1AMQA

X-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from escherichia coli in three forms
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from Escherichia coli in three forms.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 129
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1amqA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1amqA01
1SZSA 3IHJA 1YNUA 4OT8A 1MLZA 5J8QA 3BCAA 2W7IA 1ARTA 4IXSA 3QN6A 3WCOA 1KKJA 4ATQA 5DJ9A 4ADEA 1C4KA 1TOKA 3USFA 1KKPA 2Z1YA 1PFFA 2Z9VA 3FRKA 3WY7A 2C81A 4J8LA 3FDBA 2D63A 2EO5A 4R2NA 5D95A 1ASFA 2QB3A 2VYCA 5BJ3A 2OGEA 2Z9WA 2O7CA 1BQAA 1CQ6A 2W7FA 4K2IA 5DX5A 4ZWMA 4LC3A 3WCNA 3EIBA 5M46A 2YCTA 2FNUA 1ASGA 4TMRA 4WB0B 4ZASA 5C6UA 4JF1A 3KKIA 4A6UA 1ASEA 4AZJA 2O1BA 1AY5A 2BHXA 1YJZA 3L8AA 1DGDA 4GEBA 2X3LA 1DKAA 2E7IA 5HHYA 4ADDA 1IUGA 1CJ0A 1O62A 4LW4A 3BWOA 2W8TA 3JTXA 3TCMA 1W7LA 2F8JA 2D5YA 1AICA 4KAMA 2DOUA 2Z67A 3T32A 3I5TA 2W8WA 2W7MA 1TARA 1DFOA 1XEYA 1BJWA 3QBOA 1BJNA 1T3IA 1GC0A 2VMSA 3JU7A 3JWAA 3ZZJA 1KL1A 1B4XA 3KE3A 3N0LA 2QA3A 4L0OA 4WD2A 3G8MA 4O6ZA 2HOXA 2VMRA 4WXFA 2FM1A 2GMUA 4TV7A 1ARIA 4Q6RA 2OKJA 3HMUA 4AO4A 2GSAA 4ZM3A 1GDEA 3EI7A 2WKAA 1M0NA 1MDXA 3DR7A 1O69A 4E3RA 4FFCA 1W7NA 2E7UA 1B8GA 2OGAA 4MGRA 1TOJA 2AY4A 1AJSA 1M4NA 1QZ9A 2DGMA 4MQQA 2JJFA 4ITXA 3HT4A 5EQCA 5D5SA 2AY2A 2VMVA 4ZM4A 4XK1A 2ZC0A 3QI6A 3ELPA 1WSTA 3AATA 2VMTA 3E2ZA 4M2JA 2ZY4A 1B5PA 1TATA 1TASA 4WYAA 3PD6A 3RUYA 1ELUA 4GSAA 2Z9UA 3ASAA 4IXZA 2V1PA 2VMWA 4WYEA 1QITA 3CAIA 4ATPA 2HOZA 1G4XA 1X28A 4WBTA 5JAYA 2CJDA 3DRDA 2BWNA 1I43A 2YHKA 4A6TA 5DB5A 3EI9A 3NTJA 1YAAA 4RM1A 1QIRA 1SZUA 2VI9A 3AEMC 4F5FA 1WYVA 3VK3A 1D7RA 1MDZA 2W7GA 3UE8A 1SFFA 3WLXA 3B1EA 3ECDA 3FFHA 4IW7A 2ZJGA 3FVUA 1YJSA 2BYLA 4LNLA 3PAAA 3II0A 4H51A 1UU2A 2HUFA 3DC1A 4HVKA 1AHFA 2Q7WA 4A0FA 1S0AA 3N5MA 4JEWA 2C7TA 3TFTA 1EG5A 1Y4IA 2HP1A 3A2BA 4B9BA 3N75A 4OTLA 4MKKA 4W1WA 2QLRA 2W7DA 4N0WA 1V2DA 3AEPA 2OQXA 2ZSLA 4XJLA 3VK2A 1UU1A 3GZDA 3F0HA 3E6GA 3ASBA 4K2BA 1LK9A 1OXPA 1YOOA 2D64A 2ZUKA 3DZZA 3MAFA 1WKHA 4E3QA 4W5KA 1AHYA 1JS6A 1W3UA 1FC4A 4W1VA 4XJPA 3B1DA 1BJOA 1PMOA 1M32A 2BIEA 3AOWA 4MSOA 3NU7A 1FG3A 1X0MA 1OHWA 1DTYA 2R5CA 3GETA 3QHXA 2YCNA 4U2HA 2YKYA 4JE5A 2ZY2A 1FG7A 1EJIA 2OATA 3IF2A 3R9AA 3ZRQA 2BWPA 1N8PA 2VLHA 4UHOA 1ASAA 3ATHA 2HORA 4PVFA 1M0PA 2QB2A 7AATA 1C9CA 3MKJA 1LW5A 1MLYA 4PIWA 4IXOA 4CBSA 2W7KA 3P1TA 3COGA 2VMYA 4F5KA 2V0YA 4OBUA 1ARGA 5EFSA 4F5GA 1XI9A 3DYDA 1AY8A 3QPGA 1MAQA 4XAUA 3BCXA 3P6KA 2WK7A 4WB0A 1VP4A 5FT8A 2D7ZA 2ZYJA 1BT4A 2GQNA 3NUIA 3E77A 2JJEA 4JEYA 4UHMA 4W1XA 3TFUA 3JZLA 4Q75A 2DGKA 2R2NA 3OP7A 4P3MA 4DGTA 5M49A 1CZCA 3VAXA 3H7FA 3PDBA 1DJ9A 2EZ2A 4K2MA 3L44A 1LS3A 4R5FA 3ZRPA 1WYTA 1O4SA 3DR4A 1ASNA 4NOGA 1V2FA 3B46A 2XBNA 3NRAA 4FL0A 4OBVA 2O0RA 4ISYA 3AELA 1AHXA 1M0QA 1TOGA 1GC2A 4LNMA 1VJOA 2Z9XA 3LVMA 1ARSA 1AIAA 1GD9A 4WYCA 2CH2A 3FVXA 9AATA 1AHGA 1IX8A 4XEWA 3EI5A 2C44A 2AY8A 5E5IA 3PDXA 5G2QA 3LVLB 2CTZA 4TN4A 4XJOA 5G2PA 3PPLA 2VGWA 1GC4A 1BW0A 3KGXA 1E5EA 1B9HA 3NDNA 4IYOB 4BMKA 3WKSA 3PA9A 3Q8NA 3NYSA 4F5IA 5LH9A 2BI1A 1IX7A 3DXWA 2W7HA 3WGBA 1JG8A 2D61A 2E7JA 3FSLA 2ZY5A 3AEOA 3GBXA 1GC3A 4LNJA 4RAEA 1N2TA 1I41A 2VIBA 1ECXA 2VI8A 2AATA 2JG2A 3E9KA 1M6SA 2CSTA 3UWCA 2W7LA 4OCAA 4LW2A 4GE4A 1DJEA 2ORDA 4IX8A 4RLGA 2AY1A 2Z61A 3EZ1A 2VGSA 3HDOA 1DGEA 1S09A 2DGLA 3I16A 3DXVA 1JS3A 2JJHA 1TOEA 2EH6A 2VGTA 3AEJA 1YJYA 4JEXA 4Y0HA 4A0RA 4DBCA 2BI3A 4GRXA 3NYTA 2VLFA 2PB0A 3D6KA 4J5UA 1AHEA 3FKDA 2EGYA 4EMYA 1MGVA 1YIZA 2BIAA 2CJGA 3ZRRA 4N0BA 5HXXA 3CQ5A 3BS8A 4HF8A 2C0RA 3F6TA 4A0HA 3MAUA 5FT5A 2YCPA 1AAWA 1YIYA 3FQ7A 3H14A 2AY9A 4WYDA 3FZ6A 4F5MA 3KGWA 3RBFA 2BI5A 1W7MA 1C7OA 1AX4A 2JJGA 2HUUA 2RFVA 5F8VA 4B98A 1ASBA 3R4TA 4ADCA 1LKCA 1P3WA 5HDMA 5IWQA 3HBXA 2CJHA 4PFFA 1GEWA 1RV3A 5EIGB 1C0NA 5FT4A 2W8VA 1X2AA 3FFRA 4JF0A 5AX8A 1J04A 2HUIA 2DR1A 4EU1A 3TQXA 3NX3A 1MAPA 3RCHB 4Y0DA 1OATA 3G0TA 3EZSA 2VMPA 4W91A 4R5ZA 2X5FA 4OC9A 3FTBA 4I8AA 1LC8A 1QJ5A 3RQ1A 1I48A 3WX9A 4AH3A 4A6RA 2FYFA 3CQ4A 1BS0A 1J32A 3DODA 3LVKA 4A0GA 1BQDA 4ADBA 5G4JA 1WYUB 3I4JA 1B9IA 3EI6A 3BWNA 1IJIA 1WKGA 1OHVA 2YKXA 3AENB 1ZODA 4A72A 3HVYA 2DKBA 1AJRA 4IY7A 3AEJC 1KMJA 4KXKA 5BJ4A 4MQPA 1ARHA 4W8IA 3FQ8A 3OKSA 3LWSA 1GEXA 1IBJA 1PG8A 1BJ4A 3RI6A 1SF2A 4ZLVA 1G7XA 3PIUA 4BQ0A 3WGCA 3W1JA 3GSBA 3K7YA 1V2EA 3WZFA 1B5OA 4CXQA 3K40A 1V72A 1RV4A 1C7GA 2FQ6A 4RITA 4CXRA 1CZEA 1SZKA 3JW9A 4QGRA 4WLJA 4BA5A 1EQBA 1QISA 4AZKA 2FN6A 4M2MA 3ELEA 1CL1A 5EUEA 1RVUA 3AOVA 4GE9A 4XQ2A 1SPAA 3QM2A 1C7NA 3QGUA 4M2KA 1LC7A 2HOYA 2R5CB 4BA4A 5G09A 1LC5A 4R8DA 3GZDC 1CQ7A 5TF5A 4F5HA 1D7SA 2Z1ZA 2G6WA 3FQAA 1ASDA 1AMAA 2GB3A 1AMRA 1TPLA 4JEZA 1AIBA 2ZP7A 5EAVA 1AKBA 4Q76A 4CBRA 1PMMA 3W1HA 2X5DA 4F5JA 4BHDA 1I29A 3B1CA 3CBFA 4MY5A 2W8UA 5E4ZA 1D7VA 3NU8A 4A00A 1SVVA 3BWNC 1VEFA 2X8UA 2AY5A 3CQ6A 2BKWA 2R5EA 3FDDA 2YKUA 4KYOA 4IYOA 4OYTA 4CVQA 4EB7A 1UU0A 1W23A 2D66A 1BKGA 1ASCA 4E1OA 1Z7DA 2Z20A 3BV0A 2CY8A 4UHNA 3HQTA 2EPJA 4UQVA 3PDBB 3FVSA 5I92A 3A9ZA 4WXBA 8AATA 1WYTB 2VMOA 3AEMA 3LVJA 3DU4A 1U08A 4ZDLA 4ZSYA 3VOMA 1ELQA 1IAYA 4EB5A 1S06A 3EUCA 2JGTA 4PFNA 3UAKA 4DQ6A 4ZDOA 2VMZA 2YRRA 3E2FA 2VMNA 1ORDA 4WP0A 1QGNA 3MEBA 1AMSA 5M4BA 4JEVA 4WYGA 3LY1A 4P7YA 4RKCA 5G0AA 2AEVA 3VK4A 5LHAA 4ZDPA 1G4VA 3NYUA 2YRIA 2XH1A 2QMAA 1AMQA 5EUDA 5EAAA 2HZPA 4AO9A 1ASMA 1IVRA 5E3KA 3BCBA 4ZAHA 3ISLA 1UKJA 2VMQA 2YKVA 1X29A 3MBBA 2EZ1A 4EFFA 1AJSB 1ZC9A 2BYJA 3FZ8A 4AOAA 2AY3A 2CB1A 1AY4A 4RJ0A 5G4IA 2OKKA 5EIGA 3LG0A 1OHYA 2CH1A 3A8UX 1AKCA 1S07A 3E2ZB 2AY6A 4OMAA 2W8JA 4UOYA 5DJ1A 2VGVA 3HL2A 4ZWVA 3PD6B 2VMUA 4Q31A 4RIZA 3RCHA 4WXGA 5EUNA 3MC6A 3PJ0A 3BN1A 1KMKA 3GJUA 3BB8A 3HLMA 3A9YA 1KL2A 3MADA 2PO3A 4F5LA 2WK8A 2JISA 2GMSA 3B8XA 3NNKA 2R0TA 1RVYA 4ZSWA 1MDOA 1AKAA 1QJ3A 4GDYA 2D65A 3WKRA 3M5UA 1M0OA 1S08A 2E54A 3JWBA 1WYVB 4U1TA 1WYUA 3ZZKA 1O61A 3PGYA 1Z3ZA 4E77A 2AEUA 4Y0IA 3AENA 1IX6A 3FZ7A 4GE7A 2BWOA 2ZSMA 3W1IA 3ACZA 3BC8A 2CINA 3G7QA 2D7YA 2TPLA 3FD0A 3RBLA 2VMXA 2AY7A 2FNIA 3F9TA 1H1CA 4WLHA 2QBTA 3TATA 2NMPA 3EI8A 4WYFA 4ITGA 1IAXA 2VIAA 1M7YA 1OXOA 4XJMA 5K8BA 1ZOBA 1G7WA 3VP6A 2BI9A 1GCKA 1CQ8A 1AAMA 1JF9A 2VGZA 2DKJA 3FCRA 2VGUA 2PB2A 1CS1A 1GBNA 1GEYA 3GZCA 1H0CA 3A9XA 2CFBA 4RJYA 1ASLA 3EIAA 3GR9A 4MQRA 1N31A 1E5FA 1D7UA 2BI2A 3E2YA 3MAFB 4F4EA 2BIGA 3NUBA 2W7JA 5FT6A 5M4DA 1TOIA 3GWPA 3LV2A 1D2FA 1LW4A 2CANA 1BJOB 1CL2A 4MKJA 2W7EA 3K28A 5F9SA 2ZY3A 3MC6C 2YOBA 2HP2A 1DJUA 3AV7A 4RKDA 4JE5D 2WK9A
