1AM4D

Complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
177
structure length
174
Chain Sequence
PQTIKCVVVGDGAVGKTCLLISYTTNKFYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P50-RHOGAP
publication title Crystal structure of a small G protein in complex with the GTPase-activating protein rhoGAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (gtpase-activating/gtp-binding)
total genus 42
structure length 174
sequence length 177
chains with identical sequence E, F
ec nomenclature
pdb deposition date 1997-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1am4D00
1UBGA 2VP0A 2FGJA 3GFPA 4KVGA 2NO1A 1LW7A 4KBGA 2GK7A 1XWIA 2VP4A 3IO3A 4GZMA 3WNBA 1NJFA 2PL3A 2AR7A 2CEAA 3RS3A 3SYNA 1W5SA 3RSLA 3LV8A 4Q1AA 4HB0A 1QF9A 5ANRB 1JJVA 1JPNA 1U8AA 2A5FA 2F43B 4OI2A 4TZ0A 1XJQA 5B58C 1G7TA 1RPZA 2GVZC 4D4MA 1TF5A 2OFWA 4NE2A 2O8EA 5JSZA 2B8WA 5GJWC 2BCJQ 4LBWA 1QHNA 3QEOA 4CEIA 1NKTA 1QBKC 4HZUB 1WCV1 4HSEA 5B64A 2CHVA 4YLGA 4CIDA 3VHLB 3SYKA 4W9MC 4BFTA 2GF0A 4B2IA 2CE7A 3LD9A 3QBVA 2BWJA 3B9QA 3R20A 2C95A 3Q9LA 5CM8B 1GNRA 5CDFA 2CL6X 1AZSC 2F7SA 3DMNA 4MRRA 2YJTD 2XJ9A 4I99A 1U9IC 3PUXA 4KBFA 1ZINA 5EE0A 2JASA 2G6BA 4PXAA 1YZKA 3N70A 2AXPA 3U3JA 2QE7A 3Q5EA 4RJLA 1GVNB 5DH9A 5JRZA 2V7QA 3OZXA 4JZKA 5GVRA 4Z54A 3EPJA 3LRPA 3QF4B 5K8IA 1FP6A 5FOWA 1ESNA 4Q4LA 4EFMA 3OEED 2R6FA 5KNCA 3TUIC 2QAGB 4V0LA 2F9MA 4M9XA 3IO5A 4CVNA 2VHCA 3O8CA 1GG2A 1DBSA 1U98A 4WZBE 2QPAA 2JLXA 3TJZA 4DJTA 4TL8A 3FMFA 3TE6A 2BMJA 4P31A 4DDTA 4ZI2A 1A5TA 1E9EA 5KUTA 4LJ8A 1KO7A 3LBIA 1DAFA 3AVXA 2IEYA 3V4RA 2BM1A 3DVLA 3RWMB 1Z47A 1EGAA 2HCBA 1E2GA 2W2VA 1ZM4A 2PX3A 1H65A 5KU1A 2IHBA 2QMOA 3L8YA 2V4ZA 4BGDA 1G8HA 1XTKA 1R5NA 2WOOA 3QNUA 4TT3A 4O0MA 2FDCA 3GEHA 4PAMA 2P65A 1R0XA 1QHIA 2I4IA 3C8UA 1RFLA 2OCAA 4Q1CA 1R0ZA 4ZDIA 3P26A 3R8FA 1Z3IX 1SXJB 4IDQA 3IHLA 1M7GA 2HXSA 2YKGA 3AVYA 1D5CA 1IN6A 1AK2A 5DN6D 1BYUA 4W5HA 4UJ3A 4LHXA 2H7VA 3RS4A 5H68A 4TMVA 2DFLA 1Z83A 1YZLA 1NVVQ 4AG6A 4LZZA 1M1YE 5JJLA 1MR3F 1GITA 1DAHA 3AGQA 1KI2A 1KYIA 1S1CA 2WOJA 2IUSA 1E2PA 1K8RA 1T6NA 2HYDA 2ZJ2A 3NKVA 4D80A 4U02A 2XAUA 1XX6A 3QBTA 4K46A 1W0JD 2N42A 1P7CA 2W00A 2AD1A 3B8HA 3QXCA 1ZJ6A 2BMFA 2KB0A 4BRWA 2NIPA 1K5DA 2GKSA 1ZU4A 3FPAA 4IOMA 4KODA 2ZPTX 4PHTA 4HATA 1WMSA 2BCGY 3HWSA 2DFNA 4C4PA 1IONA 4US1R 2NZJA 1NMYA 2CJWA 2R6DA 3EIQA 4PPGA 3U7HB 3CPEA 2W58A 5HE9A 4P32A 3FMOB 3OE7D 4P4SB 1U9IA 1Y3AA 5D3MA 1OIXA 4WOPA 1KTVA 4TLEA 4DB2A 1IY0A 2QNRA 3KQUA 3VR4A 2Z0MA 1FFHA 3L0PA 2QN6A 2RMKA 1Q3HA 3TAUA 1QVRA 3TAHA 4A2QA 1KK2A 1U0JA 1OH8A 4F4IA 4NTZA 1WF3A 1TX4B 1UDWA 3A4NA 2V6JA 3ZVRA 2C9CA 4WW0A 2ZU0C 5G41A 3T5GA 2DWQA 4RFVA 2OE2A 1DOAA 1GRNA 1XBTA 2D4HA 3M4YA 1S1MA 2D2FA 5FOUA 3KXLA 1MT0A 3M0EA 5DLQC 4AYXA 3OIUA 4Q4HA 3RRYA 3QXHA 4EJSC 4O2RA 4MRSA 2ZSEA 2C5LA 5DSZA 4WBSA 3I4LA 2QBYA 2Q3FA 4UNPA 2R6CA 4OQXA 4M1KA 4RD0A 1TF7A 3BFXA 1F2TA 1YRBA 1G6OA 3FVQA 4A92A 1EFTA 2ZITA 1Q1QA 3W3AA 4IKEA 3BH0A 1TQ6A 1NVXQ 1KDOA 2W0SA 1RKBA 2B7CA 2NQ2C 5M04A 4AURA 3NVAA 4IOKA 1MO3A 4M1MA 1YR7A 2WWWA 1NG1A 2AWOA 1IJFA 1VYTA 1JR3D 1TTTA 4MRVA 4RCZA 4M9QA 4JS0A 1LB1B 1SXJE 2WJYA 2HF8A 4BPBA 5FBQB 2PJRA 3CZPA 1E1RD 1E4YA 4WA7A 2OCBA 2W2TA 3L82B 2R6GA 4S2EA 1CS4C 1W4BA 3CO5A 3D3QA 4RD1A 4LI0A 5HKKA 1ZBDA 3ADKA 3MWKA 2ZUBA 3THYB 4DLXA 3BFVA 4PFSA 2GJKA 3U4QA 2GEUA 2WSSA 1E9FA 3AKCA 1A82A 4IVRA 2RGDA 1X8JA 2G88A 4URYR 4N0DA 4WXPA 4F4CA 2RAPA 1UAAA 1RRPA 4A8JC 1NLFA 5BWMA 3REGA 4TTQA 5DYGA 4DT1B 1E0KA 1E79D 1AQUA 4Q7KA 4Q7LA 3ZJYA 4XH9B 3A4MA 1WXQA 2L0XA 4AK9A 2A5GA 2CL7X 2NO7A 3U3RA 1SVOA 2ZJYA 2X1VA 5CLQA 4M22A 4EPWA 3CX8A 3U2QA 4LWZA 2IYYA 3GD7A 1Z29A 1X86B 2N1BA 2ZRAA 1VCNA 3AF3A 2GXAA 3EZ6A 4A6PA 1ZC4A 2Q0HA 2FA9A 4Q18A 221PA 5CITA 3QOFA 4MGKR 1RYFA 2X8AA 3RNLA 3LO5A 1GKYA 3P20A 4TMXA 3VKWA 5TXGA 4I1SA 5DGXA 3C14C 3W6NA 2CK3D 4LUCA 3FWYA 3Q72A 1X3SA 3QUSA 3EAQA 2ZS7A 1HTWA 2IS2A 4DDVA 2YOGA 4C0AC 3SBDA 4LBVA 4EJSA 4CEHA 2IYZA 4TYPA 4DC9A 1Z6GA 1YZTA 4O2LA 4PX9A 2BMDA 1GL6A 3CR7A 2IX3A 4C0LA 2F55A 4KO8A 4Q21A 3LVRE 3LW7A 4MRPA 3GLHB 5FUWA 2YYZA 2ZEJA 4GZLA 2GF9A 4D82A 3BB4A 4KI0A 3FE2A 1G3MA 3TLXA 3U3MA 4TTRA 1JQLB 4NYIQ 4CRWB 3KUCA 5DI9A 4G0NA 3JZMA 3GQBA 3L8ZA 1NP6A 4ASUA 1SVLA 3VNVA 2ZE5A 3Q7QA 1IAQA 3L2OB 2FFAA 4UQOA 1J90A 1JB1A 2H5EA 2X19A 3T1TA 2DY1A 5AK0A 2NMVA 3TSZA 4C3ZA 4HAVA 2ORWA 4EPXA 4KITB 4UNSA 1NBME 5EE1A 5HZKA 3E5HA 3IGFA 2J7PA 5JJKA 2KBEA 3LXXA 4OHXA 1W2HA 2YV5A 5AJZA 4MDEA 2OBNA 1GOTA 4F7WA 4FIDA 3IIMA 1OB5A 1M74A 5GADl 4BZXA 4GL2A 1CKEA 1D6JA 2IYLD 1Q44A 2IK8A 1W36D 2ZS9A 1ANKA 3D7MA 4A8JA 1JPJA 1GIAA 1VMAA 1EFCA 2O8CA 5FBVB 1NNEA 3U60B 2OG2A 2IUTA 3HP1A 4MH0R 1ZM2A 4DXAA 4Q4AA 1XXHB 5FPTA 3UANA 3K8YA 1EXMA 1OXXK 4DHEA 3QKSB 2ZE6A 4EUNA 1CTQA 2ZU6A 3FFBA 3I92A 3OEHD 5BN4A 1KSGA 2BEKA 3P32A 4JVNA 4LK2A 4FCVA 3WRYC 1G20E 1Y63A 4G01B 4QBIA 2IUUA 4DZZA 3NHAA 4S35A 5EXPA 1XZPA 3GLFA 1G291 3RS0A 3OF5A 2P6RA 1US8B 3ZVMA 5EZ6B 2XTZA 1D8TA 2OZEA 4QGGA 2GZDA 4Q1DA 1BKDR 2QMUA 3HYRA 4W5WA 3SI7A 4BFVA 2O8DA 1DAKA 1NVVR 2OBLA 4HUTA 3RWOA 4B2LA 2IYSA 3VU9B 4OI0A 1Z28A 1OSNA 5FOSA 4LHYA 4LJ7A 2OBMA 