1AMAA

Domain closure in mitochondrial aspartate aminotransferase
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain closure in mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 140
structure length 401
sequence length 401
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1992-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1amaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1amaA01
2D7ZA 1P3WA 4W5KA 4RJ0A 2D64A 4ZAHA 1UU1A 1IX7A 3D6KA 3FKDA 3FDDA 3WLXA 1W3UA 4J8LA 4WBTA 2AY9A 1TPLA 4MY5A 2VMZA 1OXPA 1AAMA 1ASAA 1DKAA 1N8PA 3MC6C 4CVQA 1DJEA 3QPGA 4OT8A 1O62A 3DXVA 3II0A 3USFA 2JJGA 3ECDA 1MAQA 2FM1A 4F5IA 1S0AA 3RBLA 4ZDPA 1TOEA 3FQAA 3WZFA 2FQ6A 5HXXA 1OATA 1O61A 4Q6RA 1G4XA 1B9HA 4E1OA 3TFTA 5C6UA 3CAIA 4R8DA 3LWSA 1MDOA 4JEWA 1S09A 1JG8A 1RV4A 2W8JA 4E3RA 2EZ1A 2CY8A 4XJPA 3AV7A 4ZASA 4MQQA 1C7OA 1M0PA 2YKXA 2ZUKA 1VP4A 4ZWMA 4ZSYA 1BJWA 4RJYA 4Y0IA 4WLJA 4AO9A 4LNMA 1YNUA 4WP0A 1SPAA 2DOUA 2X3LA 4ADEA 2FYFA 1CL1A 3FVXA 2GMSA 2VI9A 2XBNA 3COGA 2OQXA 1V2DA 2VGWA 5D95A 3NU7A 3PGYA 2CJDA 2PO3A 3E2ZA 5DX5A 1JS6A 4F4EA 3LVLB 1D7RA 1SFFA 2VMRA 3LVKA 1KL2A 2W7LA 3WCNA 3NUIA 4U1TA 1I43A 3FQ8A 4DGTA 3K28A 2ZY4A 2ORDA 1CZCA 3E6GA 3FSLA 5M46A 2W8VA 3ZRQA 4CXQA 1ASDA 1WYVB 3WGCA 2FN6A 4B98A 4W8IA 3L8AA 4F5FA 4ATPA 3TFUA 1AHYA 1D7UA 4JE5A 1TATA 4ADDA 3PD6A 2OGEA 4KYOA 4E77A 2YOBA 2D61A 4ATQA 4ITXA 3FDBA 1EJIA 1YJSA 2ZY5A 3HQTA 3AEMC 2W7FA 2YKYA 3OKSA 2X5FA 3VAXA 4AO4A 1SVVA 3LVJA 1X0MA 2AY4A 2ZY3A 2VGZA 4WLHA 4JF0A 2O1BA 1IBJA 1RV3A 3CQ6A 4HVKA 2BIGA 2DGMA 5F8VA 1XI9A 4UHNA 1AAWA 4IYOA 3RI6A 4A0FA 3B1DA 2BIEA 3FQ7A 1M6SA 4R5ZA 2ZYJA 4UOYA 1PMOA 2NMPA 2W7JA 4W1VA 5EFSA 1TOIA 3PDBB 1MGVA 2AY5A 4JE5D 4WYFA 5EAAA 1YAAA 2D7YA 3R9AA 1DFOA 1D2FA 1X28A 2HUIA 2VMTA 3DODA 4XQ2A 2BWNA 2CANA 3WGBA 4ADCA 4GEBA 2AATA 1SF2A 3Q8NA 4KXKA 4WYEA 2VMPA 1RVYA 4F5GA 1IJIA 1PMMA 1WKGA 3DXWA 4JEYA 1LW5A 2R5EA 3W1HA 5FT4A 1ASBA 4OYTA 4WXBA 1GC2A 1AMAA 3DU4A 5EUNA 1X2AA 1DGDA 2DKJA 2CTZA 5EIGB 2Z61A 5DB5A 3AEJC 1OHVA 2EGYA 4A00A 1TOKA 2YHKA 1E5EA 1LK9A 2G6WA 2AY2A 2V0YA 3NNKA 3NYUA 4TV7A 3FTBA 2Z9WA 4UQVA 1ARGA 3NRAA 2ZY2A 3GSBA 2EO5A 1AJSA 2ZJGA 2O0RA 5M4BA 3W1IA 5FT6A 1O4SA 4OCAA 3JZLA 1ARTA 1LC5A 3ZRRA 3ZZKA 4DQ6A 3EI9A 4H51A 4WYCA 3UE8A 1UU2A 1S08A 3G0TA 3PAAA 4A6RA 4A0GA 4PIWA 3FVSA 4WYGA 3RBFA 5LHAA 1AKAA 2DR1A 4ZM3A 2Z67A 4GSAA 3BCAA 4GDYA 3JW9A 3DYDA 1KMKA 1MAPA 3DC1A 4LNLA 4TN4A 2GQNA 2VGTA 2F8JA 3BCBA 1M0QA 3CBFA 1CZEA 1CJ0A 1Z7DA 2AY1A 2Q7WA 2QB3A 1WSTA 3G8MA 2W7IA 2QB2A 3E2YA 1C9CA 1PG8A 1C0NA 2HORA 2CINA 1GEYA 5G2QA 4K2BA 2Z9VA 3L44A 2AY6A 4R5FA 3VOMA 4F5HA 1T3IA 1WYVA 5E3KA 4AOAA 1Y4IA 1AMQA 1RVUA 1U08A 1D7VA 4WYAA 3GZDA 3HVYA 4BA5A 2FNIA 2VMOA 2VMQA 3FZ7A 2W7DA 1KKJA 2W8UA 2X8UA 4M2JA 1AHEA 3EZ1A 3E9KA 1B9IA 1ORDA 3F0HA 3G7QA 5FT5A 3RCHB 1GDEA 1BS0A 1ELQA 4AZKA 3R4TA 4BA4A 1AIBA 3K7YA 4OBUA 3W1JA 1IUGA 2YRIA 3FCRA 2CFBA 4LW4A 3FD0A 3MKJA 3AENA 1GC0A 5G09A 3WCOA 4N0WA 1YJYA 2D66A 3I16A 4RIZA 2D5YA 4M2MA 1AY8A 2BHXA 2BI5A 2RFVA 2C0RA 3HLMA 3RUYA 3WY7A 3A2BA 5M4DA 3PDXA 1BJOA 3NX3A 3TQXA 2HOZA 1V2EA 4PVFA 1M0NA 2AY8A 1ELUA 1ZOBA 2BI2A 2BYLA 2BWOA 3BC8A 1AHXA 3E2FA 3ZRPA 1AJRA 4XAUA 4OBVA 3UAKA 1AIAA 2QA3A 3AOVA 1MLYA 1AKBA 5TF5A 3FVUA 1ASEA 3F6TA 4J5UA 5IWQA 3BWNC 3FZ8A 4ADBA 3AEPA 7AATA 2VMNA 3FZ6A 1O69A 1GCKA 4GE7A 4A6TA 3BB8A 3MAUA 4NOGA 3RCHA 4LC3A 1GBNA 1V2FA 1BQDA 2BWPA 1M4NA 1W7LA 2W7EA 2E7JA 4OMAA 1ASCA 1LS3A 4PFNA 2CJHA 4RKDA 4JEXA 5E4ZA 4XJMA 4Q75A 3A9XA 2CJGA 3BWOA 2WK8A 3OP7A 2VIAA 3MAFA 3VK2A 2CB1A 2R0TA 2HP2A 3A9ZA 4XJLA 1C7NA 4K2MA 2VLHA 3EI8A 3NU8A 2AEUA 3GJUA 2VMXA 1SZKA 3GR9A 3TATA 3FFHA 4F5JA 4OTLA 3MADA 2E54A 2EPJA 2BIAA 2HOYA 4L0OA 2AY7A 1ASMA 1TASA 2WK9A 1WKHA 3EI5A 2E7IA 3CQ4A 1CQ8A 3KGXA 4Q31A 1EG5A 2QMAA 1ASFA 2Z1ZA 2JG2A 3KE3A 4WXGA 1AICA 2DGKA 1QITA 2JJHA 3PPLA 3TCMA 2EH6A 2AY3A 4IY7A 3B1CA 1G7WA 2HP1A 4W1WA 2JJFA 4RLGA 3RQ1A 2CSTA 1B5PA 3WKRA 4IXSA 4ZM4A 3B8XA 1BJ4A 1VJOA 2GMUA 1YJZA 3AOWA 3HT4A 3I5TA 3N5MA 4UHOA 4M2KA 2HUUA 1LC8A 2BYJA 3MBBA 3GETA 4EB5A 1QIRA 1AHGA 4CBSA 3WX9A 2C44A 2JGTA 3JTXA 3AELA 3QM2A 3MEBA 3BWNA 1WYTB 1QJ5A 4Q76A 1BJNA 2OATA 3ACZA 4XK1A 4XJOA 1ECXA 3AEMA 3AEJA 3NDNA 1Z3ZA 2W7HA 3VK4A 1H0CA 5G4JA 1M0OA 3QGUA 4LW2A 1ARSA 4ITGA 4QGRA 2VMVA 3CQ5A 4CBRA 2C7TA 2VIBA 1ZC9A 2JJEA 1LC7A 2GB3A 4MKKA 4ZSWA 1H1CA 2BI1A 2Z1YA 1TARA 1BW0A 3ISLA 4N0BA 4P3MA 4RM1A 1BJOB 2OKJA 1N31A 4U2HA 4BQ0A 5M49A 4AZJA 2BI9A 8AATA 4XEWA 4AH3A 3QN6A 4IYOB 4BHDA 2W7MA 3GZDC 3VP6A 3B46A 5BJ4A 4ZDLA 1CQ6A 5J8QA 1ASLA 3K40A 1OXOA 2W7KA 5HHYA 2D65A 4F5LA 4Y0DA 1SZUA 2EZ2A 1V72A 3FFRA 2OGAA 1BKGA 2QLRA 3DRDA 4IX8A 1TOGA 1WYUB 1G7XA 3E77A 5HDMA 2VYCA 3JWBA 3N75A 1D7SA 2VMYA 2W7GA 4IXOA 3EI7A 3A9YA 1FC4A 1IVRA 2DKBA 2PB2A 1IAXA 3PD6B 5LH9A 5EQCA 4ZDOA 3VK3A 1B5OA 3MC6A 3KKIA 4O6ZA 1M7YA 4RKCA 1G4VA 1IX6A 3A8UX 4KAMA 2YKUA 4RITA 5D5SA 1OHYA 3AEOA 1XEYA 1FG3A 2VMUA 2HUFA 1W7NA 3JU7A 3P6KA 2VGVA 1QZ9A 4R2NA 4TMRA 1JS3A 4FL0A 1QISA 1YIYA 3N0LA 2X5DA 2YKVA 1SZSA 5G0AA 5BJ3A 3DR4A 4JF1A 4W1XA 2CH1A 2ZP7A 1KKPA 4EFFA 4BMKA 2VGSA 4UHMA 1UKJA 2HZPA 2R2NA 2ZSLA 3BN1A 4A0HA 3PJ0A 3QI6A 3H14A 1WYUA 1C4KA 4F5KA 4A72A 2Z9UA 1OHWA 3P1TA 3AATA 3BCXA 4GE4A 1I41A 1FG7A 3EUCA 1I29A 3KGWA 1YIZA 2VLFA 3LG0A 4GE9A 1MLZA 2O7CA 3NYSA 1LKCA 3BS8A 3GBXA 3PA9A 3NTJA 1CQ7A 3HL2A 2BKWA 2VMWA 1MDZA 1QGNA 3QHXA 4P7YA 3JWAA 1W7MA 1AMRA 3LV2A 1J32A 4RAEA 4ZLVA 2E7UA 3NYTA 4LNJA 1TOJA 3EIBA 3ELPA 2YRRA 5EIGA 4EB7A 3M5UA 1ASNA 4MGRA 5EUDA 3ZZJA 4WYDA 1KMJA 3DZZA 5K8BA 1CS1A 3HDOA 5I92A 3ATHA 1GC4A 1WYTA 4WD2A 1JF9A 4A6UA 3AENB 3NUBA 5EUEA 1S06A 1DJUA 3HMUA 1ARHA 1GC3A 3DR7A 2CH2A 1LW4A 3GWPA 5FT8A 3EIAA 3IHJA 4JEZA 2HOXA 2OKKA 4MQPA 1GD9A 2FNUA 2Z20A 3EI6A 3F9TA 1IX8A 3H7FA 3BV0A 4E3QA 1J04A 2VGUA 3ASBA 3PDBA 1E5FA 1I48A 4W91A 2YCPA 1PFFA 4JEVA 2QBTA 5EAVA 1X29A 4EU1A 4A0RA 1KL1A 1S07A 2WK7A 1AHFA 5DJ1A 2XH1A 1DGEA 2D63A 3FRKA 2ZC0A 1GEWA 1ARIA 1N2TA 3ASAA 1AY4A 1B8GA 1IAYA 2GSAA 3GZCA 2VMSA 1M32A 2YCNA 4K2IA 5G4IA 4CXRA 4IW7A 5AX8A 3UWCA 1AMSA 1BT4A 4IXZA 3IF2A 2JISA 4MSOA 2R5CB 4WB0B 1EQBA 3T32A 4B9BA 1DJ9A 2ZSMA 4WXFA 3WKSA 1ZODA 4WB0A 1AY5A 3PIUA 1ASGA 2R5CA 2V1PA 1C7GA 3B1EA 1UU0A 4ISYA 4I8AA 2W8TA 4DBCA 2DGLA 1AX4A 3ELEA 4Y0HA 1DTYA 2AEVA 5E5IA 2W8WA 5G2PA 3MAFB 4MQRA 1W23A 4OC9A 1CL2A 1QJ3A 1MDXA 2C81A 2WKAA 4MKJA 3HBXA 1YOOA 1VEFA 9AATA 4F5MA 3QBOA 1AKCA 3EZSA 2PB0A 5F9SA 3LVMA 1AJSB 4GRXA 1GEXA 2Z9XA 3E2ZB 1BQAA 4FFCA 4PFFA 4EMYA 4ZWVA 3I4JA 2BI3A 4HF8A 5DJ9A 2TPLA 2VI8A 5JAYA 2YCTA 1B4XA 3LY1A