chains in the Genus database with same CATH superfamily
1SZSA 3IHJA 1YNUA 4OT8A 1MLZA 5J8QA 3BCAA 2W7IA 1ARTA 4IXSA 3QN6A 3WCOA 1KKJA 4ATQA 5DJ9A 4ADEA 1C4KA 1TOKA 3USFA 1KKPA 2Z1YA 1PFFA 2Z9VA 3FRKA 3WY7A 2C81A 4J8LA 3FDBA 2D63A 2EO5A 4R2NA 5D95A 1ASFA 2QB3A 2VYCA 5BJ3A 2OGEA 2Z9WA 2O7CA 1BQAA 1CQ6A 2W7FA 4K2IA 5DX5A 4ZWMA 4LC3A 3WCNA 3EIBA 5M46A 2YCTA 2FNUA 1ASGA 4TMRA 4WB0B 4ZASA 5C6UA 4JF1A 3KKIA 4A6UA 1ASEA 4AZJA 2O1BA 1AY5A 2BHXA 1YJZA 3L8AA 1DGDA 4GEBA 2X3LA 1DKAA 2E7IA 5HHYA 4ADDA 1IUGA 1CJ0A 1O62A 4LW4A 3BWOA 2W8TA 3JTXA 3TCMA 1W7LA 2F8JA 2D5YA 1AICA 4KAMA 2DOUA 2Z67A 3T32A 3I5TA 2W8WA 2W7MA 1TARA 1DFOA 1XEYA 1BJWA 3QBOA 1BJNA 1T3IA 1GC0A 2VMSA 3JU7A 3JWAA 3ZZJA 1KL1A 1B4XA 3KE3A 3N0LA 2QA3A 4L0OA 4WD2A 3G8MA 4O6ZA 2HOXA 2VMRA 4WXFA 2FM1A 2GMUA 4TV7A 1ARIA 4Q6RA 2OKJA 3HMUA 4AO4A 2GSAA 4ZM3A 1GDEA 3EI7A 2WKAA 2FKIA 1M0NA 1MDXA 3DR7A 1O69A 4E3RA 4FFCA 1W7NA 2E7UA 1B8GA 2OGAA 4MGRA 1TOJA 2AY4A 1AJSA 1M4NA 1QZ9A 2DGMA 4MQQA 2JJFA 4ITXA 3HT4A 5EQCA 5D5SA 2AY2A 2VMVA 4ZM4A 4XK1A 2ZC0A 3QI6A 3ELPA 1WSTA 3AATA 2VMTA 3E2ZA 4M2JA 2ZY4A 1B5PA 1TATA 1TASA 4WYAA 3N4XA 3PD6A 3RUYA 1ELUA 4GSAA 2Z9UA 3ASAA 4IXZA 2V1PA 2VMWA 4WYEA 1QITA 3CAIA 4ATPA 2HOZA 1G4XA 1X28A 4WBTA 5JAYA 2CJDA 3DRDA 2BWNA 2QSRA 1I43A 2YHKA 4A6TA 5DB5A 3EI9A 3NTJA 1YAAA 4RM1A 1QIRA 1SZUA 2VI9A 3AEMC 4F5FA 1WYVA 3VK3A 1D7RA 1MDZA 2W7GA 3UE8A 1SFFA 3WLXA 3B1EA 3ECDA 3FFHA 4IW7A 2ZJGA 3FVUA 1YJSA 2BYLA 4LNLA 3PAAA 3II0A 4H51A 1UU2A 2HUFA 3DC1A 4HVKA 1AHFA 2Q7WA 4A0FA 1S0AA 3N5MA 4JEWA 2C7TA 3TFTA 1EG5A 1Y4IA 2HP1A 3A2BA 4B9BA 3N75A 4OTLA 4MKKA 4W1WA 2QLRA 2W7DA 4N0WA 1V2DA 3H9XA 3AEPA 2OQXA 2ZSLA 4XJLA 3VK2A 1UU1A 3GZDA 3F0HA 3E6GA 3ASBA 4K2BA 1LK9A 1OXPA 1YOOA 2D64A 2ZUKA 3DZZA 3MAFA 1WKHA 4E3QA 4W5KA 1AHYA 1JS6A 1W3UA 1FC4A 4W1VA 4XJPA 3B1DA 1BJOA 1PMOA 1M32A 2BIEA 3AOWA 4MSOA 3NU7A 1FG3A 1X0MA 1OHWA 1DTYA 2R5CA 3GETA 3QHXA 2YCNA 4U2HA 2YKYA 4JE5A 2ZY2A 1FG7A 1EJIA 2OATA 3IF2A 3R9AA 3ZRQA 2BWPA 1N8PA 2VLHA 4UHOA 1ASAA 3ATHA 2HORA 4PVFA 1M0PA 2QB2A 7AATA 1C9CA 3MKJA 1LW5A 1MLYA 4PIWA 4IXOA 4CBSA 2W7KA 3P1TA 3COGA 2VMYA 4F5KA 2V0YA 4OBUA 1ARGA 5EFSA 4F5GA 1XI9A 3DYDA 1AY8A 3QPGA 1MAQA 4XAUA 3BCXA 3P6KA 2WK7A 4WB0A 1VP4A 5FT8A 2D7ZA 2ZYJA 1BT4A 2GQNA 3NUIA 3E77A 2JJEA 4JEYA 4UHMA 4W1XA 3TFUA 3JZLA 4Q75A 2DGKA 2R2NA 3OP7A 4P3MA 4DGTA 5M49A 1CZCA 3VAXA 3H7FA 3PDBA 1DJ9A 2EZ2A 4K2MA 3L44A 1LS3A 4R5FA 3N4RA 3ZRPA 1WYTA 1O4SA 3DR4A 1ASNA 4NOGA 1V2FA 3B46A 2XBNA 3NRAA 4FL0A 4OBVA 2O0RA 4ISYA 3AELA 1AHXA 1M0QA 1TOGA 1GC2A 4LNMA 1VJOA 2Z9XA 3LVMA 1ARSA 1AIAA 1GD9A 4WYCA 2CH2A 3FVXA 9AATA 1AHGA 1IX8A 4XEWA 3EI5A 2C44A 2AY8A 5E5IA 3PDXA 5G2QA 3LVLB 2CTZA 4TN4A 4XJOA 5G2PA 3PPLA 2VGWA 1GC4A 1BW0A 3KGXA 1E5EA 1B9HA 3NDNA 4IYOB 4BMKA 3WKSA 3PA9A 3Q8NA 3NYSA 4F5IA 5LH9A 2BI1A 1IX7A 3DXWA 2W7HA 3WGBA 1JG8A 3N4SA 2D61A 2E7JA 3FSLA 2ZY5A 3AEOA 3GBXA 1GC3A 4LNJA 4RAEA 1N2TA 1I41A 2VIBA 1ECXA 2VI8A 2AATA 2JG2A 3E9KA 1M6SA 2CSTA 3UWCA 2A1VA 2W7LA 4OCAA 4LW2A 4GE4A 1DJEA 2ORDA 4IX8A 4RLGA 2AY1A 5KTBA 2Z61A 3EZ1A 2VGSA 3HDOA 1DGEA 1S09A 2DGLA 3I16A 3DXVA 1JS3A 2JJHA 1TOEA 2EH6A 2VGTA 3AEJA 1YJYA 4JEXA 4Y0HA 4A0RA 4DBCA 2BI3A 4GRXA 3NYTA 2VLFA 2PB0A 3D6KA 4J5UA 1AHEA 3FKDA 2EGYA 4EMYA 1MGVA 1YIZA 2BIAA 2CJGA 3ZRRA 4N0BA 5HXXA 3CQ5A 3BS8A 4HF8A 2C0RA 3F6TA 4A0HA 3MAUA 5FT5A 2YCPA 1AAWA 1YIYA 3FQ7A 3H14A 2AY9A 4WYDA 3FZ6A 4F5MA 3KGWA 3RBFA 2BI5A 1W7MA 1C7OA 1AX4A 2JJGA 2HUUA 2RFVA 5F8VA 4B98A 1ASBA 3R4TA 4ADCA 1LKCA 1P3WA 5HDMA 5IWQA 3HBXA 2CJHA 4PFFA 1GEWA 1RV3A 5EIGB 1C0NA 5FT4A 2W8VA 1X2AA 3FFRA 4JF0A 5AX8A 1J04A 2HUIA 2DR1A 4EU1A 3TQXA 3NX3A 1MAPA 3RCHB 4Y0DA 1OATA 3G0TA 3EZSA 2VMPA 4W91A 4R5ZA 2X5FA 4OC9A 3FTBA 4I8AA 1LC8A 1QJ5A 3RQ1A 1I48A 3WX9A 4AH3A 4A6RA 2FYFA 3CQ4A 1BS0A 1J32A 3DODA 3LVKA 4A0GA 1BQDA 4ADBA 5G4JA 1WYUB 3I4JA 1B9IA 2EYQA 3EI6A 3BWNA 1IJIA 1WKGA 1OHVA 2YKXA 3AENB 1ZODA 4A72A 3HVYA 2DKBA 1AJRA 4IY7A 3AEJC 1KMJA 4KXKA 5BJ4A 4MQPA 1ARHA 4W8IA 3FQ8A 3OKSA 3LWSA 1GEXA 2WB6A 1IBJA 1PG8A 1BJ4A 3RI6A 1SF2A 4ZLVA 1G7XA 3PIUA 4BQ0A 3WGCA 3W1JA 3GSBA 3K7YA 1V2EA 2G7JA 3WZFA 1B5OA 4CXQA 3K40A 1V72A 1RV4A 1C7GA 2FQ6A 4RITA 4CXRA 1CZEA 1SZKA 3JW9A 4QGRA 4WLJA 4BA5A 1EQBA 1QISA 4AZKA 2FN6A 4M2MA 3ELEA 1CL1A 5EUEA 1RVUA 3AOVA 4GE9A 4XQ2A 1SPAA 3QM2A 1C7NA 3QGUA 4M2KA 1LC7A 2HOYA 2R5CB 4BA4A 5G09A 1LC5A 4R8DA 3GZDC 1CQ7A 5TF5A 4F5HA 1D7SA 2Z1ZA 2G6WA 3FQAA 1ASDA 1AMAA 2GB3A 1AMRA 1TPLA 4JEZA 1AIBA 2ZP7A 5EAVA 1AKBA 4Q76A 4CBRA 1PMMA 3W1HA 2X5DA 4F5JA 4BHDA 1I29A 3B1CA 3CBFA 4MY5A 2W8UA 5E4ZA 1D7VA 3NU8A 4A00A 1SVVA 3BWNC 1VEFA 2X8UA 2AY5A 3CQ6A 2BKWA 2R5EA 3FDDA 2YKUA 4KYOA 4IYOA 1KAFA 4OYTA 4CVQA 4EB7A 1UU0A 1W23A 2D66A 1BKGA 1ASCA 4E1OA 1Z7DA 2Z20A 3BV0A 2CY8A 4UHNA 3HQTA 2EPJA 4UQVA 3PDBB 3FVSA 5I92A 3A9ZA 4WXBA 8AATA 1WYTB 2VMOA 3AEMA 3LVJA 3DU4A 1U08A 4ZDLA 4ZSYA 3VOMA 1ELQA 1IAYA 4EB5A 1S06A 3EUCA 2JGTA 4PFNA 3UAKA 4DQ6A 4ZDOA 2VMZA 2YRRA 3E2FA 2VMNA 1ORDA 4WP0A 1QGNA 3MEBA 1AMSA 5M4BA 4JEVA 4WYGA 3LY1A 4P7YA 4RKCA 5G0AA 2AEVA 3VK4A 5LHAA 4ZDPA 1G4VA 3NYUA 2YRIA 2XH1A 2QMAA 1AMQA 5EUDA 5EAAA 2HZPA 4AO9A 1ASMA 1IVRA 5E3KA 3BCBA 4ZAHA 3ISLA 1UKJA 2VMQA 2YKVA 1X29A 3MBBA 2EZ1A 4EFFA 1AJSB 1ZC9A 2BYJA 3FZ8A 4AOAA 2AY3A 2CB1A 1AY4A 4RJ0A 5G4IA 2OKKA 