXU A;  4P8B A;  3PMX A;  4ISU A;  4LAT A;  2OX3 A;  4QHQ A;  1LCF A;  5ET5 A;  1SW4 A;  2P2A A;  4OER A;  4OEV A;  2ZYM A;  1FPK A;  3ECR A;  3HFU A;  4EQB A;  1B3F A;  3VVF A;  1EZ9 A;  5ITP A;  3RLF E;  2H4I A;  2ZZX A;  3LUY A;  1OMP A;  4G68 C;  3V8X B;  4GWO A;  4H5F A;  1SBP A;  3KC1 A;  1FW0 A;  3MC2 A;  3M3K A;  4G2Z A;  4XKP A;  4KXP A;  4P3L A;  2F7A A;  2ESN A;  4POW A;  4JVC A;  4QSD A;  1M5B A;  4LZ5 A;  1SW1 A;  5H8F B;  1NV5 A;  3MAM A;  3O97 A;  3N6T A;  3T9V A;  5I57 A;  1B52 A;  2V4C A;  5H8H B;  3T22 A;  3ILT B;  3PPQ A;  4XF5 A;  1UIU A;  4OFL A;  4XIG Q;  3UIF A;  1URG A;  2DYX A;  2I3W A;  3TAJ A;  4U1Z A;  1NNT A;  4KHZ E;  1NUY A;  1N04 A;  3B7D A;  1DSN A;  3PPP A;  2H25 A;  3SEU A;  2I4B A;  5BWJ A;  4QFO A;  4F39 A;  3MP8 A;  3RGY A;  1QUL A;  1MXV A;  1CB6 A;  1PBP A;  3O29 A;  5HPQ A;  4X1D A;  3EPE A;  5ELV A;  2AYS A;  3H6T A;  4N91 A;  2XXQ A;  5CRY A;  2ONK E;  2UVH A;  4N15 A;  3S4U A;  5EQ9 A;  1FQD A;  3PUW E;  1GTK A;  2ZYO A;  3Q28 A;  2RKM A;  1AOV A;  1NV3 A;  4ESW A;  4G8N A;  4O7I A;  2P0S A;  1T0K A;  4C0R A;  2QJE A;  1JEV A;  1B3L A;  1Z7N E;  5EYH A;  4H46 A;  3U94 A;  2QMX A;  4YU0 A;  2XHD A;  2O84 X;  1MXZ A;  4UAB A;  2DE3 A;  3G3K A;  4PF6 A;  1A99 A;  2VHA A;  1WDN A;  5TPA A;  4G4P A;  3FVK A;  4MFI A;  4JXI A;  3E3K A;  1Q9D A;  4GWX A;  1B5I A;  1DPP A;  2B65 A;  4R6K A;  4GFR A;  4RPN A;  5CM6 A;  5KCJ A;  2PFZ A;  4GD5 A;  3EHT A;  5A5L A;  4FJP A;  2RC9 A;  1MQD A;  3C36 A;  5B70 A;  4BLA A;  4KYD A;  3OSQ A;  3IOT A;  2HZL A;  4FOR A;  3WAE A;  1D9V A;  4OET A;  3HO7 A;  1UQW A;  1ATG A;  1OLA A;  2BJI A;  4BDO A;  3E4R A;  2P3V A;  4ZZA A;  4KYE A;  3O2A A;  4IY5 A;  3U72 A;  4MNC A;  1BK4 A;  3GBA A;  1YCJ A;  2F7C A;  5ICQ A;  4H45 A;  2G93 A;  2ZXT A;  1EYK A;  4DXB A;  1AMF A;  1L5T A;  4YB5 A;  3DM0 A;  5AA3 A;  1H3D A;  1IMD A;  4MLV A;  5ESY A;  2HFB A;  2R8T A;  1FQF A;  3E78 A;  1BLF A;  1SDX A;  1QUK A;  3V5A A;  4AS5 A;  1MXX A;  4G68 B;  5FBP A;  4NTL A;  1ZBM A;  4XKR A;  1DOT A;  2IA4 A;  2I49 A;  1EZO A;  1KZ8 A;  4Q0C A;  3KN8 A;  4F1Y A;  4QXD A;  4F19 A;  2KLF A;  4Z0I A;  1LLS A;  2IEE A;  5IM2 A;  5ICT A;  4JDF A;  3D4G A;  1NNP A;  1RYO A;  2A5S A;  2F5X A;  1I6B A;  1II5 A;  4X1B A;  3DP4 A;  3KZG A;  4NF5 B;  5CBR A;  2XXU A;  3S9L C;  4FBP A;  3TEP A;  2THI A;  3TTR A;  2KR0 A;  4XTC Q;  3CSB A;  1H45 A;  4Q30 B;  5I2K A;  5I56 A;  2XXY A;  2VOZ A;  4IO6 A;  4NF8 A;  3LC8 A;  4F1V A;  2HHM A;  3MP6 A;  1USY