chains in the Genus database with same CATH superfamily
2D7ZA 1P3WA 4W5KA 4RJ0A 2D64A 4ZAHA 1UU1A 1IX7A 3D6KA 3FKDA 3FDDA 3WLXA 1W3UA 4J8LA 4WBTA 2AY9A 1TPLA 4MY5A 2VMZA 3N4SA 1OXPA 1AAMA 1ASAA 1DKAA 1N8PA 3MC6C 4CVQA 1DJEA 3QPGA 4OT8A 1O62A 3DXVA 3II0A 3USFA 2JJGA 3ECDA 1MAQA 2FM1A 4F5IA 1S0AA 3RBLA 4ZDPA 1TOEA 3FQAA 3WZFA 2FQ6A 5HXXA 1OATA 1O61A 4Q6RA 1G4XA 1B9HA 4E1OA 3TFTA 5C6UA 3CAIA 4R8DA 3LWSA 1MDOA 4JEWA 1S09A 1JG8A 1RV4A 2W8JA 4E3RA 2EZ1A 2CY8A 4XJPA 3AV7A 4ZASA 4MQQA 1C7OA 1M0PA 2YKXA 2ZUKA 1VP4A 4ZWMA 4ZSYA 1BJWA 4RJYA 4Y0IA 4WLJA 4AO9A 4LNMA 1YNUA 4WP0A 1SPAA 2G7JA 2DOUA 2X3LA 4ADEA 2FYFA 1CL1A 3FVXA 2GMSA 2VI9A 2XBNA 3COGA 2OQXA 1V2DA 2VGWA 5D95A 3NU7A 3PGYA 2CJDA 2PO3A 3E2ZA 5DX5A 1JS6A 4F4EA 3LVLB 1D7RA 1SFFA 2VMRA 3LVKA 2EYQA 1KL2A 2W7LA 3WCNA 3NUIA 4U1TA 1I43A 3FQ8A 4DGTA 3K28A 2ZY4A 2ORDA 1CZCA 3E6GA 3FSLA 5M46A 2W8VA 3ZRQA 4CXQA 1ASDA 1WYVB 3WGCA 2FN6A 4B98A 4W8IA 3L8AA 4F5FA 4ATPA 3TFUA 1AHYA 1D7UA 4JE5A 1TATA 4ADDA 3PD6A 2OGEA 4KYOA 4E77A 2YOBA 2D61A 4ATQA 4ITXA 3FDBA 1EJIA 1YJSA 2ZY5A 3HQTA 3AEMC 2W7FA 2YKYA 3OKSA 2X5FA 3VAXA 4AO4A 1SVVA 3LVJA 1X0MA 2AY4A 2ZY3A 2VGZA 4WLHA 4JF0A 2O1BA 1IBJA 1RV3A 3CQ6A 4HVKA 2BIGA 2DGMA 5F8VA 1XI9A 4UHNA 1AAWA 4IYOA 3RI6A 4A0FA 3B1DA 2BIEA 3FQ7A 1M6SA 4R5ZA 2ZYJA 4UOYA 1PMOA 2NMPA 2W7JA 4W1VA 5EFSA 1TOIA 3PDBB 1MGVA 2AY5A 4JE5D 4WYFA 5EAAA 1YAAA 2D7YA 3R9AA 1DFOA 1D2FA 1X28A 2HUIA 2VMTA 3DODA 4XQ2A 2BWNA 2CANA 3WGBA 4ADCA 4GEBA 2AATA 1SF2A 3Q8NA 4KXKA 4WYEA 2VMPA 1RVYA 4F5GA 1IJIA 1PMMA 1WKGA 3DXWA 4JEYA 1LW5A 2R5EA 3W1HA 5FT4A 1ASBA 4OYTA 4WXBA 1GC2A 1AMAA 3DU4A 5EUNA 1X2AA 1DGDA 2DKJA 2CTZA 5EIGB 2Z61A 5DB5A 3AEJC 1OHVA 2EGYA 4A00A 1TOKA 2YHKA 1E5EA 1LK9A 2G6WA 2AY2A 2V0YA 3NNKA 3NYUA 4TV7A 3FTBA 2Z9WA 4UQVA 1ARGA 3NRAA 2ZY2A 3GSBA 2EO5A 1AJSA 2ZJGA 2O0RA 5M4BA 3W1IA 5FT6A 1O4SA 4OCAA 3JZLA 1ARTA 1LC5A 3ZRRA 3ZZKA 4DQ6A 3EI9A 4H51A 4WYCA 3UE8A 1UU2A 1S08A 3G0TA 3PAAA 4A6RA 4A0GA 4PIWA 3FVSA 4WYGA 3RBFA 5LHAA 1AKAA 2DR1A 4ZM3A 2Z67A 4GSAA 3BCAA 4GDYA 3JW9A 3DYDA 1KMKA 1MAPA 3DC1A 4LNLA 4TN4A 2GQNA 2VGTA 2F8JA 3BCBA 1M0QA 3CBFA 1CZEA 1CJ0A 1Z7DA 2AY1A 2Q7WA 2QB3A 1WSTA 3G8MA 2W7IA 2QB2A 3E2YA 1C9CA 1PG8A 1C0NA 2HORA 2CINA 1GEYA 5G2QA 4K2BA 2KFPA 2Z9VA 3L44A 4H63Q 2AY6A 4R5FA 3VOMA 4F5HA 1T3IA 1WYVA 5E3KA 4AOAA 1Y4IA 1AMQA 1RVUA 1U08A 1D7VA 4WYAA 3GZDA 3HVYA 4BA5A 2FNIA 2VMOA 2VMQA 3FZ7A 2W7DA 1KKJA 2W8UA 2X8UA 4M2JA 1AHEA 3EZ1A 3E9KA 1B9IA 1ORDA 3F0HA 3G7QA 5FT5A 3RCHB 1GDEA 1BS0A 1ELQA 4AZKA 3R4TA 4BA4A 1AIBA 3K7YA 2A1VA 4OBUA 3W1JA 1IUGA 2YRIA 3FCRA 2CFBA 4LW4A 3FD0A 3MKJA 3AENA 1GC0A 5G09A 3WCOA 4N0WA 1YJYA 2D66A 3I16A 4RIZA 2D5YA 4M2MA 1AY8A 2BHXA 2BI5A 2RFVA 2C0RA 3HLMA 3RUYA 3WY7A 3A2BA 5M4DA 3PDXA 1BJOA 3NX3A 3TQXA 1KAFA 2QSRA 2HOZA 1V2EA 4PVFA 1M0NA 2AY8A 1ELUA 1ZOBA 2BI2A 2BYLA 2BWOA 3BC8A 1AHXA 3E2FA 3ZRPA 1AJRA 4XAUA 4OBVA 3UAKA 2WB6A 1AIAA 2QA3A 3AOVA 1MLYA 1AKBA 5TF5A 3FVUA 1ASEA 3F6TA 4J5UA 5IWQA 3BWNC 3FZ8A 4ADBA 3AEPA 7AATA 2VMNA 3FZ6A 1O69A 1GCKA 4GE7A 4A6TA 3BB8A 3MAUA 4NOGA 3RCHA 4LC3A 1GBNA 1V2FA 1BQDA 2BWPA 1M4NA 3H9XA 1W7LA 2W7EA 2E7JA 4OMAA 3N4XA 1ASCA 1LS3A 4PFNA 2CJHA 4RKDA 4JEXA 5E4ZA 4XJMA 4Q75A 3A9XA 2CJGA 3BWOA 2WK8A 3OP7A 2VIAA 2FKIA 3MAFA 3VK2A 2CB1A 2R0TA 2HP2A 3A9ZA 4XJLA 1C7NA 4K2MA 2VLHA 3EI8A 3NU8A 2AEUA 3GJUA 2VMXA 1SZKA 3GR9A 3TATA 3FFHA 4F5JA 4OTLA 3MADA 2E54A 2EPJA 2BIAA 2HOYA 4L0OA 2AY7A 1ASMA 1TASA 2WK9A 1WKHA 3EI5A 2E7IA 3CQ4A 1CQ8A 3KGXA 4Q31A 1EG5A 2QMAA 1ASFA 2Z1ZA 2JG2A 3KE3A 4WXGA 1AICA 2DGKA 1QITA 2JJHA 3PPLA 3TCMA 3N4RA 2EH6A 2AY3A 4IY7A 3B1CA 1G7WA 2HP1A 4W1WA 2JJFA 4RLGA 3RQ1A 2CSTA 1B5PA 3WKRA 4IXSA 4ZM4A 3B8XA 1BJ4A 1VJOA 2GMUA 1YJZA 3AOWA 3HT4A 3I5TA 3N5MA 4UHOA 4M2KA 2HUUA 1LC8A 2BYJA 3MBBA 3GETA 4EB5A 1QIRA 1AHGA 4CBSA 3WX9A 2C44A 2JGTA 3JTXA 3AELA 3QM2A 3MEBA 3BWNA 1WYTB 1QJ5A 4Q76A 1BJNA 2OATA 3ACZA 4XK1A 4XJOA 1ECXA 3AEMA 3AEJA 3NDNA 1Z3ZA 2W7HA 3VK4A 1H0CA 5G4JA 1M0OA 3QGUA 4LW2A 1ARSA 4ITGA 4QGRA 2VMVA 3CQ5A 4CBRA 2C7TA 2VIBA 1ZC9A 2JJEA 1LC7A 2GB3A 4MKKA 4ZSWA 1H1CA 2BI1A 2Z1YA 1TARA 1BW0A 3ISLA 4N0BA 4P3MA 4RM1A 1BJOB 2OKJA 1N31A 4U2HA 4BQ0A 5M49A 4AZJA 2BI9A 8AATA 4XEWA 4AH3A 3QN6A 4IYOB 4BHDA 2W7MA 3GZDC 3VP6A 3B46A 5BJ4A 4ZDLA 1CQ6A 5J8QA 1ASLA 3K40A 1OXOA 2W7KA 5HHYA 2D65A 4F5LA 4Y0DA 1SZUA 2EZ2A 1V72A 3FFRA 2OGAA 1BKGA 2QLRA 3DRDA 4IX8A 1TOGA 1WYUB 1G7XA 3E77A 5HDMA 2VYCA 3JWBA 3N7NA 3N75A 1D7SA 2VMYA 2W7GA 4IXOA 3EI7A 3A9YA 1FC4A 1IVRA 2DKBA 2PB2A 1IAXA 3PD6B 5LH9A 5EQCA 4ZDOA 3VK3A 1B5OA 3MC6A 3KKIA 4O6ZA 1M7YA 4RKCA 1G4VA 1IX6A 3A8UX 4KAMA 2YKUA 4RITA 5D5SA 1OHYA 3AEOA 1XEYA 1FG3A 2VMUA 2HUFA 1W7NA 3JU7A 3P6KA 5KTBA 2VGVA 1QZ9A 4R2NA 4TMRA 1JS3A 4FL0A 1QISA 1YIYA 3N0LA 2X5DA 2YKVA 1SZSA 5G0AA 5BJ3A 3DR4A 4JF1A 4W1XA 2CH1A 2ZP7A 1KKPA 4EFFA 4BMKA 2VGSA 4UHMA 1UKJA 2HZPA 2R2NA 2ZSLA 3BN1A 4A0HA 3PJ0A 3QI6A 3H14A 1WYUA 1C4KA 4F5KA 4A72A 2Z9UA 1OHWA 3P1TA 3AATA 3BCXA 4GE4A 1I41A 1FG7A 3EUCA 1I29A 3KGWA 1YIZA 2VLFA 3LG0A 4GE9A 1MLZA 2O7CA 3NYSA 1LKCA 3BS8A 3GBXA 3PA9A 3NTJA 1CQ7A 3HL2A 2BKWA 2VMWA 1MDZA 1QGNA 3QHXA 4P7YA 3JWAA 1W7MA 1AMRA 3LV2A 1J32A 4RAEA 4ZLVA 2E7UA 3NYTA 4LNJA 1TOJA 3EIBA 3ELPA 2YRRA 5EIGA 4EB7A 3M5UA 1ASNA 4MGRA 5EUDA 