1AM4D

Complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
177
structure length
174
Chain Sequence
PQTIKCVVVGDGAVGKTCLLISYTTNKFYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P50-RHOGAP
publication title Crystal structure of a small G protein in complex with the GTPase-activating protein rhoGAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (gtpase-activating/gtp-binding)
total genus 42
structure length 174
sequence length 177
chains with identical sequence E, F
ec nomenclature
pdb deposition date 1997-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1am4D00
3ONWA 1HYQA 4ABYA 5JCPA 4IRUB 1LNZA 3PEUA 2AD5A 3QXJA 2JLSA 1KNXA 3H2YA 3EX7C 3QY0A 3Q9LA 3NXSA 3NEJA 3L0IB 1L4UA 1H8EA 5L8VA 3PUZA 4LJAA 4MA4A 3LVQE 3EPKA 1JJVA 4US2R 2BM0A 2Z83A 2H7VA 5K8IA 2R65A 3DMDA 5JSZB 2KI5A 1DE0A 2F1RA 4QHSA 1XD2A 2O8FA 1S4QA 2PL3A 4BFXA 1JR6A 4C7OB 1WF3A 3CM0A 1TTTA 1XPUA 3DOFA 3LV8A 1DOAA 4QGHA 4TMZA 5FTNA 4YXWD 2CMKA 1G8HA 2R6DA 3EZ9A 4A36A 4Q4HA 5GJBA 2LKDA 4ZO4A 3UG7A 1W36B 3RAPR 3AM1A 3HU2A 3TSOA 4ON9A 4HAUA 2GTPA 2IS1A 4TTPA 3MGCA 4US1R 3A36A 4Q9KA 3RWOA 4IFEA 5L3VA 1HE1C 4OI0A 4AKEA 2JLYA 1EWRA 2XTNA 3W3ZB 2C77A 3BH6A 1H8HD 4AC9A 3KJIA 3NBXX 1ESMA 1OJLA 1Z6GA 4C7OA 3DDCA 2WIAA 3BK7A 3QNUA 3UPUA 4LYHA 3CRMA 3OEHD 3IBGA 4GZMA 4HAZA 4B3DA 3CR8A 4PC2A 4IDNA 1PLLA 3BRWD 3CPHA 5KDOA 3KQLA 1G20E 4AKGA 2I1VB 2Z0MA 1SHZA 1TPZA 5KNDA 2O8DB 3CPJB 4Y0VA 1F5NA 1MRSA 2IEZA 1T91A 4IDOA 4QJ3A 1HY3A 5DYGA 1YZLA 1CP2A 2FJUA 2XZOA 3RWMB 4DT1B 2QQEA 2EVWX 5CM8B 2OBLA 1ZW6A 2WSSA 3U3MA 5BN5A 2W6JD 1D9ZA 4XWAA 5CB8A 3GLHE 4UNQA 4PSVA 2F7SA 1JEEA 2J7PA 5HCNA 2ZE5A 2GHIA 3PV0A 2CL7X 1OSNA 1M2OB 3T1VA 4HLQB 3OHMA 2KBEA 4Q48A 1E0AA 2EWVA 4Q4LA 2VEDA 1SGWA 3X1WA 4MYUA 4LK2A 3ADDA 1IN7A 1M34E 1NMYA 2BVNA 2V1UA 5DH9A 1XCGB 1W46A 2FSGA 1GTVA 1VHTA 3F3YA 1QRAA 4QJ4A 3EW9A 1N25A 1VIYA 2QAGC 3GJ6A 4DT1A 2O8CA 3ASYA 1A4RA 1P75A 3MWLA 1W5SA 4UKDA 3D31A 2HJGA 2PJZA 1FUKA 2DBYA 4M1KA 2JLXA 4LOAA 3SYLA 3QKSA 2RGGA 1P5ZB 1DPFA 1ZYUA 4I1VA 4GOXA 1NSTA 3K09C 4KI0A 4L9SA 1NG9A 2WPDA 3FHCB 2YWHA 4DKXA 2PT5A 3I73A 3NBFA 4TMVA 3QKTA 1G3IA 1WP9A 4GRAA 2F9LA 2O52A 1Q1QA 4ILEA 2GEVA 2QEQA 4QOSA 1LFDB 3HWSA 4LJ5A 2ZRIA 1P9WA 1UF9A 5D3MB 4DCUA 4B33A 3VHLB 4JSYA 3GLGA 2GJSA 3OF5A 4M22A 2ZRKA 4V0ME 5EE3A 3TIFA 4DBLC 1NNEA 4PO9A 5EJEA 4F4IA 2OCPA 1FMLA 1T0JB 1Z63A 2H17A 4DLVA 1EGAA 4JYBA 2JJ2D 1FL9A 4WVFA 4B75A 2RGNA 4PO8A 4JLDA 3KKPA 1EXMA 4TYWA 3LLUA 2YOFA 1FTSA 5DN6A 3THOA 2QE7D 1G7TA 1QHHA 2G1JA 3CWQA 3MCAA 1Z0JA 2IT1A 4GBMA 2EWWA 1R0YA 4YXWA 2ZJBA 3I5XA 1S9HA 3IPYA 1C1YA 3QPUA 3JZAA 4MGIR 3Q8XB 1T8UA 2IEYA 5DHFA 3X2SA 1VTKA 1LY1A 1U98A 5CLLA 1G8FA 2PMDA 1QHYA 1JR3E 2QORA 5DNYB 4LHVA 1G5RA 4GSYA 4Q1DA 1GG2A 5CIWA 4AG5A 1S3GA 3VKGA 1HH4A 5BW8A 2OXRA 2WJYA 2ODWA 5L3SA 1E96A 3TVTA 1WE2A 2ZSBA 3LXRA 3NC0C 4BRWA 2ONJA 3T15A 1K5GA 3GMTA 3AVUA 4B71A 2F3RA 1AM4D 3P4XA 1XTSA 2BJWA 3CNNA 3ASZA 3OEHA 2R8RA 4TTQA 3VU9B 1KO1A 3TAUA 2VHUA 1OIVA 2CVHA 1Z0KA 2YC2C 4YMUA 5KOYA 4OJQA 5FL7D 4EPTA 2WAYA 4AYTA 1TUEA 1GRRA 1YZKA 1NN1A 2ZSFA 3BORA 5EQTA 2DWPA 3R8CA 1CJMA 2X2FA 4JL6A 3G5UA 4TLBA 5EP1A 4JL8A 1Z6AA 2CNWD 4URVR 1SXJD 3AVOA 3T12A 1K5DA 1TQ6A 2GK7A 2J0VA 2YV5A 1W0JD 5AUOB 3X1DA 2W6JA 3W8NA 3C15C 3RSOA 1SKYE 4R98A 4BZXA 3K1JA 1E2FA 4BFTA 4YMSA 1G3RA 2FMXA 4Q1FA 1PLJA 2ZYUX 4TMKA 4Q9HA 3VU9A 4QRHA 2BOVA 3RVBA 2IF0A 1XCMA 4JL5A 5GADl 1ZNYA 1PZNA 1S9DA 3VQTA 5SZIA 3EWAA 4MKIA 5CYPA 1QVAA 4UQOA 4DZZA 1TQ2A 4JS0A 1XTIA 1Z08A 3B1WA 1NVXQ 1CBUA 1YHNA 5IF9A 2GCNA 4WZAE 4PHGA 1GM5A 1OH6A 2J87A 4B3XA 2XJ4A 2HLDD 2FPKA 2IL1A 4Q1EA 2J5XA 2VHCA 1G7CA 3K0FB 1E2DA 4PSKA 5KHOC 4IKEA 2KE5A 1US8A 5E95A 1KO7A 4HSEA 4QBHA 4ZV4A 2LCFA 2WV9A 2XZPA 2OZEA 4NL4H 5FBLB 4JT4A 5EE9A 4B47A 4E22A 1EESA 3CNLA 4HDOB 1XD8A 3WYGA 3K9HA 1FX0B 4ZKDA 1KO4A 4EPRA 1DAMA 1E9FA 3IO3A 5LDDC 4AG6A 2ZETA 4L9WA 1AGPA 2NO0A 1TAGA 4BRUA 1YU9A 3AF3A 3HYTA 3Q7PA 2QY9A 3A58B 4V0OA 2O0KA 3PENA 1W5TA 5F9HA 5KSPA 4MRPA 2J1LA 1PJRA 1KSFX 3QF4A 3X1YA 2RHMA 2FGKA 2J7KA 1DARA 2QROA 4TYQA 4EFNA 1OH7A 2RGEA 2FDCA 3BJIC 2ZRAA 3PUYA 3SI7A 3CF2A 3E5HA 4P4TA 3MSXA 4G01B 4DHEA 1OPXA 5J4HA 1X3SA 4IDQA 1NIJA 2WTUA 1Z6XA 1KY2A 4WZBE 5HE9A 1XXHE 1LTQA 2QE7A 3C8UA 2V7QD 2ZITA 3D6TB 4MYCA 4DDVA 3MWYW 5JJLA 1G8GA 1O87A 2OV2A 4LBYA 1E9AA 5TY0A 4EJSB 5TMPA 2IUSA 3LQRA 4Q03A 2XTZA 3O8RA 2ZR9A 4RKFA 4LV8B 4RJLA 5KNBA 3QVVA 3KDSE 2FG5A 1RW4A 3WYFA 3MJHA 1GP2A 1SXJB 4OK5A 1WA5A 3LW8A 4G5OA 1E2QA 5DHAA 2RH5A 5JWOA 5JWHA 4D81A 1YR9A 1E9CA 2ZJYA 5LPNA 2QZ4A 4PZZA 1ZJ6A 4ASUA 1KHTA 1XTRA 3UKDA 1XMIA 4PAMA 1VG1A 2R6AA 4RFVA 5JFGA 4B3CA 4RZ2A 1GITA 2B21A 2PCJA 2WMOB 5TB5A 2JLQA 5JMTA 2Q21A 3B1VA 4XVUA 3VR5A 1N0WA 5J47A 3CPEA 5FL7A 2JDID 3A1SA 1AKEA 1ANKA 4BLOA 5E7IA 5EP4A 4KLZA 4TT3D 1UEIA 5TV2A 3IPXA 1MO3A 3Q72A 1G7RA 4A2WA 1IXRC 2IX3A 2CNWA 2ORWA 1K6MA 1SXJA 2GJ8A 4B2IA 4C3ZA 3FOZA 1UPTA 1W0JA 1ZUIA 2ZREA 2VA8A 2OCYC 5EE5B 2FZ4A 3DZDA 5A0FA 1NLFA 5L3RA 3U3OA 4IW3B 2P5SA 2J0UA 4X8LA 1TX4B 4MKGA 3KKMA 1TQ4A 1U0JA 4FW9A 1EFRD 2VP6A 1P62B 3K53A 3LQQA 2ZI7A 3JVUA 4RD2A 4D4KA 5B64A 2WWWA 