E;  4JSD A;  1LBW A;  3CR9 A;  2G29 A;  3HV1 A;  3IOU A;  1QKA A;  1IIW A;  3IB2 A;  4DI4 B;  1WVJ A;  1VDW A;  4EXK A;  1TWY A;  4UAC A;  4RJZ A;  3SZP A;  4KCC A;  4DCY A;  3G3G A;  1RDX A;  3M3F A;  3VFJ A;  1VE4 A;  2ZYN A;  1FPF A;  3T1B A;  1UTB A;  3IL1 B;  2X26 A;  3O6I A;  3SEY A;  1ZTY A;  1M5D A;  5FTH A;  2PFY A;  2ZNS A;  3NOH A;  1LFG A;  1S50 A;  2Q8J A;  3R6U A;  1YAE A;  1Y3N A;  3A29 A;  1LCT A;  2PCR A;  3BFU A;  4GVO A;  5H8Q B;  4JB7 A;  3H4Z A;  4KYS A;  4MHF A;  1GV8 A;  1FPG A;  3OO8 A;  2O1L A;  2PT1 A;  4ELO A;  1EZP A;  4P0G A;  1OQG A;  2GFE A;  4QSC A;  3ODB A;  2HXW A;  5ET6 A;  1RYX A;  1O63 A;  3C32 A;  3K00 A;  3KOT A;  3U93 A;  2R71 A;  4DE8 A;  3U8Q A;  2A5T B;  2XXP A;  3MZB A;  4U21 A;  3RTF B;  2WYP A;  1PEB A;  2ZNT A;  5IZ1 A;  4YIC A;  3T96 B;  4AQ4 A;  3IB0 A;  1KA0 A;  3FZV A;  3G3J A;  3PD8 A;  4OYV A;  4OWD A;  5H8N B;  3HHF A;  4MNP A;  4NAP A;  1DCU A;  1LGB C;  3TPA A;  4GWS A;  3FXB A;  3PUX E;  1EYJ A;  3Q25 A;  4JWX A;  5CMM A;  5HBC A;  1LBV A;  2ALU A;  1JQF A;  3Q26 A;  1PB9 A;  5H8N A;  3ONM A;  4BDL A;  3TEL A;  3U65 A;  1FQA A;  1P1U A;  2D21 A;  1R6Z A;  2I58 A;  3BIH A;  4BDR A;  2Y7W A;  1YXI A;  3Q27 A;  1XOC A;  5IZ3 A;  4P1L A;  1ZIU A;  1GGG A;  3C9H A;  1HSJ A;  4THI A;  4IO3 A;  4Q5T A;  1I6Q A;  1RDZ A;  1Y1Z A;  4PFU A;  2H99 A;  3IK6 B;  4PCD A;  5H8F A;  4MBP A;  4YB6 A;  4OVJ A;  4EF2 A;  5H8H A;  1IXI A;  3C33 A;  4KPT A;  1XHY A;  3HCQ A;  1SI0 A;  3MVZ A;  1JET A;  2RIN A;  4JWY A;  2OWS A;  3UP9 A;  1MG1 A;  2F3B A;  1MDP 1;  4DXU A;  3D1R A;  5I58 A;  3RPL A;  2FIE A;  2XX7 A;  5CC2 A;  1QW0 A;  3KN7 A;  4YMA A;  5F24 A;  4C1T A;  3TTM A;  1YZ0 A;  4KQP A;  4KFQ A;  1QUI A;  1UIV A;  2WBD A;  3TUS A;  5ET8 A;  4PF8 A;  3HN0 A;  1B4Z A;  3TMG A;  2PBW A;  2B3B A;  2Y5L A;  3PPN A;  2ANJ A;  3QUF A;  4F18 A;  4G77 A;  4MH5 A;  4P47 A;  2DE4 A;  2VGQ A;  2QS2 A;  4PFI A;  4DXC A;  4EQ7 A;  3GZG A;  3FJG A;  5IKB A;  4DI3 D;  2VT5 A;  1Y4C A;  5I84 A;  4P0I A;  3T66 A;  3DP6 A;  1LFH A;  3VLU A;  3F11 A;  3O6H A;  3B50 A;  2UYE A;  4RK2 A;  2VPN A;  3IO6 A;  3MPL A;  2GHA A;  1SQY A;  1ELJ A;  1MQG A;  1N7W A;  5AE4 A;  2FIX A;  2VD3 A;  1MH3 A;  5CI5 A;  1B7Z A;  5EHS A;  4I8C A;  3UGW A;  1AWB A;  3EF7 A;  4OFO A;  2Q2C A;  1YYZ A;  4IY6 A;  3SEV A;  2REJ A;  5CMB A;  1SD3 A;  1VSO A;  1ZJL A;  1DTZ A;  4R75 A;  1R1N A;  3FVG A;  1WOD A;  1NV2 A;  3RPW A;  4N6K A;  4YKK A;  4I3E A;  4N17 A;  5J1D A;  2GH9 A;  1ZU0 A;  