3ZZJA 4WYDA 1KMJA 3DZZA 5K8BA 1CS1A 3HDOA 5I92A 3ATHA 1GC4A 1WYTA 4WD2A 1JF9A 4A6UA 3AENB 3NUBA 5EUEA 1S06A 1DJUA 3HMUA 1ARHA 1GC3A 3DR7A 2CH2A 1LW4A 3GWPA 5FT8A 3EIAA 3IHJA 4JEZA 2HOXA 2OKKA 4MQPA 1GD9A 2FNUA 2Z20A 3EI6A 3F9TA 1IX8A 3H7FA 3BV0A 4E3QA 1J04A 2VGUA 3ASBA 3PDBA 1E5FA 1I48A 4W91A 2YCPA 1PFFA 4JEVA 2QBTA 5EAVA 1X29A 4EU1A 4A0RA 1KL1A 1S07A 2WK7A 1AHFA 5DJ1A 2XH1A 1DGEA 2D63A 3FRKA 2ZC0A 1GEWA 1ARIA 1N2TA 3ASAA 1AY4A 1B8GA 1IAYA 2GSAA 3GZCA 2VMSA 1M32A 2YCNA 4K2IA 5G4IA 4CXRA 4K05A 4IW7A 5AX8A 3UWCA 1AMSA 1BT4A 4IXZA 3IF2A 2JISA 4MSOA 2R5CB 4WB0B 1EQBA 3T32A 4B9BA 1DJ9A 2ZSMA 4WXFA 3WKSA 1ZODA 4WB0A 1AY5A 3PIUA 1ASGA 2R5CA 2V1PA 1C7GA 3B1EA 1UU0A 4ISYA 4I8AA 2W8TA 4DBCA 2DGLA 1AX4A 3ELEA 4Y0HA 1DTYA 2AEVA 5E5IA 2W8WA 5G2PA 3MAFB 4MQRA 1W23A 4OC9A 1CL2A 1QJ3A 1MDXA 2C81A 2WKAA 4MKJA 3HBXA 1YOOA 1VEFA 9AATA 4F5MA 3QBOA 1AKCA 3EZSA 2PB0A 5F9SA 3LVMA 1AJSB 4GRXA 1GEXA 2Z9XA 3E2ZB 1BQAA 4FFCA 4PFFA 4EMYA 4ZWVA 3I4JA 2BI3A 4HF8A 5DJ9A 2TPLA 2VI8A 5JAYA 2YCTA 1B4XA 3LY1A
chains in the Genus database with same CATH topology
2D7ZA 1P3WA 4W5KA 4RJ0A 2D64A 4ZAHA 1UU1A 1IX7A 3D6KA 3FKDA 3FDDA 3WLXA 1W3UA 4J8LA 4WBTA 2AY9A 1TPLA 4MY5A 2VMZA 3N4SA 1OXPA 1AAMA 1ASAA 1DKAA 1N8PA 3MC6C 4CVQA 1DJEA 3QPGA 4OT8A 1O62A 3DXVA 3II0A 3USFA 2JJGA 3ECDA 1MAQA 2FM1A 4F5IA 1S0AA 3RBLA 4ZDPA 1TOEA 3FQAA 3WZFA 2FQ6A 5HXXA 1OATA 1O61A 4Q6RA 1G4XA 1B9HA 4E1OA 3TFTA 5C6UA 3CAIA 4R8DA 3LWSA 1MDOA 4JEWA 1S09A 1JG8A 1RV4A 2W8JA 4E3RA 2EZ1A 2CY8A 4XJPA 3AV7A 4ZASA 4MQQA 1C7OA 1M0PA 2YKXA 2ZUKA 1VP4A 4ZWMA 4ZSYA 1BJWA 4RJYA 4Y0IA 4WLJA 4AO9A 4LNMA 1YNUA 4WP0A 1SPAA 2G7JA 2DOUA 2X3LA 4ADEA 2FYFA 1CL1A 3FVXA 2GMSA 2VI9A 2XBNA 3COGA 2OQXA 1V2DA 2VGWA 5D95A 3NU7A 3PGYA 2CJDA 2PO3A 3E2ZA 5DX5A 1JS6A 4F4EA 3LVLB 1D7RA 1SFFA 2VMRA 3LVKA 2EYQA 1KL2A 2W7LA 3WCNA 3NUIA 4U1TA 1I43A 3FQ8A 4DGTA 3K28A 2ZY4A 2ORDA 1CZCA 3E6GA 3FSLA 5M46A 2W8VA 3ZRQA 4CXQA 1ASDA 1WYVB 3WGCA 2FN6A 4B98A 4W8IA 3L8AA 4F5FA 4ATPA 3TFUA 1AHYA 1D7UA 4JE5A 1TATA 4ADDA 3PD6A 2OGEA 4KYOA 4E77A 2YOBA 2D61A 4ATQA 4ITXA 3FDBA 1EJIA 1YJSA 2ZY5A 3HQTA 3AEMC 2W7FA 2YKYA 3OKSA 2X5FA 3VAXA 4AO4A 1SVVA 3LVJA 1X0MA 2AY4A 2ZY3A 2VGZA 4WLHA 4JF0A 2O1BA 1IBJA 1RV3A 3CQ6A 4HVKA 2BIGA 2DGMA 5F8VA 1XI9A 4UHNA 1AAWA 4IYOA 3RI6A 4A0FA 3B1DA 2BIEA 3FQ7A 1M6SA 4R5ZA 2ZYJA 4UOYA 1PMOA 2NMPA 2W7JA 4W1VA 5EFSA 1TOIA 3PDBB 1MGVA 2AY5A 4JE5D 4WYFA 5EAAA 1YAAA 2D7YA 3R9AA 1DFOA 1D2FA 1X28A 2HUIA 2VMTA 3DODA 4XQ2A 2BWNA 2CANA 3WGBA 4ADCA 4GEBA 2AATA 1SF2A 3Q8NA 4KXKA 4WYEA 2VMPA 1RVYA 4F5GA 1IJIA 1PMMA 1WKGA 3DXWA 4JEYA 1LW5A 2R5EA 3W1HA 5FT4A 1ASBA 4OYTA 4WXBA 1GC2A 1AMAA 3DU4A 5EUNA 1X2AA 1DGDA 2DKJA 2CTZA 5EIGB 2Z61A 5DB5A 3AEJC 1OHVA 2EGYA 4A00A 1TOKA 2YHKA 1E5EA 1LK9A 2G6WA 2AY2A 2V0YA 3NNKA 3NYUA 4TV7A 3FTBA 2Z9WA 4UQVA 1ARGA 3NRAA 2ZY2A 3GSBA 2EO5A 1AJSA 2ZJGA 2O0RA 5M4BA 3W1IA 5FT6A 1O4SA 4OCAA 3JZLA 1ARTA 1LC5A 3ZRRA 3ZZKA 4DQ6A 3EI9A 4H51A 4WYCA 3UE8A 1UU2A 1S08A 3G0TA 3PAAA 4A6RA 4A0GA 4PIWA 3FVSA 4WYGA 3RBFA 5LHAA 1AKAA 2DR1A 4ZM3A 2Z67A 4GSAA 3BCAA 4GDYA 3JW9A 3DYDA 1KMKA 1MAPA 3DC1A 4LNLA 4TN4A 2GQNA 2VGTA 2F8JA 3BCBA 1M0QA 3CBFA 1CZEA 1CJ0A 1Z7DA 2AY1A 2Q7WA 2QB3A 1WSTA 3G8MA 2W7IA 2QB2A 3E2YA 1C9CA 1PG8A 1C0NA 2HORA 2CINA 1GEYA 5G2QA 4K2BA 2KFPA 2Z9VA 3L44A 4H63Q 2AY6A 4R5FA 3VOMA 4F5HA 1T3IA 1WYVA 5E3KA 4AOAA 1Y4IA 1AMQA 1RVUA 1U08A 1D7VA 4WYAA 3GZDA 3HVYA 4BA5A 2FNIA 2VMOA 2VMQA 3FZ7A 2W7DA 1KKJA 2W8UA 2X8UA 4M2JA 1AHEA 3EZ1A 3E9KA 1B9IA 1ORDA 3F0HA 3G7QA 5FT5A 3RCHB 1GDEA 1BS0A 1ELQA 4AZKA 3R4TA 4BA4A 1AIBA 3K7YA 2A1VA 4OBUA 3W1JA 1IUGA 2YRIA 3FCRA 2CFBA 4LW4A 3FD0A 3MKJA 3AENA 1GC0A 5G09A 3WCOA 4N0WA 1YJYA 2D66A 3I16A 4RIZA 2D5YA 4M2MA 1AY8A 2BHXA 2BI5A 2RFVA 2C0RA 3HLMA 3RUYA 3WY7A 3A2BA 5M4DA 3PDXA 1BJOA 3NX3A 3TQXA 2QSRA 2HOZA 1V2EA 4PVFA 1M0NA 2AY8A 1ELUA 1ZOBA 2BI2A 2BYLA 2BWOA 3BC8A 1AHXA 3E2FA 3ZRPA 1AJRA 4XAUA 4OBVA 3UAKA 2WB6A 1AIAA 2QA3A 3AOVA 1MLYA 1AKBA 5TF5A 3FVUA 1ASEA 3F6TA 4J5UA 5IWQA 3BWNC 3FZ8A 4ADBA 3AEPA 7AATA 2VMNA 3FZ6A 1O69A 1GCKA 4GE7A 4A6TA 3BB8A 3MAUA 4NOGA 3RCHA 4LC3A 1GBNA 1V2FA 1BQDA 2BWPA 1M4NA 3H9XA 1W7LA 2W7EA 2E7JA 4OMAA 3N4XA 1ASCA 1LS3A 4PFNA 2CJHA 4RKDA 4JEXA 5E4ZA 4XJMA 4Q75A 3A9XA 2CJGA 3BWOA 2WK8A 3OP7A 2VIAA 2FKIA 3MAFA 3VK2A 2CB1A 2R0TA 2HP2A 3A9ZA 4XJLA 1C7NA 4K2MA 2VLHA 3EI8A 3NU8A 2AEUA 3GJUA 2VMXA 1SZKA 3GR9A 3TATA 3FFHA 4F5JA 4OTLA 3MADA 2E54A 2EPJA 2BIAA 2HOYA 4L0OA 2AY7A 1ASMA 1TASA 2WK9A 1WKHA 3EI5A 2E7IA 3CQ4A 1CQ8A 3KGXA 4Q31A 1EG5A 2QMAA 1ASFA 2Z1ZA 2JG2A 3KE3A 4WXGA 1AICA 2DGKA 1QITA 2JJHA 3PPLA 3TCMA 3N4RA 2EH6A 2AY3A 4IY7A 3B1CA 1G7WA 2HP1A 4W1WA 2JJFA 4RLGA 3RQ1A 2CSTA 1B5PA 3WKRA 4IXSA 4ZM4A 3B8XA 1BJ4A 1VJOA 2GMUA 1YJZA 3AOWA 3HT4A 3I5TA 3N5MA 4UHOA 4M2KA 2HUUA 1LC8A 2BYJA 3MBBA 3GETA 4EB5A 1QIRA 1AHGA 4CBSA 3WX9A 2C44A 2JGTA 3JTXA 3AELA 3QM2A 3MEBA 3BWNA 1WYTB 1QJ5A 4Q76A 1BJNA 2OATA 3ACZA 4XK1A 4XJOA 1ECXA 3AEMA 3AEJA 3NDNA 1Z3ZA 2W7HA 3VK4A 1H0CA 5G4JA 1M0OA 3QGUA 4LW2A 1ARSA 4ITGA 4QGRA 2VMVA 3CQ5A 4CBRA 2C7TA 2VIBA 1ZC9A 2JJEA 1LC7A 2GB3A 4MKKA 4ZSWA 1H1CA 2BI1A 2Z1YA 1TARA 1BW0A 3ISLA 4N0BA 4P3MA 4RM1A 1BJOB 2OKJA 1N31A 4U2HA 4BQ0A 5M49A 4AZJA 2BI9A 8AATA 4XEWA 4AH3A 3QN6A 4IYOB 4BHDA 2W7MA 3GZDC 3VP6A 3B46A 5BJ4A 4ZDLA 1CQ6A 5J8QA 1ASLA 3K40A 1OXOA 2W7KA 5HHYA 2D65A 4F5LA 4Y0DA 1SZUA 2EZ2A 1V72A 3FFRA 2OGAA 1BKGA 2QLRA 3DRDA 4IX8A 1TOGA 1WYUB 1G7XA 3E77A 5HDMA 2VYCA 3JWBA 3N7NA 3N75A 1D7SA 2VMYA 2W7GA 4IXOA 3EI7A 3A9YA 1FC4A 1IVRA 2DKBA 2PB2A 1IAXA 3PD6B 5LH9A 5EQCA 4ZDOA 3VK3A 1B5OA 3MC6A 3KKIA 4O6ZA 1M7YA 4RKCA 1G4VA 1IX6A 3A8UX 4KAMA 2YKUA 4RITA 5D5SA 1OHYA 3AEOA 1XEYA 1FG3A 2VMUA 2HUFA 1W7NA 3JU7A 3P6KA 5KTBA 2VGVA 1QZ9A 4R2NA 4TMRA 1JS3A 4FL0A 1QISA 1YIYA 3N0LA 2X5DA 2YKVA 1SZSA 5G0AA 5BJ3A 3DR4A 4JF1A 4W1XA 2CH1A 2ZP7A 1KKPA 4EFFA 4BMKA 2VGSA 4UHMA 1UKJA 2HZPA 2R2NA 2ZSLA 3BN1A 