1AMRA

X-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from escherichia coli in three forms
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from Escherichia coli in three forms.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 140
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1amrA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1amrA01
4M2KA 2GSAA 3COGA 1ZOBA 2CJHA 4A00A 3TQXA 4WLHA 4W1VA 4CBRA 3B46A 4U1TA 2ZSLA 3UE8A 4HF8A 3A9XA 4EB7A 2Z9XA 4PFNA 1G7XA 3R4TA 1H0CA 1WYVA 4ZLVA 1ARTA 1CL1A 3MAFB 1DKAA 2X5FA 3K28A 4N0WA 3K40A 4A0RA 1TOEA 3BWNC 3GETA 4CVQA 3VK2A 3N5MA 1YIYA 4F5FA 3BC8A 1X29A 4BHDA 4JEXA 4F5KA 2ZJGA 4EFFA 5FT8A 3NX3A 1EJIA 2Z1ZA 2AY3A 1LK9A 4A6RA 4MQPA 4A0HA 2FYFA 5J8QA 4KAMA 1WSTA 4RJ0A 1CQ7A 1WKHA 3MADA 4IXOA 4OMAA 1B4XA 3CQ6A 3EI9A 1T3IA 3A2BA 3BCXA 1PMMA 3QN6A 1AAMA 2YCNA 1DGDA 5M4BA 1IX8A 1U08A 3USFA 4GRXA 4ZAHA 4Y0HA 1ASAA 1D2FA 1YOOA 1YNUA 2CH1A 1W23A 1LS3A 3F6TA 2Z9UA 3II0A 4UOYA 4KXKA 2EPJA 2HP2A 4PVFA 2CSTA 1I48A 3JZLA 3D6KA 1AICA 1ASGA 1UU2A 3MAFA 2TPLA 5E5IA 2OGAA 1AKAA 1BW0A 2Z20A 1O4SA 1W7MA 1TOIA 1IJIA 4K2MA 4WYEA 1V72A 1G4XA 3NDNA 2AY9A 5D5SA 2X8UA 1KL2A 4JF1A 4M2JA 2ZY3A 2JJHA 2R5CB 3FQAA 3TFUA 2BIGA 4XEWA 2EGYA 3EZSA 3WZFA 4OBUA 2C0RA 1X28A 4XJPA 1YJYA 2W7DA 3N75A 4CXRA 2PB0A 3WGBA 1AMRA 1AY8A 2JGTA 2JJEA 3HVYA 4MGRA 2C81A 2W7KA 1YAAA 2CANA 1IUGA 2QBTA 3ZRPA 3PAAA 2D7YA 1TOKA 1M32A 2AY4A 3WGCA 9AATA 2GQNA 5G4IA 2VMZA 4OYTA 5FT5A 4TN4A 1H1CA 1TASA 3VOMA 2XH1A 1AY5A 4ZASA 5EAVA 2GMSA 1CS1A 1Z7DA 4EB5A 3AV7A 2VYCA 2WK9A 3I16A 1S09A 3GR9A 2FNIA 3OKSA 4JE5D 3B8XA 2AY8A 3AENB 4WB0B 5DJ1A 4AO4A 3EI5A 3WLXA 4ADDA 4F5LA 2R5CA 4GEBA 5EUNA 1ECXA 1WYUB 1XEYA 3A8UX 4IY7A 4TV7A 1IAXA 5EQCA 4OBVA 4ITGA 1IBJA 3WKSA 4BQ0A 1KL1A 1TPLA 5HHYA 4NOGA 3FKDA 3NRAA 4LNJA 1DFOA 3QM2A 1QISA 2BI1A 3T32A 1AMSA 2V1PA 3I4JA 3BWOA 3H7FA 1DJ9A 2R5EA 3NUBA 2BWOA 3ZRRA 1ARSA 2E7UA 3HQTA 4H51A 2PB2A 3BB8A 3GZCA 2GMUA 3PGYA 4JEWA 