3IBYA 3Q8XB 5JEDA 2HJVA 4HUQA 3B60A 1R2QA 2CVFA 3ZH9B 4CEJA 4OQFA 3QXJA 1BH2A 2JGNA 3EARA 1HE8B 4RD3A 1VKJA 2QU8A 2ZREA 3I1FA 4X8HA 4A6XA 1IN8A 1NIPA 4BFZA 5C2JB 5JWHA 2CCGA 2GCOA 2PCLA 2QA5A 2QP3A 1DAGA 1XNJA 3H86A 3ZZUA 1B0UA 2PH1A 1N6OA 2G83A 2WJGA 1ZD9A 1TNDA 4ZPXA 4DLWA 1LTQA 1G3IA 1H8ED 4P3YA 4DSNA 2P5TB 2ASEA 1NN1A 2ZANA 4YXWA 1JJ7A 2XGJA 1G5TA 3GLHE 5J40A 1IN7A 4HB2A 3QJYA 1SQ5A 1VG1A 2BEJA 2HUPA 5J47A 1W0KD 2PZFA 4O25A 3OFND 3QENA 1KI6B 4KLNA 2V3CC 2JJ1D 3MG9A 2BKEA 2QY9A 4JIMA 1S3GA 3LQRA 2JLSA 4XD7D 4Z8XA 1Z0FA 3FDIA 3QKRA 4H1VA 4Q47A 1YR6A 5IK2A 1JQJC 5F98A 2YWHA 2F1HA 1KDRA 3MGCA 3WP1B 3X1WA 2KE5A 1U90A 5FI1B 5BQ5A 4W5JA 2GTPA 1Q3TA 5KHOC 4PSKA 3KKQA 1OV4A 4OK6A 3OIVA 4TYQA 4QGFA 2JDIA 2Z5FA 3CBQA 3SHFA 3NWJA 1TUIA 1KNQA 4Q03A 2EFHB 3T1VA 3I73A 1AQYA 2YHSA 3A1WA 4B75A 3P27A 3QY0A 5DYIA 2VHQA 5CK5A 1Q1ZA 3C5HA 1FX0A 4DLSA 1XU4A 3AVQA 1SHZA 4WVFA 2J0UA 5KDDA 3KQHA 2OAP1 1XTRA 3CRVA 2IXFA 4HLUA 1QHSA 4PPNA 4M1YA 4U7DA 1RRFA 4V0KA 2GVDC 4QRHA 4LJYA 1Z0KA 4AD8A 3CR8A 1E3MA 1OJLA 2MSEB 3AEZA 4KFSA 4W7SA 3PR1A 2DBYA 2UVQA 4PSVA 4QBHA 4BWYA 1DO2A 4HAYA 1KKMA 2C99A 3K53A 1EG7A 1LV7A 3B1YA 1FW6A 3PCRB 1RRGA 3QE0A 5L3SB 2OUKA 1JXMA 1OFIA 5BW8A 4LJ5A 1GSIA 3KTAA 1AS3A 2A5YB 2ZSAA 1XF9A 3H0KA 4L8GA 3S1AB 1ZP6A 1GRRA 1XB2A 2ZYUX 2IYUA 3BWDD 1JAIA 4UXHA 5DI3B 1G7SA 4URZR 5IHPA 4M9ZA 2XITA 1D2MA 2REOA 4AYWA 1OB2A 1TUEA 4OKSA 4L4UA 1E9RA 3B13B 2F6RA 1HE1C 3LA6A 5HZHA 2C2HA 1NRJB 3OAAA 4LHZA 4RKFA 1OFTA 2QT1A 3CRMA 4TYNA 1FMJA 1W4CA 3K1JA 3FKSD 3KJIA 4MYHA 3TW8B 1KO5A 4AKIA 4XTRA 5EUQB 5TVKA 1I4DD 3P4XA 1D2EA 2AKYA 3PIRA 1S8FA 4EQ6B 4YMVA 1S9HA 4Z51A 1PLKA 3KDSE 5SZIA 2F1JA 4TYYA 4WAUA 1ELOA 2VP5A 4Q00A 4R2IA 4X8OA 2QAJA 2ZRMA 2IC5A 4I1VA 2GZAA 2BBTA 1XCMA 4ILEA 4LGMA 1G7CA 3LBNA 5L3QA 4LHWA 2WIAA 1G3RA 3SS8A 3Q85A 4HAZA 2D06A 4B3DA 2JATA 3EPHA 1GTVA 5H8WA 2QAGC 1OW3B 4JYBA 4US2R 2YVUA 3WHKA 1BMFA 1OKKD 4ZIRA 2YC2C 3RYTC 4B3XA 1J70A 1E96A 2X77A 2DFTA 4PAQA 4RZUA 1U81A 4HLCA 4NH0A 3ZS8A 4PTLA 3W8NA 3THXB 5BN3A 1EWQA 1DG3A 2REBA 4KFUA 1OHHA 1HYQA 1KJZA 1XZQA 2QQEA 3CUEF 4NKRA 4C30A 3RRNA 3TK1A 3WMGA 4ACAA 3F5FA 3NDPA 1VYUA 4NYIR 2B21A 2BKUA 3AF4A 1GFIA 1GUAA 2O5VA 3LAWA 5C18A 1MRNA 4YDSA 2J3EA 1AGPA 2EW1A 2V1UA 1P61B 3TRFA 1NF3A 4ZDWA 4URXR 1KMHB 4DBLC 3U3OA 4DB4A 2WPDA 2QM8A 4PSAA 2P3SA 1WP9A 5AUNB 3GLIB 1G17A 2R9VA 1QG2A 1DPFA 1SXJC 2VSXA 1DTSA 4PHHA 2WWHA 3G82C 5FL7A 4JLKA 4UJ5A 2V55B 5BXQC 1E99A 3FKQA 3I3SR 1E2IA 3ZIAA 4UKDA 2B6HA 3U7EB 1VCMA 2XZOA 1KNXA 4D0NA 2F43A 1ESMA 2IYWA 1BS1A 1XD9A 4KV9A 2ORIA 3EG5A 5JJIA 1N6NA 5C4MA 5TY0A 1UPTA 2ZI3A 2ZSDA 5KPJA 2GRJA 3B1ZA 5JBQA 3GP8A 3N2IA 2XTMA 1E4VA 1IXRC 4PQYA 1ZRHA 2Q21A 4HZUA 4OHWA 3BH7A 2AFHE 4Q4JB 3RAPR 2R2AA 2IYQA 5HCIA 1YVDA 1A1VA 1U2RA 2PMKA 1FL9A 1GKUB 4PANA 4C7OB 5G40A 3T1OA 3GFTA 2AX4A 3T61A 1KI1A 3UK6A 3VR1A 3L0IB 121PA 2F9LA 3R9IA 4B3CA 3I32A 4DIEA 5FPYA 4TZ6A 1IQPA 1CLUA 3MCAA 4IDOA 1IM2A 2XSZD 421PA 2EWWA 1TEVA 3A1SA 2QTHA 3DKVA 1JI0A 3FB4A 1EWRA 1LS1A 2NO0A 2YOHA 2A3RA 4V0OA 1NY6A 1D2NA 4GDFA 3GEEA 3QF4A 1NVUQ 5B2ZA 3SFVA 1OE0A 2VLIA 4JBYA 4HAUA 4NYMQ 3WYAA 3F8TA 4OQNA 5AUQA 2QAGA 4NYJQ 1OIWA 1YZNA 5LDDC 4HDQB 2JLQA 3X2SA 2DB3A 3QG5A 1Z0DA 3MSXA 2IBMA 4ZKDA 3SQXA 1KSJA 1T0JB 1CIPA 3KFXA 5EP2A 1RC8A 4FD2A 1Q1BA 3SJBA 4GRAA 2AL7A 4FN5A 2WWIA 3QKTA 3W6OA 4WZAE 2J87A 2ZRFA 4NCIA 4Q9LA 2WZQA 2EWVA 2RB4A 3QPWA 4YQFA 5FPSA 2QUZA 3QPUA 1M2OB 4JLVA 2BM0A 4JMPA 3GJ8A 3T35A 2G77B 2OLJA 3TR5A 4M1SA 2D3WA 4LV5B 2WIBA 4JLDA 1SXJA 5HCNA 1UEIA 1LVGA 2KI5A 4D4KA 4F92B 2WV9A 1FUKA 721PA 1JR3E 4GFDA 3TMKA 2CL0X 3VR3A 2RCNA 4RVCA 3GLIE 3WP0A 1XPOA 2J7KA 2UZ3A 1MKYA 4DLRA 1NVWQ 4PC2A 2ZRPA 1ZNWA 3MJRA 1KSFX 1CJTC 4MGIR 1XTJA 2VH5R 4LRWA 2OCPA 3DOFA 1W36B 2GCPA 2OFOA 2AD5A 2YZ2A 5G53C 2ZAMA 4F38A 3QG1A 3KB2A 5ELXA 4EFLA 3FMPB 1L8QA 2YOFA 1GP2A 2B7BA 4MITA 5CIWA 1NG9A 1E9BA 4R98A 1CJUC 1QRAA 1RVDA 2GDJA 4JKYA 3RS7A 2CXXA 1QZXA 3WMEA 2BMEA 2VHTA 4JL5A 1CULC 3WY9A 3SR0A 5JHGB 4G5QA 4HI0E 4QNRA 1XEWY 2MSDB 2XB2A 2B8TA 1PZNA 4LY6A 1IXZA 4RZXA 4QGAA 1SGWA 1DAIA 2JDID 3BH6A 1IN5A 3FFAA 1XPRA 1EFRA 2H18A 2H17A 4DLUA 4P4SA 2QZ4A 4PAOA 3R7WB 4LC1A 4PC1A 2DR3A 4M1OA 5B30A 5KOYA 3MUFA 3IEUA 1W47A 4JLJA 4ON9A 4KAXA 5EXXA 4QBFA 2IA5A 4KCGA 1XEWX 3SJAA 3CM0A 4B34A 2UKDA 2CBZA 2H1LA 4A82A 4BLQA 1EFUA 3NEJA 2OXRA 5AJYA 2VBCA 1OXVA 2C96A 4NONA 1ZUIA 2XOKD 2FG5A 3C4JA 3KQNA 1ZW6A 1COWA 1N5JA 1KJWA 1HH4A 1DO0A 2WJJA 2JIZA 1E2LA 2VHUA 3I62A 2ZRIA 4KLZA 1N0VC 3RSOA 2W6ID 4IEEA 3SYLA 1P4SA 1C1YA 4BE7B 2JLZA 2GJ8A 1VTKA 521PA 1GNQA 1NLYA 3K9LA 2ZJBA 2JCSA 2F3TA 1KK3A 3KKOA 4TLAA 5E7MA 4B6EA 3HYTA 4M0LA 4XOIA 1UEJA 4IHQA 3BK7A 2PCJA 1E2MA 1L4UA 1AJEA 4CT4B 3BIFA 1DS6A 2GZHA 5FTMA 3FHTA 2QSYA 4ZCIA 4LJ9A 4MRNA 4BQSA 2BDTA 2OCYC 1HT2E 1KDTA 1E2FA 1M6NA 2AKAB 5EUMA 1OXTA 2QTVB 3FMIA 2P67A 4TSFD 2ZSBA 2O0HA 2ZYTX 4M9SA 4QKQA 1YZGA 4AWXA 4Q9KA 1WA5A 1KZ7B 3PG5A 4QNMA 2HLDD 2WJHA 5P21A 2ZI9A 2QORA 4V02A 1U99A 5H70A 5AJWA 1KO8A 1NKSA 1II8B 2RGGA 1KZGB 2CHGA 2AK3A 4MKIA 2ZJAA 5GJBA 2FWRA 5JMTA 4LCBA 2IWHA 4V0NA 2CLCX 3MAAC 5CDFE 3BRWD 4C0QC 