4A0HA 3PJ0A 3QI6A 3H14A 1WYUA 1C4KA 4F5KA 4A72A 2Z9UA 1OHWA 3P1TA 3AATA 3BCXA 4GE4A 1I41A 1FG7A 3EUCA 1I29A 3KGWA 1YIZA 2VLFA 3LG0A 4GE9A 1MLZA 2O7CA 3NYSA 1LKCA 3BS8A 3GBXA 3PA9A 3NTJA 1CQ7A 3HL2A 2BKWA 2VMWA 1MDZA 1QGNA 3QHXA 4P7YA 3JWAA 1W7MA 1AMRA 3LV2A 1J32A 4RAEA 4ZLVA 2E7UA 3NYTA 4LNJA 1TOJA 3EIBA 3ELPA 2YRRA 5EIGA 4EB7A 3M5UA 1ASNA 4MGRA 5EUDA 3ZZJA 4WYDA 1KMJA 3DZZA 5K8BA 1CS1A 3HDOA 5I92A 3ATHA 1GC4A 1WYTA 4WD2A 1JF9A 4A6UA 3AENB 3NUBA 5EUEA 1S06A 1DJUA 3HMUA 1ARHA 1GC3A 3DR7A 2CH2A 1LW4A 3GWPA 5FT8A 3EIAA 3IHJA 4JEZA 2HOXA 2OKKA 4MQPA 1GD9A 2FNUA 2Z20A 3EI6A 3F9TA 1IX8A 3H7FA 3BV0A 4E3QA 1J04A 2VGUA 3ASBA 3PDBA 1E5FA 1I48A 4W91A 2YCPA 1PFFA 4JEVA 2QBTA 5EAVA 1X29A 4EU1A 4A0RA 1KL1A 1S07A 2WK7A 1AHFA 5DJ1A 2XH1A 1DGEA 2D63A 3FRKA 2ZC0A 1GEWA 1ARIA 1N2TA 3ASAA 1AY4A 1B8GA 1IAYA 2GSAA 3GZCA 2VMSA 1M32A 2YCNA 4K2IA 5G4IA 4CXRA 4K05A 4IW7A 5AX8A 3UWCA 1AMSA 1BT4A 4IXZA 3IF2A 2JISA 4MSOA 2R5CB 4WB0B 1EQBA 3T32A 4B9BA 1DJ9A 2ZSMA 4WXFA 3WKSA 1ZODA 4WB0A 1AY5A 3PIUA 1ASGA 2R5CA 2V1PA 1C7GA 3B1EA 1UU0A 4ISYA 4I8AA 2W8TA 4DBCA 2DGLA 1AX4A 3ELEA 4Y0HA 1DTYA 2AEVA 5E5IA 2W8WA 5G2PA 3MAFB 4MQRA 1W23A 4OC9A 1CL2A 1QJ3A 1MDXA 2C81A 2WKAA 4MKJA 3HBXA 1YOOA 1VEFA 9AATA 4F5MA 3QBOA 1AKCA 3EZSA 2PB0A 5F9SA 3LVMA 1AJSB 4GRXA 1GEXA 2Z9XA 3E2ZB 1BQAA 4FFCA 4PFFA 4EMYA 4ZWVA 3I4JA 2BI3A 4HF8A 5DJ9A 2TPLA 2VI8A 5JAYA 2YCTA 1B4XA 3LY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7Z A;  1P3W A;  4W5K A;  4RJ0 A;  2D64 A;  4ZAH A;  1UU1 A;  1IX7 A;  3D6K A;  3FKD A;  3FDD A;  3WLX A;  1W3U A;  4J8L A;  4WBT A;  2AY9 A;  1TPL A;  4MY5 A;  2VMZ A;  1OXP A;  1AAM A;  1ASA A;  1DKA A;  1N8P A;  3MC6 C;  4CVQ A;  1DJE A;  3QPG A;  4OT8 A;  1O62 A;  3DXV A;  3II0 A;  3USF A;  2JJG A;  3ECD A;  1MAQ A;  2FM1 A;  4F5I A;  1S0A A;  3RBL A;  4ZDP A;  1TOE A;  3FQA A;  3WZF A;  2FQ6 A;  5HXX A;  1OAT A;  1O61 A;  4Q6R A;  1G4X A;  1B9H A;  4E1O A;  3TFT A;  5C6U A;  3CAI A;  4R8D A;  3LWS A;  1MDO A;  4JEW A;  1S09 A;  1JG8 A;  1RV4 A;  2W8J A;  4E3R A;  2EZ1 A;  2CY8 A;  4XJP A;  3AV7 A;  4ZAS A;  4MQQ A;  1C7O A;  1M0P A;  2YKX A;  2ZUK A;  1VP4 A;  4ZWM A;  4ZSY A;  1BJW A;  4RJY A;  4Y0I A;  4WLJ A;  4AO9 A;  4LNM A;  1YNU A;  4WP0 A;  1SPA A;  2DOU A;  2X3L A;  4ADE A;  2FYF A;  1CL1 A;  3FVX A;  2GMS A;  2VI9 A;  2XBN A;  3COG A;  2OQX A;  1V2D A;  2VGW A;  5D95 A;  3NU7 A;  3PGY A;  2CJD A;  2PO3 A;  3E2Z A;  5DX5 A;  1JS6 A;  4F4E A;  3LVL B;  1D7R A;  1SFF A;  2VMR A;  3LVK A;  1KL2 A;  2W7L A;  3WCN A;  3NUI A;  4U1T A;  1I43 A;  3FQ8 A;  4DGT A;  3K28 A;  2ZY4 A;  2ORD A;  1CZC A;  3E6G A;  3FSL A;  5M46 A;  2W8V A;  3ZRQ A;  4CXQ A;  1ASD A;  1WYV B;  3WGC A;  2FN6 A;  4B98 A;  4W8I A;  3L8A A;  4F5F A;  4ATP A;  3TFU A;  1AHY A;  1D7U A;  4JE5 A;  1TAT A;  4ADD A;  3PD6 A;  2OGE A;  4KYO A;  4E77 A;  2YOB A;  2D61 A;  4ATQ A;  4ITX A;  3FDB A;  1EJI A;  1YJS A;  2ZY5 A;  3HQT A;  3AEM C;  2W7F A;  2YKY A;  3OKS A;  2X5F A;  3VAX A;  4AO4 A;  1SVV A;  3LVJ A;  1X0M A;  2AY4 A;  2ZY3 A;  2VGZ A;  4WLH A;  4JF0 A;  2O1B A;  1IBJ A;  1RV3 A;  3CQ6 A;  4HVK A;  2BIG A;  2DGM A;  5F8V A;  1XI9 A;  4UHN A;  1AAW A;  4IYO A;  3RI6 A;  4A0F A;  3B1D A;  2BIE A;  3FQ7 A;  1M6S A;  4R5Z A;  2ZYJ A;  4UOY A;  1PMO A;  2NMP A;  2W7J A;  4W1V A;  5EFS A;  1TOI A;  3PDB B;  1MGV A;  2AY5 A;  4JE5 D;  4WYF A;  5EAA A;  1YAA A;  2D7Y A;  3R9A A;  1DFO A;  1D2F A;  1X28 A;  2HUI A;  2VMT A;  3DOD A;  4XQ2 A;  2BWN A;  2CAN A;  3WGB A;  4ADC A;  4GEB A;  2AAT A;  1SF2 A;  3Q8N A;  4KXK A;  4WYE A;  2VMP A;  1RVY A;  4F5G A;  1IJI A;  1PMM A;  1WKG A;  3DXW A;  4JEY A;  1LW5 A;  2R5E A;  3W1H A;  5FT4 A;  1ASB A;  4OYT A;  4WXB A;  1GC2 A;  1AMA A;  3DU4 A;  5EUN A;  1X2A A;  1DGD A;  2DKJ A;  2CTZ A;  5EIG B;  2Z61 A;  5DB5 A;  3AEJ C;  1OHV A;  2EGY A;  4A00 A;  1TOK A;  2YHK A;  1E5E A;  1LK9 A;  2G6W A;  2AY2 A;  2V0Y A;  3NNK A;  3NYU A;  4TV7 A;  3FTB A;  2Z9W A;  4UQV A;  1ARG A;  3NRA A;  2ZY2 A;  3GSB A;  2EO5 A;  1AJS A;  2ZJG A;  2O0R A;  5M4B A;  3W1I A;  5FT6 A;  1O4S A;  4OCA A;  3JZL A;  1ART A;  1LC5 A;  3ZRR A;  3ZZK A;  4DQ6 A;  3EI9 A;  4H51 A;  4WYC A;  3UE8 A;  1UU2 A;  1S08 A;  3G0T A;  3PAA A;  4A6R A;  4A0G A;  4PIW A;  3FVS A;  4WYG A;  3RBF A;  5LHA A;  1AKA A;  2DR1 A;  4ZM3 A;  2Z67 A;  4GSA A;  3BCA A;  4GDY A;  3JW9 A;  3DYD A;  1KMK A;  1MAP A;  3DC1 A;  4LNL A;  4TN4 A;  2GQN A;  2VGT A;  2F8J A;  3BCB A;  1M0Q A;  3CBF A;  1CZE A;  1CJ0 A;  1Z7D A;  2AY1 A;  2Q7W A;  2QB3 A;  1WST A;  3G8M A;  2W7I A;  2QB2 A;  3E2Y A;  1C9C A;  1PG8 A;  1C0N A;  2HOR A;  2CIN A;  1GEY A;  5G2Q A;  4K2B A;  2Z9V A;  3L44 A;  2AY6 A;  4R5F A;  3VOM A;  4F5H A;  1T3I A;  1WYV A;  5E3K A;  4AOA A;  1Y4I A;  1AMQ A;  1RVU A;  1U08 A;  1D7V A;  4WYA A;  3GZD A;  3HVY A;  4BA5 A;  2FNI A;  2VMO A;  2VMQ A;  3FZ7 A;  2W7D A;  1KKJ A;  2W8U A;  2X8U A;  4M2J A;  1AHE A;  3EZ1 A;  3E9K A;  1B9I A;  1ORD A;  3F0H A;  3G7Q A;  5FT5 A;  3RCH B;  1GDE A;  1BS0 A;  1ELQ A;  4AZK A;  3R4T A;  4BA4 A;  1AIB A;  3K7Y A;  4OBU A;  3W1J A;  1IUG A;  2YRI A;  3FCR A;  2CFB A;  4LW4 A;  3FD0 A;  3MKJ A;  3AEN A;  1GC0 A;  5G09 A;  3WCO A;  4N0W A;  1YJY A;  2D66 A;  3I16 A;  4RIZ A;  2D5Y A;  4M2M A;  1AY8 A;  2BHX A;  2BI5 A;  2RFV A;  2C0R A;  3HLM A;  3RUY A;  3WY7 A;  3A2B A;  5M4D A;  3PDX A;  1BJO A;  3NX3 A;  3TQX A;  2HOZ A;  1V2E A;  4PVF A;  1M0N A;  2AY8 A;  1ELU A;  1ZOB A;  2BI2 A;  2BYL A;  2BWO A;  3BC8 A;  1AHX A;  3E2F A;  3ZRP A;  1AJR A;  4XAU A;  4OBV A;  3UAK A;  1AIA A;  2QA3 A;  3AOV A;  1MLY A;  1AKB A;  5TF5 A;  3FVU A;  1ASE A;  3F6T A;  4J5U A;  5IWQ A;  3BWN C;  3FZ8 A;  4ADB A;  3AEP A;  7AAT A;  2VMN A;  3FZ6 A;  1O69 A;  1GCK A;  4GE7 A;  4A6T A;  3BB8 A;  3MAU A;  4NOG A;  