3EKI A;  3MVW A;  3OO6 A;  4QFP A;  2Z8D A;  3MZ9 A;  1M5F A;  4OVS A;  4ZEC A;  4YKP A;  2X7Q A;  3FUZ A;  1B7U A;  3P7I A;  4DIG A;  4BDN A;  3TTK A;  2O1M A;  3MST A;  5AA2 A;  5I2N B;  4PFT A;  4PE5 B;  2XXK A;  3O9P A;  2F34 A;  4M4G A;  2DSF A;  3IJX B;  1MY0 A;  3VLV A;  3SDF A;  4PE3 A;  4U22 A;  2I6E A;  2Z22 A;  5FHN A;  4LQ5 A;  1A8E A;  2GQ1 A;  2ZNU A;  1D4N A;  3A3U A;  5I2N A;  2V3Q A;  3CIJ A;  3B6T A;  4UA8 A;  3N5L A;  1IEJ A;  2XXT A;  2DQV A;  3K6V A;  3KJ7 A;  4ZEK A;  2PX1 A;  3VXC A;  5TPA B;  1FRP A;  3B6Q A;  1IMA A;  4EDP A;  1S9T A;  1H76 A;  2RC7 A;  3A09 A;  1B32 A;  1SPI A;  3PUV E;  3MUQ A;  3KJT A;  4O3A A;  1LBZ A;  4GWZ A;  3EN3 A;  3QSL A;  1NNF A;  3PUZ E;  4X48 A;  4HE0 A;  1B40 A;  5A5X B;  2NUV A;  1JVY A;  4NG7 A;  4RPO A;  5AA2 B;  3RT6 B;  3FV1 A;  3LSW A;  3PD9 A;  3W9W A;  2V25 A;  2UVJ A;  1IUD A;  2OCU A;  1B58 A;  4N8Y A;  4GL0 A;  4GWW A;  5CMC A;  1B5J A;  4H6D A;  3LR1 A;  2E0S A;  3M3L A;  3G3I A;  4OHN A;  1LB8 A;  1US5 A;  4KR5 A;  1XS5 A;  1NUW A;  3KC0 A;  2UVI A;  1NV1 A;  3UA8 A;  2F97 A;  4OES A;  2OZZ A;  4GIZ A;  1NV6 A;  2DE2 A;  4FAT A;  1FTA A;  1F9B A;  3OSR A;  2O7I A;  4MMP A;  1LEV A;  4GWU A;  1FCK A;  1VFD A;  4G8M A;  1EYI A;  2PVU A;  2VP1 A;  4HXV A;  1IQ7 A;  4NF4 B;  1FPI A;  4MJO A;  3T93 B;  3TZA A;  4EUO A;  2DVC A;  4LP2 B;  1UTB B;  3IOW A;  1OVT A;  3H3G A;  3VVD A;  4N13 A;  1KA1 A;  1M5E A;  1G0H A;  5DT6 A;  3FV2 A;  3O66 A;  2FBP A;  5K2Y A;  1QJM A;  4LN5 A;  3I6V A;  4OVP A;  5I5P A;  3FJ7 A;  4R73 A;  4QFK A;  3VVE A;  1R9Q A;  3MYU A;  4LVQ A;  4I62 A;  4ZE8 A;  3SEX A;  1FJ9 A;  2WKY A;  3IOV A;  3IX1 A;  1N3X A;  2OWT A;  4ESX A;  4MX6 A;  3FGS A;  3VXB A;  3ZSF A;  2ABH A;  5FTI A;  4ZEI A;  1D9Y A;  5DEX B;  4I40 A;  5I2K B;  4L17 A;  4EQ9 A;  1RDY A;  1A7L A;  1JNF A;  4DDD A;  5F7V A;  1JVX A;  2CZI A;  1FSA A;  3B6W A;  3TCG A;  3VDF A;  3DP8 A;  4QSE A;  1SW2 A;  4R6Y A;  2F6P A;  3C31 A;  5H8S A;  2RF1 A;  1FQE A;  4HW8 A;  2F35 A;  2F78 A;  2VD2 A;  4POX A;  2B3F A;  4N6P A;  1B51 A;  1R9L A;  3CFX A;  1SYH A;  2BJJ X;  3TDJ A;  1SVX B;  3K2D A;  2CEY A;  1EH3 A;  1SW5 A;  1FTO A;  1N7X A;  5FHM A;  2OWZ A;  2XXX A;  3FJM A;  1FBH A;  2ZZV A;  4GBV A;  3IOR A;  4YKJ A;  2QS4 A;  1YPN A;  2AL4 A;  1QGX A;  5EYG A;  3VLW A;  2AL5 A;  5H8Q A;  3USD A;  4P56 A;  2PMS A;  1XI6 A;  3IR1 A;  3KSX A;  5L9S A;  5I57 B;  5HM4 B;  3PPO A;  2OK2 A;  4TQU Q;  2Y84 A;  1DK4 A;  1PC3 A;  1FPE A;  1JP4 A;  