5IT5A 4UXIA 1XCGB 3WBKA 1UFQA 3SZRA 3THYA 4ITRC 2XNSA 4LJ6A 2OSBA 1SULA 1T5IA 4IFEA 2OLKA 2W6JD 2FX3A 2V8OA 3MWLA 2G1KA 1IHUA 2DYKA 4QBGB 2WKQA 4Q66C 1M34E 1XD2B 1UF9A 1OT3A 1V5WA 3OIWA 5D3QA 1OH7A 4Z1MD 2KSQA 3GLGB 3K0AB 2RGCA 4AC9A 1U8YA 1W4RA 3IPXA 1SVIA 4GT1A 4DT1A 1ZUNB 4TYWA 3NXSA 2ZR9A 4ZO4A 1ZUHA 3DDCA 1N6PA 1K6MA 2XB4A 3W90A 4BEBA 1CR1A 4JT4A 1UBFA 3QKUA 3TGPA 5DHAA 3ZD7A 3BBPA 3KX2A 4IXNA 3BE4A 2ONJA 4HDCA 2QRNA 1BMFD 1RIFA 4TQUS 1ZMXA 2PEYA 4QM7A 3W3ZB 1XTQA 1Z63A 2JJ2A 2TMKA 1LY1A 4C2UA 2FPMA 3C41J 3ECCA 1Q57A 3CRRA 4FMBB 1DADA 5J4KA 1WBBA 4L15A 2G3YA 4BFYA 3GJXC 4YONB 3ND9A 4XWAA 2AFIE 1NSTA 4PC6A 1AGRA 2VF8A 2XX3A 2ZE7A 3V9PA 1XMSA 1Z6XA 3PQCA 2DWOA 3VR2A 1KAOA 2ZRGA 3L0OA 3B9PA 4EIWA 5J4VA 2X2EA 3THOA 1K5GA 2BVNA 2ERXA 3SC3A 4EAQA 3U6KA 2FFBA 1EX6A 4GOKA 2RH5A 2BJWA 2WKRA 5JCPA 4P4TA 3VAAA 2C77A 3KKMA 5FR2A 1H8HD 4AKHA 5E7IA 4JBXA 1IOZA 3I8XA 2R44A 2PZEA 4PHGA 5EE9A 3K9NA 3GLHA 4LC0A 2ZE8A 3GJ7A 1F3OA 5FL7D 3VNUA 4QJ4A 4YMUA 1KGDA 3TQCA 3AVOA 5SZJA 4HDOB 3CF2A 3T06B 1QHXA 4BUJA 3I5YA 1IY1A 2O8BB 2ZR0A 3QSYA 4OJQA 2D62A 1GL7A 2Q6TA 1AS2A 1KHTA 2AHOA 3I8SA 3HR7A 1XMVA 2Z4SA 4TLCA 1TU4A 3CH4B 1N25A 2NG1A 5E4FA 1DELA 1DE0A 1KI4A 3RS2A 2PZGA 2V54A 2QTFA 1F6BA 1G8GA 2J1LA 2ZJOA 2OEPA 4MGZR 5FTLA 1KO1A 1ODFA 2D7CA 4IXMA 1EESA 5LBIA 1JAHA 3PENA 3IDQA 4C0BA 2WTUA 1TMKA 4D6PA 1VDZA 3N5CA 2OILA 3EIEA 3TH5A 4DCNA 3U44B 4NYMR 1E0AA 3B5JA 1UBCA 1ONBA 1HA3A 2O8EB 3VKGA 4K81B 1KI8A 3FHOA 1E1QA 2LKCA 4A0RA 4DUGA 3AF2A 1E2HA 3NBFA 5KO2A 3WXMA 5K8LA 4BEJA 2IF2A 4R2HA 4DCVA 1KAGA 2JAQA 3ICQB 4MUAA 2FSGA 1TADA 3KXKA 1S96A 4IEIA 4N3NA 5J4YA 4TWZA 4I1OA 3ZVNA 1PVOA 3EASA 2AXNA 4TL9A 1FTNA 5EXSA 4C0KA 1Z07A 3D6TB 4G3XA 5LB4A 1DAMA 2GAOA 2NPFA 5KDLA 2CNWA 1XXHA 2PX0A 4G5GA 4LDJA 5HTKA 3GLGE 1UKYA 3QKSA 4I81A 1U8ZA 3PUYA 3GMTA 3A4LA 3NH6A 3KXIA 3ND8A 5GJCA 4NCNA 2FOLA 5JWRA 1ZM3A 3E2IA 3E1SA 3RC3A 1KI3A 4KYUA 1QHHB 1FP7A 1US8A 1J8YF 2QE7D 3EA0A 4JLBA 4GSYA 5SZKB 2OXCA 4XVRA 2CMKA 2YNMA 3L0SA 2V7QD 1GKIA 4GP6A 1P3JA 4WXRA 3UMSA 3ZLJA 3CZQA 5J5CA 2QRZA 3VKHA 1S2MA 1T5LA 1W1WA 4BZPA 1N2CE 3VU9A 3TSOA 4ARZB 5AWFC 1RJ9B 1E9SA 1F48A 1G4AE 3CNNA 3KKPA 3ADBA 2BC9A 1XEXB 4BZQA 2YWEA 4NL4H 4ZDKA 1P9RA 1ZD1A 2P6NA 4TN1A 5BYJA 5EE3A 3X1YA 2QQ0A 3LLUA 5JZVA 2BBWA 4CDGA 1WE2A 3SU8A 4AIIA 1OFUX 4TMZA 2ZRCA 4ESVA 4XSGA 1M8PA 2WAXA 3V4FA 1Z2CA 2IEZA 5FBLB 4B2PA 5FBRB 4OL0A 4A9AA 4B33A 1JBKA 1G3UA 4WZ6A 4ZKEA 3K70D 4F4JA 1X1RA 3SNHA 5IDVA 1G4UR 5BYKA 1S3SA 3GEIA 1U0LA 3AP2A 4HAXA 3EPLA 3HU3A 4IDHA 4TT3D 4ZDJA 2IS4A 1ZD8A 1XPUA 1SVKA 4MYTA 2R65A 4DCSA 3K0SA 2YINC 5E7JA 5FPHA 2FFHA 1KI6A 2EFGA 3J81k 2HT6A 2QL6A 4PPFA 4PZYA 4C0SA 1OXUA 2H57A 3NEYA 4M8NE 1N6IA 2JLVA 1VG0B 3AF1A 3OEEA 1C9KA 4OYHA 3AGPA 2PLFA 2BV3A 3IIKA 1G16A 1N6HA 3AH8A 4TLDA 1FZQA 5JEEA 2GXQA 3UWKA 2C03A 3ZVLA 4YDHB 4QHYA 4DLVA 1CJKC 3CPHA 2A30A 1YZUA 2WWXA 2AWNA 3VX4A 4D4JA 3P1JA 3B2EA 4QG7A 3ZGXA 1F2UB 2JLWA 3RC8A 5EJEA 4D25A 3AVPA 1W46A 2FF7A 4B47A 1L4YA 5GJVC 4CW7A 1TQ4A 1JR6A 5JS8A 3O8DA 5DO9A 2QENA 1KSHA 3REFA 4RKEA 2G9NA 1J2JA 1G9XA 2CVHA 1NN3A 2ODNA 2EFEB 5FOXA 1LNZA 2CLSA 1Q20A 3BS4A 8OHMA 3W9YA 2ZXUA 2PEZA 3GPLA 4EPTA 3KJHA 5DN6A 1XTSA 3THWB 2F1IA 4DWJA 1N0WA 4KVAA 4MDFA 2Z43A 3KKNA 1CF4A 2GILA 2RKOA 1N3BA 1WB9A 3IPYA 2EVWX 4QFMA 2B92A 5SZHB 3ZDQA 1G64A 4XSHA 2VHJA 4B32A 3VMFA 2IW3A 5A5GA 3M6AA 3CRQA 4A2PA 5L3SA 4KU4A 4G5OA 2REXB 4LYJA 1G8PA 5LD2B 2DWPA 3PEWA 3Q3JB 4DDUA 2H16A 5K8TA 4Q1BA 4TL7A 4D2IA 2MMGA 1PUJA 1FQJA 1W0JA 3BFKA 3S1AA 3T34A 5DI3A 1W48A 2WBLC 1B23P 1FTSA 2QMHA 1SVSA 3BGWA 4CYMA 1UDXA 1MO6A 2C9OA 1MRSA 2HF9A 1W44A 4GOJA 4C2TA 1T8TA 1FOEB 1TPZA 2DPXA 4MUBA 1II0A 4FWIB 5AJXA 4TMTA 3TIFA 4XVUA 5KNBA 1NMXA 5AUOB 1EK0A 3IBGA 2GAAA 3C7KA 2ZJZA 2J41A 2Q9BA 1Z0IA 2LCFA 2WMNB 2D74A 4M1WA 3CF6R 4MKFA 2D7DA 3NBZC 1MV5A 3T12A 3HDTA 1Z8FA 3EZ7A 2GXUA 3QIAA 3EIHA 1J99A 3TVDA 1TQDA 2QT0A 3AQ4A 1IN4A 4Q9IA 3CWZA 4HYYA 5FH9A 5F9HA 2RGEA 4EQ6A 4KHZA 4Q48A 1CRPA 2G1JA 2PT7A 3VR6A 2VSOA 5J4LA 1AM4D 5AUPB 4D26A 1PUIA 1P73A 5KDOA 4IDPA 2GK6A 2XJ4A 1CR4A 1YJ5A 1UJ2A 1W2GA 3DO6A 5F2EA 5HPYB 1J7KA 1AKYA 1W4AA 4PC3A 5HKKD 1YR9A 3NC0C 1S4QA 3AM1A 4TL6A 3AKDA 4BFWA 3KQKA 3D31A 2WSSD 2IYXA 3GJ5A 4U5XA 4B44A 4PHFA 1R8QA 3HJNA 4MQBA 4P0TA 2A2ZA 2ZJ8A 1N6KA 3B6EA 4PC7A 3A8TA 5DHFA 4C0JA 3THXA 2XXAB 2RGNC 5CK4A 2VYFA 1GDDA 2DHRA 1TEXA 3ZS9A 1CU1A 2J59A 4RFSB 4D0LB 3W34A 4A0HA 3IQXA 4BFXA 5L3VA 1GZSA 2QG6A 1FQKA 1JR3A 1KMHA 4UNRA 1QG4A 2W2XA 3R9WA 4OI4A 5EXTA 3MJHA 3GLIA 1MABB 1Q12A 3CIOA 3MWYW 5CJ2A 1J8MF 5FTNA 4AI6A 1BOFA 1E1RA 1G1MA 4PZZA 2ODBA 2RHDA 2ANCA 5JCZA 1Q0UA 4M4SA 4YMSA 5JECA 1UKEA 3KUDA 4IOLA 2Q9CA 4NU0A 3LLMA 1X1SA 2ODEA 4GPTA 3CWQA 4Y0VA 4RSGA 1WQ1R 3MRSA 4BFUA 3PEUA 4EKDA 4JT2A 5E95A 3SFZA 4ERNA 2NOAA 1DG1G 1P72A 1VHLA 3LDAA 3UMFA 2NO6A 2FJUA 3U7GA 4TMKA 3ETLA 4POAA 1W36C 3DZ8A 4AY2A 2JA1A 2CCJA 4JVLA 1AZTA 1M7BA 2WVJA 3CX6A 3TSWA 4FI3C 1NSFA 4HB3A 4TLBA 2A5JA 1AN0A 5JS7A 4OK3A 5H1YA 3LY5A 3QXSA 1NIJA 2VTKA 1NN0A 1RRCA 5FFMA 4Q4JA 4L9WA 1Z2AA 4DSTA 3QVUA 2PBRA 1E9CA 2BOVA 4PZLA 1T3SA 2HT1A 3PEYA 4C7OA 