3RCH A;  4LC3 A;  1GBN A;  1V2F A;  1BQD A;  2BWP A;  1M4N A;  1W7L A;  2W7E A;  2E7J A;  4OMA A;  1ASC A;  1LS3 A;  4PFN A;  2CJH A;  4RKD A;  4JEX A;  5E4Z A;  4XJM A;  4Q75 A;  3A9X A;  2CJG A;  3BWO A;  2WK8 A;  3OP7 A;  2VIA A;  3MAF A;  3VK2 A;  2CB1 A;  2R0T A;  2HP2 A;  3A9Z A;  4XJL A;  1C7N A;  4K2M A;  2VLH A;  3EI8 A;  3NU8 A;  2AEU A;  3GJU A;  2VMX A;  1SZK A;  3GR9 A;  3TAT A;  3FFH A;  4F5J A;  4OTL A;  3MAD A;  2E54 A;  2EPJ A;  2BIA A;  2HOY A;  4L0O A;  2AY7 A;  1ASM A;  1TAS A;  2WK9 A;  1WKH A;  3EI5 A;  2E7I A;  3CQ4 A;  1CQ8 A;  3KGX A;  4Q31 A;  1EG5 A;  2QMA A;  1ASF A;  2Z1Z A;  2JG2 A;  3KE3 A;  4WXG A;  1AIC A;  2DGK A;  1QIT A;  2JJH A;  3PPL A;  3TCM A;  2EH6 A;  2AY3 A;  4IY7 A;  3B1C A;  1G7W A;  2HP1 A;  4W1W A;  2JJF A;  4RLG A;  3RQ1 A;  2CST A;  1B5P A;  3WKR A;  4IXS A;  4ZM4 A;  3B8X A;  1BJ4 A;  1VJO A;  2GMU A;  1YJZ A;  3AOW A;  3HT4 A;  3I5T A;  3N5M A;  4UHO A;  4M2K A;  2HUU A;  1LC8 A;  2BYJ A;  3MBB A;  3GET A;  4EB5 A;  1QIR A;  1AHG A;  4CBS A;  3WX9 A;  2C44 A;  2JGT A;  3JTX A;  3AEL A;  3QM2 A;  3MEB A;  3BWN A;  1WYT B;  1QJ5 A;  4Q76 A;  1BJN A;  2OAT A;  3ACZ A;  4XK1 A;  4XJO A;  1ECX A;  3AEM A;  3AEJ A;  3NDN A;  1Z3Z A;  2W7H A;  3VK4 A;  1H0C A;  5G4J A;  1M0O A;  3QGU A;  4LW2 A;  1ARS A;  4ITG A;  4QGR A;  2VMV A;  3CQ5 A;  4CBR A;  2C7T A;  2VIB A;  1ZC9 A;  2JJE A;  1LC7 A;  2GB3 A;  4MKK A;  4ZSW A;  1H1C A;  2BI1 A;  2Z1Y A;  1TAR A;  1BW0 A;  3ISL A;  4N0B A;  4P3M A;  4RM1 A;  1BJO B;  2OKJ A;  1N31 A;  4U2H A;  4BQ0 A;  5M49 A;  4AZJ A;  2BI9 A;  8AAT A;  4XEW A;  4AH3 A;  3QN6 A;  4IYO B;  4BHD A;  2W7M A;  3GZD C;  3VP6 A;  3B46 A;  5BJ4 A;  4ZDL A;  1CQ6 A;  5J8Q A;  1ASL A;  3K40 A;  1OXO A;  2W7K A;  5HHY A;  2D65 A;  4F5L A;  4Y0D A;  1SZU A;  2EZ2 A;  1V72 A;  3FFR A;  2OGA A;  1BKG A;  2QLR A;  3DRD A;  4IX8 A;  1TOG A;  1WYU B;  1G7X A;  3E77 A;  5HDM A;  2VYC A;  3JWB A;  3N75 A;  1D7S A;  2VMY A;  2W7G A;  4IXO A;  3EI7 A;  3A9Y A;  1FC4 A;  1IVR A;  2DKB A;  2PB2 A;  1IAX A;  3PD6 B;  5LH9 A;  5EQC A;  4ZDO A;  3VK3 A;  1B5O A;  3MC6 A;  3KKI A;  4O6Z A;  1M7Y A;  4RKC A;  1G4V A;  1IX6 A;  3A8U X;  4KAM A;  2YKU A;  4RIT A;  5D5S A;  1OHY A;  3AEO A;  1XEY A;  1FG3 A;  2VMU A;  2HUF A;  1W7N A;  3JU7 A;  3P6K A;  2VGV A;  1QZ9 A;  4R2N A;  4TMR A;  1JS3 A;  4FL0 A;  1QIS A;  1YIY A;  3N0L A;  2X5D A;  2YKV A;  1SZS A;  5G0A A;  5BJ3 A;  3DR4 A;  4JF1 A;  4W1X A;  2CH1 A;  2ZP7 A;  1KKP A;  4EFF A;  4BMK A;  2VGS A;  4UHM A;  1UKJ A;  2HZP A;  2R2N A;  2ZSL A;  3BN1 A;  4A0H A;  3PJ0 A;  3QI6 A;  3H14 A;  1WYU A;  1C4K A;  4F5K A;  4A72 A;  2Z9U A;  1OHW A;  3P1T A;  3AAT A;  3BCX A;  4GE4 A;  1I41 A;  1FG7 A;  3EUC A;  1I29 A;  3KGW A;  1YIZ A;  2VLF A;  3LG0 A;  4GE9 A;  1MLZ A;  2O7C A;  3NYS A;  1LKC A;  3BS8 A;  3GBX A;  3PA9 A;  3NTJ A;  1CQ7 A;  3HL2 A;  2BKW A;  2VMW A;  1MDZ A;  1QGN A;  3QHX A;  4P7Y A;  3JWA A;  1W7M A;  1AMR A;  3LV2 A;  1J32 A;  4RAE A;  4ZLV A;  2E7U A;  3NYT A;  4LNJ A;  1TOJ A;  3EIB A;  3ELP A;  2YRR A;  5EIG A;  4EB7 A;  3M5U A;  1ASN A;  4MGR A;  5EUD A;  3ZZJ A;  4WYD A;  1KMJ A;  3DZZ A;  5K8B A;  1CS1 A;  3HDO A;  5I92 A;  3ATH A;  1GC4 A;  1WYT A;  4WD2 A;  1JF9 A;  4A6U A;  3AEN B;  3NUB A;  5EUE A;  1S06 A;  1DJU A;  3HMU A;  1ARH A;  1GC3 A;  3DR7 A;  2CH2 A;  1LW4 A;  3GWP A;  5FT8 A;  3EIA A;  3IHJ A;  4JEZ A;  2HOX A;  2OKK A;  4MQP A;  1GD9 A;  2FNU A;  2Z20 A;  3EI6 A;  3F9T A;  1IX8 A;  3H7F A;  3BV0 A;  4E3Q A;  1J04 A;  2VGU A;  3ASB A;  3PDB A;  1E5F A;  1I48 A;  4W91 A;  2YCP A;  1PFF A;  4JEV A;  2QBT A;  5EAV A;  1X29 A;  4EU1 A;  4A0R A;  1KL1 A;  1S07 A;  2WK7 A;  1AHF A;  5DJ1 A;  2XH1 A;  1DGE A;  2D63 A;  3FRK A;  2ZC0 A;  1GEW A;  1ARI A;  1N2T A;  3ASA A;  1AY4 A;  1B8G A;  1IAY A;  2GSA A;  3GZC A;  2VMS A;  1M32 A;  2YCN A;  4K2I A;  5G4I A;  4CXR A;  4IW7 A;  5AX8 A;  3UWC A;  1AMS A;  1BT4 A;  4IXZ A;  3IF2 A;  2JIS A;  4MSO A;  2R5C B;  4WB0 B;  1EQB A;  3T32 A;  4B9B A;  1DJ9 A;  2ZSM A;  4WXF A;  3WKS A;  1ZOD A;  4WB0 A;  1AY5 A;  3PIU A;  1ASG A;  2R5C A;  2V1P A;  1C7G A;  3B1E A;  1UU0 A;  4ISY A;  4I8A A;  2W8T A;  4DBC A;  2DGL A;  1AX4 A;  3ELE A;  4Y0H A;  1DTY A;  2AEV A;  5E5I A;  2W8W A;  5G2P A;  3MAF B;  4MQR A;  1W23 A;  4OC9 A;  1CL2 A;  1QJ3 A;  1MDX A;  2C81 A;  2WKA A;  4MKJ A;  3HBX A;  1YOO A;  1VEF A;  9AAT A;  4F5M A;  3QBO A;  1AKC A;  3EZS A;  2PB0 A;  5F9S A;  3LVM A;  1AJS B;  4GRX A;  1GEX A;  2Z9X A;  3E2Z B;  1BQA A;  4FFC A;  4PFF A;  4EMY A;  4ZWV A;  3I4J A;  2BI3 A;  4HF8 A;  5DJ9 A;  2TPL A;  2VI8 A;  5JAY A;  2YCT A;  1B4X A;  3LY1 A; 
#chains in the Genus database with same CATH topology
 2D7Z A;  1P3W A;  4W5K A;  4RJ0 A;  2D64 A;  4ZAH A;  1UU1 A;  1IX7 A;  3D6K A;  3FKD A;  3FDD A;  3WLX A;  1W3U A;  4J8L A;  4WBT A;  2AY9 A;  1TPL A;  4MY5 A;  2VMZ A;  3N4S A;  1OXP A;  1AAM A;  1ASA A;  1DKA A;  1N8P A;  3MC6 C;  4CVQ A;  1DJE A;  3QPG A;  4OT8 A;  1O62 A;  3DXV A;  3II0 A;  3USF A;  2JJG A;  3ECD A;  1MAQ A;  2FM1 A;  4F5I A;  1S0A A;  3RBL A;  4ZDP A;  1TOE A;  3FQA A;  3WZF A;  2FQ6 A;  5HXX A;  1OAT A;  1O61 A;  4Q6R A;  1G4X A;  1B9H A;  4E1O A;  3TFT A;  5C6U A;  3CAI A;  4R8D A;  3LWS A;  1MDO A;  4JEW A;  1S09 A;  1JG8 A;  1RV4 A;  2W8J A;  4E3R A;  2EZ1 A;  2CY8 A;  4XJP A;  3AV7 A;  4ZAS A;  4MQQ A;  1C7O A;  1M0P A;  2YKX A;  2ZUK A;  1VP4 A;  4ZWM A;  4ZSY A;  1BJW A;  4RJY A;  4Y0I A;  4WLJ A;  4AO9 A;  4LNM A;  1YNU A;  4WP0 A;  1SPA A;  2G7J A;  2DOU A;  2X3L A;  4ADE A;  2FYF A;  1CL1 A;  3FVX A;  2GMS A;  2VI9 A;  2XBN A;  3COG A;  2OQX A;  1V2D A;  2VGW A;  5D95 A;  3NU7 A;  3PGY A;  2CJD A;  2PO3 A;  3E2Z A;  5DX5 A;  1JS6 A;  4F4E A;  3LVL B;  1D7R A;  1SFF A;  2VMR