4R72 A;  4ELQ A;  3C35 A;  4YKI A;  3DLN A;  1QKB A;  4H5G A;  4P9K A;  4BDQ A;  2MKZ A;  3I3V A;  1XC1 A;  5L9O A;  3TTN A;  3FXR A;  4DZ1 A;  3SKP A;  3MJN A;  1B6H A;  2HAV A;  2Q2A A;  4JBZ A;  1A54 A;  3GYY A;  1B9J A;  4R2F A;  1IXG A;  5TP9 B;  4QFN A;  1FPD A;  1B2H A;  4QBA A;  3N26 A;  4FED A;  4PAI A;  1B4H A;  2O69 A;  3U92 A;  4F2Q A;  1N76 A;  4U23 A;  3T9H B;  4PGP A;  4R9F A;  3C34 A;  1Q35 A;  1ANF A;  1B0H A;  5AA2 D;  3EQ1 A;  5TP9 A;  4C1U A;  4O3C A;  1JW4 A;  3L6G A;  1JW5 A;  3RUM A;  4PP0 A; 
#chains in the Genus database with same CATH homology
 3KN7 A;  4YMA A;  4IGR A;  2PT2 A;  3T22 A;  5B7D A;  3ILT B;  3PPQ A;  1UIU A;  3VE1 B;  3TTM A;  4C1T A;  4OFL A;  3MPK A;  2Y7P A;  3O28 A;  3QK6 A;  4KQP A;  4RYA A;  1BP5 A;  4U2R A;  4KFQ A;  1QUI A;  1AL3 A;  1J1N A;  1URG A;  4XIG Q;  3UIF A;  2DYX A;  2I3W A;  2NWJ A;  1UIV A;  2XXI A;  1UTH B;  3TAJ A;  4U1Z A;  1NNT A;  3RTW B;  4KHZ E;  1H43 A;  1CE2 A;  4JSO A;  4PQJ A;  1N04 A;  3CRB A;  3TUS A;  3B7D A;  3H6V A;  1MXU A;  2O51 A;  3HN0 A;  3KBR A;  1B4Z A;  1DSN A;  1MM6 A;  3KG2 A;  3TMG A;  3PPP A;  3MW0 A;  4E0X A;  2H25 A;  4IO5 A;  1O64 A;  2B3B A;  2PBW A;  3SEU A;  3PPN A;  1MY2 A;  2ANJ A;  3QUF A;  4F18 A;  4LZ7 A;  2I4B A;  2V93 A;  5BWJ A;  4QFO A;  4G77 A;  4MH5 A;  4PFY A;  1MRP A;  4F39 A;  3D4C A;  2O6A A;  3MP8 A;  2DE4 A;  2VGQ A;  2QS2 A;  4DXC A;  3RGY A;  1QUL A;  1MXV A;  4BDM A;  1CB6 A;  1PBP A;  2O7U A;  2ZMB A;  1A8F A;  3O29 A;  1NFT A;  4EQ7 A;  4X1D A;  4FAJ A;  2I48 A;  3EPE A;  4HTG A;  4X9T A;  5HPQ A;  5ELV A;  1B3G A;  1MH4 A;  3K1M A;  5LOM A;  4MF3 A;  2AYS A;  3GZG A;  3H6T A;  3FJG A;  5IKB A;  1B3H A;  2Y7K A;  4F29 A;  1URD A;  1EU8 A;  1LFI A;  1LST A;  2XXQ A;  1B1X A;  2D3I A;  4FE8 A;  5CRY A;  1Y4C A;  2ONK E;  2UVH A;  4GF8 A;  5I84 A;  4P0I A;  3T66 A;  3DP6 A;  3HST A;  5JTY B;  3VLU A;  3F11 A;  3O6H A;  3W9V A;  1LFH A;  5I58 B;  4LON B;  3OO9 A;  1TFA A;  3I5O A;  2UYE A;  3LSL A;  4RK2 A;  3S4U A;  2REG A;  1FQD A;  3IO6 A;  1ZLQ A;  2ONR A;  3MPL A;  2GHA A;  3PUW E;  1SQY A;  3R7X A;  1B5H A;  1ELJ A;  3JZJ A;  1GTK A;  2ZYO A;  4DCX A;  3S9M C;  3EHS A;  3JV9 A;  3Q28 A;  3TCH A;  1MQG A;  2RKM A;  2V3U A;  1BIY A;  1N7W A;  3IAZ A;  4FIM A;  3TQL A;  1AOV A;  5AE4 A;  3MZ1 A;  3RY3 A;  1MS7 A;  4G8N A;  4ONY A;  3G3H A;  4ESW A;  2RCB A;  2I4C A;  2XXV A;  4ZDM A;  2VD3 A;  1MH3 A;  3PU5 A;  5CI5 A;  2P0S A;  5JTY A;  5KZT A;  1NH7 A;  3FD3 A;  3L6H A;  4F3P