5EIGA 3LG0A 1OHYA 2CH1A 3A8UX 1AKCA 1S07A 3E2ZB 2AY6A 4OMAA 2W8JA 4UOYA 5DJ1A 2VGVA 3HL2A 4ZWVA 3PD6B 2VMUA 4Q31A 4RIZA 3RCHA 4WXGA 5EUNA 3MC6A 3PJ0A 3BN1A 1KMKA 3GJUA 3BB8A 3HLMA 3A9YA 1KL2A 3MADA 2PO3A 4F5LA 2WK8A 2JISA 2GMSA 3B8XA 3NNKA 2R0TA 1RVYA 4ZSWA 1MDOA 1AKAA 1QJ3A 4GDYA 2D65A 3WKRA 3M5UA 1M0OA 1S08A 2E54A 3JWBA 1WYVB 4U1TA 1WYUA 3ZZKA 1O61A 3PGYA 1Z3ZA 4E77A 2AEUA 4Y0IA 3AENA 1IX6A 3FZ7A 4GE7A 2BWOA 2ZSMA 3W1IA 3ACZA 3BC8A 3N7NA 2CINA 3G7QA 2D7YA 2TPLA 3FD0A 3RBLA 2VMXA 2AY7A 2FNIA 3F9TA 1H1CA 4WLHA 2QBTA 3TATA 2NMPA 3EI8A 4WYFA 4ITGA 1IAXA 2VIAA 1M7YA 1OXOA 4XJMA 5K8BA 1ZOBA 1G7WA 3VP6A 2BI9A 1GCKA 1CQ8A 2KFPA 4K05A 1AAMA 1JF9A 2VGZA 2DKJA 3FCRA 2VGUA 2PB2A 1CS1A 1GBNA 1GEYA 3GZCA 1H0CA 3A9XA 2CFBA 4RJYA 1ASLA 3EIAA 3GR9A 4MQRA 1N31A 4H63Q 1E5FA 1D7UA 2BI2A 3E2YA 3MAFB 4F4EA 2BIGA 3NUBA 2W7JA 5FT6A 5M4DA 1TOIA 3GWPA 3LV2A 1D2FA 1LW4A 2CANA 1BJOB 1CL2A 4MKJA 2W7EA 3K28A 5F9SA 2ZY3A 3MC6C 2YOBA 2HP2A 1DJUA 3AV7A 4RKDA 4JE5D 2WK9A
chains in the Genus database with same CATH topology
1SZSA 3IHJA 1YNUA 4OT8A 1MLZA 5J8QA 3BCAA 2W7IA 1ARTA 4IXSA 3QN6A 3WCOA 1KKJA 4ATQA 5DJ9A 4ADEA 1C4KA 1TOKA 3USFA 1KKPA 2Z1YA 1PFFA 2Z9VA 3FRKA 3WY7A 2C81A 4J8LA 3FDBA 2D63A 2EO5A 4R2NA 5D95A 1ASFA 2QB3A 2VYCA 5BJ3A 2OGEA 2Z9WA 2O7CA 1BQAA 1CQ6A 2W7FA 4K2IA 5DX5A 4ZWMA 4LC3A 3WCNA 3EIBA 5M46A 2YCTA 2FNUA 1ASGA 4TMRA 4WB0B 4ZASA 5C6UA 4JF1A 3KKIA 4A6UA 1ASEA 4AZJA 2O1BA 1AY5A 2BHXA 1YJZA 3L8AA 1DGDA 4GEBA 2X3LA 1DKAA 2E7IA 5HHYA 4ADDA 1IUGA 1CJ0A 1O62A 4LW4A 3BWOA 2W8TA 3JTXA 3TCMA 1W7LA 2F8JA 2D5YA 1AICA 4KAMA 2DOUA 2Z67A 3T32A 3I5TA 2W8WA 2W7MA 1TARA 1DFOA 1XEYA 1BJWA 3QBOA 1BJNA 1T3IA 1GC0A 2VMSA 3JU7A 3JWAA 3ZZJA 1KL1A 1B4XA 3KE3A 3N0LA 2QA3A 4L0OA 4WD2A 3G8MA 4O6ZA 2HOXA 2VMRA 4WXFA 2FM1A 2GMUA 4TV7A 1ARIA 4Q6RA 2OKJA 3HMUA 4AO4A 2GSAA 4ZM3A 1GDEA 3EI7A 2WKAA 2FKIA 1M0NA 1MDXA 3DR7A 1O69A 4E3RA 4FFCA 1W7NA 2E7UA 1B8GA 2OGAA 4MGRA 1TOJA 2AY4A 1AJSA 1M4NA 1QZ9A 2DGMA 4MQQA 2JJFA 4ITXA 3HT4A 5EQCA 5D5SA 2AY2A 2VMVA 4ZM4A 4XK1A 2ZC0A 3QI6A 3ELPA 1WSTA 3AATA 2VMTA 3E2ZA 4M2JA 2ZY4A 1B5PA 1TATA 1TASA 4WYAA 3N4XA 3PD6A 3RUYA 1ELUA 4GSAA 2Z9UA 3ASAA 4IXZA 2V1PA 2VMWA 4WYEA 1QITA 3CAIA 4ATPA 2HOZA 1G4XA 1X28A 4WBTA 5JAYA 2CJDA 3DRDA 2BWNA 2QSRA 1I43A 2YHKA 4A6TA 5DB5A 3EI9A 3NTJA 1YAAA 4RM1A 1QIRA 1SZUA 2VI9A 3AEMC 4F5FA 1WYVA 3VK3A 1D7RA 1MDZA 2W7GA 3UE8A 1SFFA 3WLXA 3B1EA 3ECDA 3FFHA 4IW7A 2ZJGA 3FVUA 1YJSA 2BYLA 4LNLA 3PAAA 3II0A 4H51A 1UU2A 2HUFA 3DC1A 4HVKA 1AHFA 2Q7WA 4A0FA 1S0AA 3N5MA 4JEWA 2C7TA 3TFTA 1EG5A 1Y4IA 2HP1A 3A2BA 4B9BA 3N75A 4OTLA 4MKKA 4W1WA 2QLRA 2W7DA 4N0WA 1V2DA 3H9XA 3AEPA 2OQXA 2ZSLA 4XJLA 3VK2A 1UU1A 3GZDA 3F0HA 3E6GA 3ASBA 4K2BA 1LK9A 1OXPA 1YOOA 2D64A 2ZUKA 3DZZA 3MAFA 1WKHA 4E3QA 4W5KA 1AHYA 1JS6A 1W3UA 1FC4A 4W1VA 4XJPA 3B1DA 1BJOA 1PMOA 1M32A 2BIEA 3AOWA 4MSOA 3NU7A 1FG3A 1X0MA 1OHWA 1DTYA 2R5CA 3GETA 3QHXA 2YCNA 4U2HA 2YKYA 4JE5A 2ZY2A 1FG7A 1EJIA 2OATA 3IF2A 3R9AA 3ZRQA 2BWPA 1N8PA 2VLHA 4UHOA 1ASAA 3ATHA 2HORA 4PVFA 1M0PA 2QB2A 7AATA 1C9CA 3MKJA 1LW5A 1MLYA 4PIWA 4IXOA 4CBSA 2W7KA 3P1TA 3COGA 2VMYA 4F5KA 2V0YA 4OBUA 1ARGA 5EFSA 4F5GA 1XI9A 3DYDA 1AY8A 3QPGA 1MAQA 4XAUA 3BCXA 3P6KA 2WK7A 4WB0A 1VP4A 5FT8A 2D7ZA 2ZYJA 1BT4A 2GQNA 3NUIA 3E77A 2JJEA 4JEYA 4UHMA 4W1XA 3TFUA 3JZLA 4Q75A 2DGKA 2R2NA 3OP7A 4P3MA 4DGTA 5M49A 1CZCA 3VAXA 3H7FA 3PDBA 1DJ9A 2EZ2A 4K2MA 3L44A 1LS3A 4R5FA 3N4RA 3ZRPA 1WYTA 1O4SA 3DR4A 1ASNA 4NOGA 1V2FA 3B46A 2XBNA 3NRAA 4FL0A 4OBVA 2O0RA 4ISYA 3AELA 1AHXA 1M0QA 1TOGA 1GC2A 4LNMA 1VJOA 2Z9XA 3LVMA 1ARSA 1AIAA 1GD9A 4WYCA 2CH2A 3FVXA 9AATA 1AHGA 1IX8A 4XEWA 3EI5A 2C44A 2AY8A 5E5IA 3PDXA 5G2QA 3LVLB 2CTZA 4TN4A 4XJOA 5G2PA 3PPLA 2VGWA 1GC4A 1BW0A 3KGXA 1E5EA 1B9HA 3NDNA 4IYOB 4BMKA 3WKSA 3PA9A 3Q8NA 3NYSA 4F5IA 5LH9A 2BI1A 1IX7A 3DXWA 2W7HA 3WGBA 1JG8A 3N4SA 2D61A 2E7JA 3FSLA 2ZY5A 3AEOA 3GBXA 1GC3A 4LNJA 4RAEA 1N2TA 1I41A 2VIBA 1ECXA 2VI8A 2AATA 2JG2A 3E9KA 1M6SA 2CSTA 3UWCA 2A1VA 2W7LA 4OCAA 4LW2A 4GE4A 1DJEA 2ORDA 4IX8A 4RLGA 2AY1A 5KTBA 2Z61A 3EZ1A 2VGSA 3HDOA 1DGEA 1S09A 2DGLA 3I16A 3DXVA 1JS3A 2JJHA 1TOEA 2EH6A 2VGTA 3AEJA 1YJYA 4JEXA 4Y0HA 4A0RA 4DBCA 2BI3A 4GRXA 3NYTA 2VLFA 2PB0A 3D6KA 4J5UA 1AHEA 3FKDA 2EGYA 4EMYA 1MGVA 1YIZA 2BIAA 2CJGA 3ZRRA 4N0BA 5HXXA 3CQ5A 3BS8A 4HF8A 2C0RA 3F6TA 4A0HA 3MAUA 5FT5A 2YCPA 1AAWA 1YIYA 3FQ7A 3H14A 2AY9A 4WYDA 3FZ6A 4F5MA 3KGWA 3RBFA 2BI5A 1W7MA 1C7OA 1AX4A 2JJGA 2HUUA 2RFVA 5F8VA 4B98A 1ASBA 3R4TA 4ADCA 1LKCA 1P3WA 5HDMA 5IWQA 3HBXA 2CJHA 4PFFA 1GEWA 1RV3A 5EIGB 1C0NA 5FT4A 2W8VA 1X2AA 3FFRA 4JF0A 5AX8A 1J04A 2HUIA 2DR1A 4EU1A 3TQXA 3NX3A 1MAPA 3RCHB 4Y0DA 1OATA 3G0TA 3EZSA 2VMPA 4W91A 4R5ZA 2X5FA 4OC9A 3FTBA 4I8AA 1LC8A 1QJ5A 3RQ1A 1I48A 3WX9A 4AH3A 4A6RA 2FYFA 3CQ4A 1BS0A 1J32A 3DODA 3LVKA 4A0GA 1BQDA 4ADBA 5G4JA 1WYUB 3I4JA 1B9IA 2EYQA 3EI6A 3BWNA 1IJIA 1WKGA 1OHVA 2YKXA 3AENB 1ZODA 4A72A 3HVYA 2DKBA 1AJRA 4IY7A 3AEJC 1KMJA 4KXKA 5BJ4A 4MQPA 1ARHA 4W8IA 3FQ8A 3OKSA 3LWSA 1GEXA 2WB6A 1IBJA 1PG8A 1BJ4A 3RI6A 1SF2A 4ZLVA 1G7XA 3PIUA 4BQ0A 3WGCA 3W1JA 3GSBA 3K7YA 1V2EA 2G7JA 3WZFA 1B5OA 4CXQA 3K40A 1V72A 1RV4A 1C7GA 2FQ6A 4RITA 4CXRA 1CZEA 1SZKA 3JW9A 4QGRA 4WLJA 4BA5A 1EQBA 1QISA 4AZKA 2FN6A 4M2MA 3ELEA 1CL1A 5EUEA 1RVUA 3AOVA 4GE9A 4XQ2A 1SPAA 3QM2A 1C7NA 3QGUA 4M2KA 1LC7A 2HOYA 2R5CB 4BA4A 5G09A 1LC5A 4R8DA 3GZDC 1CQ7A 5TF5A 4F5HA 1D7SA 2Z1ZA 2G6WA 3FQAA 1ASDA 1AMAA 2GB3A 1AMRA 1TPLA 4JEZA 1AIBA 2ZP7A 5EAVA 1AKBA 4Q76A 4CBRA 1PMMA 3W1HA 2X5DA 4F5JA 4BHDA 1I29A 3B1CA 3CBFA 4MY5A 2W8UA 5E4ZA 1D7VA 3NU8A 4A00A 1SVVA 3BWNC 1VEFA 2X8UA 2AY5A 3CQ6A 2BKWA 2R5EA 3FDDA 2YKUA 4KYOA 4IYOA 4OYTA 4CVQA 4EB7A 1UU0A 1W23A 2D66A 1BKGA 1ASCA 4E1OA 1Z7DA 2Z20A 3BV0A 2CY8A 4UHNA 3HQTA 2EPJA 4UQVA 3PDBB 3FVSA 5I92A 3A9ZA 4WXBA 8AATA 1WYTB 2VMOA 3AEMA 3LVJA 3DU4A 1U08A 4ZDLA 4ZSYA 3VOMA 1ELQA 1IAYA 4EB5A 1S06A 