4PC3A 3WMFA 5C18A 2BCGY 2CBZA 3KXIA 4F4JA 4AWXA 1G1MA 2GXSA 4FWIB 3SEAA 1E32A 2GXUA 4R2IA 4HDCA 4PPFA 4D0NA 4KFUA 2ZSDA 3SHWA 1GWNA 3B60A 1BYUA 4ZPXA 1IBRA 4MGYR 4D0LB 3CW2A 4HEJA 1E2GA 1EWQA 2HLDA 2W6ID 4OBEA 4RVCA 2W83A 1GL6A 1CU1A 1DO0A 1Q20A 4LPSA 5J5CA 2XB4A 1RC8A 3B9PA 2ZVQX 1IY1A 3WHLA 5FTKA 1E79A 1EK0A 1LF5A 1YQTA 1LVGA 2JAQA 3CX7A 2W0MA 4LJ9A 3I8XA 1GRNA 3AVWA 1V5WA 4B74A 1S1CA 2PZEA 3WNBA 4PQYA 1MABA 3B1XA 1BYIA 4AI6A 4YC7A 3DKPA 5HR5A 4LYJA 1KSHA 3TQCA 1F6BA 3NKVA 1K8RA 2CHGA 1CJVC 4PPGA 2FNAA 2MSDB 4BASA 5DSZA 1D8TA 2GF0A 1KDOA 2Q9BA 1KKMA 5DI3B 4FINA 1NBMD 2OILA 3B8HA 3FTQA 1KAOA 1NMXA 3I4LA 3EIQA 4A4DA 2ZUDA 1VKJA 2EW1A 1NIPA 3NTUA 4I1SA 5AUPB 2OHFA 2GEDA 2V7QA 3NH9A 4A6XA 1G5TA 3SR0A 3OEED 5FTJA 2OFOA 1R0WA 3QG1A 4A15A 3CONA 3TBKA 1E2LA 3UANA 3W90A 1COWD 2IK8A 4LBZA 4W5JA 3RRYA 1UKVY 3L8ZA 3IO5A 3NDPA 2PX0A 4TMXA 1XP8A 1F2UB 4Q18A 4ZIRA 4FXPA 2J3EA 4QXAA 5DI3A 2DFTA 2RB4A 3C5HA 1ZCAA 4N0EA 4V0MA 1IY2A 1Q3HA 1KAGA 4Q01A 3EPJA 2XZLA 1G4AE 5B57C 1OFTA 3UK6A 1NF3A 1YZTA 3GLGE 1ZD8A 2GJAA 4E5UA 2VIIA 2OBNA 2PLRA 4JLVA 4ZCLA 1O3YA 2BKEA 3FMFA 2V4ZA 4L4UA 2CLSA 3DO6A 4KJZA 4V02A 1T3SA 3BFXA 4LV6A 1OFUX 1Q12A 2JDIA 2JLZA 1DS6A 3THWB 3QKRB 1UDXA 4TT3A 3AGPA 4NCJA 4Q47A 2EFCB 1DEKA 1XEWX 3U44A 3V00A 4C2UA 4BEBA 1E2IA 3ZS8A 2V6IA 1Z2CA 1E98A 2XOKA 4IDPA 4KITB 3WXMA 3GEEA 4L5BA 1XTQA 1ELOA 1Y3AA 1JJ7A 3IILA 4QNRA 1L4YA 1EFRA 3AP1A 4CEJB 4D4JA 1A7JA 3SJAA 1CKEA 1KDRA 2F43B 2QQ0A 4PXAA 3BGWA 5G41A 5EXSA 3OESA 2ZRPA 1M74A 3N2EA 2O0HA 4GP6A 1E2PA 1YZQA 3AEZA 3NHAA 4AKHA 1UM8A 5JJKA 1NVVR 4QGAA 2E87A 2PT7A 4MYTA 2XGJA 1ZUNB 5J4LA 2C95A 2X1VA 4C2TA 3U4QA 2Z4RA 3FDIA 4RD0A 1EX6A 3NVAA 4WBSA 4A1FA 3GFOA 3KJGA 3VR2A 1X6VA 1YRBA 3AVQA 3CBQA 3MFYA 2B6HA 2W6IA 1J99A 3D3QA 1MR3F 1E2JA 4KSCA 5JRZA 1MV5A 4WXRA 5A4JA 4OHVA 2ZRHA 3EC2A 3R20A 4NYMR 4V0NA 4E03A 2OCBA 2OM2A 1SHKA 4D80A 2DWQA 4P33A 3FKSD 4H1UA 4MUBA 3BB1A 2KSQA 4LC0A 3MWKA 3Q3JB 2D62A 1U94A 1VCIA 4HAXA 4MRSA 5AR1A 5JS8A 4FCTA 1AQUA 2H92A 4D2IA 1SQ5A 2DY1A 4ARZA 1OW3B 1JI0A 2ZAMA 2RGAA 5FUWA 3EPLA 5J40A 5JHHB 1KZGB 1TQDA 4R7ZA 4PHHA 1RIFA 1KO5A 2NOAA 1J8YF 4AY2A 1NJFA 4MDEA 1AA9A 3P20A 1RVDA 2IS4A 1ZD9A 1G9XA 1I4LD 2G83A 3RHFA 1BOFA 1II8B 2QM7A 2GVDC 2WIBA 5J4YA 2TMKA 2Q3HA 1NBMA 2IF2A 4ZI2A 1W36D 1ZUHA 4UXJA 2B7CA 2IWHA 3IKJA 4LHZA 1AZSC 4QL3A 1TL7C 4IVPA 2EFGA 2DPXA 2REXB 1G6OA 3OFND 4B73A 3ZQJA 5F98A 1NJGA 1VG0B 4Z8XA 2RCNA 3C41J 5KNCA 1E9BA 4LJ6A 4Q1CA 5LD2B 3IUYA 4LZZA 1MT0A 3QIAA 1R10A 1OYYA 2P65A 4H1VA 4IEIA 4DDWA 1IAQA 1TU4A 2GBLA 1N0VC 5FI1B 1COWA 2CJWB 5G3ZA 1C9KA 1XMSA 3WRYC 3ZZUA 4HUQA 1P9RA 4ERNA 1II8A 2ZRFA 1E2MA 2EQBA 2ZRLA 5FUYA 2OLJA 2WWIA 2JA1A 4JLNA 1ESNA 1OH5A 3HJNA 5D3QA 1R5BA 4CVNA 1RKBA 3KJEA 3OZXA 4LI0A 4GOKA 2P5TB 3SFVA 5IRCD 1XJCA 5LB2A 4YMWA 4DSUA 3LW7A 1II0A 2QP3A 2O8BB 2DFKB 1VHLA 3N70A 3DKVA 4IVQA 3KQUA 1LV7A 2XEXA 3SBDA 4HDQB 4X8HA 3CO5A 1ONBA 3UMRA 1KKLA 2N1BA 3KL4A 2NZJA 2CJWA 1G3UA 4G0NA 3KQKA 2HT1A 3AUYA 4DIDA 2WOJA 2XXAB 2CK3D 3IHLA 2VP0A 3EZFA 2CL0X 3ZZTA 4G5GA 5BN4A 1KSJA 1MO4A 2C78A 2G77B 5HZHA 1NVVQ 1WBDA 1JXMA 3BBPA 421PA 2RGNC 2IBMA 1Q21A 5AJVB 5JWRA 1T6NA 3U7GA 4KO8A 2IUTA 1XDBA 5EUQB 1UADA 2FFHA 2R2AA 4MUAA 1NN3A 1GDDA 1XEFA 4FMCB 4C0QC 1XEWY 4B44A 1KK1A 4E09A 1OT3A 4UNSA 4A82A 3BFVA 1T3LA 4LRWA 2A30A 5AJYA 3T5DA 3RYTC 4NYMQ 1E2EA 4DLRA 3ZDQA 2WWHA 3DPUA 2HYDA 2GJ9A 4FI3C 5F2EA 2XXAA 2NGRA 2P2LA 1FP7A 4LYFA 4XD7A 3O8CA 4C0BA 4NCIA 3B13B 4IXNA 4TL7A 4PPNA 4A92A 3T1TA 4C0SA 1CEEA 4NHOA 3RRMA 5AUQA 1KI6A 4TN1A 2G9NA 1UFQA 2AD1A 4FIDA 5GJWC 4ZDJA 2ERYA 4V0KA 3NDBB 4M9QA 1SXJE 5KU1A 2VPPA 1JPNA 1RYHA 3I1FA 4B48A 1IHUA 4FMDF 4Z1MD 3EASA 2JEOA 4N3NA 4LX0A 2QTVB 5HPYB 4HAVA 2BMJA 2G3YA 1U0HC 4LJ8A 1SKQA 1XZPA 4Z51A 3K0CA 2AKYA 2WHXA 3RDPA 4JJKA 4F92B 5CM9C 1E1RA 5JSZA 1XJQA 3KXLA 5BWMA 1AJEA 2VSOA 4W9MC 1YR7A 2IYWA 1W4RA 1KI3A 2WBLC 3L82B 5FOXA 4DLXA 2VTKA 1XU4A 1J8MF 1JEDA 2A5GA 2KB0A 4H9GA 4CIDA 4D82A 2FX3A 5C1BA 2ODBA 2WM9B 1M1YE 4PAQA 1Q44A 4F38A 2ZJZA 5JBQA 2R6CA 3OFNA 3EARA 4DUGD 3AF4A 2QMOA 2YVUA 3C7KA 4MRVA 3BD9A 1GL7A 1NG1A 5DE3A 4DRZA 3AF2A 1Q1ZA 2ATVA 4DB4A 3IEUA 2K5UA 4OL0A 4CEIB 4JLKA 4DVGA 1RRPA 2HXSA 2OLKA 3GJ0A 2QM8A 2OE2A 1NVWQ 2GK6A 2VBCA 1Z6TA 5C46F 3KX2A 4CDGA 5SZHB 4ESVA 3VR1A 4HLUC 4L15A 3P1JA 1ZNXA 2AL7A 2WJIA 2O8DA 2QSYA 1TADA 1FTNA 2QUZA 3E2IA 1JAIA 2WZQA 4C0LA 3C4JA 4DLUA 3JVVA 1AKYA 1GAJA 2QPTA 3QOFA 3UATA 4TMTA 4P3YA 5H1YA 4CEIA 2CHQA 1ZNZA 5JECA 1SVMA 1IJFA 4Q7LA 3KTAB 2RMKA 2C9YA 2KWIA 4RFSB 5JLJA 2H18A 3LD9A 1KI7A 5CJPA 1GNRA 2G0TA 2QL6A 4ZDWA 3TR5A 2CK3A 5B58C 5FOWA 4HYYA 4EPVA 3P26A 3VX3A 2W2VA 3MJRA 2AWOA 1PUIA 4M1SA 1GL9B 4K46A 4Q5IA 2R44A 1D2MA 4OK6A 1CTQA 2FGJA 2BMFA 2BCJQ 1SZPA 2IYUA 1M7HA 3FE2A 4X8MA 5LB4A 1CLUA 2ZU0C 2XB2A 2F6RA 3SHFA 4UXHA 3RS5A 3DEFA 4RFSA 2OAQ1 4FMCF 1KI1A 1JNYA 2QENA 2XNDD 1UAAA 4CRWB 3IIMA 4QHYA 1CJTC 2KBFA 2NIPA 4RCZA 1EFUA 1TF7A 4A0GA 2PH1A 1DADA 4RZUA 3THYB 3PIRA 1FQJA 1ZM4A 2QMUA 2FFBA 1W4CA 2WKRA 3U61B 3TSZA 5J4VA 4D6PA 2Q9AA 2P3SA 3T1OA 4MGZR 1AK2A 5D3MA 2NO7A 3VKHA 2ZU6A 3OIUA 4DLTA 4IJMA 2PBRA 