A;  1B7Z A;  1I69 A;  3IJO B;  5EHS A;  1T0K A;  3OO7 A;  2NVU B;  2F6G A;  1Z7M E;  1JEV A;  2F7B A;  1B3L A;  1Z7N E;  2QJE A;  3EF7 A;  3K1N A;  4I8C A;  4OFO A;  4G8H A;  4FEC A;  2Q2C A;  3U94 A;  5K2X A;  4IY6 A;  5M2V A;  2R6G E;  2QMX A;  1NKX A;  4YU0 A;  2REJ A;  3SEV A;  5CMB A;  4KYD A;  4E0W A;  4PET A;  2XHD A;  1SD3 A;  2O84 X;  1MXZ A;  3OEN A;  1VSO A;  1ZJL A;  2DE3 A;  5BUU A;  2F8D A;  3G3K A;  1DTZ A;  4R75 A;  2QL3 A;  2FNC A;  1R1N A;  5EHM A;  1A99 A;  4C0R A;  4LZ8 A;  4F2O A;  2VHA A;  4H0W A;  1WDN A;  3FVG A;  4F22 A;  5TPA A;  1WOD A;  3V83 A;  4G4P A;  1P1Q A;  3RPW A;  5I59 B;  3FVK A;  4MFI A;  4YKK A;  4JXI A;  2QS1 A;  2Q88 A;  5J1D A;  2DXR A;  4ZS9 A;  2GH9 A;  4QFL A;  1ZU0 A;  3MVW A;  1MPC A;  1BKA A;  2XXW A;  3TQW A;  3OO6 A;  4QFP A;  1Y20 A;  3E3K A;  2Z8D A;  3MZ9 A;  1M5F A;  4ZEC A;  2Q9T A;  3CVG A;  1B5I A;  1URS A;  1DPP A;  4IGT A;  4YKP A;  3R26 A;  3OD7 A;  3ILU B;  2X7Q A;  1OLC A;  2B65 A;  2OBG A;  2V84 A;  3PUY E;  4R6K A;  3FUZ A;  1B7U A;  4GFR A;  5DVI A;  3CSG A;  4RPN A;  2YPN A;  5CM6 A;  5KCJ A;  5I59 A;  1N84 A;  1MY4 A;  2GRV A;  3P7I A;  4GD5 A;  2XX8 A;  4DIG A;  4BDN A;  1P1W A;  2I0C A;  3PV0 E;  3EHT A;  3GBB A;  3TTK A;  4ZED A;  1LAG E;  1FQC A;  2O1M A;  4LA9 A;  5AA2 A;  5I2N B;  4FJP A;  4PE5 B;  4PFT A;  1POT A;  3O9P A;  2RC9 A;  1MQD A;  2F34 A;  3KN3 A;  4G68 A;  3C36 A;  3M8U A;  4M4G A;  3K01 A;  2DSF A;  2Q89 A;  4BLA A;  4R6H A;  5B70 A;  3IJX B;  1MY0 A;  3OOA A;  1MQH A;  2D5W A;  1LAX A;  2QRY A;  1JW1 A;  1LBB A;  1B46 A;  1LAF E;  1PB7 A;  3IOT A;  3OSQ A;  4LUB A;  3VLV A;  2HZL A;  2XXH A;  4FOR A;  3SDF A;  4WKM A;  3WAE A;  4U22 A;  4IO4 A;  4XKN A;  4O3B A;  2I6E A;  2Z22 A;  3T9X B;  4EXL A;  4F3B A;  1KWH A;  5FHN A;  5KCJ B;  1D9V A;  4IO2 A;  5TU0 A;  1N0T A;  4IO7 A;  1A8E A;  4LQ5 A;  4OET A;  2CZL A;  2ZNU A;  3HO7 A;  2XD3 A;  3OEL A;  1D4N A;  1UQW A;  3A3U A;  5I2N A;  1US4 A;  1ATG A;  1OLA A;  3KGC A;  4OFJ A;  2V3Q A;  3VV5 A;  4KCD A;  4BDO A;  3CIJ A;  3B6T A;  4UA8 A;  3E4R A;  3N5L A;  1A40 A;  1IEJ A;  2XXT A;  1VFE A;  4ZZA A;  1XT8 A;  2DQV A;  1ZMG A;  4KYE A;  3O2A A;  3K6V A;  4IY5 A;  2HCA A;  3KJ7 A;  4ZEK A;  2PX1 A;  2X7P A;  3U72 A;  1Q1K A;  1YTV A;  4RK9 A;  5TPA B;  3VXC A;  3WAF A;  3B6Q A;  3GBA A;  2RCA A;  3KOS A;  1YCJ A;  3LSF B;  3TKD A;  3UN6 A;  4MLQ A;  5A5X A;  2XD2 A;  4R2B A;  4EDP A;  1S9T A;  3RT8 A;  4LQ2 A;  2YJP A;  1OVB A;  1H76 A;  2F7C A;  1NH8 