1KMQA 1NLZA 1FUUA 3KL4A 1DAEA 2YWGA 3DMDA 5IF9A 4BLTA 4CF7A 3X1XA 5E3HA 3HPRA 3PEVA 4PO1A 4ASUD 2R6AA 5TV2A 1BIFA 2GXSA 3U61B 2PJZA 2MMCA 3BERA 4FMDF 1RYHA 4HEJA 2ZI4A 4ACBA 1A2KC 1HUQA 4OHYA 3K0FB 3I61A 2O8FB 2QM7A 4EDHA 2LWIA 3RDPA 1Q1EA 3OESA 4PO8A 1CJMA 3KJEA 2FMXA 3W8RA 1AA9A 1CP2A 4C0HA 4AKGA 1DARA 1P2SA 2GCNA 3LNCA 3VHXA 2J7PD 3EC2A 4DEYA 4L5BA 4LV8B 2HXYA 2CLDX 2C04A 3EXAA 1GILA 5F9FA 3LWNA 1ZAKA 1O87A 5FOTA 4NMMA 2FFQA 2VSFA 4B35A 4UNQA 2RHMA 2FPKA 2YC4C 1ETUA 2BBSA 1CEEA 2A7QA 2H92A 1R0WA 2RGNA 3AVTA 2I3BA 1LFDB 2DCUA 2OESA 3BD9A 1HT1E 5KSYA 4AKEA 4J0QA 821PA 3B78A 3LXRA 1A2BA 5TDHA 1T9HA 1G21E 4JLNA 4MYCA 1G19A 5AJVB 2C8VA 3M1IA 4JLMA 1XRJA 1I4TD 2VP9A 4M21A 5TB5A 3WBJA 4QL3A 4BRUA 4FMDB 3L43A 4V0ME 1R6BX 4LHVA 1XMJA 5FR1A 4IW3B 3N2EA 4HAWA 1JECA 2V9PA 3U6BA 2IS1A 3WNCA 1KOFA 2WMOB 2WJIA 5JSZB 2OM2A 2ZTSA 1SKQA 2QPTA 4P33A 4E09A 5KNDA 4G5RA 4CEIB 2JLYA 3GCGA 1W7AA 2GJAA 2P2LA 1OIVA 2A9KA 2Y8EA 5CYOA 2HJGA 1ZC3A 3NC1C 4ZV4A 2H8KA 1F5NA 1G8YA 3MFYA 4YXWD 2F1RA 1BO6A 3VR5A 1T3HA 3KZ1E 3AF0A 3OEHA 3EZ9A 3ZQJA 2IYTA 2W83A 2ZRJA 3LH5A 2VP6A 1G7RA 3W6PA 4DCUA 4JVMA 2GEVA 3BORA 3BXZA 2NO9A 3AP1A 4P4UA 1W5TA 4RY2A 1ZU5A 5B57C 2GEDA 1E9DA 2CE2X 1E9AA 3R7WA 2XZPA 4QJ5A 4TTPA 2IXEA 1T0HB 1EFHA 4Q7MB 5CIQA 4DVGA 5IK2D 2ZI6A 1PLJA 3C5CA 2JLUA 3R9XA 2ZETA 3CKLA 4M53A 2FSFA 1Z6TA 3QF7A 1TAGA 1X8LA 2NGRA 1E94E 3KB1A 1ZVQA 1P9WA 5FI0B 4LV6A 4Q19A 2WWFA 1P62B 5EP3A 3AKYA 2GBLC 2ODWA 1Q21A 1YRAA 2J46A 4IDNA 1N5KA 1W49A 2VQSA 3I72A 3QVVA 1HY3A 1NY5A 4LYAA 4N0EA 4G5SA 2XTNA 3K70B 1H8EA 5FUYA 5LPNA 3ONWA 3H2YA 4NCHA 4A4DA 4C9BA 2Q3HA 1GNPA 3TR0A 4NPHA 2VL7A 3EA5A 2EFCB 2P5SA 4RZ2A 3U3KA 4EFNA 1FMLA 1WDTA 2ZRNA 1W0KA 4D4LA 4M1TA 1MO5A 3C15C 3OFNA 1E0SA 2E1RA 4ZCMA 3QEJA 2JJ1A 3K0CC 4LBYA 4L9SA 3X1ZA 4NP6A 4XD7A 2X2FA 3FHCB 4XJXA 1XMIA 1ZYUA 2D2EA 2ZRKA 1Z0JA 3WYFA 3CW2A 4QHTA 1G8FA 3E70C 4A2WA 4LPKA 4GNKA 1IJEA 1II9A 1P2UA 5FTJA 2RGBA 4K8OA 1CR0A 1YKSA 3MLEA 4LYFA 4M2LA 1II8A 3IQWA 2ZVQX 3PUVA 4OBEA 1TF2A 2OV2A 3RHFA 3BC1A 5CLLA 2EFDB 3GJ4A 5JHHB 1FNMA 4TQAA 1MH1A 2DFKB 4V03A 3NG1A 4CZ2A 2WM9B 4X8LA 3P4YA 3TW4A 2VO1A 1NBMA 3BB1A 3OAAD 2V1XA 4F93B 2IYRA 2GESA 1XD2A 2IS6A 1QHGA 2CJWB 2R8RA 3EZFA 4XIGS 3ZZTA 4MA4A 4BECA 3CRW1 1RE0A 3B82A 3GLGA 1NMZA 3K9GA 3K0AA 4QXAA 5D3MB 3T15A 2VEDA 4DEXA 2BIFA 4PQRA 1IXSB 3F0TA 1G5PA 1HQYE 2FSIA 4D0GA 1U94A 3ICEA 3ASYA 5JI2E 1CR2A 2ERYA 1PLLA 3A1UA 3WHLA 1E2EA 4ABYA 4FWTA 3LQQA 3SJZA 2XZLA 4AG5A 4CGZA 1VHTA 2V6IA 1I2DA 1KO4A 3B85A 5FUVA 4RD4A 4XVQA 5A4JA 2E87A 1YE8A 3TNFA 4Q4HB 2XNDA 1JALA 3NHBA 2SHKA 2FEMA 2GBLA 3H4MA 3GJ0A 4BLRA 4NZYA 4KYIB 4OJKA 2QBYB 2ZYWX 3VX3A 2ATVA 2EYUA 1MOZA 4H1UA 2EQBA 2Q9AA 1RW4A 3HU2A 4RZ3A 2ZM5A 1HEIA 3TBKA 1F2TB 2IT1A 3NBYC 1E2NA 4OQMA 5FTKA 4RD6A 2BHRA 1SHKA 1OYYA 3FKSA 1OHHD 1CRQA 2GJ9A 1GM5A 4ZI3A 4Q01A 3RLFA 1KDPA 1VIYA 3DOEA 2O8BA 1ZNXA 2QMEA 4EPRA 3K0CA 2NPIA 2FGKA 2FZ4A 4NDZA 4Q1EA 5TARA 2GJSA 1P6XA 3O8BA 4DIDA 4XWOA 1G3QA 2WPDD 1KKLA 2ZRDA 2J0VA 2A5DA 5EP4A 2FZLA 4LJ4A 5KPDA 1NI3A 2VP2A 2YWFA 2ZRBA 2JJ8A 5LB2A 3TQFA 4BLSA 3AVWA 1OYWA 3K9HA 3A1TA 3ZD6A 3EX7C 3SJCA 1RZ3A 5C46F 2E9SA 1TL7C 2ZROA 1NN5A 4KFTA 1E0JA 2JEOA 3DM5A 3NBXX 4FXPA 4KXFB 2QGZA 4O3MA 1N0UA 4QGHA 1V43A 4EPYA 2WWGA 1E2JA 3U44A 3ZIAD 3U4QB 4QOSA 3B1VA 1Z6AA 1KY3A 5DISB 1Q22A 3A37A 3H84A 6Q21A 1WRBA 2UZIR 3U5ZB 2Z83A 4KSCA 1OKKA 3B7GA 1FNNA 3GFOA 4OHVA 1UKZA 5A0FA 2ONKA 1OPXA 4BASA 4DSOA 1GWNA 4GOXA 5HR5A 2WWYA 4DLTA 2HYIC 4URWR 4QM6A 1CJVC 4U00A 3DPUA 3SEAA 1N6LA 2QROA 4E03A 1QDEA 4NCJA 4KSBA 1ZNZA 1SVWA 3SDZA 2J0QA 2BBOA 2VRWA 4DSUA 2NZ8A 3TKLA 5KTYA 4B3GA 1VECA 5C1BA 3PJRA 2QSZA 4LJAA 2O0KA 3IEVA 4F91B 3U7FB 3AKEA 3Q5DA 4MKHA 4Q9HA 2J5XA 3HU1A 2IWRA 3UMRA 3W5JA 1M7HA 2ZUCA 4LOAA 2ORVA 4OQLA 5JWOA 2GWHA 4PPQA 2P6UA 4NYJR 1GL9B 1Z22A 3PXGA 3UKDA 4GP7A 3AVUA 4LSGA 1UKVY 1UM8A 5FUXA 4OI1A 1E2QA 1R4AA 2NTYC 3WMFA 4DLZA 1T3LA 3UG7A 3MMPA 1OF1A 2HCJB 3KJGA 4R9UC 4IFBA 3ASZA 3OHMA 4JL8A 3K09C 1QHHA 3JZAA 4DKXA 3BAFA 4JSTA 4JLPA 4R7ZA 3JVVA 4I4LA 2ZJ5A 2WSMA 3EWSA 4LPSA 1ZM9A 5G3ZA 2WHXA 1SKYB 2ZR7A 3FYHA 1N5LA 3RRMA 3A36A 3CONA 4EJSB 4CEHB 3GJ3A 1T91A 4ARZA 1RJ9A 2O52A 4GBMA 5LD2C 4II7A 2OAQ1 1VG8A 1XEXA 2OO7A 4YMTA 1LF5A 3WNDA 3MD0A 2AK2A 2ECKA 4A36A 4TQ9A 4QC2A 4B48A 3DM9B 1X8KA 3EW9A 4I1UA 2ZQ5A 3BB3A 1A7JA 3TUZC 4FMCF 4X8MA 4E5UA 1UADA 1Z6YA 1G5RA 4A1FA 4FINA 2FEOA 1VIAA 4CT5A 3A58B 3F3YA 3R8CA 4PR0A 1ZCBA 2LKDA 3DHWC 1R8SA 2OT3B 3PV0A 1AIPA 2J45A 5J4HA 2ZI5A 4A0FA 3VTKA 1VCOA 2XSZA 3QQ5A 1F60A 1Z5ZA 1ZIPA 2QI9C 1OFHA 1X6VA 2Z6VA 4B3FX 1SXJD 4NBSA 4XWKA 3UG6A 2ZRHA 3LFUA 2C98A 3PITA 3KQLA 5CM9C 2CCKA 5IRCD 4HLUC 4FCWA 3UWOA 5GVSA 4UXJA 2C9YA 3SOPA 5C4GB 4DLYA 4ZCLA 4BLOA 1QVAA 2VIIA 5JI3E 3HPQA 3O8RA 2ZVPX 3C16C 5EE5B 3BOSA 2MSCB 4A8JB 3D8BA 2IHYA 1KI7A 2QP9X 4R71A 3G0HA 5JLJA 3CNOA 2O8CB 1F2UA 1XFAA 2IF0A 2OHFA 3I5XA 3CNLA 4Q4AB 2G0NA 2I1VB 1R10A 1JXOA 1R0YA 3DL0A 4FMCB 5KSPA 3H1TA 1HV8A 1OXSC 2F3RA 1P60A 5CYPA 5EZ5A 1D9XA 1S9DA 5FBWB 4D81A 2ZI7A 3HR8A 4JL6A 3GLFB 4E07A 1XDBA 1EFRD 1MO4A 4H9GA 5JFGA 2O8DB 3AUYA 3QPVA 2ZYVX 