1ZM7A 4Z1MA 2CCJA 3TK1A 2ZJ8A 4PTLA 4CYMA 2UZIR 3I72A 4IOLA 3A8TA 1GOTA 3GCGA 1WDTA 2OBMA 4OI4A 5FPTA 4IHQA 5EXTA 2FZLA 1EX7A 1NLYA 1E9RA 2JJ1D 6Q21A 1H8HA 1TF2A 2JIZD 5AK0A 4Z8YA 4A9AA 2ZUCA 2ZJAA 1HEIA 4LC1A 4B3BA 3THYA 1YE8A 2AWNA 3QPVA 5JRJA 1XPRA 3LDAA 4PQFA 3DMNA 1P60A 4YMVA 4LHWA 1X86B 5AJZA 1D2NA 1XCPA 5JJIA 3TW4A 4EDHA 4B2PA 3CRVA 2VQSA 3X1XA 5GVSA 1ZNWA 4DUGA 2PCLA 2ZUBA 8OHMA 1G4UR 1Q0UA 4RZ3A 1RE0A 4M2LA 1DBSA 1XD9A 2AN9A 4KYIB 2AFIE 1R5OA 3JZMA 1G5PA 3K70C 4O0MA 2I1QA 4LDJA 1CIPA 1U8ZA 1OIXA 1N6PA 3CKLA 5KDLA 3T1QA 4BLQA 4U7DA 2ATXA 1OKKD 1Y63A 3NHBA 3CWZA 3PEVA 5DYIA 1F3OA 1SVWA 4JVNA 1M7GA 1X1SA 3AVVA 4DDUA 2ORVA 1YZNA 5G40A 2IYZA 2JATA 4BFYA 4BE7B 3G0HA 3SE0A 3QE0A 3MAAC 1KI8A 2EYQA 1P2SA 4O25A 2GA8A 5JCZA 4W7SA 2VP5A 2RGBA 2A5DA 1UBFA 4DIEA 1AN0A 3ADCA 1Z47A 1NBME 1WRBA 2QAJA 4OYHA 1SVKA 2ZVPX 2AR7A 1Z6YA 3OAAD 1N2CE 1OXTA 2C99A 1W2HA 3LRPA 4HZUB 3PXGA 1Z28A 3RC8A 3AVXA 1CF4A 1XMJA 4NMMA 3QBVA 5E7JA 4TLEA 2QAGB 2JASA 1VCNA 3A37A 1DG3A 4MDFA 1FOEB 3OIVA 1RRGA 3GJ5A 1DAFA 4Q9LA 2ZSAA 1S8FA 1YR6A 2OSBA 3TUZC 3MD0A 3RS0A 1DELA 4M8NE 4UXIA 1E3MA 4EKDA 1T8TA 5FFMA 2YYZA 4DLSA 4LWZA 4XSHA 2X19A 4A8JC 3KXKA 1T0HB 2ZI9A 3B6EA 3GLIB 1QBKC 1HA3A 2W58A 3K0FA 3A1VA 3AH8A 3D8BA 1KOFA 2XNDA 4BFVA 2IYLD 3KKOA 4M1YA 2JJ2A 2QAGA 3VAAA 2ZR0A 1XEXB 2ZANA 3L0PA 3CRQA 1YJ5A 1AS0A 1R0XA 3F5FA 3SNHA 1FX0A 1FP6A 2GAAA 5CB6A 1GKYA 2NO9A 1UKEA 5HKKD 1G3MA 3FHOA 4CGZA 3QEOA 1IQPA 4KFRA 3T34A 1IN5A 3MLEA 2F1JA 3FKQA 5FTMA 5FBWB 1R5NA 4BFSA 2ZYTX 3RC3A 3DM5A 3GLIA 1GRQA 2LWIA 1VIAA 4PSAA 3QUSA 2ZRDA 2OFXA 4JT2A 2XTMA 2FEOA 1MKYA 1VPLA 3B5JA 4UJ5A 5TARA 2OXCA 2F9MA 3C5CA 4GZLA 3B85A 4HB4A 2QPOA 4KU4A 2I3BA 4AD8A 3CIOA 3QI2A 1E69A 4EPXA 4JBWA 4BUJA 4TYYA 2WKPA 1JXOA 3HP1A 1E9SA 4RD3A 4EJSA 3FYHA 1WQ1R 3TRFA 2FSHA 2OFWA 3AB3A 2QP4A 1KYIA 1OFIA 4TLCA 1X1RA 4I99A 3CR7A 4UJ3A 2X2EA 5CITA 4LHXA 4OQLA 5BYKA 1N6RA 3EIEA 1BS1A 2RAPA 4Y0AA 1DAGA 2R9VA 2HV8A 3KQHA 2XJ9A 1ZC3A 4IOMA 4WXPA 3TMKA 3TKLA 4F93B 3GP8A 1N6NA 1FW6A 3FMIA 3P4YA 3GFTA 1IY0A 4PANA 4MRNA 5JHGB 1UBGA 2AK2A 4ZI3A 4WIAA 2BBWA 3R7WB 2NO6A 1OKKA 1RJ9B 2VYFA 4URZR 5HCIA 3FGNA 1NL3A 4A0FA 4XVRA 3HU3A 2ANBA 2VLIA 2P6RA 5ELXA 2A2ZA 3TSWA 4W5WA 2H57A 2IYQA 4AURA 2QG6A 1I4DD 4MH0R 1YVDA 2SHKA 5BQ5A 3ZVRA 1Z22A 4B43A 3M0EA 4IXMA 2J59A 3SZRA 4YMTA 1VECA 2IA5A 2BM1A 2QBYB 3FVQA 3GLHB 4K8OA 5JS7A 4OQNA 2W0SA 3OAAA 4LBWA 3TVDA 3A1WA 2JLRA 3GJXC 3W3AA 3R7WA 3W5IA 3TQFA 3B82A 2FA9A 4G3XA 2CE7A 2RGXA 5IK2D 1U99A 2XSZD 2ZJ2A 3KKQA 1Q1EA 3CH4B 5JI2E 1G18A 3W6PA 1RRCA 4NE2A 3O8DA 3Q85A 2YC4C 3J81k 5KSYA 1NN0A 4RD4A 1Z0AA 1E0SA 4JBXA 2EYUA 1ZM9A 4YQFA 2H5EA 2O8EB 2QBYA 4OHXA 2ZE8A 5CLQA 1Q22A 1RPZA 2GBLC 3A4LA 3SU8A 2DCUA 4EAQA 2ZS8A 3KUDA 3GFPA 2NPIA 1BO6A 1VDZA 4A8JB 2ZI5A 2ZYWX 4B6EA 1E9EA 4ZDKA 2R62A 2ZYVX 4TTRA 4D25A 3W6OA 2C96A 1E2NA 5BYJA 4P32A 5HKKA 1WB9A 2IYVA 3LWNA 4Q9JA 5L3QB 4EPYA 3EWSA 3LX5A 3H86A 3G82C 3WHKA 3LBHA 3ZZ0A 3BH7A 1ODFA 1NKSA 4Q1BA 1XF9A 1Z29A 3KB2A 5E7MA 4C0JA 4MRRA 3LH5A 2REOA 4GFDA 3TAHA 1J90A 3ZH9B 4B2LA 5LBIA 2J9RA 1IXZA 2B8WA 2YINC 1MO5A 221PA 3QBTA 1TUIA 1U2RA 4EFMA 1II9A 1LW7A 4KAXA 1ZM3A 3QXCA 2VP9A 1EFHA 3QENA 1U81A 1VCMA 2HCBA 5DI9A 4LUCA 4BZQA 3VNVA 4N0DA 4Q21A 2A7QA 1MOZA 2O0JA 2FFAA 5L3QA 3LXXA 2WVJA 3EZ7A 5AWFC 4KHZA 3O47A 1T3HA 1WMSA 2UKDA 4A6PA 5FPKA 1GVNB 4Q7JB 1CR0A 2RKOA 4U5XA 5FR1A 4XWOA 1P72A 2P6NA 3GLFB 2BV3A 1F2UA 2IW3A 4QC2A 3W8RA 1NI3A 3KFXA 2NO1A 2VF7A 3L8YA 3L43A 3QXXA 3UMSA 3H4MA 5UKDA 4JVMA 4AYWA 1UJ2A 1JQLB 4URXR 4LYAA 4DEYA 5FL3A 5AUNB 2R6FA 2FSFA 3KJHA 2GCOB 4KSBA 5IDVA 1RZ3A 4P31A 1LS1A 1U0LA 4I1OA 5DO9A 5EXXA 4HAWA 4A2PA 1S1MA 4F91B 2ZRCA 1IM2A 3IEVA 1UDWA 3R8FA 2ZROA 5EXPA 4ACAA 3THWA 1E1QD 3QKRA 1N6OA 3GLFA 5KYKA 1BMFD 2WAXA 3D7MA 1OHHD 1MH1A 2C04A 4TSFD 2IC5A 1J7KA 3CX6A 4WAUA 3X1ZA 1KI9A 1OB5A 4BZPA 1NLZA 1SVOA 4XWKA 4CEJA 3U7FB 1Z0DA 4FMDB 2F43A 3AUXA 4KBGA 2JCSA 3VHXA 1CRQA 721PA 1A5TA 1S2MA 2ECKA 2QI9C 2QT1A 3A1UA 4I1UA 1R7RA 2ZEJA 3QF7A 4JBYA 4C0KA 4M0LA 2G6BA 3NH6A 4Z54A 1OXVA 4WA7A 2VHQA 3AF1A 3VKWA 2VRWA 4GL2A 3GEHA 2ERXA 5C4GB 3IIJA 4Q19A 3TJZA 2A78A 2QGZA 4WOPA 3U3KA 4XH9B 3WBKA 1FZQA 2V54A 2A3RA 4LCBA 4QHTA 1D2EA 2HYIC 5DIFA 1R6BX 2ZIAA 4M1TA 4ZDIA 3NBYC 4QJ5A 3NEYA 1HQCA 1GZSA 1VCOA 1JAHA 3FFBA 4FWTA 4EIWA 2IYRA 1YZUA 4QBGB 2REBA 1P2TA 2P67A 4M1OA 4I4LA 1ZIOA 3OEEA 2IUUA 3TNFA 1W1WA 2JGNA 1Z07A 4QNMA 2C5LA 3I3SR 3ZJYA 1ZD1A 4IOKA 2GZDA 2ORIA 4O2RA 4MKHA 4RZXA 4U00A 1W7AA 4NONA 4QGGA 2W2TA 4QKQA 3QKUA 4HB2A 2ZE7A 3I92A 1OXXK 1CR1A 2GWHA 3SQXA 1S96A 1KK0A 2BBOA 2E1RA 3HR8A 5EP3A 2PMKA 2O5VA 3S1AB 3SYKA 3UMFA 4BGDA 3SS8A 3LNCA 2QGNA 1NMZA 3W5JA 2WSSD 3AKYA 3IDQA 1XXHB 4C0AC 4US0R 2WJHA 3RS3A 2YOHA 3HU1A 5CYOA 1HE8B 4MYHA 4DLWA 5H8WA 4B6FA 4MITA 1E0KA 3MWJA 3WP0A 4M9SA 2NMVA 1FMJA 4M21A 1XJ0A 3O8BA 4TQUS 1IN8A 3CF6R 4MQBA 1P2UA 3I62A 3U6KA 1KK3A 2ZS7A 1TU3A 1XB2A 3A4MA 4TZ0A 4B3GA 1XRJA 4HZIA 5FH9A 1G6HA 1L7VC 1DAEA 2FH5B 1QHIA 2ZPTX 3FPAA 4JZKA 4HAYA 2ZRJA 4C0HA 4HLCA 2GESA 3K0AB 3S1AA 3B7GA 1TNDA 5FUXA 2PEZA 3NBZC 2LKCA 5BXQC 2O8BA 4HUTA 2MMGA 3GLIE 