A;  3LVK A;  2EYQ A;  1KL2 A;  2W7L A;  3WCN A;  3NUI A;  4U1T A;  1I43 A;  3FQ8 A;  4DGT A;  3K28 A;  2ZY4 A;  2ORD A;  1CZC A;  3E6G A;  3FSL A;  5M46 A;  2W8V A;  3ZRQ A;  4CXQ A;  1ASD A;  1WYV B;  3WGC A;  2FN6 A;  4B98 A;  4W8I A;  3L8A A;  4F5F A;  4ATP A;  3TFU A;  1AHY A;  1D7U A;  4JE5 A;  1TAT A;  4ADD A;  3PD6 A;  2OGE A;  4KYO A;  4E77 A;  2YOB A;  2D61 A;  4ATQ A;  4ITX A;  3FDB A;  1EJI A;  1YJS A;  2ZY5 A;  3HQT A;  3AEM C;  2W7F A;  2YKY A;  3OKS A;  2X5F A;  3VAX A;  4AO4 A;  1SVV A;  3LVJ A;  1X0M A;  2AY4 A;  2ZY3 A;  2VGZ A;  4WLH A;  4JF0 A;  2O1B A;  1IBJ A;  1RV3 A;  3CQ6 A;  4HVK A;  2BIG A;  2DGM A;  5F8V A;  1XI9 A;  4UHN A;  1AAW A;  4IYO A;  3RI6 A;  4A0F A;  3B1D A;  2BIE A;  3FQ7 A;  1M6S A;  4R5Z A;  2ZYJ A;  4UOY A;  1PMO A;  2NMP A;  2W7J A;  4W1V A;  5EFS A;  1TOI A;  3PDB B;  1MGV A;  2AY5 A;  4JE5 D;  4WYF A;  5EAA A;  1YAA A;  2D7Y A;  3R9A A;  1DFO A;  1D2F A;  1X28 A;  2HUI A;  2VMT A;  3DOD A;  4XQ2 A;  2BWN A;  2CAN A;  3WGB A;  4ADC A;  4GEB A;  2AAT A;  1SF2 A;  3Q8N A;  4KXK A;  4WYE A;  2VMP A;  1RVY A;  4F5G A;  1IJI A;  1PMM A;  1WKG A;  3DXW A;  4JEY A;  1LW5 A;  2R5E A;  3W1H A;  5FT4 A;  1ASB A;  4OYT A;  4WXB A;  1GC2 A;  1AMA A;  3DU4 A;  5EUN A;  1X2A A;  1DGD A;  2DKJ A;  2CTZ A;  5EIG B;  2Z61 A;  5DB5 A;  3AEJ C;  1OHV A;  2EGY A;  4A00 A;  1TOK A;  2YHK A;  1E5E A;  1LK9 A;  2G6W A;  2AY2 A;  2V0Y A;  3NNK A;  3NYU A;  4TV7 A;  3FTB A;  2Z9W A;  4UQV A;  1ARG A;  3NRA A;  2ZY2 A;  3GSB A;  2EO5 A;  1AJS A;  2ZJG A;  2O0R A;  5M4B A;  3W1I A;  5FT6 A;  1O4S A;  4OCA A;  3JZL A;  1ART A;  1LC5 A;  3ZRR A;  3ZZK A;  4DQ6 A;  3EI9 A;  4H51 A;  4WYC A;  3UE8 A;  1UU2 A;  1S08 A;  3G0T A;  3PAA A;  4A6R A;  4A0G A;  4PIW A;  3FVS A;  4WYG A;  3RBF A;  5LHA A;  1AKA A;  2DR1 A;  4ZM3 A;  2Z67 A;  4GSA A;  3BCA A;  4GDY A;  3JW9 A;  3DYD A;  1KMK A;  1MAP A;  3DC1 A;  4LNL A;  4TN4 A;  2GQN A;  2VGT A;  2F8J A;  3BCB A;  1M0Q A;  3CBF A;  1CZE A;  1CJ0 A;  1Z7D A;  2AY1 A;  2Q7W A;  2QB3 A;  1WST A;  3G8M A;  2W7I A;  2QB2 A;  3E2Y A;  1C9C A;  1PG8 A;  1C0N A;  2HOR A;  2CIN A;  1GEY A;  5G2Q A;  4K2B A;  2KFP A;  2Z9V A;  3L44 A;  4H63 Q;  2AY6 A;  4R5F A;  3VOM A;  4F5H A;  1T3I A;  1WYV A;  5E3K A;  4AOA A;  1Y4I A;  1AMQ A;  1RVU A;  1U08 A;  1D7V A;  4WYA A;  3GZD A;  3HVY A;  4BA5 A;  2FNI A;  2VMO A;  2VMQ A;  3FZ7 A;  2W7D A;  1KKJ A;  2W8U A;  2X8U A;  4M2J A;  1AHE A;  3EZ1 A;  3E9K A;  1B9I A;  1ORD A;  3F0H A;  3G7Q A;  5FT5 A;  3RCH B;  1GDE A;  1BS0 A;  1ELQ A;  4AZK A;  3R4T A;  4BA4 A;  1AIB A;  3K7Y A;  2A1V A;  4OBU A;  3W1J A;  1IUG A;  2YRI A;  3FCR A;  2CFB A;  4LW4 A;  3FD0 A;  3MKJ A;  3AEN A;  1GC0 A;  5G09 A;  3WCO A;  4N0W A;  1YJY A;  2D66 A;  3I16 A;  4RIZ A;  2D5Y A;  4M2M A;  1AY8 A;  2BHX A;  2BI5 A;  2RFV A;  2C0R A;  3HLM A;  3RUY A;  3WY7 A;  3A2B A;  5M4D A;  3PDX A;  1BJO A;  3NX3 A;  3TQX A;  1KAF A;  2QSR A;  2HOZ A;  1V2E A;  4PVF A;  1M0N A;  2AY8 A;  1ELU A;  1ZOB A;  2BI2 A;  2BYL A;  2BWO A;  3BC8 A;  1AHX A;  3E2F A;  3ZRP A;  1AJR A;  4XAU A;  4OBV A;  3UAK A;  2WB6 A;  1AIA A;  2QA3 A;  3AOV A;  1MLY A;  1AKB A;  5TF5 A;  3FVU A;  1ASE A;  3F6T A;  4J5U A;  5IWQ A;  3BWN C;  3FZ8 A;  4ADB A;  3AEP A;  7AAT A;  2VMN A;  3FZ6 A;  1O69 A;  1GCK A;  4GE7 A;  4A6T A;  3BB8 A;  3MAU A;  4NOG A;  3RCH A;  4LC3 A;  1GBN A;  1V2F A;  1BQD A;  2BWP A;  1M4N A;  3H9X A;  1W7L A;  2W7E A;  2E7J A;  4OMA A;  3N4X A;  1ASC A;  1LS3 A;  4PFN A;  2CJH A;  4RKD A;  4JEX A;  5E4Z A;  4XJM A;  4Q75 A;  3A9X A;  2CJG A;  3BWO A;  2WK8 A;  3OP7 A;  2VIA A;  2FKI A;  3MAF A;  3VK2 A;  2CB1 A;  2R0T A;  2HP2 A;  3A9Z A;  4XJL A;  1C7N A;  4K2M A;  2VLH A;  3EI8 A;  3NU8 A;  2AEU A;  3GJU A;  2VMX A;  1SZK A;  3GR9 A;  3TAT A;  3FFH A;  4F5J A;  4OTL A;  3MAD A;  2E54 A;  2EPJ A;  2BIA A;  2HOY A;  4L0O A;  2AY7 A;  1ASM A;  1TAS A;  2WK9 A;  1WKH A;  3EI5 A;  2E7I A;  3CQ4 A;  1CQ8 A;  3KGX A;  4Q31 A;  1EG5 A;  2QMA A;  1ASF A;  2Z1Z A;  2JG2 A;  3KE3 A;  4WXG A;  1AIC A;  2DGK A;  1QIT A;  2JJH A;  3PPL A;  3TCM A;  3N4R A;  2EH6 A;  2AY3 A;  4IY7 A;  3B1C A;  1G7W A;  2HP1 A;  4W1W A;  2JJF A;  4RLG A;  3RQ1 A;  2CST A;  1B5P A;  3WKR A;  4IXS A;  4ZM4 A;  3B8X A;  1BJ4 A;  1VJO A;  2GMU A;  1YJZ A;  3AOW A;  3HT4 A;  3I5T A;  3N5M A;  4UHO A;  4M2K A;  2HUU A;  1LC8 A;  2BYJ A;  3MBB A;  3GET A;  4EB5 A;  1QIR A;  1AHG A;  4CBS A;  3WX9 A;  2C44 A;  2JGT A;  3JTX A;  3AEL A;  3QM2 A;  3MEB A;  3BWN A;  1WYT B;  1QJ5 A;  4Q76 A;  1BJN A;  2OAT A;  3ACZ A;  4XK1 A;  4XJO A;  1ECX A;  3AEM A;  3AEJ A;  3NDN A;  1Z3Z A;  2W7H A;  3VK4 A;  1H0C A;  5G4J A;  1M0O A;  3QGU A;  4LW2 A;  1ARS A;  4ITG A;  4QGR A;  2VMV A;  3CQ5 A;  4CBR A;  2C7T A;  2VIB A;  1ZC9 A;  2JJE A;  1LC7 A;  2GB3 A;  4MKK A;  4ZSW A;  1H1C A;  2BI1 A;  2Z1Y A;  1TAR A;  1BW0 A;  3ISL A;  4N0B A;  4P3M A;  4RM1 A;  1BJO B;  2OKJ A;  1N31 A;  4U2H A;  4BQ0 A;  5M49 A;  4AZJ A;  2BI9 A;  8AAT A;  4XEW A;  4AH3 A;  3QN6 A;  4IYO B;  4BHD A;  2W7M A;  3GZD C;  3VP6 A;  3B46 A;  5BJ4 A;  4ZDL A;  1CQ6 A;  5J8Q A;  1ASL A;  3K40 A;  1OXO A;  2W7K A;  5HHY A;  2D65 A;  4F5L A;  4Y0D A;  1SZU A;  2EZ2 A;  1V72 A;  3FFR A;  2OGA A;  1BKG A;  2QLR A;  3DRD A;  4IX8 A;  1TOG A;  1WYU B;  1G7X A;  3E77 A;  5HDM A;  2VYC A;  3JWB A;  3N7N A;  3N75 A;  1D7S A;  2VMY A;  2W7G A;  4IXO A;  3EI7 A;  3A9Y A;  1FC4 A;  1IVR A;  2DKB A;  2PB2 A;  1IAX A;  3PD6 B;  5LH9 A;  5EQC A;  4ZDO A;  3VK3 A;  1B5O A;  3MC6 A;  3KKI A;  4O6Z A;  1M7Y A;  4RKC A;  1G4V A;  1IX6 A;  3A8U X;  4KAM A;  2YKU A;  4RIT A;  5D5S A;  1OHY A;  3AEO A;  1XEY A;  1FG3 A;  2VMU A;  2HUF A;  1W7N A;  3JU7 A;  3P6K A;  5KTB A;  2VGV A;  1QZ9 A;  4R2N A;  4TMR A;  1JS3 A;  4FL0 