1VEFA 4ZDPA 3A9YA 2D7ZA 1OHYA 4JEZA 4AO9A 5BJ3A 4XJLA 3AELA 2W8VA 2DOUA 4MQRA 1AAWA 3AOVA 1SVVA 3AOWA 2YKUA 3FVSA 1CQ8A 2VMRA 2W7JA 3RCHB 3TATA 1I41A 3VK3A 1V2FA 5DX5A 5EAAA 3E2ZB 1ASBA 3B1EA 1IVRA 2OGEA 2YRRA 3AENA 3MEBA 4U2HA 4WB0A 4FL0A 5G09A 5AX8A 3W1JA 5BJ4A 4ZM4A 1AHEA 4GE7A 3LG0A 2WKAA 3CQ5A 1WYUA 3UAKA 4A6UA 5I92A 2HUIA 1B8GA 3EIAA 3NNKA 3PIUA 1OATA 1LKCA 2R2NA 4OC9A 3NYSA 2OQXA 4XK1A 4O6ZA 1M4NA 1AHYA 1O61A 2Z67A 4Q6RA 3DC1A 5LHAA 1QJ5A 3BCBA 5IWQA 3PA9A 4LNLA 1ORDA 3VK4A 5G2QA 2HZPA 4W5KA 4ADEA 4R2NA 4AZKA 1BS0A 5F9SA 4DGTA 2CY8A 1AHGA 2AEVA 1CZCA 1GC3A 1WYTB 4RITA 4UHNA 2BHXA 3MC6A 4XQ2A 4XJOA 4A72A 2ZC0A 1ASCA 4I8AA 1MLYA 1GC4A 3LVMA 4ATQA 3BN1A 3G7QA 3NU7A 3FZ7A 4P3MA 1B5PA 3RCHA 5M4DA 1M0PA 2PO3A 2HOZA 3RBLA 3E2ZA 4GE4A 4Y0DA 1LW4A 4ZWMA 3EI7A 4K2BA 5HXXA 1JG8A 4Q75A 1MAPA 1RVYA 1W7LA 1MDZA 1LC7A 1E5FA 3LWSA 2XBNA 2QB3A 4F5GA 4WYAA 3JW9A 1S06A 3RQ1A 1AMAA 4RLGA 1C4KA 5TF5A 4BA4A 3NYUA 3PDXA 1LW5A 1LC5A 2VMNA 4B98A 3QHXA 1N31A 1YIZA 4R8DA 2VI9A 3RUYA 4UHMA 3JTXA 1WYTA 2YKXA 4WYDA 2VLFA 2C44A 4XJMA 2W7HA 3PJ0A 2VIBA 3ELEA 2BWNA 5K8BA 3L8AA 4OT8A 1XI9A 2G6WA 3CBFA 2DR1A 1IX6A 3JWBA 1MDOA 2VGZA 3I5TA 4E3RA 1AX4A 2BKWA 3E6GA 4Q31A 4WBTA 1C7OA 1J04A 8AATA 1WKGA 4DBCA 1EG5A 3E77A 4RAEA 2ZY5A 5E4ZA 2QB2A 1IX7A 4WYFA 3RBFA 2VI8A 3HT4A 3AEOA 1ASFA 1AMQA 3DU4A 2YCTA 4WD2A 5DJ9A 2BI3A 5G2PA 3ACZA 3MC6C 3R9AA 2VGUA 3TCMA 3FCRA 1ZC9A 2W7EA 2ZY4A 1JF9A 4AZJA 4IW7A 3JU7A 2HUFA 4GSAA 3GZDA 3FDDA 4Y0IA 4MSOA 3ZZJA 1ASEA 3FVUA 2C7TA 2O0RA 4ISYA 1GDEA 2EZ2A 2VIAA 3VAXA 3NYTA 4AOAA 2HORA 4JEYA 1RV3A 4CBSA 5G4JA 1V2DA 1ELQA 3LV2A 2X5DA 3AEPA 1N2TA 4RJYA 3G0TA 4RKCA 3E9KA 4WYCA 1DTYA 3AATA 3LVKA 4JE5A 3EI6A 2ZP7A 2ZY2A 1LC8A 3ISLA 4RM1A 4WYGA 4IXZA 3FZ6A 3WY7A 2OATA 2CTZA 2DKBA 3HMUA 2QA3A 3TFTA 1TATA 4MQQA 1VJOA 1OHVA 1KMKA 2BI2A 2X3LA 3DZZA 4WXFA 2E7IA 1N8PA 1SZSA 1CL2A 4K2IA 1D7VA 1QIRA 3LVJA 2VMYA 1TOJA 3FD0A 3ELPA 1AKBA 3EIBA 1B9HA 2CB1A 2W8WA 2JG2A 5EUEA 2VMPA 