1GKUB 2EFHB 3ECCA 2WJJA 3CB4A 3B1ZA 5JI3E 1E9DA 4JLMA 5JEEA 2GCPA 4PR0A 2IXFA 1KDTA 1XD2B 3I8SA 5DISB 5KDDA 3VR3A 4OI1A 2O8FB 3CLVA 3ND9A 1JQJC 1SVLA 1BMFA 5KTYA 2VSXA 3GJ7A 1TEVA 1ZIPA 4CZ2A 4PC6A 1OHHA 5HTKA 1HT2E 2ZM5A 2OAP1 5FOVA 4KV9A 1E0JA 4TSFA 1JECA 4GI7A 4PHFA 2P0EA 4NU0A 2V3CC 2GRJA 5F3WB 3Q5DA 3M6AA 5K8TA 4HLDA 2FV8A 4XVQA 3GEIA 1GIAA 5FI0B 3FKSA 4S2EA 2QMEA 1KTVA 4GP7A 4XJXA 1OXUA 1YKSA 3SJCA 3NG1A 1IN4A 1EFTA 1E4VA 4OI2A 5FUVA 3V9PA 5E3HA 2FPLA 4B76A 4NZYA 5BN3A 5DN6D 1WBBA 5F9FA 4ITRC 4NTZA 4X8OA 2WWGA 3BERA 1Q57A 2WWXA 4CF7A 1NRJB 4XIGS 1KDPA 4QFMA 1UKYA 4CT4B 2BEJA 2OUKA 2WJGA 4KXFB 5EE0A 1P2VA 3T5GA 2CDNA 1QHGA 3BIFA 3IIKA 2PZFA 1KJYA 2NG1A 2D06A 1A2KC 1OB2A 4KVAA 3QVUA 1Q3TA 5P21A 3AF0A 5EP2A 4I81A 1G41A 2QU8A 4POAA 3VMFA 3K0SA 4ESHA 1GKIA 3A6PC 5C4MA 1KMHB 2YJTD 2ZR7A 5A5GA 1I2DA 1P73A 5KSZA 1IOZA 2QN6A 3NWJA 1GFIA 4BQSA 2WICA 1HV8A 5TDHA 3MMPA 5ANRB 3PUWA 1BIFA 3I61A 4LSGA 2DWOA 1M6NA 4AK9A 5CDFA 1SULA 3U3JA 3SFZA 5B30A 1R0ZA 3BXZA 3H0KA 2IS6A 2J45A 1HTWA 2YZ2A 3W9YA 1EFCA 4QG7A 4URWR 2O8CB 1ETUA 2GEUA 4XTRA 1OIWA 1EG7A 2AK3A 4AIIA 4JKYA 1PUJA 1N6HA 3WY9A 1E2KA 3QKSB 3TGPA 5HZKA 2CHVA 3B9QA 1HQYE 1KMHA 1XBTA 1DO2A 1ZC4A 2YWEA 2ZI4A 4YDHB 3LBIA 3TUIC 3VX4A 3ZS9A 2QRZA 4NDZA 1CJKC 3UWOA 4FN5A 4BFZA 3U7EB 1JALA 2QTHA 4JMPA 3BS4A 1RFLA 3AV0B 4PX9A 4LBVA 4C4PA 1FNMA 2C2HA 3ADBA 1CR4A 4F7WA 4EQ6B 2IHYA 3MG9A 3M4YA 1GUAA 2VO1A 2WMNB 1G291 5H68A 3RRZA 4GPTA 3RLFA 3GLGB 3PEYA 2HT6A 5KUTA 2G0NA 1AGRA 2ZJOA 2V8OA 3N5CA 2ZS9A 1Z0FA 4JLOA 3ICEA 3QEJA 5EZ6B 3KTAA 1BH2A 1G64A 4TMWA 1J70A 4NCNA 2FPMA 4RD1A 1HT1E 2CL6X 3LLMA 2CVFA 5K8LA 2FU5C 1U9IA 2OT3B 3DOEA 3K8YA 2UVQA 3RRNA 1IN6A 1QHHB 1W44A 4R9UC 2GXQA 2IWRA 2ZI6A 1G3QA 1T9HA 1KY3A 4OHZA 4KODA 1YR8A 4DB2A 1HURA 1N0UA 4Q66C 5FTLA 4KFTA 3U6BA 1GILA 3R9WA 1AS2A 3BC1A 3KB1A 4QBIA 4EQ6A 3ZIAD 5JEDA 3DZ8A 3AVTA 2Z4SA 4DC9A 3BB3A 3DM9B 4U02A 1VG9B 2Z5FA 1D9XA 4Q1AA 1QHNA 4M9ZA 4V03A 2KJQA 1N6IA 3P27A 3UWKA 1G17A 5IHPA 2ASEA 4B32A 4G5QA 4EJSC 1ZU4A 4DSTA 1I2MA 821PA 1AIPA 2OO7A 3HPQA 5L3SB 3EG5A 3WYAA 1AS3A 2W2XA 3KZ1E 5FOTA 4PAOA 3ZD7A 2D7DA 3QXSA 4KYUA 2OESA 3PITA 2HXYA 4PO1A 1DVRA 3ADKA 1TMKA 4N1AA 1SXJC 2A5JA 5KO2A 3SJZA 1TF5A 1JPJA 2UZ3A 5M04A 2F1IA 3NIBA 4S35A 4JLAA 2ZSEA 3GLFE 2AXPA 2JLUA 4Q4JB 1M7BA 1WCV1 3AVYA 5CK5A 2B8TA 2HJVA 3SC3A 5EE1A 1X8LA 3B2EA 2QMHA 1NKTA 3RS2A 4ASUD 2CLDX 3PFIA 2WSMA 3PEWA 2OCAA 2J0QA 4LV5B 4HB0A 2Q0HA 1LS6A 4QBFA 3VTKA 2CE2X 1S0UA 2GZAA 4Q7KA 3C16C 1UKZA 2GF9A 4WW0A 2AKAB 3FB4A 1U90A 4K81B 4PZLA 4RD6A 1CULC 1DG1G 3PCRB 1A82A 1XWIA 3QXHA 4Q4JA 4ZCIA 1NSFA 4A0RA 1N5IA 1AZTA 2WOOA 3HYRA 521PA 2Z43A 1D6JA 1UBEA 1W4BA 4G1UC 3TH5A 3T06B 2YWFA 2VSFA 1GNPA 2GJKA 3EZ6A 2ZXUA 2ZAOA 4DCNA 2ZQ5A 4JLJA 3T61A 2VP4A 4TYNA 4URYR 3GJ8A 1YZGA 2VH5R 1W2GA 2A5YB 1MO6A 1US8B 2GVZC 1NP6A 2QPAA 3LVRE 2G1KA 2C03A 1ZP6A 1YRAA 3ICQB 3EAQA 3Q7QA 2Q3MA 2D7CA 1RRFA 4URUR 3EA0A 3SDZA 3WMGA 1MRNA 2BIFA 5FOUA 3K70D 2ZTSA 3AVPA 4DSOA 4NYIR 1FQKA 4RSGA 2N46A 4TL6A 3N2IA 1GNQA 3B78A 3LY5A 4D4LA 2E9SA 3QF4B 3WNCA 4GDFA 1W0KD 2BMDA 4JKIA 4Q9IA 3L0SA 1QVRA 2MMCA 4HLUA 1OH8A 4D26A 1F2TB 4HZUA 2X8AA 1U8AA 5K8UA 1E79D 5DLQC 2J46A 1OLOA 4QM6A 3GQBA 1SVSA 2IXGA 3ZVMA 4M1WA 4C9BA 4BPBA 2BDTA 1FUUA 3PUVA 4GOJA 4JVSB 4LY6A 2D74A 2WKQA 3K09A 2CXXA 2YNMA 2ZRGA 4NH0A 4UNPA 5IT5A 2HUPA 4JJZA 1SVIA 3EPHA 3ZIAA 5FR2A 1V43A 3ETLA 2PEYA 4NBSA 4G5RA 4IOJA 4TLDA 1M8PA 1D5CA 2FF7A 2AX4A 2OG2A 1ZMXA 5SZJA 4XTCS 2R6GA 1LF0A 3EXAA 5AJWA 5KPJA 1F2TA 3BFKA 2WWFA 3QQ5A 4LHYA 3U5ZB 1XEXA 2JJ1A 2DB3A 1E6CA 3KKNA 2JIZA 5FOSA 3WBJA 1CS4C 2YWGA 4DJTA 1ZRHA 4KBFA 4DWJA 5CIQA 4FD2A 2XX3A 1CXZA 3W34A 4DSNA 2W00A 2Q6TA 1W48A 3DVLA 2GAOA 1LB1B 4OJKA 2XAUA 3BB4A 4BLSA 1G16A 1W49A 3VR6A 4PHTA 2IYXA 1KK2A 1OV4A 2QA5A 2ZI3A 2IHBA 1P9NA 1T5IA 4NPHA 2V1XA 2FFQA 2NZ8A 3TW8B 4OHWA 3W6NA 1J2JA 4BLTA 2OEPA 1Z2AA 2J0UB 4CT5A 4A0HA 621PA 2YOGA 2IYSA 4PPQA 3WP1B 4D0GA 3FMOB 3PJRA 2D4HA 2WWYA 4OQMA 3AKCA 2GXAA 1F48A 2BBTA 5FPHA 3RNLA 1KGDA 3CUEF 4GNKA 4NP6A 2CCKA 4C30A 3KQNA 4TQAA 4Q00A 5G53C 3L0OA 4YDSA 4KFSA 1G21E 3OIWA 4M1MA 3BWDD 4II7A 2ZRBA 3K70B 3FHTA 5H70A 1ZINA 1L2TA 4Q4AB 4P0TA 4A2QA 1JR3D 2XOKD 2XITA 2H8KA 3IGFA 4CW7A 1AQYA 3GJ3A 5CJ2A 4OHYA 2Q3FA 3PVSA 3UXMA 2C98A 4YLGA 1KZ7B 1PLKA 3LO5A 5HE8A 5AJXA 1N3BA 3UG6A 4NYIQ 2EFDB 4IFBA 1W4AA 2BMEA 3BAFA 4DXAA 1NVUQ 1KI2A 4ZKEA 1QHSA 1UBCA 2CLCX 4RY2A 4LPKA 1RJ9A 3B1YA 2BC9A 2CEAA 3PUXA 1VG8A 2AXNA 4PC1A 4R2HA 3U3RA 4DLZA 4TZ6A 1VYTA 1XTKA 1MABB 4UNNA 3U2QA 4BEJA 2A5FA 2C9OA 2VL7A 4Q4AA 3L2OB 4NYJR 1I4TD 2DFNA 3H84A 4YONB 1A2BA 4F4CA 1ZAKA 3LX8A 2Q9CA 4OQFA 1W0KA 4PC7A 5SZKB 3WRXC 2FWRA 2IYTA 3IHWA 1PVOA 5GJVC 2NPFA 1HUQA 3WNDA 2ONKA 1VYUA 3TR0A 5CDFE 4GMXA 2HF8A 3GLHA 1WXQA 4NKRA 3EIHA 1XFAA 1E94E 3R9IA 2EU8A 1QG2A 1H65A 1OF1A 2HCJB 3DL0A 2ZRNA 3LBNA 4JVLA 1FPMA 4IEEA 1KNQA 4JLPA 3AQ4A 4P4UA 4FCVA 3RANA 4BECA 2NQ2C 3U60B 4CEHB 4GMDA 3LAWA 1KMQA 1X8JA 3RSLA 3V4FA 2AHOA 1KSGA 3K0EA 3ZYCA 3REFA 4D4MA 1XZQA 4ZIRB 5FPYA 5J4KA 5LD2C 2O8EA 1E2HA 3UIEA 2D2EA 4JYCA 2A9KA 4QM7A 3P32A 4XOIA 3OE7D 4M9XA 