4JYCA 3THWA 3K09A 4FCTA 1U0HC 4XTCS 4DCTA 4Y0AA 4IJMA 4Q1FA 4NCKA 4N1AA 4A15A 4HUQB 1YU9A 4IVQA 3A1VA 3RS5A 4CEJB 5CJPA 1E6CA 1YR8A 1NJGA 4OK5A 3QXXA 2PT5A 3LX5A 2GCOB 4MYUA 4RD2A 1TQ2A 1COWD 5CB8A 1SKYE 4TMWA 1KK0A 3ZYCA 1VCIA 2JIZD 4GMDA 1FPMA 3SBEA 1DVRA 1L7VC 2HDNB 3SE0A 1XTIA 1E69A 4L16A 1Z0AA 3ADDA 3EPKA 2QP4A 2XEXA 3B1XA 1IBRA 2RGXA 3PUWA 3AP3A 1JEDA 1LF0A 2VF7A 1N5IA 4IVPA 3T1QA 2HV8A 3NTUA 4Z8YA 3SHWA 1D9ZA 1WBDA 3IHWA 3IKJA 3QKRB 3G5UA 4IOJA 1P5ZB 1XJCA 1XP8A 4PQFA 3UIEA 1P2TA 4LYHA 3SN6A 3V00A 2CDNA 1E2DA 3AUXA 1NBMD 1SZPA 3PUZA 1OH5A 2WJVA 4B76A 2XOKA 4B43A 1XCPA 3OE7A 2O0JA 1YQTA 1Z06A 2GNOA 3DEFA 4DRZA 4B74A 1A4RA 1XXHE 4HLQB 1I4LD 2W6IA 3DKPA 2RGAA 3IUYA 2FH5B 1FX0B 1VYVA 2ZIAA 3SQWA 2ATXA 1R5BA 4B71A 2J0UB 4G1UC 1C4OA 1EX7A 5FL3A 3CB4A 5HE8A 1VPLA 1E98A 4EPVA 1KJYA 3LBHA 1HQCA 4JVSB 4MKGA 5DNYB 4JLOA 1L2TA 5KSZA 3EWAA 4JJKA 4DDWA 1GAJA 3TUJC 4RCYA 2QPOA 1GRQA 5CB6A 2W0MA 3RVBA 2XXAA 4QJ3A 4YMWA 2XNDD 3K0EA 2IL1A 4HLDA 3RRZA 3NH9A 4TSFA 1BYIA 4RFSA 2R62A 1KIMA 5DIFA 4V0MA 3NDBB 3ZZ0A 4B6FA 2HLDA 3GLFE 1PV4A 2JJ2D 1IY2A 3KTAB 3LW8A 4HZIA 5EP1A 1MABA 5BN5A 5L8VA 2Q3MA 2CHQA 3UPUA 1YHNA 5G3YA 1I2MA 1ZM7A 4MGYR 4IRUB 4WIAA 3CF0A 3WRXC 2PLRA 4E22A 2FPLA 1G18A 2VPPA 4JKIA 1P75A 4UNNA 3GJ6A 1HURA 2JLRA 1UBEA 2W6JA 3WYGA 1ZIOA 3X1DA 5L3RA 4LX0A 3NIBA 3KFVA 4JBWA 4QHSA 1AS0A 1NL3A 2FSHA 3EC1A 5DE3A 4Z1MA 2BJVA 2P0EA 1OH6A 3FGNA 1Z08A 1KK1A 1T4GA 1OLOA 2J0SA 3RABA 5FPKA 4ESHA 3B1WA 3W5IA 1AKEA 2ZS8A 3PFIA 4YC7A 1R7RA 4GMXA 5TMPA 2GA8A 3UXMA 1SVMA 2QEQA 2ZAOA 3DZDA 2KWIA 1JEEA 3JVUA 3CLVA 4BFSA 1N6RA 2KBFA 4BLPA 5KSOA 2G0TA 2ZUDA 1ZCAA 4AYTA 2WKPA 2ZSFA 3MWJA 1KI9A 3IIJA 3QI2A 621PA 2VA8A 2ZRLA 4JLAA 2WICA 3CPJB 4JSYA 1P9NA 3TVTA 3UATA 2AN9A 1E2KA 1P2VA 4NHOA 1G6HA 4OHZA 2FE4A 5L3QB 2GHIA 4URVR 3CX7A 3K0FA 1E79A 2KJQA 2WAYA 3Q7PA 4GI7A 4JJZA 5JRJA 2J9RA 2A78A 2O8FA 1T8UA 3AV0B 3VQTA 5EQTA 1S0UA 3LX8A 1R5OA 4LBZA 1TU3A 1XD8A 3LVQE 2K5UA 3RANA 4ZIRB 4DUGD 1E1QD 2OFXA 3FOZA 1CXZA 3VFDA 1G41A 2EU8A 1O3YA 3PVSA 2FU5C 1H8HA 4Q5IA 4FW9A 4URUR 1E32A 2IXGA 2QGNA 2ANBA 2EYQA 3CH5A 2HEIA 3AVVA 4US0R 1DEKA 4HB4A 4Q9JA 4B3BA 3K70C 2CK3A 1LS6A 1YZQA 1XJ0A 3FTQA 5K8UA 2N46A 2IYVA 5KYKA 3OIYA 1KY2A 1QHYA 3AB3A 2C78A 1JNYA 2CNWD 1XEFA 2FNAA 2I1QA 3ZQ6A 3IILA 4B73A 5F3WB 3A6PC 5FOVA 4A0GA 3BJIC 1PJRA 1VG9B 4KFRA 5UKDA 5AR1A 3ADCA 4PO9A 3EZ2A 2FN4A 2FV8A 2PMDA 2Z4RA 4Q7JB 4KJZA 1ZNYA 4Q02A 1CBUA 2GETA 3O47A 3T5DA
chains in the Genus database with same CATH superfamily
2II6A 2VP0A 3HP4A 3NRJA 4TS9A 1IYZA 3LNTA 2YNMD 1XWIA 1JQKA 2FSSA 4GZMA 1YRYE 2AR7A 1LBHA 4P1ZA 3HJFA 4HB0A 2IZ1A 3AXTA 1FVOA 1FW8A 1O58A 1U8AA 2F43B 5AM3A 3C3WA 3MINA 3N2LA 1G7TA 1RPZA 3KTFA 2H2WA 4NFSA 4JITA 3HVUA 1EJ6A 1I51A 2FPSA 2PRSA 4NE2A 4BXOA 4OAQA 4HVLA 3VPFA 4BWGA 4D3YA 1U1CA 5C8YA 1JIIA 1H23A 1XSEA 1X9GA 4ZD6A 3TFWA 4HSEA 4O4IB 4OQPA 4YLGA 4CIDA 1O1YA 4CG3A 3FOWA 3H9BA 3SYKA 3W9SA 2CE7A 4KG7A 3B9QA 3R20A 3KQTA 5J5VA 2FCRA 4F9GA 2JFNA 1NFQA 2N75A 3Q9LA 3ZU4A 1GNRA 5CDFA 2LV8A 4RQUA 3QK7A 5T8KA 4L2IA 1PD0A 4GF5A 1U9IC 3PUXA 1KE2A 3AV3A 5I7WA 1ZINA 2DBZA 1FU4A 2JASA 1HFWA 2G6BA 2OO5C 1YZKA 2NU7B 2ZW9A 3C7TA 2AXPA 3N70A 2R1TB 3U3JA 3Q5EA 4N8EA 1YJQA 1U3TA 5TGZA 4E30A 3M3PA 3V1YA 2A0FA 4EG7A 5JRZA 2IBSA 2IPAB 2V45A 4ZGGA 1NUTA 1ISFA 4Z54A 3E7PA 1UWVA 3JSXA 4NXNB 1ESNA 2VDWA 5I7EA 3OEED 3RI3A 4CF3A 1ZH4A 2JIMA 4PNPA 2YHBA 2PDAA 1V4BA 3F5MA 3I9KA 2BTEA 2HM7A 5TS3A 3QU4A 4JU8A 1T5BA 3LBAA 3K0BA 4YO8A 3O8CA 1L8LA 4HXFB 4RVOA 2QPAA 4PYMA 4E2ZA 1D0VA 1CZOA 4KTVE 4ECEA 1SC1A 1PR6A 1G0OA 3RARA 1PR1A 3TJZA 1G5IA 3H4VA 9ABPA 2JH9A 1OWPA 1RQRA 1WCIA 1D6NA 2FEWB 1SKUA 3MMXA 1KO7A 3LBIA 1DAFA 1DIHA 1VXOA 2IEYA 2NX2A 1SD2A 1GGHA 1SZJG 4YLYA 1Z47A 1EGAA 3IHTA 1E2GA 1FDVA 1RBMA 2W2VA 2XVZA 4LYEA 2PX3A 5I47A 3TXYA 1MQ9A 3T1NA 3AZOA 3L8YA 4BGDA 4W5OA 1R5NA 1D6MA 2OZLA 3HSSA 1PZEA 4TT3A 5AT1A 1UKAA 5B3JA 1GCUA 4CI9A 4H4CA 2HN9A 4X3OA 4OHBA 5EIXA 2P65A 2FR8A 3BMNB 3IBFA 3MJCA 4QIHA 1RQNA 1R0XA 2I4IA 2OCAA 4ZDIA 4Q1CA 1DQPA 4RMNA 1Z3IX 2BR3A 4N40A 2LUOA 5FLKA 2YKGA 4RM2A 3AY7A 4LNUA 3RG2A 2GBFA 4K9NA 3UT5B 3FUWA 2NUPA 2X3FA 2R7LA 1RXYA 2KQUA 1XZDA 5GZ1A 4R2MA 4TMVA 5LOVB 2NSJA 5LZ9A 3Q9NA 1Z83A 4AG6A 3G2MA 3S7ZA 4CIAA 1MGOA 3DL7A 1U8FO 2GYVA 2XMDA 3H97A 4EVRA 5JJLA 1QLHA 2C84A 4PAWA 3DC7A 4NESA 1KYIA 1NBAA 2OY0A 4GECA 4NOJA 2I9KA 2IUSA 3W3AH 1C7ZA 5TQVA 1K97A 2IEGA 2DR0A 3R9KA 3QBTA 3WI7A 2BFWA 1W0JD 2XQFA 4IMPA 4O2BB 5T6BA 4Z7NB 3W7BA 1QO0D 5EMLA 1JU4A 5J2UA 1IPHA 4L6CA 3EK2A 3H5WA 3V7YA 3S6JA 1UUFA 4JP1A 3DDOA 1EP1B 2ZPTX 3CFYA 1HX7A 3IVAA 1JEJA 1BHSA 3BKWA 3AETB 1WMSA 3L6CA 4FYYA 4HATA 3NB0A 5M2QA 2PUAA 5EUCA 3AZPA 4HBZA 2LPMA 1PR3A 4J0IA 5DYNA 2PZAA 2QTCA 2JNWA 3OQ1A 3OMLA 5K3BA 4D46A 1YRWA 3L1UA 1H2XA 1QZZA 3TTSA 2C0PA 1EWVA 3OE7D 2Q7DA 1J39A 1U9IA 1Y3AA 2ATCA 3LL7A 2G36A 5DX0A 5G4KB 4AG3A 4DNOA 3KLBA 2OO5A 5IVIA 3KQUA 1TMYA 4REQA 4EG3A 3ZCQA 5CNJA 5MFZA 2XODA 5F77A 4M0KA 4DHWA 4WLUA 3B6ZA 1E89A 1QVRA 3TAHA 1JP7A 4EB6A 3C7AA 4QZVA 1EE2A 5JG7A 5K09A 2G76A 1GNSA 1QGZA 1KPHA 1KA9H 1W52X 3AK4A 1UDWA 4GO1A 1KGSA 