2ZYJA 2QLRA 3B1CA 2AY1A 3QPGA 1C7GA 3BCAA 3KE3A 4LW4A 2CJGA 2YKYA 4MKKA 1YJSA 2VGSA 3VP6A 1BJWA 1MAQA 2OKKA 4EMYA 2CJDA 1RVUA 2VMQA 4EU1A 1O62A 2Z61A 2VMOA 1C9CA 1AIAA 1DJUA 3GWPA 4GDYA 2BI5A 3RI6A 1GBNA 3JWAA 4ZSWA 1GEWA 2DKJA 2VGWA 2W7GA 3UWCA 4E77A 2YHKA 3QGUA 2NMPA 2YOBA 1AKCA 4ZWVA 4QGRA 2D65A 1SZKA 2VMTA 3AEMA 3HLMA 1YJZA 4BA5A 2FM1A 3AEJA 4ITXA 3ASAA 4WXBA 3LVLB 1X0MA 5C6UA 2HUUA 5G0AA 3GZDC 1W3UA 2CH2A 2W7FA 4IYOB 4A0GA 3DXVA 2JJFA 4MY5A 4BMKA 3GBXA 2W8UA 1BJOB 2FQ6A 1S0AA 3KGWA 5EIGB 2WK8A 2ORDA 1KKJA 1CJ0A 1S07A 3QBOA 4F4EA 4W1WA 3N0LA 3ZZKA 3L44A 1QJ3A 1B9IA 3KGXA 4J5UA 1IAYA 1M6SA 4ZDOA 3WCOA 3NU8A 2BYLA 1CZEA 1M0QA 1SPAA 5DB5A 5EUDA 3DODA 4R5FA 1UU1A 2GB3A 2AATA 1TOGA 1W7NA 2VGTA 1ASMA 1QZ9A 3IF2A 3WCNA 1BKGA 1MDXA 3DXWA 2FNUA 1OHWA 1BQDA 4LW2A 4AH3A 5JAYA 4LNMA 2VMWA 3P1TA 1AJSB 1EQBA 3MBBA 2V0YA 2Q7WA 4WP0A 3PD6B 4M2MA 1MGVA 1G7WA 1Y4IA 2D66A 2JISA 2EH6A 3DR4A 1B5OA 2HP1A 4IYOA 4PFFA 1P3WA 1I29A 2VMVA 1QITA 4PIWA 3HBXA 4F5JA 1BJOA 3ATHA 3E2YA 3HDOA 5EIGA 4RIZA 5HDMA 3NTJA 3KKIA 1AY4A 2AEUA 3ECDA 3FQ7A 1AIBA 1O69A 1JS3A 2AY5A 2FN6A 3DYDA 4UHOA 4W8IA 1X2AA 3QI6A 5EFSA 2D64A 4WLJA 1BT4A 1GEXA 4IX8A 1VP4A 1C7NA 4L0OA 3BS8A 4JEVA 5FT4A 4ATPA 3FZ8A 1E5EA 4OTLA 3FFHA 1OXPA 1FC4A 1GD9A 4GE9A 4MKJA 2YCPA 1GCKA 1FG3A 1GEYA 3AEMC 5D95A 2VLHA 3AEJC 3ASBA 1M0OA 3EUCA 3F9TA 4ZM3A 3EZ1A 2F8JA 1DGEA 3MKJA 3M5UA 2ZUKA 4FFCA 3Q8NA 3PPLA 3H14A 1JS6A 2HOXA 1AJSA 3E2FA 3PD6A 1D7UA 2DGKA 3K7YA 5F8VA 1Z3ZA 4RKDA 1ARGA 1D7RA 2EZ1A 4E3QA 5M49A 2O1BA 4LC3A 1ASDA 4WXGA 1TARA 3LY1A 4B9BA 1CQ6A 2W7MA 3WKRA 2E7JA 2W7IA 3DR7A 5M46A 3W1HA 4XAUA 2E54A 2DGLA 1AHFA 2O7CA 4ZDLA 4F5HA 3HL2A 1ARHA 3FTBA 3F0HA 2VMUA 1SF2A 2D63A 4F5IA 1ASLA 3GSBA 4A0FA 1M0NA 2D5YA 1KMJA 1D7SA 3WX9A 7AATA 3PDBB 3ZRQA 2AY6A 2R0TA 2YKVA 1BQAA 1KKPA 1V2EA 2BWPA 1ASNA 1BJ4A 2ZSMA 2DGMA 3BWNA 4CXQA 1UU0A 1C0NA 2YRIA 4UQVA 2HOYA 3A9ZA 3FRKA 1RV4A 2CFBA 3DRDA 5E3KA 1PFFA 4A6TA 2BIAA 3GJUA 4R5ZA 1G4VA 