3SQWA 2QSZA 4BFUA 1N6KA 3K9GA 5G3YA 4RKEA 4TQ9A 3ZVNA 1B23P 3SJBA 2BEKA 2N42A 3ZVLA 1XX6A 2GDJA 2ZRMA 1DAIA 4IVRA 4A8JA 4WZ6A 1G7SA 1QZXA 2VHTA 3R9XA 2V6JA 3T35A 1P61B 1KJWA 4EPWA 3TLXA 1NY6A 1T5LA 2F1HA 4FMBB 2BWJA 4DCSA 4TL9A 4CEHA 2DYKA 4PFSA 4EFLA 3M1IA 1XPOA 1P7CA 2GKSA 2G88A 2F55A 1VMAA 2QNRA 2QTFA 4B35A 5CK4A 1QDEA 2RHDA 4DEXA 3E70C 4Q7MB 3U44B 2PJRA 2GILA 4M4SA 5TXGA 1ZU5A 1TEXA 3CRRA 1XNJA 1S3SA 2NTYC 3HDTA 4JIMA 1XTJA 4LJ7A 2MSCB 4RCYA 2B92A 2BJVA 1Z8FA 3AKEA 2PLFA 3VFDA 4BLRA 2FN4A 3CRW1 1KI4A 2FSIA 1IXSB 2ANCA 2HDNB 2ZE6A 4M53A 2FOLA 4O2LA 4LJ4A 1Q1BA 5JZVA 2HEIA 3NC1C 4DDTA 4DCVA 1OFHA 4LJYA 1KIMA 4PQRA 5TVKA 3EA5A 1C4OA 1G8YA 1N5JA 2GNOA 3DHWC 3OIYA 3VR4A 3ZLJA 3IQXA 3HR7A 1Z83A 1OE0A 4J0QA 1F60A 3V4RA 4OKSA 3U4QB 3EZ2A 1BKDR 2H16A 2L0XA 1JR3A 2JLWA 1DTSA 3C14C 1P6XA 1GSIA 4EUNA 5GVRA 2J0SA 1Z5ZA 4G5SA 3VNUA 3FWYA 4NCKA 5FPSA 2HF9A 4BLPA 4BWYA 3AP2A 3ZD6A 4OK3A 1N5LA 3F0TA 2XNSA 3K0CC 1JB1A 3H1TA 4NYJQ 1SKYB 2D3WA 4GT1A 2DR3A 3E1SA 3MUFA 3QJYA 1P4SA 1N5KA 2DFLA 2GCOA 3PG5A 1JBKA 2DHRA 5IK2A 2XSZA 1H8ED 1NN5A 4XSGA 2P6UA 5GJCA 4ARZB 1NY5A 4BFWA 3FMPB 1DAKA 2V9PA 2RGCA 2ODEA 1E99A 5E4FA 1W36C 3PQCA 4Q02A 4XD7D 3Q5EA 1A1VA 3QPWA 1PV4A 3TE6A 4MKFA 2J41A 3K9NA 1R4AA 2CCGA 2Y8EA 2VHJA 1XMVA 1CR2A 1QF9A 1QG4A 1Z3IX 4P4SB 3CX8A 3RABA 3AGQA 3GJ4A 4HB3A 3U7HB 4LGMA 2IYYA 5KSOA 2EFEB 3F8TA 1KJZA 4R71A 5KPDA 3TUJC 3IBYA 1U8YA 2YKGA 1CRPA 1KO8A 4TYPA 1P3JA 4W5HA 2JLVA 3IQWA 1E1RD 2BBSA 2BHRA 1OYWA 1R2QA 2F3TA 2QP9X 3K9LA 3SBEA 2C9CA 3I32A 2B7BA 2PZGA 5C2JB 2AFHE 2X77A 4HUQB 2FEMA 1CJUC 3SOPA 3THXB 4TLAA 3CH5A 4B3FX 3CF0A 3KUCA 1OXSC 4UNRA 1FFHA 4P4SA 5FBVB 3PR1A 3OE7A 1UEJA 4NCHA 4AYXA 3A1TA 3ZGXA 4PZYA 4HATA 4KCGA 5DGXA 2V55B 4B34A 3ND8A 4JSTA 4DLYA 2VP2A 5FBRB 2FE4A 2QT0A 4KLNA 4L8GA 4AKIA 2IS2A 2VF8A 2D2FA 2Z6VA 3AP3A 4L16A 4HI0E 2JJ8A 2J7PD 1G8PA 4QGFA 3LA6A 1E4YA 3MRSA 1X8KA 4JLBA 3KFVA 1ZVQA 2PX3A 4KVGA 2WJVA 4V0LA 3RS7A 1RYFA 3QSYA 3THXA 3BE4A 3SN6A 2ODNA 2ZJ5A 3AKDA 3RS4A 4ACBA 1W47A 3A4NA 3LFUA 2IXEA 2H1LA 5FBQB 3GD7A 3REGA 1T4GA 5EZ5A 1FNNA 1VYVA 4IDHA 4MGKR 1U9IC 5B2ZA 4O3MA 4TL8A 3I5YA 1XXHA 3FFAA 4DCTA 3BOSA 3SYNA 2BKUA 121PA 3BH0A 1ZBDA 5EUMA 2C8VA 3CZPA 1R8SA 1ZCBA 1B0UA 3HPRA 3EC1A 4OQXA 1Z0IA 2WPDD 4ZCMA 3CNOA 2GETA 4TWZA 4FCWA 1DAHA 1L8QA 1G19A 2I4IA 1E1QA 1IONA 3CZQA 3ZQ6A 1QHXA 1Z06A 4E07A 1ZM2A 3GPLA 2RGDA 2YHSA 1N6LA 3QG5A 1IJEA 4Q4HB 3WMEA 1R8QA 2QRNA 3K0AA 2GZHA 1KI6B 2MSEB
chains in the Genus database with same CATH superfamily
1YJBA 4K9NA 1HYQA 3N3AC 1QV9A 2ZSKA 4HQFA 1BU8A 1FDIA 1LNZA 3PEUA 2QNBA 2AD5A 3QXJA 2JLSA 4MO2A 1FSSA 1QIGA 4MWTA 1AUQA 4P35A 5KOIA 2QJWA 3QY0A 1USUA 3L5KA 3DO5A 3LM8A 5BRNA 4BNTA 3HVJA 1L4UA 1H8EA 2CJXA 4MZDA 4P0PB 3PUZA 3AUJB 4LHEA 2QLBA 1GV0A 2BM0A 5JNUA 5BQOA 3HB1A 2LXNA 3DMDA 1RWQA 4QHSA 2F1RA 2Q5QA 1E1LA 1XD2A 1MG5A 3MCZA 4QFCA 4ZEMA 2O8FA 5E2BA 1JEQB 1SCQA 2JFWA 1UCFA 4IIXA 4ZHSA 3O5AA 5E7QA 3TQTA 2REQB 4LDPA 1DOAA 4NEQA 3G0DA 3OJOA 2O7NA 5FTNA 4ZEWA 1N1MA 1Y7IA 3G9UA 4RORA 4MP3A 1GU7A 3G8AA 3SX2A 3TTVA 4BKOA 2YN4A 5GJBA 4NJMB 3ONVA 3VYVA 4C4OA 5EN4A 3RAPR 1SIBE 4EHBA 2G5GX 3OPXA 1LI4A 4J1QA 1PSWA 3L7CA 5C34B 4ON9A 1IZ7A 1Q0HA 4X54A 4UVDA 5DBIA 3IR5A 4ZA2A 4US1R 4WV3A 1ONPA 2Q1SA 1KPHA 1VBMA 3BN3A 3A36A 3PP8A 4Q9KA 4IFEA 1SBCA 5TT1A 3DDWA 3RWOA 1A9PA 4TVSA 5L3VA 1ISJA 4AQDA 3OE4A 4AKEA 4Z4IA 2OB2A 3FNIA 2NUPB 2C77A 3FVTA 4BUCA 1Z6GA 1D4OA 4FJ1A 3RSHA 5LXTA 4ZO9A 1THTA 3K30A 4LYHA 1M2VB 3KP1A 5FNVB 3RJ9A 1GUBA 4CN9A 3TOSA 4TTAA 3E2PA 3IBGA 4TXMA 2FWIA 1SVUA 4DAEA 1XQYA 4PC2A 5G4KB 2W6ZA 1QH9A 1XFDA 1U7OA 4ER5A 1QRUA 1PG5A 5BSHA 1XALA 3GPCA 5DIZA 5KDOA 1O96B 3D8RA 5CDHA 3DXZA 5KJEA 4X1IA 2I1VB 3F5DA 1V1JA 2OR3A 4BNVA 3UV6A 4Y0VA 5DZSA 2O8DB 1T2VA 3IAHA 4IDOA 1AUVA 3USZA 1HY3A 1UXOA 5DYGA 3X1MA 2XZOA 4P53A 4RV5A 1H2BA 2GPNA 4DYHA 5K6TA 1BKSB 2QQEA 2EVWX 5CM8B 2OBLA 1ZW6A 5C3UA 3SZMA 4MS4A 2VNHA 4XWAA 5CB8A 2PKEA 4PR3A 3RUPA 2C3OA 3WLAA 1JEEA 2BM9A 4WJLA 4NBTA 3OTGA 2ZE5A 1O9BA 2IDZA 4UUAA 1N7HA 2HQ1A 2CL7X 2NZUG 2WMYA 4ND3A 4X9XA 5E38A 3T1VA 3WAKA 4U2CA 2KBEA 4XDGA 2PGDA 5FAXA 1UBMS 4BN4A 3IALA 1E0AA 2PSFA 4C21A 3E7FA 1B3BA 3GG2A 3WGTA 4UBLA 4BAUA 5K6RA 1S5PA 3OLQA 3VJLA 4MUXA 5IWCA 5DLDA 1VQ1A 4C7JA 1NXSA 1W59A 2BVNA 3K5WA 3R5SA 2V1UA 1W46A 4IP0A 1F8YA 2YY5A 4GVPA 1GTVA 1M1NB 4AMVA 5DGDA 3VMMA 1QRAA 1PTKA 4EG8A 5H3CA 4YJ3A 4NX2A 1NQVA 1SWWA 1VIYA 4EP1A 1CS0A 1IZ0A 2BFAA 2CGEA 3MWLA 1W5SA 3CSUA 1MORA 1O9HA 3OFJA 2O8NA 3AIMA 1TLTA 1ZUWA 4M1KA 3DA8A 4LOAA 4R41A 3QKSA 1DPFA 2P62A 1Q7RA 4I1VA 4KI0A 1G2QA 2W22A 5J3JA 3FHCB 4P3NA 4DKXA 2Y1CA 3I73A 3QKTA 1HYHA 3IQHX 4H0FA 2NU7B 1WP9A 3GUVA 3HLYA 2Z6UA 1Q0QA 3HADA 5FLXA 4JV5B 2G9VA 3JD1A 3QPCA 1FFXB 2C54A 4WOBA 1GUDA 3EOBI 2B7LA 1PK9A 2HSGA 1OVMA 2O0MA 2JAXA 3NETA 1UPUA 3G6KA 4MP8A 3HWSA 2NUAA 1GZVA 2P2YA 5BSGA 1UF9A 3RYFB 2GPSA 1UZUA 4JSYA 2GJSA 3TLYA 3OF5A 3ZU4A 3GLGA 2PMEA 4ARUA 1GFWA 2B8JA 4AN0A 2NP7A 5EJEA 1V45E 2WG0A 1GRCA 1I1OA 1GPYA 1XHEA 2Z2YA 1AV7A 1I2BA 1QFSA 3JQ7A 4NATA 4WJKB 1L7BA 4JYBA 2JJ2D 5AW0A 1U8XX 1SCIA 2HAEA 3ZBPA 4YH1A 3KKPA 4EEZA 