A;  2RC7 A;  3PMV A;  1BTJ A;  3A09 A;  1FQB A;  4H67 A;  1B32 A;  4NE4 A;  3H6U A;  4GL8 A;  3S2V A;  3UOR A;  5ICQ A;  3PGF A;  1PB8 A;  3MUQ A;  3PUV E;  2G93 A;  3KJT A;  2ZXT A;  4O3A A;  4DXB A;  3LBS A;  4NF5 A;  1AMF A;  4R74 A;  1L5T A;  4GLI A;  2DWI A;  3IB1 A;  4YB5 A;  1FTM A;  2OLB A;  4OTE A;  3DM0 A;  2P1S A;  2DS9 A;  3EN3 A;  1B1H A;  3H03 A;  5AA3 A;  1H3D A;  1NNF A;  3PUZ E;  3QSL A;  1Y4T A;  2Z23 A;  2R9J A;  4RY1 A;  4X48 A;  4MLV A;  3QXM A;  1B40 A;  5A5X B;  2NUV A;  2GHB A;  2HFB A;  1PDA A;  1JVY A;  3S9N C;  1FQF A;  4RPO A;  1BLF A;  4H1X A;  5L9M A;  5AA1 A;  4GOT A;  1B3E A;  1QUK A;  1SDX A;  3RT6 B;  3V5A A;  2QSX A;  3FV1 A;  3TCF A;  1MXX A;  3S9E A;  2FYI A;  4G68 B;  1USY H;  4U4S A;  4NTL A;  1MQI A;  4NF4 A;  1MM7 A;  1ZBM A;  4XKR A;  1DOT A;  3KFM A;  3LSW A;  2W7Y A;  3PD9 A;  4ZZE A;  3W9W A;  2IA4 A;  2V25 A;  2I49 A;  1EZO A;  2QS3 A;  2UVJ A;  1IUD A;  2ONS A;  4K3F A;  2OCU A;  1HSL A;  1D3K A;  3TOD A;  3BFT A;  3TFL A;  3K6U A;  4Q0C A;  3KN8 A;  4TLL B;  4R9G A;  4WEP A;  3K6X A;  4F1Y A;  5AA4 A;  4F19 A;  2KLF A;  3FAT A;  3QUJ A;  2NXO A;  4Z0I A;  1B58 A;  4GL0 A;  4HS7 A;  4OQO A;  3GLB A;  3TEL A;  5CMC A;  1LLS A;  5DYH A;  1B5J A;  2RC8 A;  2AIX A;  4H6D A;  4KI0 E;  1XVY A;  1HSE A;  2IEE A;  3N94 A;  3LR1 A;  2E0S A;  3M3L A;  3G3I A;  3IO4 A;  1AH5 A;  5ICT A;  4JDF A;  3D4G A;  2Y7I A;  1NNP A;  4OHN A;  5DVF A;  1LB8 A;  3U1O A;  4EF1 A;  2M8C A;  3OEK A;  5CMK A;  1US5 A;  3UGW A;  3V89 B;  4GXS B;  4M1V A;  5CBS A;  3K02 A;  4KR5 A;  1RYO A;  2A5S A;  2F5X A;  2XX9 A;  1I6B A;  3CFZ A;  1XS5 A;  5AA4 B;  1II5 A;  5I56 B;  4X1B A;  2UVI A;  3DP4 A;  3UA8 A;  2F97 A;  3KZG A;  5F1Q A;  1S7Y A;  3EHU A;  4OES A;  2CMO A;  2OZZ A;  1TT1 A;  2HZK A;  3FVO A;  4GIZ A;  2HQ0 A;  2DE2 A;  1B0L A;  4NF5 B;  4FAT A;  1RKM A;  2XXU A;  4ELR A;  5CBR A;  3S9L C;  3TEP A;  1OQH A;  2THI A;  3TTR A;  1TFD A;  1F9B A;  1VR5 A;  3OSR A;  2O7I A;  2HEU A;  4P11 A;  4HCW A;  4NF6 A;  3LSX A;  3MVY A;  2Y7R A;  3OMB A;  3SET A;  4XTC Q;  3CSB A;  2I0B A;  1FCK A;  1H45 A;  1VFD A;  1ZKB A;  2V3T A;  1OIB A;  1XVX A;  4G8M A;  4GQO A;  4Q30 B;  3ZKK A;  2PVU A;  5I2K A;  2Z8E A;  5I56 A;  2XXY A;  3KSJ A;  2VOZ A;  2VP1 A;  2Z8F A;  3MVX A;  4IO6 A;  3LC8 A;  4NF8 A;  1NL5 A;  4ZEB A;  3SEW A;  1FTJ A;  4F1V A;  4PFW A;  1IXH A;  4TLM B;  3A3C A;  1IQ7 A;  4NF4 B;  3MP6 A;  1USY E;  4JSD A;  3T93 B;  3TZA A;  3CR9 A;  1DTG A;  2DXY A;  2G29 A;  