4OCAA 4ADCA 3EI8A 1SZUA 3FSLA 2Z1YA 4TMRA 4F5MA 4HVKA 3IHJA 1S08A 2VMXA 3B1DA 4N0BA 3P6KA 1FG7A 1AJRA 1MLZA 1ZODA 2Z9WA 1WYVB 2WK7A 2RFVA 1ELUA 4E1OA 5LH9A 4P7YA 1M7YA 1I43A 4IXSA 4W1XA 1ARIA 4ZSYA 2QMAA 4Q76A 2OKJA 2CINA 4ADBA 3FFRA 1J32A 2VGVA 1PG8A 1AHXA 2BIEA 2BI9A 2Z9VA 3FDBA 1OXOA 1DJEA 1BJNA 4W91A 3CQ4A 3FVXA 1UKJA 2AY7A 2JJGA 3BV0A 3G8MA 2W8TA 3NUIA 1QGNA 1SFFA 3PDBA 1GC2A 4JF0A 3CAIA 3OP7A 3W1IA 1PMOA 4J8LA 5FT6A 3MAUA 4KYOA 2VMSA 2W7LA 2BYJA 4DQ6A 3FQ8A 2EO5A 2D61A 2AY2A 2W8JA 1GC0A
chains in the Genus database with same CATH superfamily
4M2KA 2GSAA 3COGA 1ZOBA 2CJHA 4A00A 3TQXA 4WLHA 4W1VA 4CBRA 3B46A 4U1TA 2ZSLA 3UE8A 5KTBA 4HF8A 3A9XA 4EB7A 2Z9XA 4PFNA 1G7XA 3R4TA 1H0CA 1WYVA 4ZLVA 1ARTA 1CL1A 3MAFB 1DKAA 2X5FA 3K28A 4N0WA 3K40A 4A0RA 1TOEA 3BWNC 3GETA 4CVQA 3VK2A 3N5MA 1YIYA 4F5FA 3BC8A 1X29A 4BHDA 4JEXA 4F5KA 2ZJGA 4EFFA 5FT8A 3NX3A 1EJIA 2Z1ZA 2AY3A 1LK9A 4A6RA 4MQPA 4A0HA 2FYFA 5J8QA 4KAMA 1WSTA 4RJ0A 1CQ7A 1WKHA 3MADA 4IXOA 4OMAA 1B4XA 3CQ6A 3EI9A 1T3IA 3A2BA 3BCXA 1PMMA 3QN6A 1AAMA 2YCNA 1DGDA 5M4BA 1IX8A 1U08A 3USFA 4GRXA 4ZAHA 4Y0HA 1ASAA 1D2FA 1YOOA 1YNUA 2CH1A 1W23A 1LS3A 3F6TA 2Z9UA 3II0A 4UOYA 4KXKA 2EPJA 2HP2A 4PVFA 2CSTA 1I48A 3JZLA 3D6KA 1AICA 1ASGA 1UU2A 3MAFA 2TPLA 5E5IA 2OGAA 1AKAA 1BW0A 2Z20A 1O4SA 1W7MA 1TOIA 1IJIA 4K2MA 4WYEA 1V72A 1G4XA 3NDNA 2AY9A 5D5SA 2X8UA 1KL2A 4JF1A 4M2JA 2ZY3A 2JJHA 2R5CB 3FQAA 3TFUA 2BIGA 4XEWA 2EGYA 3EZSA 3WZFA 4OBUA 2C0RA 1X28A 4XJPA 1YJYA 2W7DA 3N75A 4CXRA 2PB0A 3WGBA 1AMRA 1AY8A 2JGTA 2JJEA 3HVYA 4MGRA 2C81A 2W7KA 1YAAA 2CANA 1IUGA 2QBTA 3ZRPA 3PAAA 2D7YA 1TOKA 1M32A 2AY4A 3WGCA 9AATA 2GQNA 5G4IA 2VMZA 4OYTA 5FT5A 4TN4A 1H1CA 1TASA 3VOMA 2XH1A 1AY5A 4ZASA 5EAVA 2GMSA 1CS1A 1Z7DA 4EB5A 3AV7A 2VYCA 2WK9A 3I16A 1KAFA 1S09A 3GR9A 2FNIA 3OKSA 4JE5D 3B8XA 2AY8A 3AENB 4WB0B 5DJ1A 4AO4A 3EI5A 3WLXA 4ADDA 4F5LA 2R5CA 4GEBA 5EUNA 1ECXA 1WYUB 1XEYA 3A8UX 4IY7A 4TV7A 1IAXA 5EQCA 4OBVA 4ITGA 1IBJA 3WKSA 