A;  1QIS A;  1YIY A;  3N0L A;  2X5D A;  2YKV A;  1SZS A;  5G0A A;  5BJ3 A;  3DR4 A;  4JF1 A;  4W1X A;  2CH1 A;  2ZP7 A;  1KKP A;  4EFF A;  4BMK A;  2VGS A;  4UHM A;  1UKJ A;  2HZP A;  2R2N A;  2ZSL A;  3BN1 A;  4A0H A;  3PJ0 A;  3QI6 A;  3H14 A;  1WYU A;  1C4K A;  4F5K A;  4A72 A;  2Z9U A;  1OHW A;  3P1T A;  3AAT A;  3BCX A;  4GE4 A;  1I41 A;  1FG7 A;  3EUC A;  1I29 A;  3KGW A;  1YIZ A;  2VLF A;  3LG0 A;  4GE9 A;  1MLZ A;  2O7C A;  3NYS A;  1LKC A;  3BS8 A;  3GBX A;  3PA9 A;  3NTJ A;  1CQ7 A;  3HL2 A;  2BKW A;  2VMW A;  1MDZ A;  1QGN A;  3QHX A;  4P7Y A;  3JWA A;  1W7M A;  1AMR A;  3LV2 A;  1J32 A;  4RAE A;  4ZLV A;  2E7U A;  3NYT A;  4LNJ A;  1TOJ A;  3EIB A;  3ELP A;  2YRR A;  5EIG A;  4EB7 A;  3M5U A;  1ASN A;  4MGR A;  5EUD A;  3ZZJ A;  4WYD A;  1KMJ A;  3DZZ A;  5K8B A;  1CS1 A;  3HDO A;  5I92 A;  3ATH A;  1GC4 A;  1WYT A;  4WD2 A;  1JF9 A;  4A6U A;  3AEN B;  3NUB A;  5EUE A;  1S06 A;  1DJU A;  3HMU A;  1ARH A;  1GC3 A;  3DR7 A;  2CH2 A;  1LW4 A;  3GWP A;  5FT8 A;  3EIA A;  3IHJ A;  4JEZ A;  2HOX A;  2OKK A;  4MQP A;  1GD9 A;  2FNU A;  2Z20 A;  3EI6 A;  3F9T A;  1IX8 A;  3H7F A;  3BV0 A;  4E3Q A;  1J04 A;  2VGU A;  3ASB A;  3PDB A;  1E5F A;  1I48 A;  4W91 A;  2YCP A;  1PFF A;  4JEV A;  2QBT A;  5EAV A;  1X29 A;  4EU1 A;  4A0R A;  1KL1 A;  1S07 A;  2WK7 A;  1AHF A;  5DJ1 A;  2XH1 A;  1DGE A;  2D63 A;  3FRK A;  2ZC0 A;  1GEW A;  1ARI A;  1N2T A;  3ASA A;  1AY4 A;  1B8G A;  1IAY A;  2GSA A;  3GZC A;  2VMS A;  1M32 A;  2YCN A;  4K2I A;  5G4I A;  4CXR A;  4K05 A;  4IW7 A;  5AX8 A;  3UWC A;  1AMS A;  1BT4 A;  4IXZ A;  3IF2 A;  2JIS A;  4MSO A;  2R5C B;  4WB0 B;  1EQB A;  3T32 A;  4B9B A;  1DJ9 A;  2ZSM A;  4WXF A;  3WKS A;  1ZOD A;  4WB0 A;  1AY5 A;  3PIU A;  1ASG A;  2R5C A;  2V1P A;  1C7G A;  3B1E A;  1UU0 A;  4ISY A;  4I8A A;  2W8T A;  4DBC A;  2DGL A;  1AX4 A;  3ELE A;  4Y0H A;  1DTY A;  2AEV A;  5E5I A;  2W8W A;  5G2P A;  3MAF B;  4MQR A;  1W23 A;  4OC9 A;  1CL2 A;  1QJ3 A;  1MDX A;  2C81 A;  2WKA A;  4MKJ A;  3HBX A;  1YOO A;  1VEF A;  9AAT A;  4F5M A;  3QBO A;  1AKC A;  3EZS A;  2PB0 A;  5F9S A;  3LVM A;  1AJS B;  4GRX A;  1GEX A;  2Z9X A;  3E2Z B;  1BQA A;  4FFC A;  4PFF A;  4EMY A;  4ZWV A;  3I4J A;  2BI3 A;  4HF8 A;  5DJ9 A;  2TPL A;  2VI8 A;  5JAY A;  2YCT A;  1B4X A;  3LY1 A; 
#chains in the Genus database with same CATH homology
 2D7Z A;  1P3W A;  4W5K A;  4RJ0 A;  2D64 A;  4ZAH A;  1UU1 A;  1IX7 A;  3D6K A;  3FKD A;  3FDD A;  3WLX A;  1W3U A;  4J8L A;  4WBT A;  2AY9 A;  1TPL A;  4MY5 A;  2VMZ A;  3N4S A;  1OXP A;  1AAM A;  1ASA A;  1DKA A;  1N8P A;  3MC6 C;  4CVQ A;  1DJE A;  3QPG A;  4OT8 A;  1O62 A;  3DXV A;  3II0 A;  3USF A;  2JJG A;  3ECD A;  1MAQ A;  2FM1 A;  4F5I A;  1S0A A;  3RBL A;  4ZDP A;  1TOE A;  3FQA A;  3WZF A;  2FQ6 A;  5HXX A;  1OAT A;  1O61 A;  4Q6R A;  1G4X A;  1B9H A;  4E1O A;  3TFT A;  5C6U A;  3CAI A;  4R8D A;  3LWS A;  1MDO A;  4JEW A;  1S09 A;  1JG8 A;  1RV4 A;  2W8J A;  4E3R A;  2EZ1 A;  2CY8 A;  4XJP A;  3AV7 A;  4ZAS A;  4MQQ A;  1C7O A;  1M0P A;  2YKX A;  2ZUK A;  1VP4 A;  4ZWM A;  4ZSY A;  1BJW A;  4RJY A;  4Y0I A;  4WLJ A;  4AO9 A;  4LNM A;  1YNU A;  4WP0 A;  1SPA A;  2G7J A;  2DOU A;  2X3L A;  4ADE A;  2FYF A;  1CL1 A;  3FVX A;  2GMS A;  2VI9 A;  2XBN A;  3COG A;  2OQX A;  1V2D A;  2VGW A;  5D95 A;  3NU7 A;  3PGY A;  2CJD A;  2PO3 A;  3E2Z A;  5DX5 A;  1JS6 A;  4F4E A;  3LVL B;  1D7R A;  1SFF A;  2VMR A;  3LVK A;  2EYQ A;  1KL2 A;  2W7L A;  3WCN A;  3NUI A;  4U1T A;  1I43 A;  3FQ8 A;  4DGT A;  3K28 A;  2ZY4 A;  2ORD A;  1CZC A;  3E6G A;  3FSL A;  5M46 A;  2W8V A;  3ZRQ A;  4CXQ A;  1ASD A;  1WYV B;  3WGC A;  2FN6 A;  4B98 A;  4W8I A;  3L8A A;  4F5F A;  4ATP A;  3TFU A;  1AHY A;  1D7U A;  4JE5 A;  1TAT A;  4ADD A;  3PD6 A;  2OGE A;  4KYO A;  4E77 A;  2YOB A;  2D61 A;  4ATQ A;  4ITX A;  3FDB A;  1EJI A;  1YJS A;  2ZY5 A;  3HQT A;  3AEM C;  2W7F A;  2YKY A;  3OKS A;  2X5F A;  3VAX A;  4AO4 A;  1SVV A;  3LVJ A;  1X0M A;  2AY4 A;  2ZY3 A;  2VGZ A;  4WLH A;  4JF0 A;  2O1B A;  1IBJ A;  1RV3 A;  3CQ6 A;  4HVK A;  2BIG A;  2DGM A;  5F8V A;  1XI9 A;  4UHN A;  1AAW A;  4IYO A;  3RI6 A;  4A0F A;  3B1D A;  2BIE A;  3FQ7 A;  1M6S A;  4R5Z A;  2ZYJ A;  4UOY A;  1PMO A;  2NMP A;  2W7J A;  4W1V A;  5EFS A;  1TOI A;  3PDB B;  1MGV A;  2AY5 A;  4JE5 D;  4WYF A;  5EAA A;  1YAA A;  2D7Y A;  3R9A A;  1DFO A;  1D2F A;  1X28 A;  2HUI A;  2VMT A;  3DOD A;  4XQ2 A;  2BWN A;  2CAN A;  3WGB A;  4ADC A;  4GEB A;  2AAT A;  1SF2 A;  3Q8N A;  4KXK A;  4WYE A;  2VMP A;  1RVY A;  4F5G A;  1IJI A;  1PMM A;  1WKG A;  3DXW A;  4JEY A;  1LW5 A;  2R5E A;  3W1H A;  5FT4 A;  1ASB A;  4OYT A;  4WXB A;  1GC2 A;  1AMA A;  3DU4 A;  5EUN A;  1X2A A;  1DGD A;  2DKJ A;  2CTZ A;  5EIG B;  2Z61 A;  5DB5 A;  3AEJ C;  1OHV A;  2EGY A;  4A00 A;  1TOK A;  2YHK A;  1E5E A;  1LK9 A;  2G6W A;  2AY2 A;  2V0Y A;  3NNK A;  3NYU A;  4TV7 A;  3FTB A;  2Z9W A;  4UQV A;  1ARG A;  3NRA A;  2ZY2 A;  3GSB A;  2EO5 A;  1AJS A;  2ZJG A;  2O0R A;  5M4B A;  3W1I A;  5FT6 A;  1O4S A;  4OCA A;  3JZL A;  1ART A;  1LC5 A;  3ZRR A;  3ZZK A;  4DQ6 A;  3EI9 A;  4H51 A;  4WYC A;  3UE8 A;  1UU2 A;  1S08 A;  3G0T A;  3PAA A;  4A6R A;  4A0G A;  4PIW A;  3FVS A;  4WYG A;  3RBF A;  5LHA A;  1AKA A;  2DR1 A;  4ZM3 A;  2Z67 A;  4GSA A;  3BCA A;  4GDY A;  3JW9 A;  3DYD A;  1KMK A;  1MAP A;  3DC1 A;  4LNL A;  4TN4 A;  2GQN A;  2VGT A;  2F8J A;  3BCB A;  1M0Q A;  3CBF A;  1CZE A;  1CJ0 A;  1Z7D A;  2AY1 A;  2Q7W A;  2QB3 A;  1WST A;  3G8M A;  2W7I A;  2QB2 A;  3E2Y A;  1C9C A;  1PG8 A;  1C0N A;  2HOR A;  2CIN A;  1GEY A;  5G2Q A;  4K2B A;  2KFP A;  2Z9V A;  3L44 A;  4H63 Q;  2AY6 A;  4R5F A;  3VOM A;  4F5H A;  1T3I A;  1WYV A;  5E3K A;  4AOA A;  1Y4I A;  1AMQ A;  1RVU A;  1U08 A;  1D7V A;  4WYA A;  3GZD A;  3HVY A;  