3HV1 A;  3IOU A;  3H06 B;  4EUO A;  4ZE9 A;  1QKA A;  3GXA A;  2DVC A;  4I1D A;  4LP2 B;  1UTB B;  1IIW A;  3IB2 A;  3IOW A;  1OVT A;  5AA2 B;  2H98 A;  3H3G A;  1WVJ A;  1H44 A;  3VVD A;  4EXK A;  4N13 A;  1TWY A;  4Z7E A;  4OXV A;  4UAC A;  5DVJ A;  1IIT A;  1P99 A;  1M5E A;  4NWC A;  5DT6 A;  4YB7 A;  3FV2 A;  1O7T A;  3K1P A;  1N3W A;  3O66 A;  5K2Y A;  4ZEF A;  4OZ9 A;  1QJM A;  1IXC A;  4RJZ A;  3I6V A;  5L8D A;  2XXR A;  2A5T A;  4KCC A;  4DCY A;  5KDT B;  2E1S A;  3G3G A;  5IAI A;  3M3F A;  1LAH E;  4QRZ A;  1VE4 A;  3FJ7 A;  4R73 A;  2NOO A;  1GVC A;  3VFJ A;  1MQJ A;  2ZYN A;  4F1U A;  4Q8R A;  2FA7 A;  2H9B A;  4QFK A;  3VVE A;  1R9Q A;  1UTB A;  3RN8 A;  3IL1 B;  4LVQ A;  2X26 A;  4I62 A;  5DEX A;  4ZE8 A;  3SEX A;  3O6I A;  2WKY A;  5JK4 A;  4RA1 A;  3SEY A;  1SI1 A;  2YLN A;  3IOV A;  1ZTY A;  3RQT A;  1M5D A;  3IX1 A;  5FTH A;  3OXN A;  1POY 1;  3TYH A;  1N3X A;  2F36 A;  2OWT A;  4IB2 A;  4HCY A;  2DWA A;  4ESX A;  3K0V A;  2ZNS A;  3FGS A;  3VXB A;  1A55 A;  3H7M A;  3ZSF A;  1LFG A;  1S50 A;  3CI8 A;  3R6U A;  4RXL A;  2Q8J A;  2ABH A;  1YAE A;  3ZS6 A;  1Y3N A;  5FTI A;  3BKI B;  4F3S A;  4NF6 B;  3E9X A;  1MY1 A;  1LCT A;  1LBC A;  1MPD A;  2UVG A;  4ZEI A;  1D9Y A;  2H5Y A;  5DEX B;  3BFU A;  5I2K B;  4GVO A;  5H8Q B;  3HHG A;  1DPE A;  5FHO A;  4L17 A;  4NF8 B;  4JB7 A;  5EYF A;  4EQ9 A;  1TXF A;  3G3F A;  2DWJ A;  3H4Z A;  3DEL B;  4KYS A;  1Y9U A;  1A7L A;  4U1O A;  2DP8 A;  4XXU A;  4AQ4 A;  1JNF A;  1JEU A;  3CG3 A;  3KEI A;  3QYT A;  4DDD A;  1GV8 A;  1FTK A;  5F7V A;  3OO8 A;  2LAO A;  2O1L A;  2PT1 A;  4ELO A;  1JVX A;  1EZP A;  3B6W A;  1OQG A;  2GFE A;  4P0G A;  3TCG A;  4QSC A;  3VDF A;  1MPB A;  1NNK A;  3ODB A;  3AXF A;  3RNN A;  2HXW A;  3DP8 A;  4KD5 A;  4QSE A;  1RYX A;  2QPQ A;  4OEU A;  1SW2 A;  1O63 A;  3C32 A;  3K00 A;  4R6Y A;  2F6P A;  4FEB A;  4U4X A;  3C31 A;  3KOT A;  3H6W A;  5H8S A;  3U93 A;  2R71 A;  2RF1 A;  1FQE A;  4AB5 A;  4DE8 A;  3E13 X;  1P1O A;  3TTL A;  3U8Q A;  2F35 A;  4HW8 A;  2A5T B;  4ELP A;  4F31 B;  5KDT A;  2XXP A;  5JEI A;  2F78 A;  4YAH X;  5ISU A;  1I6A A;  3MZB A;  1B05 A;  3CG1 A;  4U21 A;  2VD2 A;  3RTF B;  1QVS A;  4POX A;  1PEB A;  2B3F A;  1Y3Q A;  4N6P A;  3FAS A;  1B51 A;  3FVN A;  2ZNT A;  1R9L A;  3FXQ A;  3HPI A;  4WXJ A;  3G7W A;  3K6W A;  3MBP A;  3CFX A;  1SYH A;  2BJJ X;  3TDJ A;  1SVX B;  3C4M A;  3K2D A;  3MQ9 A;  4RNS A;  4YIC A;  3SER A;  3T96 B;  1EH3 A;  1NMU A;  1SW5 A;  2DVZ A;  3IB0 A;  5ITO A;  