3EUCA 2JGTA 4PFNA 3UAKA 4DQ6A 4ZDOA 2VMZA 2YRRA 3E2FA 2VMNA 1ORDA 4WP0A 1QGNA 3MEBA 1AMSA 5M4BA 4JEVA 4WYGA 3LY1A 4P7YA 4RKCA 5G0AA 2AEVA 3VK4A 5LHAA 4ZDPA 1G4VA 3NYUA 2YRIA 2XH1A 2QMAA 1AMQA 5EUDA 5EAAA 2HZPA 4AO9A 1ASMA 1IVRA 5E3KA 3BCBA 4ZAHA 3ISLA 1UKJA 2VMQA 2YKVA 1X29A 3MBBA 2EZ1A 4EFFA 1AJSB 1ZC9A 2BYJA 3FZ8A 4AOAA 2AY3A 2CB1A 1AY4A 4RJ0A 5G4IA 2OKKA 5EIGA 3LG0A 1OHYA 2CH1A 3A8UX 1AKCA 1S07A 3E2ZB 2AY6A 4OMAA 2W8JA 4UOYA 5DJ1A 2VGVA 3HL2A 4ZWVA 3PD6B 2VMUA 4Q31A 4RIZA 3RCHA 4WXGA 5EUNA 3MC6A 3PJ0A 3BN1A 1KMKA 3GJUA 3BB8A 3HLMA 3A9YA 1KL2A 3MADA 2PO3A 4F5LA 2WK8A 2JISA 2GMSA 3B8XA 3NNKA 2R0TA 1RVYA 4ZSWA 1MDOA 1AKAA 1QJ3A 4GDYA 2D65A 3WKRA 3M5UA 1M0OA 1S08A 2E54A 3JWBA 1WYVB 4U1TA 1WYUA 3ZZKA 1O61A 3PGYA 1Z3ZA 4E77A 2AEUA 4Y0IA 3AENA 1IX6A 3FZ7A 4GE7A 2BWOA 2ZSMA 3W1IA 3ACZA 3BC8A 3N7NA 2CINA 3G7QA 2D7YA 2TPLA 3FD0A 3RBLA 2VMXA 2AY7A 2FNIA 3F9TA 1H1CA 4WLHA 2QBTA 3TATA 2NMPA 3EI8A 4WYFA 4ITGA 1IAXA 2VIAA 1M7YA 1OXOA 4XJMA 5K8BA 1ZOBA 1G7WA 3VP6A 2BI9A 1GCKA 1CQ8A 2KFPA 4K05A 1AAMA 1JF9A 2VGZA 2DKJA 3FCRA 2VGUA 2PB2A 1CS1A 1GBNA 1GEYA 3GZCA 1H0CA 3A9XA 2CFBA 4RJYA 1ASLA 3EIAA 3GR9A 4MQRA 1N31A 4H63Q 1E5FA 1D7UA 2BI2A 3E2YA 3MAFB 4F4EA 2BIGA 3NUBA 2W7JA 5FT6A 5M4DA 1TOIA 3GWPA 3LV2A 1D2FA 1LW4A 2CANA 1BJOB 1CL2A 4MKJA 2W7EA 3K28A 5F9SA 2ZY3A 3MC6C 2YOBA 2HP2A 1DJUA 3AV7A 4RKDA 4JE5D 2WK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZS A;  3IHJ A;  1YNU A;  4OT8 A;  1MLZ A;  5J8Q A;  3BCA A;  2W7I A;  1ART A;  4IXS A;  3QN6 A;  3WCO A;  1KKJ A;  4ATQ A;  5DJ9 A;  4ADE A;  1C4K A;  1TOK A;  3USF A;  1KKP A;  2Z1Y A;  1PFF A;  2Z9V A;  3FRK A;  3WY7 A;  2C81 A;  4J8L A;  3FDB A;  2D63 A;  2EO5 A;  4R2N A;  5D95 A;  1ASF A;  2QB3 A;  2VYC A;  5BJ3 A;  2OGE A;  2Z9W A;  2O7C A;  1BQA A;  1CQ6 A;  2W7F A;  4K2I A;  5DX5 A;  4ZWM A;  4LC3 A;  3WCN A;  3EIB A;  5M46 A;  2YCT A;  2FNU A;  1ASG A;  4TMR A;  4WB0 B;  4ZAS A;  5C6U A;  4JF1 A;  3KKI A;  4A6U A;  1ASE A;  4AZJ A;  2O1B A;  1AY5 A;  2BHX A;  1YJZ A;  3L8A A;  1DGD A;  4GEB A;  2X3L A;  1DKA A;  2E7I A;  5HHY A;  4ADD A;  1IUG A;  1CJ0 A;  1O62 A;  4LW4 A;  3BWO A;  2W8T A;  3JTX A;  3TCM A;  1W7L A;  2F8J A;  2D5Y A;  1AIC A;  4KAM A;  2DOU A;  2Z67 A;  3T32 A;  3I5T A;  2W8W A;  2W7M A;  1TAR A;  1DFO A;  1XEY A;  1BJW A;  3QBO A;  1BJN A;  1T3I A;  1GC0 A;  2VMS A;  3JU7 A;  3JWA A;  3ZZJ A;  1KL1 A;  1B4X A;  3KE3 A;  3N0L A;  2QA3 A;  4L0O A;  4WD2 A;  3G8M A;  4O6Z A;  2HOX A;  2VMR A;  4WXF A;  2FM1 A;  2GMU A;  4TV7 A;  1ARI A;  4Q6R A;  2OKJ A;  3HMU A;  4AO4 A;  2GSA A;  4ZM3 A;  1GDE A;  3EI7 A;  2WKA A;  1M0N A;  1MDX A;  3DR7 A;  1O69 A;  4E3R A;  4FFC A;  1W7N A;  2E7U A;  1B8G A;  2OGA A;  4MGR A;  1TOJ A;  2AY4 A;  1AJS A;  1M4N A;  1QZ9 A;  2DGM A;  4MQQ A;  2JJF A;  4ITX A;  3HT4 A;  5EQC A;  5D5S A;  2AY2 A;  2VMV A;  4ZM4 A;  4XK1 A;  2ZC0 A;  3QI6 A;  3ELP A;  1WST A;  3AAT A;  2VMT A;  3E2Z A;  4M2J A;  2ZY4 A;  1B5P A;  1TAT A;  1TAS A;  4WYA A;  3PD6 A;  3RUY A;  1ELU A;  4GSA A;  2Z9U A;  3ASA A;  4IXZ A;  2V1P A;  2VMW A;  4WYE A;  1QIT A;  3CAI A;  4ATP A;  2HOZ A;  1G4X A;  1X28 A;  4WBT A;  5JAY A;  2CJD A;  3DRD A;  2BWN A;  1I43 A;  2YHK A;  4A6T A;  5DB5 A;  3EI9 A;  3NTJ A;  1YAA A;  4RM1 A;  1QIR A;  1SZU A;  2VI9 A;  3AEM C;  4F5F A;  1WYV A;  3VK3 A;  1D7R A;  1MDZ A;  2W7G A;  3UE8 A;  1SFF A;  3WLX A;  3B1E A;  3ECD A;  3FFH A;  4IW7 A;  2ZJG A;  3FVU A;  1YJS A;  2BYL A;  4LNL A;  3PAA A;  3II0 A;  4H51 A;  1UU2 A;  2HUF A;  3DC1 A;  4HVK A;  1AHF A;  2Q7W A;  4A0F A;  1S0A A;  3N5M A;  4JEW A;  2C7T A;  3TFT A;  1EG5 A;  1Y4I A;  2HP1 A;  3A2B A;  4B9B A;  3N75 A;  4OTL A;  4MKK A;  4W1W A;  2QLR A;  2W7D A;  4N0W A;  1V2D A;  3AEP A;  2OQX A;  2ZSL A;  4XJL A;  3VK2 A;  1UU1 A;  3GZD A;  3F0H A;  3E6G A;  3ASB A;  4K2B A;  1LK9 A;  1OXP A;  1YOO A;  2D64 A;  2ZUK A;  3DZZ A;  3MAF A;  1WKH A;  4E3Q A;  4W5K A;  1AHY A;  1JS6 A;  1W3U A;  1FC4 A;  4W1V A;  4XJP A;  3B1D A;  1BJO A;  1PMO A;  1M32 A;  2BIE A;  3AOW A;  4MSO A;  3NU7 A;  1FG3 A;  1X0M A;  1OHW A;  1DTY A;  2R5C A;  3GET A;  3QHX A;  2YCN A;  4U2H A;  2YKY A;  4JE5 A;  2ZY2 A;  1FG7 A;  1EJI A;  2OAT A;  3IF2 A;  3R9A A;  3ZRQ A;  2BWP A;  1N8P A;  2VLH A;  4UHO A;  1ASA A;  3ATH A;  2HOR A;  4PVF A;  1M0P A;  2QB2 A;  7AAT A;  1C9C A;  3MKJ A;  1LW5 A;  1MLY A;  4PIW A;  4IXO A;  4CBS A;  2W7K A;  3P1T A;  3COG A;  2VMY A;  4F5K A;  2V0Y A;  4OBU A;  1ARG A;  5EFS A;  4F5G A;  1XI9 A;  3DYD A;  1AY8 A;  3QPG A;  1MAQ A;  4XAU A;  3BCX A;  3P6K A;  2WK7 A;  4WB0 A;  1VP4 A;  5FT8 A;  2D7Z A;  2ZYJ A;  1BT4 A;  2GQN A;  3NUI A;  3E77 A;  2JJE A;  4JEY A;  4UHM A;  4W1X A;  3TFU A;  3JZL A;  4Q75 A;  2DGK A;  2R2N A;  3OP7 A;  4P3M A;  4DGT A;  5M49 A;  1CZC A;  3VAX A;  3H7F A;  3PDB A;  1DJ9 A;  2EZ2 A;  4K2M A;  3L44 A;  1LS3 A;  4R5F A;  3ZRP A;  1WYT A;  1O4S A;  3DR4 A;  1ASN A;  4NOG A;  1V2F A;  3B46 A;  2XBN A;  3NRA A;  4FL0 A;  4OBV A;  2O0R A;  4ISY A;  3AEL A;  1AHX A;  1M0Q A;  1TOG A;  1GC2 A;  4LNM A;  1VJO A;  2Z9X A;  3LVM A;  1ARS A;  1AIA A;  1GD9 A;  4WYC A;  2CH2 A;  3FVX A;  9AAT A;  1AHG A;  1IX8 A;  4XEW A;  3EI5 A;  2C44 A;  2AY8 A;  5E5I A;  3PDX A;  5G2Q A;  3LVL B;  2CTZ A;  4TN4 A;  4XJO A;  5G2P A;  3PPL A;  2VGW A;  1GC4 A;  1BW0 A;  3KGX A;  1E5E A;  1B9H A;  3NDN A;  4IYO B;  4BMK A;  3WKS A;  3PA9 A;  3Q8N A;  3NYS A;  4F5I A;  5LH9 A;  2BI1 A;  1IX7 A;  3DXW A;  2W7H A;  3WGB A;  1JG8 A;  2D61 A;  2E7J A;  3FSL A;  2ZY5 A;  3AEO A;  3GBX A;  1GC3 A;  4LNJ A;  4RAE A;  1N2T A;  1I41 A;  2VIB A;  1ECX A;  2VI8 A;  2AAT A;  2JG2 A;  3E9K A;  1M6S A;  2CST A;  3UWC A;  2W7L A;  4OCA A;  4LW2 A;  4GE4 A;  1DJE A;  2ORD A;  4IX8 A;  4RLG A;  2AY1 A;  2Z61 A;  3EZ1 A;  2VGS