1LH0A 4DMLA 1FTSA 4KH1A 2UZ0A 5DN6A 3THOA 3GROA 5JXJA 1KL7A 5EJ4A 2G1JA 3ZGYA 1WF6A 2IT1A 1CQJB 2EWWA 1R0YA 2HPZA 2ZJBA 4YXWA 4AIRA 1C1YA 4AUKA 1CFZA 5FJJA 3BMQB 4MGIR 3JVDA 4OJYA 4BATA 2CHEA 3SHQA 2IEYA 3K0BA 3VYRB 3GFFA 5CLLA 3MJDA 2ADOA 1L6RA 5KNBD 1DUSA 2VKQA 3PI6A 1V96A 3M4JA 5FPQA 3ZE6A 1TM4E 2ZVJA 3GC6A 4Q1DA 2O2EA 1ZS9A 2OPBA 3BG5A 4ZQIA 3DE0X 1XAHA 2CXUA 3ETDA 1HH4A 3FI0A 5KX5B 1JHZA 3O83A 2JK0A 2WJYA 3BF8A 5L3SA 1GGFA 1U3UA 3LCCA 1E5XA 4UHHA 3TVTA 1T6ZA 2ZSBA 3LXRA 4HX9A 5FEMA 4MLCA 3T15A 4AECA 3GMTA 3AVUA 2PSDA 4DV2B 2OV1A 4B71A 2F3RA 3GLUA 3TD6A 1O95C 3AU9A 3STWA 3P4XA 3COJA 2BJWA 3CNNA 1I6MA 2C2BA 2GARA 2R8RA 2X6RA 1KO1A 3OETA 1VFPA 4HFMA 4E13A 1OIVA 1C7ZA 2CVHA 3N7TA 2PSSA 3VR5D 4CCYA 4GVLA 3PFBA 5FL7D 4EPTA 3DE4X 1KWGA 3UJ9A 3IDOA 2YW9A 2WQ6A 4DV7B 4AYTA 5LMUB 1T1RA 4CR7A 1I7PA 1NN1A 4MQEA 3BORA 3OCJA 2FZWA 2YWCA 2H2HA 2X2FA 3BXGA 4H3KB 4J6EA 3RCBA 5IVPA 2ZRQA 3OZSA 4JL8A 1Z6AA 4XDYA 5EP1A 4OYRA 1OOEA 5A4KA 1K5DA 1M2JA 5LQUA 4F2PA 1VL5A 2YV5A 2ZIXA 3WIOA 3IKTA 1B73A 1UXGA 3OIGA 2W6JA 5CAEA 2ACKA 2XVMA 1JA1A 3G5MA 7REQA 1G2PA 2DLNA 3GGGA 4R98A 4BZXA 4U4AA 3DH0A 1HYEA 1XVIA 3KCQA 3OZ7A 1SG0A 1A7UA 2GPWA 1WSWA 3C48A 1KEVA 2P9YA 3Q7RA 2XYHA 4P3OA 4Q1FA 4S3MA 4WXEA 3RRFA 2ZYUX 1KAMA 1CK4A 2BOVA 2DHEA 4LNUA 1CZLA 3HKEA 1C9NA 1YHYA 2HQRA 3C3JA 3CNEA 3LDFA 1JQAA 1ZNYA 3OE5A 4MUGA 1HQKA 3T7KA 1XI2A 3WQSB 3EWAA 4DC1A 4UQOA 3IVXA 5IANA 3DMTC 1PR3A 1WPRA 4DZZA 5ITZB 4JS0A 4TSKA 1XTIA 2XNCA 5C9ZA 3GB9A 5KWIA 5IF9A 4HFNA 3JWHA 1GM5A 4J1TA 4XRGA 4K6HA 2HLDD 5EZSA 3UCXA 3LNTA 2OUIA 2P4HX 3K0FB 5BOVA 2FSPA 2KE5A 3LGAA 1J0DA 3HLKA 1D7OA 1US8A 2BFPA 8AT1A 1A97A 1K8YB 2QTCA 2RK3A 1JDTA 1XTZA 2ACWA 4YV1A 1AMOA 2JS7A 1SCJA 5EE9A 4FGWA 2J5BA 2Y2UA 5FX2A 1ZI6A 5KYXA 1FX0B 4S1OA 3RSCA 1G66A 1KO4A 1T1EA 2V7UA 1P19A 3TNDA 1DPGA 2EKBA 5LDDC 3O9MA 3QMWA 1CUDA 1E7MA 2B0CA 2PZKA 3X2FA 4PZEA 2NO0A 4WPGA 3DE1X 5HF8A 1YU9A 4U2GA 5ALDA 1I7DA 3ONFA 2QY9A 3E1GA 3LG2A 3MWEB 5HM8A 3PJEA 2YN0A 3KJXA 1Y6FA 2CFOA 2IQ5A 4MRAA 4C4RA 4MRPA 4D02A 3NNDA 2ZUTA 3IXMA 1KSFX 3HACA 3QF4A 3HBMA 1TUBB 2PKWA 4O2BF 3WIDA 3X1YA 5JAOA 3KQVA 1OLSA 1RRVA 5LR6A 3R09A 1TGYA 1OI7A 3TXXA 4IH4A 4U1RA 4XVCA 1HLGA 4P7BA 1TM3E 3K9CA 4MHOA 5BNFA 4BBPA 1SA0A 4DHEA 2BRUC 3GGDA 2E55A 2FEAA 3UFXA 1KOGA 2UZ4A 1K7YA 1Z6XA 5HE9A 1UBJS 2PS1A 1R8JA 3EVZA 3C8UA 1AHHA 3PKZA 3MWYW 3OLVA 5JJLA 4GI1A 4D79A 1E9AA 2DEUA 4DS3A 3AJDA 3I04M 4FNGA 5JDCC 4C5CA 1R66A 2IUSA 3BFJA 4Q03A 4EJSB 5TMPA 3GDOA 1ACLA 1YONA 2PWBA 1GNVA 3E3NA 4LV8B 3U40A 5K0TA 3UGTA 4RJLA 4WGGA 1BXZA 3BSYA 4JSRA 2VJMB 4RHEA 3TTWA 3KDSE 3LUJA 1ZJZA 1JDBC 1CY8A 3WYFA 5BORA 3HCBA 1NX9A 4L8WB 1TI7A 1SKBA 2YBEA 4QXQA 1WA5A 1Z4MA 5DHAA 3GFSA 5DXJA 1CUJA 2ZSIA 4BEWA 5EI5A 1ZJ6A 5CNMA 4ASUA 1XTRA 2Y3IA 3ETCA 1VG1A 3I2YX 5C32A 1GITA 5CG1A 1ECFA 2HKIA 3DONA 2O2SA 2ES4A 2WMOB 3F6RA 2AN3A 3GF4A 4O02B 4UM7A 3BULA 5JMTA 4NFYA 4JP5A 3B1VA 4XVUA 3MJCA 3P2KA 1N0WA 5AD1A 3CPEA 1AU9A 3A1SA 1AKEA 3S27A 3A1EA 5E7IA 2M6KA 3SNKA 1Y4AE 4BLOA 2Z56A 1QYDA 1B6TA 1CUZA 1W30A 2I7DA 2R8EA 4KLZA 1VSTA 1FZTA 2Y1XA 4FM9A 3MAGA 3IPXA 1G7RA 2IX3A 1IXRC 1DBIA 4LMAA 5KEIA 4TRJA 1K6MA 1SXJA 2GJ8A 3HB5X 1GZ7A 4LC9A 1M1YB 3FOZA 1J2YA 1EX9A 1OZGA 2AEEA 2OCYC 3A6JA 2FZ4A 3U3OA 3I9V1 1NLFA 3OJLA 4D7AA 3CB2A 4ETMA 1S2IA 2P5SA 2W2QA 1WSAA 3VPHA 1V11A 3GLSA 3IAAA 4EA7A 1EFRD 3L8MA 3Q3CA 2VP6A 3ST7A 1WTCA 3LQQA 4IIFA 2XUKA 4WLFA 2CVQA 1RAIA 4RD2A 4TROA 1X87A 1FRFS 4QXRA 2C8LA 4E4RA 4KR6A 3FB1A 2QAIA 1T1GA 2WWWA 3AUSA 3LQ4A 1ACJA 1ISRA 4PZDA 3CCBA 3FVWA 2P40A 3BE5A 3FMGA 3QKWA 1HMYA 3C3EA 3DBHB 5JNWA 2G5CA 1BWPA 1UL1X 2G80A 4W9NA 3IUPA 2RBGA 4HDCA 5FA5A 4PPFA 3AEQB 3E4CA 3WYDA 4KFUA 2ZZNA 1XRLA 1GZDA 2LD4A 4FX2A 4WMLA 1GWNA 2XYGA 5ADWA 5F7JA 1QZUA 3PKIA 3CW8X 3CW2A 2B8EA 4RMGA 5T5QA 4E32A 1Q1GA 2W6ID 1MB2A 4MVWA 4RVFA 4UUMA 3OPYA 1LLCA 1JWLA 1Q20A 1XE3A 1I24A 3GPDG 4I9UA 4KB5A 4ZD6A 4IIJB 3UYLA 4DG8A 4HTFA 4CLHA 5CH8A 3BT7A 4DY4A 1ZNQO 2AG6A 5IT4A 1C1DA 1EK0A 1XOIA 3CN9A 4KXNA 2A0XA 1K5HA 3OU7A 3VSCA 1LVGA 2JAQA 4XVHA 3AWDA 5CGZA 4DMUB 4TKUB 3AVWA 1WV0A 2H4YA 2RI1A 1UK8A 4ZQFA 2LNDA 1EDDA 5J2TA 4EHLA 3N2GB 2P9GA 1KZHA 1Y7TA 4EF6A 4RTNA 1BYIA 1U2DC 2VZ8A 2W90A 2Z9BA 1DOHA 2HF7A 4LYJA 1CZRA 3TQCA 4N5HX 4P86A 2ATIA 1Y6GA 4WZZA 1T24A 5A2GA 1K8RA 3BWMA 2FNAA 2MSDB 5DSZA 3PK0A 1KDOA 4LOLA 4E88A 3Q9NA 1DTWB 1NBMD 1OA1A 4FINA 4IMRA 4PIVA 4N6NA 3W9BA 1KAOA 1OU0A 4LYGA 1NXPA 3FPHA 1NMXA 5THQA 2FB9A 4BB6A 5HJ5A 1FMFA 5IMSA 5TSDA 3DLAA 1WZEA 4L85A 4A4DA 1TCAA 2WYOA 3PQ3A 4FB5A 3NTUA 5GONF 4YRPA 3KQYA 1I32A 4LMBA 1G5TA 5K01A 4AKTA 2XCLA 4D8XA 4BJ6A 5KTMA 4A15A 1BE1A 1Y9ZA 3AHFA 1NYQA 3QLUC 3V3TA 3TFOA 5IU6A 1FNDA 1L7QA 3ON5A 4LBZA 3UT6A 3C3XA 4LJKA 2OYCA 2A0UA 3QXGA 4NV1A 1XP8A 2WZDA 3MYYA 1O97C 2KLHA 5K0FA 1UJBA 2DSTA 5DI3A 4QXAA 4CGYA 2AX3A 2DFTA 2QRVB 3Q6IA 3BMNA 5AOAA 3HHEA 4V0MA 4Q01A 3HZOA 1Y7LA 3ELDA 1MJ5A 3EPJA 4UMDA 2XZLA 3GEBA 2JAOA 2Y6UA 3UK6A 2JLAA 1CT9A 3LY8A 3OCUA 3OY7A 2IPMA 4D6YA 1P1JA 1T5TA 2VIIA 4ZXPA 2V96A 5DW3A 4JBLA 4ZI7B 5F4ZA 2K7FA 1O3YA 4ZGWA 2CDAA 1RLJA 3ITNA 1R8XA 1NZDA 4KJZA 3HM9A 