3TRDA 1XU9A 2PR7A 1MX9A 2V6JA 3ZVRA 4JUAA 3VDRA 5IMSA 2H1OA 4ZGWA 1UQRA 2DWQA 3KQYA 5AVZA 1E5QA 2OE2A 4BNTA 1DOAA 4FDMA 2NTNA 2FMFA 2J0EA 1EFVB 4I8XA 3WMWA 4LDPA 3QVGB 3UC9A 4Y9TA 1SBCA 1WUKS 2Y68A 3U7RA 2X13A 3DQQA 4KQGA 3B70A 4PLGA 4AKSA 2YN2A 2C5LA 4WGFA 3QP9A 2JAOA 3QYPA 2W8BA 4AUEA 3A1EA 4WY8A 3CLSC 4XB6B 2G17A 2FSUA 1ZY2A 2R6CA 2HUNA 4UNPA 4OQXA 1U1DA 1KPGA 4PAGA 4AZ3B 5K4HA 1TF7A 3OQ6A 5TQ0A 1YRBA 3WK8A 4Z2AA 2HMYB 4JUBA 3FVQA 2F4VB 3WYBA 1QG6A 3ABRB 1CY0A 2CMFA 3RC9A 1VL0A 3ESXA 3W3AA 4G41A 4IKEA 1TO1E 2ZK7A 2H2HA 1HDZA 4C05A 2B7CA 5ILOA 2NQ2C 1IK4A 4AURA 1FEZA 1B8UA 2H63A 1YR7A 3HJBA 1T2FA 3F96A 4JJGA 3VZDA 1PIWA 5DZSA 5F33A 4H1WA 2QYHA 4MRVA 5EWMB 4Y67A 1NMEA 1VFPA 1L6IA 1GTRA 4JS0A 2P2CA 1SXJE 4OJYA 5B4VA 1C1DA 3W2GA 2HF8A 4WMLA 2DXIA 2F8TA 4PBTA 1QP0A 3N53A 1JDUA 1XZEA 1D1SA 5AOCA 3FNRA 3FTCA 3L82B 3S2YA 2HMWA 1CS4C 1W4BA 2H11A 3AU8A 2GSDA 3ETGA 4O5OA 1OA1A 1Z5NA 2RHLA 3LWBA 1USWA 3MWKA 4N7JA 1FE8A 3FSGD 3V8BA 4DLXA 4LMAA 2FEAA 3BFVA 1TM2A 2VBIA 1CF2O 3E3NA 4I9HA 3SK0A 1B8OA 1FDSA 3K9QO 2GEUA 4D6YA 5HNKA 3U4QA 1HDRA 1E9FA 1SWWA 4M98A 3WNQA 2Z6AA 1OTYA 1QGOA 1A82A 1VJ1A 4IVRA 2PQMA 2V0CA 2RGDA 3IR7A 1X8JA 4LA4A 2AA3A 4MB2A 4EA6A 4N0DA 3IURA 5C3MA 3Q0IA 2EL9A 3OJOA 1M75A 4WXPA 4F4CA 2BD0A 1YS6A 5K2MA 3AJDA 4BN5A 3FI9A 3REGA 4TTQA 3CE9A 4RE5A 4EO9A 3KSMA 2JAUA 2ZVJA 3I6ZA 4Q7KA 4Q7LA 4UD6A 4YP0A 5D7NA 1WSWA 3LDGA 2C2BA 4XH9B 1WXQA 4AK9A 2Q3JA 3HFRA 5EHIA 1M1NA 5EKSA 2X1VA 1LDEA 5CLQA 2ESRA 4KDEA 5IASA 3CX8A 2PNJA 3U2QA 1EGMB 3FNHA 3KQWA 4LWZA 5ENZA 5I8PA 2DLNA 1V96A 2N1BA 2WP0A 2Y1LA 5F7ZA 1VCNA 1N32B 3AF3A 3MSCA 4R0NA 5IDYA 2Q0HA 2ZQYA 5CITA 2VOJA 221PA 2VNSA 3EUAA 1RYFA 3B5EA 3O8QA 3RYFA 5KVQA 1IG3A 4YCLA 4WEOA 3JY6A 2J3HA 3BMOA 1QLWA 2H0AA 3EEFA 3OQHA 4PNEA 4LUCA 3QUSA 3TI7A 4BNDA 4RLQA 3S1SA 3RF7A 2XUZA 4YHBA 2DUJA 4DDVA 3H1GA 5IZ4A 2BDUA 5AKYA 4LBVA 5KCZA 2V7TA 1WPGA 1G66A 4TYPA 5EHGA 3VZRA 5ESDA 3T0IA 1TJ5A 4I4TB 1GTL1 3HBLA 3K96A 1U7OA 3IAS6 2QVXX 4I6JA 4P3KA 4RWZA 1NVTA 3OFSA 2IX3A 2GPAA 4XR9A 2F55A 2DBVO 4MRPA 1C7FA 1KJ8A 1W0CA 2WFAA 3OI7A 4ZT2A 1CS0B 1ML3A 1QR6A 1H42A 1XHLA 1L5OA 2WVAA 3G9ZA 4KI0A 1X70A 1Z0UA 4DYHA 1G3MA 3H19A 4JV5B 4GX0A 5AXDA 1QE3A 3QZUA 2QXUA 3KUCA 2B7LA 1OLXB 1ZOLA 3I37X 3MWDA 4EDFA 3A14A 3JZMA 3LT0A 2BGUA 3RUCA 1KPIA 5JY6A 2IGBA 3IL2A 2PUFA 3D8NA 4UBOA 1GZVA 4X63A 4ASUA 3UK7A 1SVLA 3SZGA 4IR7A 2YV1A 4O02B 3RSCA 3SICE 4BMYA 1L5LA 3F6PA 1H1LA 4C4ZA 4MS1A 5EFZA 4YRQA 2DY1A 2C3OA 4MS4B 5ADWA 2A0UA 2ORWA 4INZA 5EYPB 4A23A 4WBNF 2JIPA 5LN1A 2C5EA 2OXEA 3B3GA 4PQGA 1J21A 2G63A 4JR2A 3R24A 4CIBA 4D9MA 3DJFA 3GFFA 2I34A 3NHFA 1GAQA 2EXXA 5AICA 1W2HA 4F72A 1ULTA 1TK9A 3EFHA 3PRKE 1Y6JA 1PJZA 3LA8A 1N75A 1XZBA 3MT9A 4F7WA 2OHVA 4FIDA 1XA3A 2AMYA 2J32A 3WFJA 4BZXA 4GL2A 5KNDD 1X80B 2IYLD 3O1LA 1FJXA 1SU6A 3L1VA 4FD3A 4MEBA 1ANKA 2X15A 1GIAA 3EVDA 2QVZX 2I2DA 1BQ3A 1S6YA 1VIMA 2GBIA 4JLWA 1IWOA 1HSZA 5FBVB 4HAOA 3ZHZA 2F00A 3BREA 4PLCA 3ZE8A 2OG2A 5HVNA 4LFCB 3O4IA 1XXHB 2E18A 1OAOA 1Q6ZA 3H2HA 5FPTA 1QAOA 5JXGA 5KNCD 4DHEA 3QKSB 2ZE6A 2EKQA 5FA6A 1CTQA 1RD4A 1XA0A 2TMDA 3FFBA 2JIQA 3OEHD 3T3IA 3P32A 4ZHSA 1ES9A 4KR3A 3L93A 3WLEA 4MX8A 3V2IA 4HD8A 3NHAA 2L2QA 2ZR8A 5EXPA 3HYCA 4PV7A 2B35A 3VNBA 1US8B 5I7FA 4FONA 2XTZA 1D8TA 2OZEA 2JCYA 2FN7A 2V5UA 1BKDR 3U48A 1NP3A 3ZJVA 2C20A 4JFRA 4W5WA 1BN6A 4C06A 4C5CA 1TUBA 2OBLA 3JWHA 4HUTA 1CHNA 3RWOA 2IYSA 4YACA 4OTZA 2KLBA 2CJXA 1OSNA 3EEIA 3VGJA 4MQFA 3Q8XB 2IV2X 4I55B 3N0TA 4DXDA 1JWLA 2CVFA 3KYCB 4I14A 4TV8A 4OQFA 1KEVA 2JGNA 2YYYA 3ENWA 3NEAA 2X9VA 3ETDA 4MP3A 1F8GA 4NQRA 4RV5A 5I7RA 3QUQA 3NHMA 4ZOLA 1ICIA 4FYJA 1HORA 2CN1A 1FB5A 2VAVA 5F4BA 4ENWA 2WT4A 1DAGA 1HM5A 2Y0DA 3HL4A 1QQ6A 1MAHA 2GK3A 1A96A 4LRYA 1X9HA 1CQZA 3NV7A 3E2MA 5DSTA 2WJGA 3FVRA 1ZD9A 1TNDA 4K3VA 4ZPXA 1LTQA 2BTQA 2IP2A 5I4IA 4XVHA 4O4LF 4BUZA 2HWYA 2WNIA 3H4IA 2JGFA 4II2A 4WERA 4K7JA 1MXHA 3FWNA 1R4MB 5EESA 3MJEA 1E3EA 5J40A 3U26A 1A4IA 5FQOA 1C8BA 3AR7A 1VG1A 2YJ5A 5AKGA 2ONYA 1VE7A 1RAEA 3B12A 4FFPA 4MQEA 4ND6A 1KI6B 1TVKB 1RP7A 4ZARA 3IQIX 3GGPA 2PX2A 1SBQA 3I12A 2C2ZA 5DCYA 3LQRA 2JLSA 4XD7D 2PYZA 1ZGHA 3GT7A 1DUSA 1UC5B 3EGCA 5C51B 2E2WA 2VUSA 1AB6A 2DTXA 5HBRA 4XPIB 1CY2A 4X1KA 1BROA 2C31A 5GOTA 5LMNB 2KE5A 1L1FA 5FI1B 1R3UA 3INTA 4QYTA 4W5JA 5BQ5A 1VIDA 2PV0A 5KHOC 1E3LA 1JPUA 5K4GA 3PRYA 1V5IA 3CBQA 5EJAA 3PLNA 5A71A 2AN3A 4E7OA 4KH1A 4CG0A 2FY8A 1XALA 1JFTA 3WK9A 1QBGA 4KFCA 4CLOB 2B30A 1QHEA 1XTTA 4RH1A 4L02A 4OHOA 5CW2A 2XVAA 1HC7A 1LJ8A 3EE6A 1K27A 4IRXA 4TWRA 1CEXA 1V7QA 3O75A 1H5UA 1FNSA 3C5HA 4WOCA 1ZD4A 5CK5A 5HILA 1RXSA 4ZAXA 3ZCSA 1KYWA 2J0UA 3IQDB 5EJ2A 5AKKA 1C1XB 4N12A 5HOEA 4LF7B 3SSNA 4QO8A 4CM8B 3OPQA 1LWNA 4XYGA 3I2FA 1YS1X 5ELMA 3MB5A 1UMBA 4PPNA 4M1YA 4U7DA 5CBPA 1J42A 2OVBA 2QZZA 1G2PA 3IKTA 3MOSA 4LJYA 1ESDA 3CR8A 2JGAA 3DHVA 1A98A 3UJ7A 3FOFC 5TEWA 3UMJA 4GKKB 1D2RA 2MSLA 4U7PB 1IMOA 2MJLA 2DBYA 3PR1A 4Z9AA 4AP9A 2UVQA 2RG7A 1M2EA 4HAYA 4AJJA 3HB4X 2C29D 4RQTA 2NVOA 1LV7A 1RTTA 3K53A 3SVZA 3K92A 2BFFA 1ZNQO 2E21A 1TAHA 2HHJA 4NZ9A 3ZWMA 3Q8KA 4CR7A 2YS7A 3VJRA 5L3SB 2OUKA 