A;  3HDO A;  1DGE A;  1S09 A;  2DGL A;  3I16 A;  3DXV A;  1JS3 A;  2JJH A;  1TOE A;  2EH6 A;  2VGT A;  3AEJ A;  1YJY A;  4JEX A;  4Y0H A;  4A0R A;  4DBC A;  2BI3 A;  4GRX A;  3NYT A;  2VLF A;  2PB0 A;  3D6K A;  4J5U A;  1AHE A;  3FKD A;  2EGY A;  4EMY A;  1MGV A;  1YIZ A;  2BIA A;  2CJG A;  3ZRR A;  4N0B A;  5HXX A;  3CQ5 A;  3BS8 A;  4HF8 A;  2C0R A;  3F6T A;  4A0H A;  3MAU A;  5FT5 A;  2YCP A;  1AAW A;  1YIY A;  3FQ7 A;  3H14 A;  2AY9 A;  4WYD A;  3FZ6 A;  4F5M A;  3KGW A;  3RBF A;  2BI5 A;  1W7M A;  1C7O A;  1AX4 A;  2JJG A;  2HUU A;  2RFV A;  5F8V A;  4B98 A;  1ASB A;  3R4T A;  4ADC A;  1LKC A;  1P3W A;  5HDM A;  5IWQ A;  3HBX A;  2CJH A;  4PFF A;  1GEW A;  1RV3 A;  5EIG B;  1C0N A;  5FT4 A;  2W8V A;  1X2A A;  3FFR A;  4JF0 A;  5AX8 A;  1J04 A;  2HUI A;  2DR1 A;  4EU1 A;  3TQX A;  3NX3 A;  1MAP A;  3RCH B;  4Y0D A;  1OAT A;  3G0T A;  3EZS A;  2VMP A;  4W91 A;  4R5Z A;  2X5F A;  4OC9 A;  3FTB A;  4I8A A;  1LC8 A;  1QJ5 A;  3RQ1 A;  1I48 A;  3WX9 A;  4AH3 A;  4A6R A;  2FYF A;  3CQ4 A;  1BS0 A;  1J32 A;  3DOD A;  3LVK A;  4A0G A;  1BQD A;  4ADB A;  5G4J A;  1WYU B;  3I4J A;  1B9I A;  3EI6 A;  3BWN A;  1IJI A;  1WKG A;  1OHV A;  2YKX A;  3AEN B;  1ZOD A;  4A72 A;  3HVY A;  2DKB A;  1AJR A;  4IY7 A;  3AEJ C;  1KMJ A;  4KXK A;  5BJ4 A;  4MQP A;  1ARH A;  4W8I A;  3FQ8 A;  3OKS A;  3LWS A;  1GEX A;  1IBJ A;  1PG8 A;  1BJ4 A;  3RI6 A;  1SF2 A;  4ZLV A;  1G7X A;  3PIU A;  4BQ0 A;  3WGC A;  3W1J A;  3GSB A;  3K7Y A;  1V2E A;  3WZF A;  1B5O A;  4CXQ A;  3K40 A;  1V72 A;  1RV4 A;  1C7G A;  2FQ6 A;  4RIT A;  4CXR A;  1CZE A;  1SZK A;  3JW9 A;  4QGR A;  4WLJ A;  4BA5 A;  1EQB A;  1QIS A;  4AZK A;  2FN6 A;  4M2M A;  3ELE A;  1CL1 A;  5EUE A;  1RVU A;  3AOV A;  4GE9 A;  4XQ2 A;  1SPA A;  3QM2 A;  1C7N A;  3QGU A;  4M2K A;  1LC7 A;  2HOY A;  2R5C B;  4BA4 A;  5G09 A;  1LC5 A;  4R8D A;  3GZD C;  1CQ7 A;  5TF5 A;  4F5H A;  1D7S A;  2Z1Z A;  2G6W A;  3FQA A;  1ASD A;  1AMA A;  2GB3 A;  1AMR A;  1TPL A;  4JEZ A;  1AIB A;  2ZP7 A;  5EAV A;  1AKB A;  4Q76 A;  4CBR A;  1PMM A;  3W1H A;  2X5D A;  4F5J A;  4BHD A;  1I29 A;  3B1C A;  3CBF A;  4MY5 A;  2W8U A;  5E4Z A;  1D7V A;  3NU8 A;  4A00 A;  1SVV A;  3BWN C;  1VEF A;  2X8U A;  2AY5 A;  3CQ6 A;  2BKW A;  2R5E A;  3FDD A;  2YKU A;  4KYO A;  4IYO A;  4OYT A;  4CVQ A;  4EB7 A;  1UU0 A;  1W23 A;  2D66 A;  1BKG A;  1ASC A;  4E1O A;  1Z7D A;  2Z20 A;  3BV0 A;  2CY8 A;  4UHN A;  3HQT A;  2EPJ A;  4UQV A;  3PDB B;  3FVS A;  5I92 A;  3A9Z A;  4WXB A;  8AAT A;  1WYT B;  2VMO A;  3AEM A;  3LVJ A;  3DU4 A;  1U08 A;  4ZDL A;  4ZSY A;  3VOM A;  1ELQ A;  1IAY A;  4EB5 A;  1S06 A;  3EUC A;  2JGT A;  4PFN A;  3UAK A;  4DQ6 A;  4ZDO A;  2VMZ A;  2YRR A;  3E2F A;  2VMN A;  1ORD A;  4WP0 A;  1QGN A;  3MEB A;  1AMS A;  5M4B A;  4JEV A;  4WYG A;  3LY1 A;  4P7Y A;  4RKC A;  5G0A A;  2AEV A;  3VK4 A;  5LHA A;  4ZDP A;  1G4V A;  3NYU A;  2YRI A;  2XH1 A;  2QMA A;  1AMQ A;  5EUD A;  5EAA A;  2HZP A;  4AO9 A;  1ASM A;  1IVR A;  5E3K A;  3BCB A;  4ZAH A;  3ISL A;  1UKJ A;  2VMQ A;  2YKV A;  1X29 A;  3MBB A;  2EZ1 A;  4EFF A;  1AJS B;  1ZC9 A;  2BYJ A;  3FZ8 A;  4AOA A;  2AY3 A;  2CB1 A;  1AY4 A;  4RJ0 A;  5G4I A;  2OKK A;  5EIG A;  3LG0 A;  1OHY A;  2CH1 A;  3A8U X;  1AKC A;  1S07 A;  3E2Z B;  2AY6 A;  4OMA A;  2W8J A;  4UOY A;  5DJ1 A;  2VGV A;  3HL2 A;  4ZWV A;  3PD6 B;  2VMU A;  4Q31 A;  4RIZ A;  3RCH A;  4WXG A;  5EUN A;  3MC6 A;  3PJ0 A;  3BN1 A;  1KMK A;  3GJU A;  3BB8 A;  3HLM A;  3A9Y A;  1KL2 A;  3MAD A;  2PO3 A;  4F5L A;  2WK8 A;  2JIS A;  2GMS A;  3B8X A;  3NNK A;  2R0T A;  1RVY A;  4ZSW A;  1MDO A;  1AKA A;  1QJ3 A;  4GDY A;  2D65 A;  3WKR A;  3M5U A;  1M0O A;  1S08 A;  2E54 A;  3JWB A;  1WYV B;  4U1T A;  1WYU A;  3ZZK A;  1O61 A;  3PGY A;  1Z3Z A;  4E77 A;  2AEU A;  4Y0I A;  3AEN A;  1IX6 A;  3FZ7 A;  4GE7 A;  2BWO A;  2ZSM A;  3W1I A;  3ACZ A;  3BC8 A;  2CIN A;  3G7Q A;  2D7Y A;  2TPL A;  3FD0 A;  3RBL A;  2VMX A;  2AY7 A;  2FNI A;  3F9T A;  1H1C A;  4WLH A;  2QBT A;  3TAT A;  2NMP A;  3EI8 A;  4WYF A;  4ITG A;  1IAX A;  2VIA A;  1M7Y A;  1OXO A;  4XJM A;  5K8B A;  1ZOB A;  1G7W A;  3VP6 A;  2BI9 A;  1GCK A;  1CQ8 A;  1AAM A;  1JF9 A;  2VGZ A;  2DKJ A;  3FCR A;  2VGU A;  2PB2 A;  1CS1 A;  1GBN A;  1GEY A;  3GZC A;  1H0C A;  3A9X A;  2CFB A;  4RJY A;  1ASL A;  3EIA A;  3GR9 A;  4MQR A;  1N31 A;  1E5F A;  1D7U A;  2BI2 A;  3E2Y A;  3MAF B;  4F4E A;  2BIG A;  3NUB A;  2W7J A;  5FT6 A;  5M4D A;  1TOI A;  3GWP A;  3LV2 A;  1D2F A;  1LW4 A;  2CAN A;  1BJO B;  1CL2 A;  4MKJ A;  2W7E A;  3K28 A;  5F9S A;  2ZY3 A;  3MC6 C;  2YOB A;  2HP2 A;  1DJU A;  3AV7 A;  4RKD A;  4JE5 D;  2WK9 A; 
#chains in the Genus database with same CATH topology
 1SZS A;  3IHJ A;  1YNU A;  4OT8 A;  1MLZ A;  5J8Q A;  3BCA A;  2W7I A;  1ART A;  4IXS A;  3QN6 A;  3WCO A;  1KKJ A;  4ATQ A;  5DJ9 A;  4ADE A;  1C4K A;  1TOK A;  3USF A;  1KKP A;  2Z1Y A;  1PFF A;  2Z9V A;  3FRK A;  3WY7 A;  2C81 A;  4J8L A;  3FDB A;  2D63 A;  2EO5 A;  4R2N A;  5D95 A;  1ASF A;  2QB3 A;  2VYC A;  5BJ3 A;  2OGE A;  2Z9W A;  2O7C A;  1BQA A;  1CQ6 A;  2W7F A;  4K2I A;  5DX5 A;  4ZWM A;  4LC3 A;  3WCN A;  3EIB A;  5M46 A;  2YCT A;  2FNU A;  1ASG A;  4TMR A;  4WB0 B;  4ZAS A;  5C6U A;  4JF1 A;  3KKI A;  4A6U A;  1ASE A;  4AZJ A;  2O1B A;  1AY5 A;  2BHX A;  1YJZ A;  3L8A A;  1DGD A;  4GEB A;  2X3L A;  1DKA A;  2E7I A;  5HHY A;  4ADD A;  1IUG A;  1CJ0 A;  1O62 A;  4LW4 A;  3BWO A;  2W8T A;  3JTX A;  3TCM A;  1W7L A;  2F8J A;  2D5Y A;  1AIC A;  4KAM A;  2DOU A;  2Z67 A;  3T32 A;  3I5T A;  2W8W A;  2W7M A;  1TAR A;  1DFO A;  1XEY A;  1BJW A;  3QBO A;  1BJN A;  1T3I A;  1GC0 A;  2VMS A;  3JU7 A;  3JWA A;  3ZZJ A;  1KL1 A;  1B4X A;  3KE3 A;  3N0L A;  2QA3 A;  4L0O A;  4WD2 A;  3G8M A;  4O6Z A;  2HOX A;  2VMR A;  4WXF