5CX1B 4L73A 1YXMA 1FDWA 2AI2A 1LWOA 1UC5B 1VMIA 2H2FA 2L69A 3I1JA 3IQIX 5B6JA 3NBAA 2YV1A 5KVCA 3Q3HA 1CY2A 2XEDA 1DEKA 1XEWX 4GMHA 1V8BA 4C2UA 4BEBA 5BW4A 1E2IA 2V6IA 2ZYGA 1S6YA 2XOKA 4IDPA 4BC1A 3GEEA 1KS2A 1ELOA 3K8QA 1TA0A 2EF1A 5ALGA 1JJ7A 1S8OA 1T8YA 2FG7C 2XOEA 5IG2A 13PKA 1KYYA 3AP1A 5MN6A 3GJSA 3MPUA 4F04A 1JIJA 3VJKA 1ZEJA 1RXEA 1IATA 2F43B 4OTZA 2B4YA 5G41A 4KR9A 4HUJA 4GYJA 3SD7A 1ENOA 1S8AA 2OCIA 1CUIA 3N2EA 4YAUA 2O0HA 2B5WA 3IQGX 3U56A 4PNPA 3T3MB 4MJ7A 3K4HA 1RZRA 4AKHA 1WU7A 5COQA 5JJKA 1NVVR 1KYZA 1UMBB 4MYTA 3CLRC 4KACA 5JRDS 2XGJA 3EB9A 2FRDC 3Q0TA 2Y99A 3U19A 3FDIA 3W5HA 3HJBA 1EX6A 3NVAA 1SIUA 3MEQA 1Z13A 3RM3A 4F2WA 4LJSA 3KJGA 5J59A 3DOIA 2P4QA 5JUWA 4FFVA 3AVQA 1YRBA 3L07A 3LDUA 4GR4A 1R6UA 3MFYA 4MVJF 4UCQA 4AAYA 4QVGA 2XXBA 1J99A 1KZYC 1MR3F 1E2JA 1JDVA 1Q0LA 4OQZA 4KSCA 4DYVA 1P3DA 4EBFA 5A4JA 4OHVA 1ZUD1 2ZRHA 3G0BA 1U7DA 4S04A 3HVRA 5FWNA 3T52A 4V0NA 2JBAB 4E03A 3M83A 4BQQA 2OCBA 1JDSA 1Y1TA 2DWQA 3VSAA 1GZUA 4BDSA 4IIJF 3BB1A 2KSQA 1Y1SA 1XDWA 3ENZA 4LC0A 2CZQA 2H2WA 1L7MA 1U94A 4HAXA 2Z58A 4ZT2A 4MINA 4BO8A 4GRDA 4D2IA 4YAKA 1U2GA 3JR3A 2XUFA 4QPNA 4XJSA 1JI0A 2ZAMA 3PXXA 5BUQA 2ZB3A 3HQ4O 4G37A 4ILKA 2VQFB 4B3IA 1ZUNA 3QLJA 1YBFA 4N01A 5J40A 1VM6A 3RUCA 5JHHB 1KZGB 5FYDA 1W25A 3V7UA 1RIFA 3IKMB 1NJFA 2IS4A 3DUWA 1H94A 1ZD9A 3C5WP 3ITEA 4RKWA 2R8XA 4YALA 5DMXA 1YQDA 2G83A 4PYMA 3ZW7A 4DQXA 2QM7A 3INTA 1ZKDA 2R8PA 2W6NA 4WZAA 3MRXA 2TMKA 4PQGA 1VJTA 2O5RA 2D00A 2O0LA 1Q5PA 5DGHA 2EJVA 1N2CA 4Q9AA 4QD3A 1NX6A 7ABPA 4IVPA 5I9LA 2REXB 1G6OA 3WRXA 1U7PA 4LFAB 3PNPA 1S3FA 5KNCA 4LJ6A 4Q1CA 3IR6A 1VHDA 1JLMA 1YMUA 2P27A 1UDBA 4AUNA 2B9VA 1MT0A 4LZZA 3P96A 1R10A 3STTA 1OYYA 1YE3A 4DWOA 4DDWA 5C80A 1JLRA 1GAQA 1IAQA 1AXEA 2UYOA 1PDOA 2GBLA 1MX1A 4OXIA 3VR0A 2O7VA 3RVRA 5CB6A 1T5HX 1JPUA 1XMSA 1WZNA 2ZAGA 2PIDA 1HOXA 5AI5A 4CLXA 4HUQA 5KB3A 4DNFA 4KR7A 3VAYA 2ZRFA 5K8CA 3K6RA 3T8YA 2OLJA 3NEPX 2WWIA 5B1SA 4JLNA 2LCQA 1G9TA 4IIHA 3HJNA 3HHPA 1FU4A 2HJWA 5K5EA 3LBYA 4B3RB 3D6VA 4CQLB 1WSBA 2W4IA 1XJCA 2PRJA 3RAGA 3RVSA 1UMCB 1Z82A 4DSUA 1C0EA 2GX6A 4GYYA 4LY3A 1BFUA 2DFKB 3CG4A 2H08A 1VHLA 2J0EA 3KQUA 1JHQA 1U1CA 1J97A 1N8TA 3H8SA 2O2CA 3FIUA 1I6LA 4HDQB 4Q15A 3RSFA 3VDMA 4DR3B 1EQUA 4ZI7F 3PUJA 2J3LA 2UUCB 1IEVA 1KKLA 2D0OB 2O23A 3Q2OA 4DM3A 4EHJA 5JCXA 2NZJA 2R1VA 2CJWA 1J8DA 1Q0PA 2R2GA 3KTOA 4I4TB 4E4YA 2ZTMA 1BROA 5JSHA 2HT1A 2AE2A 2H7XA 4F1WA 3WHIA 3DCYA 1H2YA 4HDMA 4G5GA 1Q15A 5GV7A 4CNQA 5AW3A 2VYND 5EAIA 3S6JA 1KSJA 4F2GA 5HZHA 4RK1A 5IUNC 3E9ZA 4GI3A 3EWNA 2YRXA 1DCKA 5EMJA 1T6NA 3HXOA 4FC6A 1VKNA 4NULA 3FX2A 1XDBA 3NEAA 1RLMA 4EKIA 2XYRA 1UADA 3A2MA 4AY6A 3WKDA 4HC4A 5F64A 1WD7A 4DR6B 4C0QC 3OZAA 1XEWY 1QNFA 1KK1A 4KMSA 5ALRA 4E09A 2M2IA 3LK6A 2F4NA 3PPXA 1YGPA 1DC8A 2JI4A 2P75A 1YASA 3BFVA 4BO5A 2YCBA 4LX8A 3PLRA 1B00A 2Y68A 3R5HA 3ZDQA 3DPUA 2JCBA 3EZLA 4FI3C 5F2EA 4YUAA 3H1AA 5JPIA 3OZUA 3V3KA 4LYFA 4MS1A 3O8CA 3IXQA 4H15A 4C0BA 1YAJA 4YJGA 5I51A 4MS3A 4L4ZA 4GD3Q 4AMBA 3GMDA 1JKJB 1ZHOA 3IIIA 4JJ8A 5K3CA 5D86A 5CEEA 1P6QA 1FFAA 3T1TA 4FCCA 2CZGA 2YVQA 4NHOA 4ND4A 1DIAA 5AUQA 1THGA 2G9NA 4ZDJA 3SX4A 2AD1A 4FIDA 4GBGA 3NDBB 2Y0DA 3LYHA 2VPPA 1JPNA 1RYHA 4H4DA 3ZY2A 4B48A 1PR9A 3BWVA 3HVIA 4U7JA 2D4AA 4RH3A 1PX0A 2WSIA 2QTVB 2M98A 1KTIA 4ZANA 4B6JA 4LJ8A 1SKQA 3D43A 4M0PA 2FPSA 3UAVA 1AVTA 3W78A 5I7SA 1JFSA 3NIDB 5JFTA 1FYFA 2PHZA 1EFDN 2LR0A 3H75A 4JJKA 2NACA 5BR4A 3QHQA 3CT6A 1AO0A 2GASA 1AKQA 2AR0A 4G4GA 4BMOB 3AF6A 1JEQA 1CHNA 1T6XA 4L02A 3TXYA 2VSOA 5DLEA 4EKYA 5JMOA 4W9MC 2REQA 1W4RA 5AK3A 4A1OA 2KS6A 5SYAA 2VTKA 2W5UA 1JS1X 2F1OA 3KB6A 2PX6A 1DV2A 4NJMA 1LZKA 3K6KA 1UBRS 4YJDA 2ZBEA 4BLUA 2A5GA 3NUGA 4H9GA 1Q1NA 5CDFE 1L8OA 2OHGA 1QJCA 1W6RA 2WM9B 4BP1A 1U8TA 4F38A 2ZJZA 2R6CA 4XUCA 3ZOKA 1DUVG 1VSUA 3BSFA 3EARA 3C45A 2XD4A 3NUZA 4D9GA 4DUGD 3IT1A 2HWKA 4MRVA 3ZHCA 1GL7A 1NG1A 2UVPB 4B4OA 5A0VA 2LBPA 3S8EA 1ZH0A 3A7DA 5CT5A 3L1JA 3NJ4A 3O3CA 3AWIA 2NUPA 3VO8A 1A0OA 1T43A 4KEAA 4M8KA 4JLKA 1IVNA 4E5VA 4YV2A 2UUBB 2OO5C 2XT9A 3LQ1A 1AC5A 2QM8A 4L95C 5JY6A 1E5QA 2VPTA 2J3KA 4CQNA 2VBCA 5C46F 1FSPA 3KR9A 4Z4FA 3AKZA 2CXRA 1CQIB 1OZFA 1SBHA 4O6VA 4TRRA 4JGIA 1LX7A 3G9ZA 4CDGA 4ESVA 2R8BA 3VR1A 1OX4B 1O96A 4IDGA 4KUHA 4K8RB 4I55B 4L15A 5DBFA 2CSXA 3LJKA 4B7ZA 2O8DA 1RM4A 1THMA 3S7TA 4KBYA 1Z5PA 4NBNA 1CDZA 3F2IA 1I0IA 5TF0A 1T8WA 1AKYA 1C0PA 2FWMX 4LXTA 1QIFA 2DTDA 3GUHA 3EG9B 5DGTA 4CEIA 3VI4B 1YZVA 1YQXA 2WUDA 3QVLA 2Z5GA 2ZXEA 3KTAB 4UFPA 3G5TA 3JD4A 5C8YB 5JLJA 5A6SB 2H18A 3RW9A 3KZVA 4BO0A 4MVXA 2TMYA 5DM60 1GNRA 3GT7A 4O4HB 2HU8A 3ZR4B 1NBIA 3CNQS 4F4UA 2C7PA 4BQNA 4WXHA 5FOWA 1X1DA 1SG9A 2JEYA 3P26A 5E6UB 1HOTA 1XKXA 4EPVA 1VL1A 1LPPA 5DGCA 1LDBA 1PD0A 1ZHFA 2XHEA 2QL9A 4OXYA 1ZK1A 1M1NA 2WHRA 3EFHA 3JQBA 1D2MA 4OK6A 1ORVA 3CLUD 1USKA 1CTQA 3MGBA 4V0QA 3W2GA 2F17A 4GAEA 1TD9A 2CXNA 2DQ4A 2QUKA 4UD2A 1R0CA 3BCSA 2ZB4A 3NB0A 1YL6A 2A35A 4R31A 2I33A 2H48A 3QX9A 2G07A 1DEHA 3DEFA 4R2MA 4UPDA 3ZCUA 1UAAA 5FQOA 1WW8A 2A1IA 2WIFA 1XNHA 3F6PA 4EVRA 2BHLA 5E4TA 2MINB 2NVUB 2NIPA 5HF5A 3B48A 3VSBA 3GW8A 2QZJA 4E2ZA 2PH1A 