4BQ0A 1KL1A 1TPLA 5HHYA 4NOGA 3FKDA 3NRAA 4LNJA 1DFOA 3QM2A 1QISA 2BI1A 3T32A 1AMSA 2V1PA 3I4JA 3BWOA 3H7FA 1DJ9A 2R5EA 3NUBA 2BWOA 3ZRRA 1ARSA 2E7UA 3HQTA 4H51A 2PB2A 3BB8A 3GZCA 2GMUA 3PGYA 4JEWA 1VEFA 4ZDPA 3A9YA 2D7ZA 1OHYA 4JEZA 4AO9A 5BJ3A 4XJLA 3AELA 2W8VA 2DOUA 4MQRA 1AAWA 3AOVA 1SVVA 3AOWA 2YKUA 3FVSA 1CQ8A 2VMRA 2W7JA 3RCHB 3TATA 1I41A 3VK3A 1V2FA 5DX5A 5EAAA 3E2ZB 3N7NA 1ASBA 3B1EA 1IVRA 2OGEA 2YRRA 3AENA 3MEBA 4U2HA 4WB0A 4FL0A 5G09A 5AX8A 3W1JA 5BJ4A 4ZM4A 1AHEA 4GE7A 3LG0A 2WKAA 3CQ5A 1WYUA 3UAKA 4A6UA 5I92A 2HUIA 1B8GA 3EIAA 3NNKA 3PIUA 1OATA 1LKCA 2R2NA 4OC9A 3NYSA 2OQXA 4XK1A 4O6ZA 1M4NA 1AHYA 1O61A 2Z67A 4Q6RA 3DC1A 5LHAA 2EYQA 1QJ5A 3BCBA 5IWQA 3PA9A 4LNLA 1ORDA 3VK4A 5G2QA 2HZPA 4W5KA 4ADEA 4R2NA 4AZKA 1BS0A 5F9SA 4DGTA 2CY8A 1AHGA 2AEVA 1CZCA 1GC3A 1WYTB 4RITA 4UHNA 2BHXA 3MC6A 4XQ2A 4XJOA 4A72A 2ZC0A 1ASCA 4I8AA 1MLYA 1GC4A 3LVMA 4ATQA 3BN1A 3G7QA 3NU7A 3FZ7A 4P3MA 1B5PA 3RCHA 5M4DA 1M0PA 2PO3A 2HOZA 3RBLA 3E2ZA 4GE4A 4Y0DA 1LW4A 4ZWMA 3EI7A 4K2BA 5HXXA 1JG8A 4Q75A 1MAPA 1RVYA 1W7LA 1MDZA 1LC7A 1E5FA 3LWSA 2FKIA 2XBNA 2QB3A 4F5GA 4WYAA 3JW9A 1S06A 3RQ1A 1AMAA 4RLGA 1C4KA 5TF5A 4BA4A 3NYUA 3PDXA 1LW5A 1LC5A 2VMNA 4B98A 3QHXA 1N31A 1YIZA 4R8DA 2VI9A 3RUYA 4UHMA 3JTXA 1WYTA 2YKXA 4WYDA 2VLFA 2C44A 4XJMA 2W7HA 3PJ0A 2VIBA 4H63Q 3ELEA 2BWNA 5K8BA 3L8AA 4OT8A 1XI9A 2G6WA 3CBFA 2DR1A 1IX6A 3JWBA 1MDOA 2VGZA 3I5TA 4E3RA 1AX4A 2BKWA 3E6GA 4Q31A 4WBTA 1C7OA 1J04A 8AATA 1WKGA 4DBCA 1EG5A 3E77A 4K05A 4RAEA 2ZY5A 5E4ZA 2QB2A 1IX7A 4WYFA 3RBFA 2VI8A 3HT4A 3AEOA 1ASFA 1AMQA 3DU4A 2YCTA 4WD2A 5DJ9A 2BI3A 5G2PA 3ACZA 3MC6C 3R9AA 2VGUA 3TCMA 3FCRA 1ZC9A 2W7EA 2ZY4A 1JF9A 4AZJA 2KFPA 4IW7A 3JU7A 2HUFA 4GSAA 3GZDA 3FDDA 4Y0IA 4MSOA 3ZZJA 1ASEA 3FVUA 2C7TA 2O0RA 4ISYA 1GDEA 2EZ2A 2VIAA 3VAXA 3NYTA 4AOAA 2HORA 4JEYA 1RV3A 4CBSA 5G4JA 1V2DA 1ELQA 3LV2A 2X5DA 3AEPA 1N2TA 4RJYA 3G0TA 4RKCA 3E9KA 4WYCA 1DTYA 3AATA 3LVKA 4JE5A 3EI6A 2ZP7A 2ZY2A 1LC8A 3ISLA 4RM1A 