A;  2FM1 A;  2GMU A;  4TV7 A;  1ARI A;  4Q6R A;  2OKJ A;  3HMU A;  4AO4 A;  2GSA A;  4ZM3 A;  1GDE A;  3EI7 A;  2WKA A;  2FKI A;  1M0N A;  1MDX A;  3DR7 A;  1O69 A;  4E3R A;  4FFC A;  1W7N A;  2E7U A;  1B8G A;  2OGA A;  4MGR A;  1TOJ A;  2AY4 A;  1AJS A;  1M4N A;  1QZ9 A;  2DGM A;  4MQQ A;  2JJF A;  4ITX A;  3HT4 A;  5EQC A;  5D5S A;  2AY2 A;  2VMV A;  4ZM4 A;  4XK1 A;  2ZC0 A;  3QI6 A;  3ELP A;  1WST A;  3AAT A;  2VMT A;  3E2Z A;  4M2J A;  2ZY4 A;  1B5P A;  1TAT A;  1TAS A;  4WYA A;  3N4X A;  3PD6 A;  3RUY A;  1ELU A;  4GSA A;  2Z9U A;  3ASA A;  4IXZ A;  2V1P A;  2VMW A;  4WYE A;  1QIT A;  3CAI A;  4ATP A;  2HOZ A;  1G4X A;  1X28 A;  4WBT A;  5JAY A;  2CJD A;  3DRD A;  2BWN A;  2QSR A;  1I43 A;  2YHK A;  4A6T A;  5DB5 A;  3EI9 A;  3NTJ A;  1YAA A;  4RM1 A;  1QIR A;  1SZU A;  2VI9 A;  3AEM C;  4F5F A;  1WYV A;  3VK3 A;  1D7R A;  1MDZ A;  2W7G A;  3UE8 A;  1SFF A;  3WLX A;  3B1E A;  3ECD A;  3FFH A;  4IW7 A;  2ZJG A;  3FVU A;  1YJS A;  2BYL A;  4LNL A;  3PAA A;  3II0 A;  4H51 A;  1UU2 A;  2HUF A;  3DC1 A;  4HVK A;  1AHF A;  2Q7W A;  4A0F A;  1S0A A;  3N5M A;  4JEW A;  2C7T A;  3TFT A;  1EG5 A;  1Y4I A;  2HP1 A;  3A2B A;  4B9B A;  3N75 A;  4OTL A;  4MKK A;  4W1W A;  2QLR A;  2W7D A;  4N0W A;  1V2D A;  3H9X A;  3AEP A;  2OQX A;  2ZSL A;  4XJL A;  3VK2 A;  1UU1 A;  3GZD A;  3F0H A;  3E6G A;  3ASB A;  4K2B A;  1LK9 A;  1OXP A;  1YOO A;  2D64 A;  2ZUK A;  3DZZ A;  3MAF A;  1WKH A;  4E3Q A;  4W5K A;  1AHY A;  1JS6 A;  1W3U A;  1FC4 A;  4W1V A;  4XJP A;  3B1D A;  1BJO A;  1PMO A;  1M32 A;  2BIE A;  3AOW A;  4MSO A;  3NU7 A;  1FG3 A;  1X0M A;  1OHW A;  1DTY A;  2R5C A;  3GET A;  3QHX A;  2YCN A;  4U2H A;  2YKY A;  4JE5 A;  2ZY2 A;  1FG7 A;  1EJI A;  2OAT A;  3IF2 A;  3R9A A;  3ZRQ A;  2BWP A;  1N8P A;  2VLH A;  4UHO A;  1ASA A;  3ATH A;  2HOR A;  4PVF A;  1M0P A;  2QB2 A;  7AAT A;  1C9C A;  3MKJ A;  1LW5 A;  1MLY A;  4PIW A;  4IXO A;  4CBS A;  2W7K A;  3P1T A;  3COG A;  2VMY A;  4F5K A;  2V0Y A;  4OBU A;  1ARG A;  5EFS A;  4F5G A;  1XI9 A;  3DYD A;  1AY8 A;  3QPG A;  1MAQ A;  4XAU A;  3BCX A;  3P6K A;  2WK7 A;  4WB0 A;  1VP4 A;  5FT8 A;  2D7Z A;  2ZYJ A;  1BT4 A;  2GQN A;  3NUI A;  3E77 A;  2JJE A;  4JEY A;  4UHM A;  4W1X A;  3TFU A;  3JZL A;  4Q75 A;  2DGK A;  2R2N A;  3OP7 A;  4P3M A;  4DGT A;  5M49 A;  1CZC A;  3VAX A;  3H7F A;  3PDB A;  1DJ9 A;  2EZ2 A;  4K2M A;  3L44 A;  1LS3 A;  4R5F A;  3N4R A;  3ZRP A;  1WYT A;  1O4S A;  3DR4 A;  1ASN A;  4NOG A;  1V2F A;  3B46 A;  2XBN A;  3NRA A;  4FL0 A;  4OBV A;  2O0R A;  4ISY A;  3AEL A;  1AHX A;  1M0Q A;  1TOG A;  1GC2 A;  4LNM A;  1VJO A;  2Z9X A;  3LVM A;  1ARS A;  1AIA A;  1GD9 A;  4WYC A;  2CH2 A;  3FVX A;  9AAT A;  1AHG A;  1IX8 A;  4XEW A;  3EI5 A;  2C44 A;  2AY8 A;  5E5I A;  3PDX A;  5G2Q A;  3LVL B;  2CTZ A;  4TN4 A;  4XJO A;  5G2P A;  3PPL A;  2VGW A;  1GC4 A;  1BW0 A;  3KGX A;  1E5E A;  1B9H A;  3NDN A;  4IYO B;  4BMK A;  3WKS A;  3PA9 A;  3Q8N A;  3NYS A;  4F5I A;  5LH9 A;  2BI1 A;  1IX7 A;  3DXW A;  2W7H A;  3WGB A;  1JG8 A;  3N4S A;  2D61 A;  2E7J A;  3FSL A;  2ZY5 A;  3AEO A;  3GBX A;  1GC3 A;  4LNJ A;  4RAE A;  1N2T A;  1I41 A;  2VIB A;  1ECX A;  2VI8 A;  2AAT A;  2JG2 A;  3E9K A;  1M6S A;  2CST A;  3UWC A;  2A1V A;  2W7L A;  4OCA A;  4LW2 A;  4GE4 A;  1DJE A;  2ORD A;  4IX8 A;  4RLG A;  2AY1 A;  5KTB A;  2Z61 A;  3EZ1 A;  2VGS A;  3HDO A;  1DGE A;  1S09 A;  2DGL A;  3I16 A;  3DXV A;  1JS3 A;  2JJH A;  1TOE A;  2EH6 A;  2VGT A;  3AEJ A;  1YJY A;  4JEX A;  4Y0H A;  4A0R A;  4DBC A;  2BI3 A;  4GRX A;  3NYT A;  2VLF A;  2PB0 A;  3D6K A;  4J5U A;  1AHE A;  3FKD A;  2EGY A;  4EMY A;  1MGV A;  1YIZ A;  2BIA A;  2CJG A;  3ZRR A;  4N0B A;  5HXX A;  3CQ5 A;  3BS8 A;  4HF8 A;  2C0R A;  3F6T A;  4A0H A;  3MAU A;  5FT5 A;  2YCP A;  1AAW A;  1YIY A;  3FQ7 A;  3H14 A;  2AY9 A;  4WYD A;  3FZ6 A;  4F5M A;  3KGW A;  3RBF A;  2BI5 A;  1W7M A;  1C7O A;  1AX4 A;  2JJG A;  2HUU A;  2RFV A;  5F8V A;  4B98 A;  1ASB A;  3R4T A;  4ADC A;  1LKC A;  1P3W A;  5HDM A;  5IWQ A;  3HBX A;  2CJH A;  4PFF A;  1GEW A;  1RV3 A;  5EIG B;  1C0N A;  5FT4 A;  2W8V A;  1X2A A;  3FFR A;  4JF0 A;  5AX8 A;  1J04 A;  2HUI A;  2DR1 A;  4EU1 A;  3TQX A;  3NX3 A;  1MAP A;  3RCH B;  4Y0D A;  1OAT A;  3G0T A;  3EZS A;  2VMP A;  4W91 A;  4R5Z A;  2X5F A;  4OC9 A;  3FTB A;  4I8A A;  1LC8 A;  1QJ5 A;  3RQ1 A;  1I48 A;  3WX9 A;  4AH3 A;  4A6R A;  2FYF A;  3CQ4 A;  1BS0 A;  1J32 A;  3DOD A;  3LVK A;  4A0G A;  1BQD A;  4ADB A;  5G4J A;  1WYU B;  3I4J A;  1B9I A;  2EYQ A;  3EI6 A;  3BWN A;  1IJI A;  1WKG A;  1OHV A;  2YKX A;  3AEN B;  1ZOD A;  4A72 A;  3HVY A;  2DKB A;  1AJR A;  4IY7 A;  3AEJ C;  1KMJ A;  4KXK A;  5BJ4 A;  4MQP A;  1ARH A;  4W8I A;  3FQ8 A;  3OKS A;  3LWS A;  1GEX A;  2WB6 A;  1IBJ A;  1PG8 A;  1BJ4 A;  3RI6 A;  1SF2 A;  4ZLV A;  1G7X A;  3PIU A;  4BQ0 A;  3WGC A;  3W1J A;  3GSB A;  3K7Y A;  1V2E A;  2G7J A;  3WZF A;  1B5O A;  4CXQ A;  3K40 A;  1V72 A;  1RV4 A;  1C7G A;  2FQ6 A;  4RIT A;  4CXR A;  1CZE A;  1SZK A;  3JW9 A;  4QGR A;  4WLJ A;  4BA5 A;  1EQB A;  1QIS A;  4AZK A;  2FN6 A;  4M2M A;  3ELE A;  1CL1 A;  5EUE A;  1RVU A;  3AOV A;  4GE9 A;  4XQ2 A;  1SPA A;  3QM2 A;  1C7N A;  3QGU A;  4M2K A;  1LC7 A;  2HOY A;  2R5C B;  4BA4 A;  5G09 A;  1LC5 A;  4R8D A;  3GZD C;  1CQ7 A;  5TF5 A;  4F5H A;  1D7S A;  2Z1Z A;  2G6W A;  3FQA A;  1ASD A;  1AMA A;  2GB3 A;  1AMR A;  1TPL A;  4JEZ A;  1AIB A;  2ZP7 A;  5EAV A;  1AKB A;  4Q76 A;  4CBR A;  1PMM A;  3W1H A;  2X5D A;  4F5J A;  4BHD A;  1I29 A;  3B1C A;  3CBF A;  4MY5 A;  2W8U A;  5E4Z A;  1D7V A;  3NU8 A;  4A00 A;  1SVV A;  3BWN C;  1VEF A;  2X8U A;  2AY5 A;  3CQ6 A;  2BKW A;  2R5E A;  3FDD A;  2YKU A;  4KYO A;  4IYO A;  1KAF A;  4OYT A;  4CVQ A;  4EB7 A;  1UU0 A;  1W23 A;  2D66 A;  1BKG A;  1ASC A;  4E1O