1FDRA 4L6CA 3W7AA 5EKSA 4C5AA 4RZUA 1FFXA 3THYB 4GECA 3L05A 1FQJA 3CY6A 3PIRA 4XLZA 4ZTUB 1M83A 5DP2A 5ERGB 5E9AA 1O9GA 5EXDA 1TM1E 2IEIA 3U61B 4D6PA 3RC2A 2GHQA 2P3SA 2G82A 5I3ZA 3DP7A 4MGZR 3OFKA 3WMXA 3VKHA 5NLLA 4LWOA 1TK9A 1J49A 2CCJA 2PBZA 5LLSA 1WZ2A 5A4DA 4K6OA 4NZOA 3A8TA 2G7ZA 1GOTA 4EHNA 5J9FA 1WL8A 2HA2A 1WDTA 2FPPA 5THKA 2OBMA 3OQJA 5FPTA 2FOIA 1Z73A 2WZBA 5EXTA 2ODTX 1NTOA 6Q21A 1QYCA 4OQ4A 3Q41A 1H8HA 3DAGA 2ZJAA 1V47A 4NR0A 4NU6A 1CQJA 2Q9UA 2XLBA 4R0VA 3TTYA 2WF5A 2ORED 3D4BA 3DMNA 3NNNA 4HX5A 3JZDA 4PQFA 4YWHA 3GNSA 4G4SO 3PNBA 1VP9A 3WWDA 2IP4A 3Q40A 4I14A 4C06A 4KE8A 2I76A 5CXQA 2Q49A 3O26A 2VDVE 2ZIFA 1E58A 2VQSA 3GLRA 3R7AA 2ZLBA 5L40A 3X1XA 4EHKA 1AXGA 1CLEA 1ZGCA 1D7AA 4OM8A 2XE8A 4P22A 4BP9A 4ZKDA 5BR1A 1P74A 3PDHA 1GQFA 2ZUBA 4X3OA 9ATCA 5LFAA 1E5VA 1Q0UA 4M2LA 1MAAA 2Z1MA 3A9SA 1K0FA 2AZMA 1BX0A 3HE3A 3AC0A 2AFIE 4KYIB 1Y4DE 5IW8A 4O0MA 4UQLA 2I7CA 5KDLA 2OHXA 1PJ8A 2E5LB 4JITA 4X7PA 3OZWA 3T1QA 4BLQA 3QBEA 1OKKD 5DYIA 1Y4ZA 4PGHA 5LQSA 4JVNA 4QBTA 3VZCA 1OWPA 2J9ZB 2DUNA 2ORVA 2VZLA 4R7GA 5FWYB 5G40A 5TJHA 3UOWA 4DDUA 5BUSA 1QOQB 3JRNA 4D80A 5AVQA 2JATA 5I4CA 3LPDA 4BE7B 1K2VN 2M1XA 1Y9JA 3SE0A 1DQRA 2CNKA 3D6MA 1ORHA 3PJGA 4I55F 3B5EA 3FPGA 3R3JA 5JCZA 4ZVPA 3NP9A 4DIEA 4O8ZA 4WTOA 2YV3A 4TWRA 1Z47A 3B3GA 1YQEA 3HABA 2NLOA 1KEEB 4IIYA 4NOKA 2IHZA 3ORHA 4CFYA 4G4IA 3G8DA 2D2VA 4G63A 4KQ9A 2M6LA 1NVAA 3OZTA 4RWZA 3UW1A 1Z6YA 4HZUB 1OXTA 2GFQA 4IS2A 4OJNA 3ZDYB 5BR7A 1NRXA 1O94D 1D6MA 2ECOA 1RQLA 2GPTA 4TLEA 4CTJA 2PPVA 1G60A 2C4NA 4B6SA 5C8YF 1VCNA 1YJAA 3A37A 4TMFA 3V80A 4RV9A 4CKXA 3ODGA 1DG9A 4UFOA 1DAFA 1G0NA 3DOHA 4HRVA 4Q9LA 5DM1A 4O4HF 1MC5A 1YR6A 4K9RA 4LYDA 3MD0A 4XD2A 3BCHA 3WQRA 4KQEA 4XFDA 5EHNA 1E3MA 1IZ8A 3FG9A 3EH1A 4UEOA 4FR5A 4URFA 5ITZA 1IZYA 4J07A 4EKDA 4CLEA 3NO4A 3VDQA 4JJ6A 4ZMSA 2YYZA 3KWLA 2AQKA 3S2EA 3N3BC 3G02A 3GUZA 3WX0A 3BKWA 3BL8A 1KYQA 5B2EA 1XLVA 1TOAA 2PX8A 4JOBA 5ITVA 4XPZA 3KELA 2GGSA 2W58A 4EK9A 3K0FA 4FFBB 1PYDA 3RG8A 1GAEO 4GW3A 3KKOA 5H7XA 3OE1A 3RRJA 1JIQA 2PZMA 2QAGA 5KC9A 5T7BA 3E22A 2GN0A 3FBGA 3G2QA 3O92A 2VXBA 1ODSA 3JYLA 3PQEA 4KWCA 4TV8B 4FEYA 1R0XA 3D4NA 3F5FA 1FX0A 2EDCA 4KRXA 4MR9B 1SO8A 2BN4A 3IX7A 3R74A 4AL4A 1GKYA 2OOSA 5NULA 3SSOA 2HRZA 1KRXA 5SV2A 5HKKD 1OFUA 3FHOA 1N7IA 1IQPA 1Q19A 1QJ4A 3D7SA 3QWBA 1L5WA 4KFRA 4P54A 3SXUB 1BU5A 3K9FC 2F1JA 4CQMB 1A88A 4KIWA 5CLJA 4EUEA 3IA7A 3FNHA 1U3DA 5DYTA 4BVAA 1YIOA 2HNBA 2AG1A 1PZGA 1XAJA 2QG4A 3KZMA 1P0MA 3HB4X 4JT2A 5T41A 1XDZA 2XTMA 3BJEA 1JFLA 2FFJA 3B5JA 4UM5A 4BKPA 5IKXA 1NXOA 2N1MA 4E3ZA 1WPXA 3C5EA 1FIUA 4JIGA 4OMDA 2Q4TA 1QUFA 1LQ2A 5LIPA 3ANLA 2QWXA 2YQ5A 3DO8A 4JBWA 2FLKA 4EPXA 1UPXA 2WKPA 3C3KA 1K3UB 3MMSA 3I76A 1M72A 3OOEA 1PJ2A 4BN0A 4PGAA 4EJSA 2PKQP 2FLVA 2V7TA 1A96A 2FSHA 2OFWA 2OZVA 3GRYA 3LKBA 2QP4A 3TEFA 1X1TA 2PMFA 1T4DA 3PCXA 4I99A 4UJ3A 3L8CA 5IC6A 5CITA 2ZWVA 2QUIA 1AQJA 3RF7A 1E6UA 3A6HA 7MHTA 1ESCA 3EIEA 1I36A 1BS1A 2XDAA 4PGMA 4QLOA 2HPHA 4Y0AA 1TXGA 1SK9A 3TMKA 3AI3A 1EGMB 1FFGA 5I4IA 2JKVA 3ILXA 1SELA 4IDCA 3FMIA 3P4YA 3WRVA 2ZJ6A 3STVA 4WIAA 4DV5B 2BBWA 3N28A 3AIKA 1XCJA 2FSSA 4OSPA 1IWOA 5BN1A 3DZCA 1NL3A 1ETHA 4XWGA 4A0FA 1UXKA 5DM70 1PFWA 3VR4D 4X45A 3C7DB 1HFWA 4TVBA 1J0CA 1S02A 1XU7A 4WWHA 1JU4A 4Y7DA 2P68A 2FMFA 4H1WA 4WJZA 1XLTC 3FWPA 1I4DD 1TZKA 2BZ0A 2FE1A 3HEBA 4Y6PA 4YECA 3ZNOA 4C3OB 4XLLA 5A5VA 2GSWA 4FQ5A 2OO3A 3QVXA 3M0EA 1LSSA 3BMXA 4PG8A 1MHTA 2A84A 5LNK1 4IXMA 1IK4A 5IFKA 2XKAA 5BT9A 3SZRA 4YMTA 3C7AA 3AL0C 4QQNA 3E53A 3WV5A 2X0EA 3OAAA 3PDUA 1D8AA 2JLRA 4EO7A 1XLUA 4DR4B 3W5IA 3B82A 1E8NA 3A9UA 3KRTA 4MV7A 5K8JB 1YS4A 8ABPA 1Z4LA 1G42A 1U5BB 2YYYA 1HT3A 4L3OA 4RK6A 3ZLTA 3G6WA 3W6PA 4NE2A 4E1VA 3DBHA 4RMNA 1XTVA 2B35A 2YN2A 4NFSA 1X92A 3O8DA 3Q85A 2RJNA 4NF2A 3RBZA 2PZJA 1FDSA 3AEQA 1JKIA 4UMFA 2PZAA 1P7VA 3FYDA 4MVJA 4ZQHA 5G1NA 2B3DA 2YYSA 2IV2X 3TYXA 1P1KA 4KQWA 4QECA 1UPFA 3PU6A 3LZDA 4G86A 4NE7A 4KIGA 1RM5A 1Q22A 1UANA 5F5NA 1AMUA 4IIJA 4LISA 3SU8A 2DCUA 4EAQA 3SZGA 3KUDA 3GFPA 2QTTA 1BO6A 4URHA 5TS2A 4A8JB 4B6EA 1E9EA 3ZDXB 3NRBA 3PHHA 4TKUA 4OPMA 1KORA 2NU9B 4TV8F 2YCLA 3C6KA 5BSFA 3PF9A 2VSNA 5BYJA 4P32A 1GADO 3N2GA 1RYBA 2IYVA 1KAHA 3LWNA 3O8OB 4L4YA 5CDTA 1OVGA 4HH1A 4H6XA 3EWSA 4DWWA 2QUJA 3G82C 3RHSA 5C4IA 1WZCA 4NENB 1SCAA 2G9RA 4FNOA 5D00A 1Z29A 2JCXA 4MUJA 1IN1A 1FK8A 4WERA 3TAHA 1J90A 2Q5HA 4B2LA 3KHSA 3ZWMA 4YAEA 1IXZA 2J4CA 221PA 4LJLA 1FUYB 4ZO7A 1DTWA 2VJBA 4TWJA 3VOTA 4A6EA 2EBHX 4DC0A 4EFMA 3QLVC 1PTJC 1C29B 1II9A 4JEHA 4KAXA 1ZM3A 5ECGC 3JASB 3QXCA 4ALNA 1J1UA 5JS1A 3WGHA 4DLBA 3ZHUA 3GRVA 1U81A 3SZUA 4BZQA 4LUCA 3RRXA 3A04A 3VNVA 2HNKA 2DWCA 1UBTS 2C92A 2BDEA 1CVIA 3TKYA 4X85A 2PTGA 4EGJA 1MOZA 2O0JA 2BFWA 2EJUA 2OGZA 5L3QA 2EJBA 3O47A 4OXQA 1SUBA 5KKAA 2Z3WA 5FPKA 1GR0A 3DT6A 3AR5A 4MEAA 5DU2A 2J33A 5HG0A 4XWOA 5CIYA 1P72A 1NONA 1YZFA 2R00C 1LPMA 4OQDA 4K6MA 4I1PA 1T3ZA 3EIXA 1E4EA 4IEFB 5EZQA 1FRVA 3W8RA 3ILVA 1NI3A 3KFXA 2NO1A 4P5PA 2QRVA 4RK0A 3UN1A 3GLVA 3UMSA 4KO1S 3V1LA 5CA1B 3N58A 3TXAA 4X61A 4JKOA 4XCQA 4AYWA 1BA3A 2F90A 5THXA 5KYYB 4LYAA 3I4FA