3CYFA 1WUHS 1JXMA 4NV3A 1OFIA 2R60A 2X5JO 1GSIA 2M6SA 3KTAA 2XUQA 4CQMA 3HV0A 3UJAA 4QGBA 1TKRA 4BZWA 1BMDA 2MYNA 5ES3A 3GFVA 4HDMA 2CSXA 2WZCA 1ZP6A 3DWFA 5IHPA 4HPJB 3TJRA 4EJMA 1JAIA 1QYWA 1G7SA 4URZR 4M9ZA 4RY0A 4NY1A 5DRYA 5JOQA 3PD1A 4MUIA 3WLMA 2VF2A 4B7ZA 1OB2A 4MVWA 2PKRA 4PGMA 4PQEA 3B13B 4G8BA 3SZUA 4EYSA 1ND5A 2C2HA 3LVFO 4LVUA 2ZP1A 3ZXSA 4RK7A 5CCBA 3MGGA 1NP7A 1PZFA 4RYLA 3MOGA 4IY1A 3TM4A 2QB5A 5JW6A 3W5CA 4MS3A 1IBKB 4IHKA 2I8CA 3CRMA 3A9SA 3H3JA 2O5RA 1FMJA 1MVOA 3HDQA 2OZKA 3PR3A 1N4AA 1N7JA 3SIPA 1YBAA 4PCAA 1QIEA 2O54A 1Q15A 1FDUA 2WYHA 5TGTA 4NEQA 3TW8B 4OUDB 1KRWA 2FB9A 5TVKA 1I4DD 4RA6A 5JCJD 4ESOA 2CUZA 2JH3A 4KOEC 5BR7A 3DUFB 3N58A 1U2ZA 1I3MA 1NXSA 3TD2A 4YMVA 1TW3A 4ENQA 3N86A 5CURA 2WFMA 2BEUA 2CMGA 2Y4OA 2VHYA 1IWBB 1ELOA 2OV4A 1TMGE 3FNBA 4Q00A 4UVDA 4UVGA 5DTMA 2IC5A 4B7XA 5JR3A 5KWVA 2GZAA 1WVMA 1HO3A 2BBTA 3K31A 1XCMA 4PIMA 3ZLVA 2EZ8A 1G7CA 3LBNA 3S7TA 4LHWA 4ZVOA 2BZSA 1G3RA 3EIXA 3EISA 4HAZA 3ZBTA 5CFLA 1HDIA 2HFJA 2PX8A 1RQGA 1BC5A 2JATA 2YZGA 4H4EA 5H8WA 2P30A 4RX1A 4MW5A 1OW3B 3GP3A 2ZT7A 3B53X 4P7KA 4AJ4A 3HHPA 3RYTC 4MCIA 2Q3DA 1CC1S 3W77A 2PUEA 5JH7F 1Q83A 2K4MA 3RVLA 3ZWQA 1DKOA 2BFAA 4PTLA 3ZS8A 2FW8A 4F71A 2G09A 1EWQA 3OTGA 4PWYA 1DG3A 1MB3A 2EFJA 1DP4A 1HYQA 1KJZA 2QQEA 3CUEF 3OBIA 4HGPA 4IQ8A 2YXPX 4C30A 5JZVA 3NDPA 2B21A 2BKUA 3AF4A 1GUAA 4JA2A 4ANFA 3LAWA 3ODGA 5K6TA 3Q2KA 1BDHA 4Z53A 4YDSA 3AEXA 3L8MA 1AGPA 2BMAA 3AG5A 4DC0A 3NNDA 2V1UA 1EIZA 3CZ5A 5BT9A 3FYSA 3E5MA 4IUCS 4ZDWA 3Q4GA 4FZRA 3IOCA 4GD3Q 4DBLC 2QM8A 2FW6A 1P7VA 2WVGA 1EU1A 2P3SA 4JLUA 1G17A 2R9VA 1LC0A 1DPFA 1QG2A 1CUIA 1MF7A 1SXJC 3WL6A 3NYRA 3AQIA 3CVVA 4P5PA 1ZWKA 1E60A 3QTBA 4GM0A 4R1LA 2AR9A 2RJOA 3EZLA 5ESWA 3D8SA 3UGKA 3L7KA 3PEFA 5FL7A 4BMCA 2BLNA 1NBIA 2NSHA 2FFJA 2PS0A 3RS8A 5EI5A 3CCCA 4NH4A 1ZPDA 2Q7OE 1E2IA 3G02A 2BGGA 2JD0A 2B6HA 4W1QA 3ID6C 3HXOA 3PXDA 1QH1A 4FC6A 1Z16A 1R18A 4R3NA 1ESMA 3WYDA 1DFIA 1XD9A 3NUZA 4FBGA 3RKSA 5TY0A 5LZ8A 2ZI3A 4D3SA 1EIWA 1JIKA 3PEEA 2PH7A 2GN2A 5DRTA 5JBQA 2OHXA 1NFFA 1E4VA 2R5FA 4PQYA 4TUYA 4YA6A 3CMCO 3UMGA 2C8LA 5D00A 3Q6MA 3VPBA 4BLUA 4Z5XA 1EUZA 3FPBA 2R2AA 1EP2B 3HSYA 1KIAA 1RPNA 3LDUA 1OZAA 1U2RA 1A1VA 2CF5A 3A28A 1PJCA 3IEXA 4FHDA 4OL9A 2XYPA 2VSQA 4C7OB 3U1TA 4BWVA 2WQ6A 2HA3A 1KI1A 1OX4A 2MSNA 2IFTA 4WQMA 1NNLA 121PA 2AYYA 3IALA 1ZVVA 2HADA 2GO7A 3T7DA 1MJGM 4TZ6A 1B73A 1KFKB 5CT4A 4FGSA 5GOZA 5U1PA 3CEPB 4V38A 3RFXA 4YR7A 3IA7A 4NOKA 3GARA 3DFUA 1E18A 1ZEMA 5AK6A 2RHHA 2H9AA 2H1CA 2JHGA 3RVSA 2QTNA 3A1SA 2QTHA 3DKVA 2O5CA 4V1CI 3BWBA 4BBAA 1LS1A 1MJFA 2NO0A 8AT1A 4EVQA 1BMTA 4DM3A 3GEEA 4HGRA 1NVUQ 1NNI1 5B2ZA 2VPXA 3EXG1 2V3WA 2ABWA 1OE0A 1T1RA 4RGYA 3RBXA 3R5XA 3UW3A 4JBYA 4HAUA 4K1XA 4IV0A 4WXYB 4OQNA 4YRDA 1OY1A 2IOHA 2XDYA 4NYJQ 1N9GB 1OIWA 5E4YA 2ADFA 3CNQS 3HXTA 1WCYA 4NAUA 3U1VA 3UHOA 4JYZA 3DVQX 3L1KA 4X97A 3VZSA 1Z0DA 3MSXA 5BWCA 5B1DA 3UB3A 1XMPA 1KSJA 3KPYA 4S1NA 2FN3A 3ISVA 1PWHA 4RHEA 2DPHA 1LI5A 1PQYA 2Q5CA 3KFXA 1PJTA 2HJSA 3H5OA 4C2AA 4BO7A 2WU3A 5JS2A 4B7CA 2J87A 1RI4A 2YWJA 3G17A 4KL8S 5E6SA 4BFTA 2DEUA 3BICA 3GMSA 1PSDA 3GOHA 3S2ZA 1W8DA 1Q14A 2QSUA 4ZOCA 3TZKA 2DE0X 4A27A 3QPWA 5TMEA 3NALA 1KE1A 4DQXA 2BM0A 5BWOA 3A6HA 1TO2E 4YBRA 1Q0SA 3T35A 3R23A 5KOHA 1EUYA 1A5ZA 1NMSA 3JZFA 2IDZA 2WIBA 1YQUA 2IVFA 1SXJA 2SICE 4M0CA 3R1IA 3W79A 3U16A 3K4PA 4F8JA 2JBAB 3P9RA 2WV9A 3SVTA 3QMMA 5ULLA 3VR3A 3OLWA 3GLIE 3E9MA 4ZZ0A 1OLUA 2UZ3A 4BS9A 4ND8B 3DOHA 3ZDAA 4DLRA 2WUDA 3KT6A 2AG8A 3C1AA 3HI6A 5HQ3A 4D1YA 2RHGB 2WE7A 2ZRPA 3OJFA 1ENYA 3MJRA 5DGHA 3TECE 3AR2A 4HTAA 1JEQA 2RH8A 3KVOA 3NNNA 3RK1A 3FPSA 4RTLA 5BQOA 1EP9A 2OFOA 5FUMA 1EK5A 3QVTA 5HRUA 2ZAMA 3M6VA 3RC1A 3KB2A 4JR0A 4AJOA 1A8UA 1MFZA 3FMPB 3PNLA 1M0SA 3PF9A 3V8MA 1V6SA 1GP2A 2FEPA 1P1IA 2PA0A 3N59A 4R98A 1ESCA 2PRKA 3F7TA 1JIQA 2CXXA 2PMFA 1QZXA 1BWPA 4Z1OA 3ASVA 2OYRA 2P9JA 3WLNA 5IH7A 4HRVA 4HL6A 1VHJA 1XEWY 2MSDB 2HHAA 3JD4A 4MYSA 4CR8A 4RZXA 1IXZA 1FQWA 1X15A 1XDGA 1SGWA 1M3SA 1B6GA 3EOBI 2JAPA 4Z4CA 1XPRA 4OXQA 2H18A 3DTTA 4QDOA 5ITSA 3BXHA 3INNA 3D5QA 4ZK2A 3W2EA 2I6XA 1Y8RB 1TMOA 4MQ5A 1SCQA 3REOA 5B30A 3V1UA 5KOYA 1AUOA 2WF9A 1VKRA 3MUFA 3A7DA 4FBLA 3IMEA 5EJMA 3OD1A 4E70A 1C14A 3T5MA 4F1JA 3KQMA 4QFDA 3V9AA 4B34A 3SJAA 5F21A 3ES9A 2H1LA 2XTJA 1EFUA 3COJA 1KDVA 1QJ4A 2VBCA 3Q2OA 3M4NA 1OXVA 4P3NA 1PJAA 4EKYA 5DVZA 2R8EA 4CKCA 1B1CA 2IEAA 3A26A 4XI9A 1KJWA 4PGFA 1DO0A 5LYJF 4N48A 3MC1A 3EGDB 5JD4A 1E2LA 2VHUA 5AVKA 2NZUG 1JZTA 3AOGA 5FFNA 1V1RB 3Q7RA 2R6JA 2Y1XA 3CEJA 4HP8A 1BMQA 3BDIA 5EQJB 4BE7B 4CM4A 1N7IA 3ULKA 4R8LA 4MKXA 2P3QA 5DN9A 3TOCA 1KK3A 1FSSA 1VB5A 2XHZA 3KKOA 4LDRA 4YP5A 3I6IA 4BAZA 2V6FA 3COWA 5K3FA 2VCYA 2VDKB 1NONA 1YMQA 4G1VA 1UPFA 4M0LA 4ZYYA 1E2MA 4X6LA 4AJLA 3RVOA 1KORA 3FHTA 5ITZB 4ZCIA 4LJ9A 2DSNA 4LWPA 1K2WA 5D8DA 4MRNA 4ZRDA 3TRHA 2OCYC 4Q82A 3GG2A 1DFHA 5KQPA 3FB1A 1M6NA 3TL6A 2AKAB 1DTWB 3TLMA 4G0OA 4AUKA 5K3SA 4TSFD 4NX2A 3W6UA 2JIBA 4H1HA 1K98A 4MWBA 2J4DA 1YB5A 2HLDD 1SCDA 3D7KA 5HJ5A 3ZHXA 2ZI9A 1YBHA 1MXFA 4NBNA 4YRKA 5BY2A 3FUCA 2AHRA 1II8B 2H4FA 2PZLA 3M5CA 4OHMA 2RGGA 