A;  1Z7D A;  2Z20 A;  3BV0 A;  2CY8 A;  4UHN A;  3HQT A;  2EPJ A;  4UQV A;  3PDB B;  3FVS A;  5I92 A;  3A9Z A;  4WXB A;  8AAT A;  1WYT B;  2VMO A;  3AEM A;  3LVJ A;  3DU4 A;  1U08 A;  4ZDL A;  4ZSY A;  3VOM A;  1ELQ A;  1IAY A;  4EB5 A;  1S06 A;  3EUC A;  2JGT A;  4PFN A;  3UAK A;  4DQ6 A;  4ZDO A;  2VMZ A;  2YRR A;  3E2F A;  2VMN A;  1ORD A;  4WP0 A;  1QGN A;  3MEB A;  1AMS A;  5M4B A;  4JEV A;  4WYG A;  3LY1 A;  4P7Y A;  4RKC A;  5G0A A;  2AEV A;  3VK4 A;  5LHA A;  4ZDP A;  1G4V A;  3NYU A;  2YRI A;  2XH1 A;  2QMA A;  1AMQ A;  5EUD A;  5EAA A;  2HZP A;  4AO9 A;  1ASM A;  1IVR A;  5E3K A;  3BCB A;  4ZAH A;  3ISL A;  1UKJ A;  2VMQ A;  2YKV A;  1X29 A;  3MBB A;  2EZ1 A;  4EFF A;  1AJS B;  1ZC9 A;  2BYJ A;  3FZ8 A;  4AOA A;  2AY3 A;  2CB1 A;  1AY4 A;  4RJ0 A;  5G4I A;  2OKK A;  5EIG A;  3LG0 A;  1OHY A;  2CH1 A;  3A8U X;  1AKC A;  1S07 A;  3E2Z B;  2AY6 A;  4OMA A;  2W8J A;  4UOY A;  5DJ1 A;  2VGV A;  3HL2 A;  4ZWV A;  3PD6 B;  2VMU A;  4Q31 A;  4RIZ A;  3RCH A;  4WXG A;  5EUN A;  3MC6 A;  3PJ0 A;  3BN1 A;  1KMK A;  3GJU A;  3BB8 A;  3HLM A;  3A9Y A;  1KL2 A;  3MAD A;  2PO3 A;  4F5L A;  2WK8 A;  2JIS A;  2GMS A;  3B8X A;  3NNK A;  2R0T A;  1RVY A;  4ZSW A;  1MDO A;  1AKA A;  1QJ3 A;  4GDY A;  2D65 A;  3WKR A;  3M5U A;  1M0O A;  1S08 A;  2E54 A;  3JWB A;  1WYV B;  4U1T A;  1WYU A;  3ZZK A;  1O61 A;  3PGY A;  1Z3Z A;  4E77 A;  2AEU A;  4Y0I A;  3AEN A;  1IX6 A;  3FZ7 A;  4GE7 A;  2BWO A;  2ZSM A;  3W1I A;  3ACZ A;  3BC8 A;  3N7N A;  2CIN A;  3G7Q A;  2D7Y A;  2TPL A;  3FD0 A;  3RBL A;  2VMX A;  2AY7 A;  2FNI A;  3F9T A;  1H1C A;  4WLH A;  2QBT A;  3TAT A;  2NMP A;  3EI8 A;  4WYF A;  4ITG A;  1IAX A;  2VIA A;  1M7Y A;  1OXO A;  4XJM A;  5K8B A;  1ZOB A;  1G7W A;  3VP6 A;  2BI9 A;  1GCK A;  1CQ8 A;  2KFP A;  4K05 A;  1AAM A;  1JF9 A;  2VGZ A;  2DKJ A;  3FCR A;  2VGU A;  2PB2 A;  1CS1 A;  1GBN A;  1GEY A;  3GZC A;  1H0C A;  3A9X A;  2CFB A;  4RJY A;  1ASL A;  3EIA A;  3GR9 A;  4MQR A;  1N31 A;  4H63 Q;  1E5F A;  1D7U A;  2BI2 A;  3E2Y A;  3MAF B;  4F4E A;  2BIG A;  3NUB A;  2W7J A;  5FT6 A;  5M4D A;  1TOI A;  3GWP A;  3LV2 A;  1D2F A;  1LW4 A;  2CAN A;  1BJO B;  1CL2 A;  4MKJ A;  2W7E A;  3K28 A;  5F9S A;  2ZY3 A;  3MC6 C;  2YOB A;  2HP2 A;  1DJU A;  3AV7 A;  4RKD A;  4JE5 D;  2WK9 A; 
#chains in the Genus database with same CATH homology
 1SZS A;  3IHJ A;  1YNU A;  4OT8 A;  1MLZ A;  5J8Q A;  3BCA A;  2W7I A;  1ART A;  4IXS A;  3QN6 A;  3WCO A;  1KKJ A;  4ATQ A;  5DJ9 A;  4ADE A;  1C4K A;  1TOK A;  3USF A;  1KKP A;  2Z1Y A;  1PFF A;  2Z9V A;  3FRK A;  3WY7 A;  2C81 A;  4J8L A;  3FDB A;  2D63 A;  2EO5 A;  4R2N A;  5D95 A;  1ASF A;  2QB3 A;  2VYC A;  5BJ3 A;  2OGE A;  2Z9W A;  2O7C A;  1BQA A;  1CQ6 A;  2W7F A;  4K2I A;  5DX5 A;  4ZWM A;  4LC3 A;  3WCN A;  3EIB A;  5M46 A;  2YCT A;  2FNU A;  1ASG A;  4TMR A;  4WB0 B;  4ZAS A;  5C6U A;  4JF1 A;  3KKI A;  4A6U A;  1ASE A;  4AZJ A;  2O1B A;  1AY5 A;  2BHX A;  1YJZ A;  3L8A A;  1DGD A;  4GEB A;  2X3L A;  1DKA A;  2E7I A;  5HHY A;  4ADD A;  1IUG A;  1CJ0 A;  1O62 A;  4LW4 A;  3BWO A;  2W8T A;  3JTX A;  3TCM A;  1W7L A;  2F8J A;  2D5Y A;  1AIC A;  4KAM A;  2DOU A;  2Z67 A;  3T32 A;  3I5T A;  2W8W A;  2W7M A;  1TAR A;  1DFO A;  1XEY A;  1BJW A;  3QBO A;  1BJN A;  1T3I A;  1GC0 A;  2VMS A;  3JU7 A;  3JWA A;  3ZZJ A;  1KL1 A;  1B4X A;  3KE3 A;  3N0L A;  2QA3 A;  4L0O A;  4WD2 A;  3G8M A;  4O6Z A;  2HOX A;  2VMR A;  4WXF A;  2FM1 A;  2GMU A;  4TV7 A;  1ARI A;  4Q6R A;  2OKJ A;  3HMU A;  4AO4 A;  2GSA A;  4ZM3 A;  1GDE A;  3EI7 A;  2WKA A;  2FKI A;  1M0N A;  1MDX A;  3DR7 A;  1O69 A;  4E3R A;  4FFC A;  1W7N A;  2E7U A;  1B8G A;  2OGA A;  4MGR A;  1TOJ A;  2AY4 A;  1AJS A;  1M4N A;  1QZ9 A;  2DGM A;  4MQQ A;  2JJF A;  4ITX A;  3HT4 A;  5EQC A;  5D5S A;  2AY2 A;  2VMV A;  4ZM4 A;  4XK1 A;  2ZC0 A;  3QI6 A;  3ELP A;  1WST A;  3AAT A;  2VMT A;  3E2Z A;  4M2J A;  2ZY4 A;  1B5P A;  1TAT A;  1TAS A;  4WYA A;  3N4X A;  3PD6 A;  3RUY A;  1ELU A;  4GSA A;  2Z9U A;  3ASA A;  4IXZ A;  2V1P A;  2VMW A;  4WYE A;  1QIT A;  3CAI A;  4ATP A;  2HOZ A;  1G4X A;  1X28 A;  4WBT A;  5JAY A;  2CJD A;  3DRD A;  2BWN A;  2QSR A;  1I43 A;  2YHK A;  4A6T A;  5DB5 A;  3EI9 A;  3NTJ A;  1YAA A;  4RM1 A;  1QIR A;  1SZU A;  2VI9 A;  3AEM C;  4F5F A;  1WYV A;  3VK3 A;  1D7R A;  1MDZ A;  2W7G A;  3UE8 A;  1SFF A;  3WLX A;  3B1E A;  3ECD A;  3FFH A;  4IW7 A;  2ZJG A;  3FVU A;  1YJS A;  2BYL A;  4LNL A;  3PAA A;  3II0 A;  4H51 A;  1UU2 A;  2HUF A;  3DC1 A;  4HVK A;  1AHF A;  2Q7W A;  4A0F A;  1S0A A;  3N5M A;  4JEW A;  2C7T A;  3TFT A;  1EG5 A;  1Y4I A;  2HP1 A;  3A2B A;  4B9B A;  3N75 A;  4OTL A;  4MKK A;  4W1W A;  2QLR A;  2W7D A;  4N0W A;  1V2D A;  3H9X A;  3AEP A;  2OQX A;  2ZSL A;  4XJL A;  3VK2 A;  1UU1 A;  3GZD A;  3F0H A;  3E6G A;  3ASB A;  4K2B A;  1LK9 A;  1OXP A;  1YOO A;  2D64 A;  2ZUK A;  3DZZ A;  3MAF A;  1WKH A;  4E3Q A;  4W5K A;  1AHY A;  1JS6 A;  1W3U A;  1FC4 A;  4W1V A;  4XJP A;  3B1D A;  1BJO A;  1PMO A;  1M32 A;  2BIE A;  3AOW A;  4MSO A;  3NU7 A;  1FG3 A;  1X0M A;  1OHW A;  1DTY A;  2R5C A;  3GET A;  3QHX A;  2YCN A;  4U2H A;  2YKY A;  4JE5 A;  2ZY2 A;  1FG7 A;  1EJI A;  2OAT A;  3IF2 A;  3R9A A;  3ZRQ A;  2BWP A;  1N8P A;  2VLH A;  4UHO A;  1ASA A;  3ATH A;  2HOR A;  4PVF A;  1M0P A;  2QB2 A;  7AAT A;  1C9C A;  3MKJ A;  1LW5 A;  1MLY A;  4PIW A;  4IXO A;  4CBS A;  2W7K A;  3P1T A;  3COG A;  2VMY A;  4F5K A;  2V0Y A;  4OBU A;  1ARG A;  5EFS A;  4F5G A;  1XI9 A;  3DYD A;  1AY8 A;  3QPG A;  1MAQ A;  4XAU A;  3BCX A;  3P6K A;  2WK7 A;  4WB0 A;  1VP4 A;  5FT8 A;  2D7Z A;  2ZYJ A;  1BT4 A;  2GQN A;  3NUI A;  3E77 A;  2JJE A;  4JEY A;  4UHM A;  4W1X A;  3TFU A;  3JZL A;  4Q75 A;  2DGK A;  2R2N A;  3OP7 A;  4P3M A;  4DGT A;  5M49 A;  1CZC A;  3VAX A;  3H7F