4WYGA 4IXZA 3FZ6A 3WY7A 2OATA 2CTZA 2DKBA 3HMUA 2QA3A 3TFTA 1TATA 4MQQA 1VJOA 1OHVA 1KMKA 2BI2A 2X3LA 3DZZA 4WXFA 2E7IA 3N4SA 1N8PA 1SZSA 1CL2A 4K2IA 1D7VA 1QIRA 3LVJA 2VMYA 1TOJA 3FD0A 3ELPA 1AKBA 3EIBA 1B9HA 2CB1A 2W8WA 2JG2A 5EUEA 2VMPA 2ZYJA 2QLRA 3B1CA 2AY1A 3QPGA 1C7GA 3BCAA 3KE3A 4LW4A 2CJGA 2YKYA 4MKKA 3N4RA 1YJSA 2VGSA 3VP6A 1BJWA 1MAQA 2OKKA 4EMYA 2CJDA 1RVUA 2VMQA 4EU1A 1O62A 2Z61A 2VMOA 1C9CA 1AIAA 1DJUA 3GWPA 4GDYA 2BI5A 3RI6A 1GBNA 3JWAA 4ZSWA 1GEWA 2DKJA 2VGWA 2W7GA 3UWCA 4E77A 2QSRA 2YHKA 3QGUA 2NMPA 2YOBA 1AKCA 4ZWVA 4QGRA 2D65A 1SZKA 2VMTA 3AEMA 3HLMA 1YJZA 4BA5A 2FM1A 3AEJA 4ITXA 3ASAA 4WXBA 3LVLB 1X0MA 5C6UA 2HUUA 5G0AA 3GZDC 1W3UA 2CH2A 2W7FA 4IYOB 4A0GA 3DXVA 2JJFA 4MY5A 4BMKA 3GBXA 2W8UA 1BJOB 2FQ6A 1S0AA 3KGWA 5EIGB 2WK8A 2ORDA 1KKJA 1CJ0A 1S07A 3QBOA 4F4EA 4W1WA 3N0LA 3ZZKA 3L44A 1QJ3A 1B9IA 2A1VA 3KGXA 4J5UA 1IAYA 1M6SA 4ZDOA 3WCOA 3NU8A 2BYLA 1CZEA 1M0QA 1SPAA 5DB5A 5EUDA 3DODA 4R5FA 1UU1A 2GB3A 2AATA 1TOGA 1W7NA 2VGTA 1ASMA 1QZ9A 3IF2A 3WCNA 1BKGA 1MDXA 3DXWA 2FNUA 1OHWA 1BQDA 4LW2A 4AH3A 5JAYA 4LNMA 2VMWA 3P1TA 1AJSB 1EQBA 3MBBA 2V0YA 2Q7WA 4WP0A 3PD6B 4M2MA 1MGVA 1G7WA 1Y4IA 2G7JA 2D66A 2JISA 2EH6A 3DR4A 1B5OA 2HP1A 4IYOA 4PFFA 1P3WA 1I29A 2VMVA 1QITA 4PIWA 3HBXA 4F5JA 1BJOA 3ATHA 3E2YA 3HDOA 5EIGA 4RIZA 5HDMA 3NTJA 3KKIA 1AY4A 2AEUA 3ECDA 3FQ7A 1AIBA 1O69A 1JS3A 2AY5A 2FN6A 3DYDA 4UHOA 4W8IA 1X2AA 3QI6A 5EFSA 2D64A 4WLJA 1BT4A 1GEXA 4IX8A 1VP4A 1C7NA 4L0OA 3BS8A 4JEVA 5FT4A 4ATPA 3FZ8A 1E5EA 4OTLA 3FFHA 1OXPA 1FC4A 1GD9A 4GE9A 4MKJA 2YCPA 1GCKA 1FG3A 1GEYA 3AEMC 5D95A 2VLHA 3AEJC 3ASBA 1M0OA 3EUCA 3F9TA 4ZM3A 3EZ1A 2F8JA 1DGEA 3MKJA 3M5UA 2ZUKA 4FFCA 3Q8NA 3PPLA 3H14A 1JS6A 2HOXA 1AJSA 3E2FA 3PD6A 1D7UA 2DGKA 3K7YA 5F8VA 1Z3ZA 4RKDA 1ARGA 1D7RA 2EZ1A 4E3QA 5M49A 2O1BA 4LC3A 1ASDA 4WXGA 1TARA 3LY1A 4B9BA 1CQ6A 2W7MA 3WKRA 3H9XA 2E7JA 2W7IA 3DR7A 5M46A 3W1HA 4XAUA 2E54A 2DGLA 1AHFA 2O7CA 4ZDLA 4F5HA 3HL2A 1ARHA 3FTBA 3F0HA 