4GR5A 4YJFA 1KZGB 3ZY3A 1AKNA 2AK3A 3S55A 2ZJAA 5J1TB 5JJ5A 3PFCA 2VTEA 3ZQKA 3PPIA 3G0CA 1E64A 4V0NA 5CR9A 1HDOA 1L5YA 1RWMA 4C0QC 2VTBB 3CT6A 1LLUA 3GLVA 3NM5A 3DT6A 4KP7A 1UFQA 4DN6A 1XQYA 1RJFA 3QMVA 2DWCA 3EH1A 4IFEA 1E59A 1JU3A 1PKEA 1T2NA 2GOYA 1KAQA 2W6JD 3C3YA 4XARA 4BU1A 4MAAA 1JKIA 4TZKA 2DYKA 4UZSA 5DM2A 5COQA 3VYWA 1B2LA 1UF9A 3DPIA 1HRKA 3JQQA 1EXNA 3OOEA 3UJ6A 3BF7A 3QU7A 3GLGB 6LDHA 1K7XB 4RF5A 4YJ2B 4AC9A 3OE5A 4DT1A 1XV5A 1HEUA 3FVWA 1TLTA 1ZUNB 3MNFA 5KOJA 2DETA 2VDOB 1ZUHA 1YB1A 3W78A 2AC7A 3DDCA 5SYMA 4G8CA 3W90A 1VLJA 5JV5A 1UBFA 3MS2A 4BVEA 2HQ1A 3A3PA 1I10A 4IXNA 4PR3A 4HDCA 3SBXA 4CMKA 3BXOA 3UWKA 1BMFD 3PI7A 1RIFA 2OL4A 1ZMXA 4FHEA 4TQUS 3W3ZB 4DY4A 3ZNOA 1XTQA 2V59A 4R1UA 2JJ2A 5B7GA 3OQOA 4EW6A 4RDCA 4RVFA 4PYKA 4LJLA 1RI1A 3MMZA 1XUOA 1EEXB 2AZXA 4XLTA 2YNMC 3WLRA 4EARA 4V1CA 4BFYA 4MUEA 3PFWO 3GNTA 4YONB 3V2HA 2X2PA 1WCWA 2F9FA 4Q9DA 3IAM1 4RKWA 1DB3A 2CLIB 3OKFA 2YFKA 4GRDA 3V9PA 5CEJA 1XMSA 2M32A 1JDSA 4OYHA 4ZAWA 4K0KB 4H6VA 4NEHB 4RPJA 3IPCA 2JLAA 3B9PA 1ORIA 2AUMA 3L0OA 5J4VA 4KKXB 3OZGA 4ZALA 3UKOA 3Q7TA 3SC3A 4EAQA 5CAEA 4ZQFA 2RONA 1GU0A 2GBGA 1L5SA 1F6DA 2RH5A 4UTVA 2WKRA 1JFFB 1IB6A 3ACBA 3F4KA 4P4TA 5REQB 1H8HD 1Z8HA 3RAGA 4IGEA 1Y4ZA 3V4ZA 3I8XA 1JWAB 2R44A 2P40A 5DNEA 2X8LA 3CY6A 1OXKB 1T34A 1O9GA 4LC0A 5BYBA 2MTBA 3OZRA 4O3FA 3EWNA 2LXNA 3W2FA 3X1KA 2R25B 3R0VA 3TQCA 3K3PA 3T06B 2O8BB 1XDZA 1VL2A 2D0IA 3AINA 4KX3A 1ZUD1 1QYXA 4IIHA 2QR3A 2DHEA 2I3ZA 3U5TA 2ADMA 4DLNA 3KJQA 1XMVA 4N0PA 2H2AA 1Y82A 4BTEA 3JX9A 3RRXA 1JQBA 5E4FA 1KI4A 3GLSA 2HX1A 3H13A 1RT9A 1AHIA 3G7UA 2J3QA 3VZBA 2QTFA 1F6BA 4M55A 2ZJOA 1KO1A 2C4WA 3L4EA 5BWNA 2D7CA 1VE9A 1U7DA 4G25A 3GI1A 3AEKA 2ZBPA 3IDQA 1P4RA 3NOQA 1KVQA 4C0BA 4ECAA 1VDZA 3SQOA 3NIFB 3EIEA 3FPEA 4DCNA 2ZUTA 5I01A 3GNQA 5HS4A 3TZEA 1V4NA 2VJYA 1LPOA 1R0BA 3MCUA 3E27A 2I4NA 1LSOA 1TKAA 2ACKA 2LKCA 5HFAA 3AF2A 3R3XA 2UUCB 1DEOA 3WXMA 4BEJA 1GZ7A 3NR2A 4FDUA 1QU3A 2PGNA 4R2HA 2V98A 3VSAA 5CVTA 4E3WA 2PVCA 3FTNA 2HU7A 2YWDA 4MUAA 3ICQB 5KAPA 1H2FA 4IEIA 5J4YA 5AK4A 1TI7A 3IUEA 5DFAA 3ZVNA 3EASA 5B1YA 3GH3A 4F3CA 4ILKA 1D2HA 1XKQA 4A03A 3ESBA 2ZOSA 1JHRA 2J31A 2HA5A 3KOZA 4BNXA 5LB4A 1DAMA 4F60A 1FRFS 1VL6A 1I7PA 2VRCD 2CNWA 4NOMA 4G5GA 3U7IA 2ACVA 3ZY2A 2F8SA 3GQVA 1ZESA 5HTKA 3DLPX 2YX1A 1OFGA 1AG9A 5G0WA 3QHAA 1NR5A 1LK0A 2FZ5A 3ND8A 2VPIA 1S2DA 1XZLA 2FOLA 1PZMA 3E2IA 5IH3A 1KI3A 4KVFA 5HGXA 2VDUE 2WYWA 3BZBA 2QE7D 3TLAA 1EFPA 3KOUA 2CMKA 2YNMA 3T0FA 2I1WA 1RWPA 2V7QD 4WKCA 1SKMA 1JFRA 5T57A 2O06A 5DHPA 3STVA 5A4AA 1U9JA 3NKFA 5LP1A 3NTXA 4C0WA 1QQBA 1XQ1A 3ICCA 5DX8A 4DNQA 3O73A 3T1HB 4BNLA 2BISA 3TSOA 4ARZB 5KVAA 3HYSA 4Q3BA 1H4QA 3ZDCA 4JDPA 3S8EA 1L6RA 1MU0A 1R8JA 1XEXB 3BK1A 3NS7A 3PDIA 4UDXX 2H1WA 2YWEA 3FFTA 4LOLA 4MV8A 3NO4A 3BTSA 4IIFA 4QULA 3SX4A 4D45A 4PCLA 5EE3A 1K7EB 3LLUA 4X64B 4ONEA 3MTDA 1BX3A 2HQBA 3CVXA 5L3ZA 2HI0A 3KK0A 2ZRCA 1UBTS 1E2UA 4G26A 1GZ5A 2O2JA 2RJ3A 1Z2CA 2P9BA 3PQEA 5BXYA 2IEZA 5FBLB 5HK9A 4B2PA 1HNZB 3N6VA 4N6OA 4B33A 3LCUA 1WL8A 2YFYA 3DEKA 1CE8A 5FWDA 4Y2VA 4E08A 3W5BA 5IDVA 5EIWA 2VR1A 1G4UR 2B2XA 3T3PB 3K94A 4PNZA 4BQOA 4LYGA 1JDBB 1J0XO 1DRKA 2IITA 5F51A 3D0RA 3HU3A 3VVBA 3VYVA 1LXCA 4F2GA 3EPLA 4B6GA 1SVKA 2R65A 3T7KA 1MPTA 3K0SA 1SZCA 2FZCA 1GV0A 1FS5A 3IVXA 2PPLA 4AJNA 2ZUEA 4FVTA 2HT6A 5K0ZA 2B8JA 2AC2A 1MEEA 3DEZA 3I34X 4MPJA 4PPFA 2Q6LA 1JTFA 1OXUA 1FTQA 1T36B 1QKJA 4LTNA 1VG0B 5D5PA 3OEEA 1BKYA 1KAHA 5AMXA 4Z86A 1OREA 1SK8A 2L69A 1I5OA 1G16A 1N6HA 3CN9A 3LO8A 4OXYA 3OCUA 5JEEA 1XKLA 5FNZA 3FUXA 5L40A 4N03A 2GXQA 3FF1A 4NARA 1ZK2A 3BILA 5I9SA 4YDHB 2QHXA 2A30A 2WWXA 2FEXA 1JYFA 2GD6A 3BGSA 3P1JA 3M6MD 2Q4BA 4PM4A 5DHUA 3UMVA 4DC1A 3RC8A 4Y6LA 4DJDC 1LBEA 3MK31 4A2CA 5DGDA 5LL6P 5KVVA 1Q7EA 1WMFA 2IHTA 2AOUB 2YHAA 3CEHA 3JAKB 5I9TA 4CW7A 3RIYA 3QX8A 4X24A 1KSHA 2DKOA 4HNUA 3CZMA 1G9XA 3H11A 4FQ8A 2AG1A 1AX9A 2EFEB 5FOXA 4KQ6A 4G1MB 1USGA 2ZXUA 4II3A 3CH7A 4NJEB 1E3IA 1R0RE 2PEZA 3DBLA 3V97A 3THWB 3W5DA 1XLUA 1Y8QA 3D4OA 2EJTA 2IX9A 5B37A 1S8NA 1CF4A 2XTAA 1S4MA 3DCYA 4S1WA 5HIIA 4MDFA 2GILA 4H3HB 2G5PA 3Q6IA 3A25A 2RKOA 1XT6A 4HF7A 2B92A 2QRUA 2V7PA 3OICA 4OOEA 4UREA 4XSHA 3ROFA 2IW3A 1ISHA 5JAQA 3RFUA 3VMFA 4CKXA 5A5GA 2P78A 2OUIA 3JQ9C 4G5OA 5FLEX 2QLFA 3B7PA 2PX6A 3LPMA 3S81A 5LD2B 2SBTA 2ZB7A 1AH2A 1JMVA 2O3JA 4ZTBA 4BCCA 2G28A 1FQJA 1W0JA 3L06A 4AN0A 4GEGA 1QO0A 5BNWA 1FNBA 2ZWOA 3SNKA 1SVSA 2Z98A 5LNK1 3A2KA 3RUEA 2BI4A 3BGWA 4BEWA 1OC2A 1VDMA 2Q2VA 4CYMA 5E1OA 2ZYRA 4DLAA 2PLAA 3UXEA 1YUMA 2XUPA 1BW9B 1WV1A 2VH2A 2PH5A 1W25A 3KB6A 3T5AA 1T8TA 3I30X 1TPZA 2OV3A 3N9IA 4FWIB 3ZK9A 2HZ7A 1ZXLA 2A4KA 2JFWA 4QEZA 1CQXA 5AUOB 3KKLA 1OGJA 1RPJA 1KH2A 2BW0A 2J41A 2ZJZA 5KS2A 4HMPA 4XJTA 1MRZA 1WY7A 2Q4RA 3GDWA 4KNVA 1KYYA 4M1WA 4PTZA 3CF6R 4MKFA 4TV9F 4ZOAA 4UOEA 5CB0A 3Q3GE 3RU3A 4L50A 2GXUA 4R9SA 2WG0A 3L1JA 3T3MB 2P7IA 3OJEA 4PONA 3AWDA 5CG2A 1F8YA 4Q9IA 1A71A 3QVWA 2D5BA 2BKVA 5HHTA 4A1OA 4EAAA 3PJDA 1UP7A 4Q48A 1K5PA 2G1JA 1S8OA 1M6WA 2VSOA 3VTFA 1AM4D 3HCCA 2E82A 3RLIA 1JTVA 3GJYA 4A5OA 1AKQA 4URFA 1QK4A 3LYHA 2OBYA 3DO6A