A;  3PDB A;  1DJ9 A;  2EZ2 A;  4K2M A;  3L44 A;  1LS3 A;  4R5F A;  3N4R A;  3ZRP A;  1WYT A;  1O4S A;  3DR4 A;  1ASN A;  4NOG A;  1V2F A;  3B46 A;  2XBN A;  3NRA A;  4FL0 A;  4OBV A;  2O0R A;  4ISY A;  3AEL A;  1AHX A;  1M0Q A;  1TOG A;  1GC2 A;  4LNM A;  1VJO A;  2Z9X A;  3LVM A;  1ARS A;  1AIA A;  1GD9 A;  4WYC A;  2CH2 A;  3FVX A;  9AAT A;  1AHG A;  1IX8 A;  4XEW A;  3EI5 A;  2C44 A;  2AY8 A;  5E5I A;  3PDX A;  5G2Q A;  3LVL B;  2CTZ A;  4TN4 A;  4XJO A;  5G2P A;  3PPL A;  2VGW A;  1GC4 A;  1BW0 A;  3KGX A;  1E5E A;  1B9H A;  3NDN A;  4IYO B;  4BMK A;  3WKS A;  3PA9 A;  3Q8N A;  3NYS A;  4F5I A;  5LH9 A;  2BI1 A;  1IX7 A;  3DXW A;  2W7H A;  3WGB A;  1JG8 A;  3N4S A;  2D61 A;  2E7J A;  3FSL A;  2ZY5 A;  3AEO A;  3GBX A;  1GC3 A;  4LNJ A;  4RAE A;  1N2T A;  1I41 A;  2VIB A;  1ECX A;  2VI8 A;  2AAT A;  2JG2 A;  3E9K A;  1M6S A;  2CST A;  3UWC A;  2A1V A;  2W7L A;  4OCA A;  4LW2 A;  4GE4 A;  1DJE A;  2ORD A;  4IX8 A;  4RLG A;  2AY1 A;  5KTB A;  2Z61 A;  3EZ1 A;  2VGS A;  3HDO A;  1DGE A;  1S09 A;  2DGL A;  3I16 A;  3DXV A;  1JS3 A;  2JJH A;  1TOE A;  2EH6 A;  2VGT A;  3AEJ A;  1YJY A;  4JEX A;  4Y0H A;  4A0R A;  4DBC A;  2BI3 A;  4GRX A;  3NYT A;  2VLF A;  2PB0 A;  3D6K A;  4J5U A;  1AHE A;  3FKD A;  2EGY A;  4EMY A;  1MGV A;  1YIZ A;  2BIA A;  2CJG A;  3ZRR A;  4N0B A;  5HXX A;  3CQ5 A;  3BS8 A;  4HF8 A;  2C0R A;  3F6T A;  4A0H A;  3MAU A;  5FT5 A;  2YCP A;  1AAW A;  1YIY A;  3FQ7 A;  3H14 A;  2AY9 A;  4WYD A;  3FZ6 A;  4F5M A;  3KGW A;  3RBF A;  2BI5 A;  1W7M A;  1C7O A;  1AX4 A;  2JJG A;  2HUU A;  2RFV A;  5F8V A;  4B98 A;  1ASB A;  3R4T A;  4ADC A;  1LKC A;  1P3W A;  5HDM A;  5IWQ A;  3HBX A;  2CJH A;  4PFF A;  1GEW A;  1RV3 A;  5EIG B;  1C0N A;  5FT4 A;  2W8V A;  1X2A A;  3FFR A;  4JF0 A;  5AX8 A;  1J04 A;  2HUI A;  2DR1 A;  4EU1 A;  3TQX A;  3NX3 A;  1MAP A;  3RCH B;  4Y0D A;  1OAT A;  3G0T A;  3EZS A;  2VMP A;  4W91 A;  4R5Z A;  2X5F A;  4OC9 A;  3FTB A;  4I8A A;  1LC8 A;  1QJ5 A;  3RQ1 A;  1I48 A;  3WX9 A;  4AH3 A;  4A6R A;  2FYF A;  3CQ4 A;  1BS0 A;  1J32 A;  3DOD A;  3LVK A;  4A0G A;  1BQD A;  4ADB A;  5G4J A;  1WYU B;  3I4J A;  1B9I A;  2EYQ A;  3EI6 A;  3BWN A;  1IJI A;  1WKG A;  1OHV A;  2YKX A;  3AEN B;  1ZOD A;  4A72 A;  3HVY A;  2DKB A;  1AJR A;  4IY7 A;  3AEJ C;  1KMJ A;  4KXK A;  5BJ4 A;  4MQP A;  1ARH A;  4W8I A;  3FQ8 A;  3OKS A;  3LWS A;  1GEX A;  2WB6 A;  1IBJ A;  1PG8 A;  1BJ4 A;  3RI6 A;  1SF2 A;  4ZLV A;  1G7X A;  3PIU A;  4BQ0 A;  3WGC A;  3W1J A;  3GSB A;  3K7Y A;  1V2E A;  2G7J A;  3WZF A;  1B5O A;  4CXQ A;  3K40 A;  1V72 A;  1RV4 A;  1C7G A;  2FQ6 A;  4RIT A;  4CXR A;  1CZE A;  1SZK A;  3JW9 A;  4QGR A;  4WLJ A;  4BA5 A;  1EQB A;  1QIS A;  4AZK A;  2FN6 A;  4M2M A;  3ELE A;  1CL1 A;  5EUE A;  1RVU A;  3AOV A;  4GE9 A;  4XQ2 A;  1SPA A;  3QM2 A;  1C7N A;  3QGU A;  4M2K A;  1LC7 A;  2HOY A;  2R5C B;  4BA4 A;  5G09 A;  1LC5 A;  4R8D A;  3GZD C;  1CQ7 A;  5TF5 A;  4F5H A;  1D7S A;  2Z1Z A;  2G6W A;  3FQA A;  1ASD A;  1AMA A;  2GB3 A;  1AMR A;  1TPL A;  4JEZ A;  1AIB A;  2ZP7 A;  5EAV A;  1AKB A;  4Q76 A;  4CBR A;  1PMM A;  3W1H A;  2X5D A;  4F5J A;  4BHD A;  1I29 A;  3B1C A;  3CBF A;  4MY5 A;  2W8U A;  5E4Z A;  1D7V A;  3NU8 A;  4A00 A;  1SVV A;  3BWN C;  1VEF A;  2X8U A;  2AY5 A;  3CQ6 A;  2BKW A;  2R5E A;  3FDD A;  2YKU A;  4KYO A;  4IYO A;  4OYT A;  4CVQ A;  4EB7 A;  1UU0 A;  1W23 A;  2D66 A;  1BKG A;  1ASC A;  4E1O A;  1Z7D A;  2Z20 A;  3BV0 A;  2CY8 A;  4UHN A;  3HQT A;  2EPJ A;  4UQV A;  3PDB B;  3FVS A;  5I92 A;  3A9Z A;  4WXB A;  8AAT A;  1WYT B;  2VMO A;  3AEM A;  3LVJ A;  3DU4 A;  1U08 A;  4ZDL A;  4ZSY A;  3VOM A;  1ELQ A;  1IAY A;  4EB5 A;  1S06 A;  3EUC A;  2JGT A;  4PFN A;  3UAK A;  4DQ6 A;  4ZDO A;  2VMZ A;  2YRR A;  3E2F A;  2VMN A;  1ORD A;  4WP0 A;  1QGN A;  3MEB A;  1AMS A;  5M4B A;  4JEV A;  4WYG A;  3LY1 A;  4P7Y A;  4RKC A;  5G0A A;  2AEV A;  3VK4 A;  5LHA A;  4ZDP A;  1G4V A;  3NYU A;  2YRI A;  2XH1 A;  2QMA A;  1AMQ A;  5EUD A;  5EAA A;  2HZP A;  4AO9 A;  1ASM A;  1IVR A;  5E3K A;  3BCB A;  4ZAH A;  3ISL A;  1UKJ A;  2VMQ A;  2YKV A;  1X29 A;  3MBB A;  2EZ1 A;  4EFF A;  1AJS B;  1ZC9 A;  2BYJ A;  3FZ8 A;  4AOA A;  2AY3 A;  2CB1 A;  1AY4 A;  4RJ0 A;  5G4I A;  2OKK A;  5EIG A;  3LG0 A;  1OHY A;  2CH1 A;  3A8U X;  1AKC A;  1S07 A;  3E2Z B;  2AY6 A;  4OMA A;  2W8J A;  4UOY A;  5DJ1 A;  2VGV A;  3HL2 A;  4ZWV A;  3PD6 B;  2VMU A;  4Q31 A;  4RIZ A;  3RCH A;  4WXG A;  5EUN A;  3MC6 A;  3PJ0 A;  3BN1 A;  1KMK A;  3GJU A;  3BB8 A;  3HLM A;  3A9Y A;  1KL2 A;  3MAD A;  2PO3 A;  4F5L A;  2WK8 A;  2JIS A;  2GMS A;  3B8X A;  3NNK A;  2R0T A;  1RVY A;  4ZSW A;  1MDO A;  1AKA A;  1QJ3 A;  4GDY A;  2D65 A;  3WKR A;  3M5U A;  1M0O A;  1S08 A;  2E54 A;  3JWB A;  1WYV B;  4U1T A;  1WYU A;  3ZZK A;  1O61 A;  3PGY A;  1Z3Z A;  4E77 A;  2AEU A;  4Y0I A;  3AEN A;  1IX6 A;  3FZ7 A;  4GE7 A;  2BWO A;  2ZSM A;  3W1I A;  3ACZ A;  3BC8 A;  3N7N A;  2CIN A;  3G7Q A;  2D7Y A;  2TPL A;  3FD0 A;  3RBL A;  2VMX A;  2AY7 A;  2FNI A;  3F9T A;  1H1C A;  4WLH A;  2QBT A;  3TAT A;  2NMP A;  3EI8 A;  4WYF A;  4ITG A;  1IAX A;  2VIA A;  1M7Y A;  1OXO A;  4XJM A;  5K8B A;  1ZOB A;  1G7W A;  3VP6 A;  2BI9 A;  1GCK A;  1CQ8 A;  2KFP A;  4K05 A;  1AAM A;  1JF9 A;  2VGZ A;  2DKJ A;  3FCR A;  2VGU A;  2PB2 A;  1CS1 A;  1GBN A;  1GEY A;  3GZC A;  1H0C A;  3A9X A;  2CFB A;  4RJY A;  1ASL A;  3EIA A;  3GR9 A;  4MQR A;  1N31 A;  4H63 Q;  1E5F A;  1D7U A;  2BI2 A;  3E2Y A;  3MAF B;  4F4E A;  2BIG A;  3NUB A;  2W7J A;  5FT6 A;  5M4D A;  1TOI A;  3GWP A;  3LV2 A;  1D2F A;  1LW4 A;  2CAN A;  1BJO B;  1CL2 A;  4MKJ A;  2W7E A;  3K28 A;  5F9S A;  2ZY3 A;  3MC6 C;  2YOB A;  2HP2 A;  1DJU A;  3AV7 A;  4RKD A;  4JE5 D;  2WK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...