2VMUA 1SF2A 2D63A 4F5IA 1ASLA 3GSBA 4A0FA 1M0NA 2D5YA 1KMJA 1D7SA 3WX9A 7AATA 3PDBB 3ZRQA 2AY6A 2R0TA 2YKVA 1BQAA 1KKPA 1V2EA 2BWPA 1ASNA 1BJ4A 2ZSMA 2DGMA 3BWNA 4CXQA 1UU0A 1C0NA 2YRIA 4UQVA 2HOYA 3A9ZA 3FRKA 1RV4A 2CFBA 3DRDA 5E3KA 1PFFA 4A6TA 2BIAA 3GJUA 4R5ZA 1G4VA 4OCAA 4ADCA 3EI8A 1SZUA 3FSLA 2Z1YA 4TMRA 4F5MA 4HVKA 3IHJA 1S08A 2VMXA 3B1DA 4N0BA 3P6KA 1FG7A 1AJRA 1MLZA 1ZODA 2Z9WA 1WYVB 2WK7A 2RFVA 1ELUA 4E1OA 5LH9A 4P7YA 1M7YA 1I43A 4IXSA 4W1XA 1ARIA 4ZSYA 2QMAA 4Q76A 2OKJA 2CINA 4ADBA 3FFRA 1J32A 2VGVA 1PG8A 1AHXA 2BIEA 2BI9A 2Z9VA 3FDBA 1OXOA 1DJEA 1BJNA 4W91A 3CQ4A 3FVXA 1UKJA 2AY7A 2JJGA 3BV0A 3G8MA 2W8TA 3NUIA 1QGNA 1SFFA 3PDBA 1GC2A 4JF0A 3CAIA 3OP7A 3W1IA 1PMOA 4J8LA 5FT6A 3MAUA 4KYOA 2VMSA 2W7LA 3N4XA 2BYJA 4DQ6A 3FQ8A 2EO5A 2D61A 2AY2A 2W8JA 1GC0A 2WB6A
chains in the Genus database with same CATH topology
4M2KA 2GSAA 3COGA 1ZOBA 2CJHA 4A00A 3TQXA 4WLHA 4W1VA 4CBRA 3B46A 4U1TA 2ZSLA 3UE8A 5KTBA 4HF8A 3A9XA 4EB7A 2Z9XA 4PFNA 1G7XA 3R4TA 1H0CA 1WYVA 4ZLVA 1ARTA 1CL1A 3MAFB 1DKAA 2X5FA 3K28A 4N0WA 3K40A 4A0RA 1TOEA 3BWNC 3GETA 4CVQA 3VK2A 3N5MA 1YIYA 4F5FA 3BC8A 1X29A 4BHDA 4JEXA 4F5KA 2ZJGA 4EFFA 5FT8A 3NX3A 1EJIA 2Z1ZA 2AY3A 1LK9A 4A6RA 4MQPA 4A0HA 2FYFA 5J8QA 4KAMA 1WSTA 4RJ0A 1CQ7A 1WKHA 3MADA 4IXOA 4OMAA 1B4XA 3CQ6A 3EI9A 1T3IA 3A2BA 3BCXA 1PMMA 3QN6A 1AAMA 2YCNA 1DGDA 5M4BA 1IX8A 1U08A 3USFA 4GRXA 4ZAHA 4Y0HA 1ASAA 1D2FA 1YOOA 1YNUA 2CH1A 1W23A 1LS3A 3F6TA 2Z9UA 3II0A 4UOYA 4KXKA 2EPJA 2HP2A 4PVFA 2CSTA 1I48A 3JZLA 3D6KA 1AICA 1ASGA 1UU2A 3MAFA 2TPLA 5E5IA 2OGAA 1AKAA 1BW0A 2Z20A 1O4SA 1W7MA 1TOIA 1IJIA 4K2MA 4WYEA 1V72A 1G4XA 3NDNA 2AY9A 5D5SA 2X8UA 1KL2A 4JF1A 4M2JA 2ZY3A 2JJHA 2R5CB 3FQAA 3TFUA 2BIGA 4XEWA 2EGYA 3EZSA 3WZFA 4OBUA 2C0RA 1X28A 4XJPA 1YJYA 2W7DA 3N75A 4CXRA 2PB0A 3WGBA 1AMRA 1AY8A 2JGTA 2JJEA 3HVYA 4MGRA 2C81A 2W7KA 1YAAA 2CANA 1IUGA 2QBTA 3ZRPA 3PAAA 2D7YA 1TOKA 1M32A 2AY4A 3WGCA 9AATA 2GQNA 5G4IA 2VMZA 4OYTA 5FT5A 4TN4A 