4BA5 A;  2FNI A;  2VMO A;  2VMQ A;  3FZ7 A;  2W7D A;  1KKJ A;  2W8U A;  2X8U A;  4M2J A;  1AHE A;  3EZ1 A;  3E9K A;  1B9I A;  1ORD A;  3F0H A;  3G7Q A;  5FT5 A;  3RCH B;  1GDE A;  1BS0 A;  1ELQ A;  4AZK A;  3R4T A;  4BA4 A;  1AIB A;  3K7Y A;  2A1V A;  4OBU A;  3W1J A;  1IUG A;  2YRI A;  3FCR A;  2CFB A;  4LW4 A;  3FD0 A;  3MKJ A;  3AEN A;  1GC0 A;  5G09 A;  3WCO A;  4N0W A;  1YJY A;  2D66 A;  3I16 A;  4RIZ A;  2D5Y A;  4M2M A;  1AY8 A;  2BHX A;  2BI5 A;  2RFV A;  2C0R A;  3HLM A;  3RUY A;  3WY7 A;  3A2B A;  5M4D A;  3PDX A;  1BJO A;  3NX3 A;  3TQX A;  2QSR A;  2HOZ A;  1V2E A;  4PVF A;  1M0N A;  2AY8 A;  1ELU A;  1ZOB A;  2BI2 A;  2BYL A;  2BWO A;  3BC8 A;  1AHX A;  3E2F A;  3ZRP A;  1AJR A;  4XAU A;  4OBV A;  3UAK A;  2WB6 A;  1AIA A;  2QA3 A;  3AOV A;  1MLY A;  1AKB A;  5TF5 A;  3FVU A;  1ASE A;  3F6T A;  4J5U A;  5IWQ A;  3BWN C;  3FZ8 A;  4ADB A;  3AEP A;  7AAT A;  2VMN A;  3FZ6 A;  1O69 A;  1GCK A;  4GE7 A;  4A6T A;  3BB8 A;  3MAU A;  4NOG A;  3RCH A;  4LC3 A;  1GBN A;  1V2F A;  1BQD A;  2BWP A;  1M4N A;  3H9X A;  1W7L A;  2W7E A;  2E7J A;  4OMA A;  3N4X A;  1ASC A;  1LS3 A;  4PFN A;  2CJH A;  4RKD A;  4JEX A;  5E4Z A;  4XJM A;  4Q75 A;  3A9X A;  2CJG A;  3BWO A;  2WK8 A;  3OP7 A;  2VIA A;  2FKI A;  3MAF A;  3VK2 A;  2CB1 A;  2R0T A;  2HP2 A;  3A9Z A;  4XJL A;  1C7N A;  4K2M A;  2VLH A;  3EI8 A;  3NU8 A;  2AEU A;  3GJU A;  2VMX A;  1SZK A;  3GR9 A;  3TAT A;  3FFH A;  4F5J A;  4OTL A;  3MAD A;  2E54 A;  2EPJ A;  2BIA A;  2HOY A;  4L0O A;  2AY7 A;  1ASM A;  1TAS A;  2WK9 A;  1WKH A;  3EI5 A;  2E7I A;  3CQ4 A;  1CQ8 A;  3KGX A;  4Q31 A;  1EG5 A;  2QMA A;  1ASF A;  2Z1Z A;  2JG2 A;  3KE3 A;  4WXG A;  1AIC A;  2DGK A;  1QIT A;  2JJH A;  3PPL A;  3TCM A;  3N4R A;  2EH6 A;  2AY3 A;  4IY7 A;  3B1C A;  1G7W A;  2HP1 A;  4W1W A;  2JJF A;  4RLG A;  3RQ1 A;  2CST A;  1B5P A;  3WKR A;  4IXS A;  4ZM4 A;  3B8X A;  1BJ4 A;  1VJO A;  2GMU A;  1YJZ A;  3AOW A;  3HT4 A;  3I5T A;  3N5M A;  4UHO A;  4M2K A;  2HUU A;  1LC8 A;  2BYJ A;  3MBB A;  3GET A;  4EB5 A;  1QIR A;  1AHG A;  4CBS A;  3WX9 A;  2C44 A;  2JGT A;  3JTX A;  3AEL A;  3QM2 A;  3MEB A;  3BWN A;  1WYT B;  1QJ5 A;  4Q76 A;  1BJN A;  2OAT A;  3ACZ A;  4XK1 A;  4XJO A;  1ECX A;  3AEM A;  3AEJ A;  3NDN A;  1Z3Z A;  2W7H A;  3VK4 A;  1H0C A;  5G4J A;  1M0O A;  3QGU A;  4LW2 A;  1ARS A;  4ITG A;  4QGR A;  2VMV A;  3CQ5 A;  4CBR A;  2C7T A;  2VIB A;  1ZC9 A;  2JJE A;  1LC7 A;  2GB3 A;  4MKK A;  4ZSW A;  1H1C A;  2BI1 A;  2Z1Y A;  1TAR A;  1BW0 A;  3ISL A;  4N0B A;  4P3M A;  4RM1 A;  1BJO B;  2OKJ A;  1N31 A;  4U2H A;  4BQ0 A;  5M49 A;  4AZJ A;  2BI9 A;  8AAT A;  4XEW A;  4AH3 A;  3QN6 A;  4IYO B;  4BHD A;  2W7M A;  3GZD C;  3VP6 A;  3B46 A;  5BJ4 A;  4ZDL A;  1CQ6 A;  5J8Q A;  1ASL A;  3K40 A;  1OXO A;  2W7K A;  5HHY A;  2D65 A;  4F5L A;  4Y0D A;  1SZU A;  2EZ2 A;  1V72 A;  3FFR A;  2OGA A;  1BKG A;  2QLR A;  3DRD A;  4IX8 A;  1TOG A;  1WYU B;  1G7X A;  3E77 A;  5HDM A;  2VYC A;  3JWB A;  3N7N A;  3N75 A;  1D7S A;  2VMY A;  2W7G A;  4IXO A;  3EI7 A;  3A9Y A;  1FC4 A;  1IVR A;  2DKB A;  2PB2 A;  1IAX A;  3PD6 B;  5LH9 A;  5EQC A;  4ZDO A;  3VK3 A;  1B5O A;  3MC6 A;  3KKI A;  4O6Z A;  1M7Y A;  4RKC A;  1G4V A;  1IX6 A;  3A8U X;  4KAM A;  2YKU A;  4RIT A;  5D5S A;  1OHY A;  3AEO A;  1XEY A;  1FG3 A;  2VMU A;  2HUF A;  1W7N A;  3JU7 A;  3P6K A;  5KTB A;  2VGV A;  1QZ9 A;  4R2N A;  4TMR A;  1JS3 A;  4FL0 A;  1QIS A;  1YIY A;  3N0L A;  2X5D A;  2YKV A;  1SZS A;  5G0A A;  5BJ3 A;  3DR4 A;  4JF1 A;  4W1X A;  2CH1 A;  2ZP7 A;  1KKP A;  4EFF A;  4BMK A;  2VGS A;  4UHM A;  1UKJ A;  2HZP A;  2R2N A;  2ZSL A;  3BN1 A;  4A0H A;  3PJ0 A;  3QI6 A;  3H14 A;  1WYU A;  1C4K A;  4F5K A;  4A72 A;  2Z9U A;  1OHW A;  3P1T A;  3AAT A;  3BCX A;  4GE4 A;  1I41 A;  1FG7 A;  3EUC A;  1I29 A;  3KGW A;  1YIZ A;  2VLF A;  3LG0 A;  4GE9 A;  1MLZ A;  2O7C A;  3NYS A;  1LKC A;  3BS8 A;  3GBX A;  3PA9 A;  3NTJ A;  1CQ7 A;  3HL2 A;  2BKW A;  2VMW A;  1MDZ A;  1QGN A;  3QHX A;  4P7Y A;  3JWA A;  1W7M A;  1AMR A;  3LV2 A;  1J32 A;  4RAE A;  4ZLV A;  2E7U A;  3NYT A;  4LNJ A;  1TOJ A;  3EIB A;  3ELP A;  2YRR A;  5EIG A;  4EB7 A;  3M5U A;  1ASN A;  4MGR A;  5EUD A;  3ZZJ A;  4WYD A;  1KMJ A;  3DZZ A;  5K8B A;  1CS1 A;  3HDO A;  5I92 A;  3ATH A;  1GC4 A;  1WYT A;  4WD2 A;  1JF9 A;  4A6U A;  3AEN B;  3NUB A;  5EUE A;  1S06 A;  1DJU A;  3HMU A;  1ARH A;  1GC3 A;  3DR7 A;  2CH2 A;  1LW4 A;  3GWP A;  5FT8 A;  3EIA A;  3IHJ A;  4JEZ A;  2HOX A;  2OKK A;  4MQP A;  1GD9 A;  2FNU A;  2Z20 A;  3EI6 A;  3F9T A;  1IX8 A;  3H7F A;  3BV0 A;  4E3Q A;  1J04 A;  2VGU A;  3ASB A;  3PDB A;  1E5F A;  1I48 A;  4W91 A;  2YCP A;  1PFF A;  4JEV A;  2QBT A;  5EAV A;  1X29 A;  4EU1 A;  4A0R A;  1KL1 A;  1S07 A;  2WK7 A;  1AHF A;  5DJ1 A;  2XH1 A;  1DGE A;  2D63 A;  3FRK A;  2ZC0 A;  1GEW A;  1ARI A;  1N2T A;  3ASA A;  1AY4 A;  1B8G A;  1IAY A;  2GSA A;  3GZC A;  2VMS A;  1M32 A;  2YCN A;  4K2I A;  5G4I A;  4CXR A;  4K05 A;  4IW7 A;  5AX8 A;  3UWC A;  1AMS A;  1BT4 A;  4IXZ A;  3IF2 A;  2JIS A;  4MSO A;  2R5C B;  4WB0 B;  1EQB A;  3T32 A;  4B9B A;  1DJ9 A;  2ZSM A;  4WXF A;  3WKS A;  1ZOD A;  4WB0 A;  1AY5 A;  3PIU A;  1ASG A;  2R5C A;  2V1P A;  1C7G A;  3B1E A;  1UU0 A;  4ISY A;  4I8A A;  2W8T A;  4DBC A;  2DGL A;  1AX4 A;  3ELE A;  4Y0H A;  1DTY A;  2AEV A;  5E5I A;  2W8W A;  5G2P A;  3MAF B;  4MQR A;  1W23 A;  4OC9 A;  1CL2 A;  1QJ3 A;  1MDX A;  2C81 A;  2WKA A;  4MKJ A;  3HBX A;  1YOO A;  1VEF A;  9AAT A;  4F5M A;  3QBO A;  1AKC A;  3EZS A;  2PB0 A;  5F9S A;  3LVM A;  1AJS B;  4GRX A;  1GEX A;  2Z9X A;  3E2Z B;  1BQA A;  4FFC A;  4PFF A;  4EMY A;  4ZWV A;  3I4J A;  2BI3 A;  4HF8 A;  5DJ9 A;  2TPL A;  2VI8 A;  5JAY A;  2YCT A;  1B4X A;  3LY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...