2PYY A;  3PMW A;  1FTO A;  4QF9 A;  3FZV A;  1N7X A;  5FHM A;  3G3J A;  4AB6 A;  2XXX A;  3OEM A;  3FJM A;  1MXY A;  3PD8 A;  4GRK A;  4N07 A;  4YMB A;  3IOR A;  4OYV A;  4OWD A;  3N6U A;  2UYF A;  5H8N B;  4YKJ A;  3HHF A;  2HAU A;  2QS4 A;  2UXA A;  1YPN A;  3UK4 A;  2AL4 A;  4I9D A;  4NED A;  3Q29 A;  1LGB C;  2AL5 A;  4NMY A;  3FXU A;  3TPA A;  3VLW A;  3QAX A;  4OEN A;  5H8Q A;  1M5C A;  2PMS A;  3IR1 A;  3KSX A;  3PMX A;  3USD A;  5L9S A;  4ISU A;  5I57 B;  5HM4 B;  1GR2 A;  3PPO A;  3PUX E;  3Q25 A;  4LAT A;  4QHQ A;  1LCF A;  4JWX A;  1SW4 A;  2OK2 A;  2P2A A;  3MWB A;  2Y84 A;  3O6G A;  4OEV A;  4OER A;  2ZYM A;  4TQU Q;  5CMM A;  1PC3 A;  5HBC A;  2ALU A;  1JQF A;  4R72 A;  3Q26 A;  4ELQ A;  1PB9 A;  4ND9 A;  5H8N A;  3ONM A;  3C35 A;  4BDL A;  4YKI A;  1MY3 A;  2I3V A;  3DLN A;  5DTB A;  1QKB A;  1FQA A;  1P1U A;  2D21 A;  4YZZ A;  4H5G A;  1AIV A;  4GXA A;  1R6Z A;  3ZKL A;  1UTH A;  4BDQ A;  2I58 A;  3I3V A;  1QUJ A;  4BDR A;  1XC1 A;  2Y7W A;  3QIM A;  5L9O A;  2O68 A;  1P1N A;  3ECR A;  1XOC A;  3Q27 A;  3TTN A;  4H65 A;  3FXR A;  4WED A;  1Y3P A;  4DZ1 A;  4EQB A;  1B3F A;  1ZIU A;  3SKP A;  3VVF A;  1EZ9 A;  1GGG A;  3MJN A;  1B6H A;  5ITP A;  2HAV A;  2Q2A A;  4JBZ A;  1MDQ A;  4JWO A;  1A54 A;  1IZ1 A;  3CFL A;  3C9H A;  1HSJ A;  4THI A;  3RLF E;  3W15 C;  2ZYK A;  3THI A;  4OMB A;  1B9J A;  4IO3 A;  4Q5T A;  4F3G A;  1I6Q A;  2H4I A;  3BBR A;  4R2F A;  1IXG A;  1Y1Z A;  2QMW A;  1OMP A;  3LUY A;  2H99 A;  4G68 C;  4PFU A;  3IK6 B;  4GWO A;  1FTL A;  4QFN A;  4XKQ A;  5TP9 B;  3V8X B;  1B2H A;  4MBP A;  5H8F A;  4H5F A;  3N26 A;  4FED A;  1Y1M A;  4YB6 A;  1SBP A;  1B4H A;  2O69 A;  3SES A;  3U92 A;  4DLD A;  1LB9 A;  1FW0 A;  4OVJ A;  3MC2 A;  4EF2 A;  5H8H A;  4F2Q A;  1IXI A;  1N76 A;  3C33 A;  2DWH A;  3M3K A;  4G2Z A;  4U23 A;  2OJT A;  4XKP A;  4KPT A;  3T9H B;  4ECF A;  1XHY A;  3PPR A;  4NWD A;  4R9F A;  3FIR A;  3HCQ A;  1SI0 A;  3JYR A;  3MVZ A;  3T9U A;  1JET A;  1DMB A;  2ESN A;  2F7A A;  3C34 A;  4POW A;  4TOZ A;  1Q35 A;  4QSD A;  1MXW A;  2RIN A;  1ANF A;  1B0H A;  2OWS A;  4H8I A;  4JWY A;  3UP9 A;  5AA2 D;  1MG1 A;  1M5B A;  3EQ1 A;  4LZ5 A;  1SYI A;  5TP9 A;  1SW1 A;  4C1U A;  5H8F B;  1MDP 1;  1PBQ A;  3MAM A;  4DXU A;  5I58 A;  3O97 A;  1B7H A;  3N6T A;  4O3C A;  1JW4 A;  3T9V A;  5I57 A;  3L6G A;  4H8J A;  1JW5 A;  2XX7 A;  1B52 A;  2DOJ A;  3K4U A;  3MP1 A;  5H8H B;  5CC2 A;  3RUM A;  1QW0 A;  4PP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...