1H1CA 1TASA 3VOMA 2XH1A 1AY5A 4ZASA 5EAVA 2GMSA 1CS1A 1Z7DA 4EB5A 3AV7A 2VYCA 2WK9A 3I16A 1S09A 3GR9A 2FNIA 3OKSA 4JE5D 3B8XA 2AY8A 3AENB 4WB0B 5DJ1A 4AO4A 3EI5A 3WLXA 4ADDA 4F5LA 2R5CA 4GEBA 5EUNA 1ECXA 1WYUB 1XEYA 3A8UX 4IY7A 4TV7A 1IAXA 5EQCA 4OBVA 4ITGA 1IBJA 3WKSA 4BQ0A 1KL1A 1TPLA 5HHYA 4NOGA 3FKDA 3NRAA 4LNJA 1DFOA 3QM2A 1QISA 2BI1A 3T32A 1AMSA 2V1PA 3I4JA 3BWOA 3H7FA 1DJ9A 2R5EA 3NUBA 2BWOA 3ZRRA 1ARSA 2E7UA 3HQTA 4H51A 2PB2A 3BB8A 3GZCA 2GMUA 3PGYA 4JEWA 1VEFA 4ZDPA 3A9YA 2D7ZA 1OHYA 4JEZA 4AO9A 5BJ3A 4XJLA 3AELA 2W8VA 2DOUA 4MQRA 1AAWA 3AOVA 1SVVA 3AOWA 2YKUA 3FVSA 1CQ8A 2VMRA 2W7JA 3RCHB 3TATA 1I41A 3VK3A 1V2FA 5DX5A 5EAAA 3E2ZB 3N7NA 1ASBA 3B1EA 1IVRA 2OGEA 2YRRA 3AENA 3MEBA 4U2HA 4WB0A 4FL0A 5G09A 5AX8A 3W1JA 5BJ4A 4ZM4A 1AHEA 4GE7A 3LG0A 2WKAA 3CQ5A 1WYUA 3UAKA 4A6UA 5I92A 2HUIA 1B8GA 3EIAA 3NNKA 3PIUA 1OATA 1LKCA 2R2NA 4OC9A 3NYSA 2OQXA 4XK1A 4O6ZA 1M4NA 1AHYA 1O61A 2Z67A 4Q6RA 3DC1A 5LHAA 2EYQA 1QJ5A 3BCBA 5IWQA 3PA9A 4LNLA 1ORDA 3VK4A 5G2QA 2HZPA 4W5KA 4ADEA 4R2NA 4AZKA 1BS0A 5F9SA 4DGTA 2CY8A 1AHGA 2AEVA 1CZCA 1GC3A 1WYTB 4RITA 4UHNA 2BHXA 3MC6A 4XQ2A 4XJOA 4A72A 2ZC0A 1ASCA 4I8AA 1MLYA 1GC4A 3LVMA 4ATQA 3BN1A 3G7QA 3NU7A 3FZ7A 4P3MA 1B5PA 3RCHA 5M4DA 1M0PA 2PO3A 2HOZA 3RBLA 3E2ZA 4GE4A 4Y0DA 1LW4A 4ZWMA 3EI7A 4K2BA 5HXXA 1JG8A 4Q75A 1MAPA 1RVYA 1W7LA 1MDZA 1LC7A 1E5FA 3LWSA 2FKIA 2XBNA 2QB3A 4F5GA 4WYAA 3JW9A 1S06A 3RQ1A 1AMAA 4RLGA 1C4KA 5TF5A 4BA4A 3NYUA 3PDXA 1LW5A 1LC5A 2VMNA 4B98A 3QHXA 1N31A 1YIZA 4R8DA 2VI9A 3RUYA 4UHMA 3JTXA 1WYTA 2YKXA 4WYDA 2VLFA 2C44A 4XJMA 2W7HA 3PJ0A 2VIBA 4H63Q 3ELEA 2BWNA 5K8BA 3L8AA 4OT8A 1XI9A 2G6WA 3CBFA 2DR1A 1IX6A 3JWBA 1MDOA 2VGZA 3I5TA 4E3RA 1AX4A 2BKWA 3E6GA 4Q31A 4WBTA 1C7OA 1J04A 8AATA 1WKGA 4DBCA 1EG5A 3E77A 4K05A 4RAEA 2ZY5A 5E4ZA 2QB2A 1IX7A 4WYFA 3RBFA 2VI8A 3HT4A 3AEOA 1ASFA 1AMQA 3DU4A 2YCTA 4WD2A 5DJ9A 2BI3A 5G2PA 3ACZA 3MC6C 3R9AA 2VGUA 3TCMA 3FCRA 1ZC9A 2W7EA 2ZY4A 1JF9A 4AZJA 2KFPA 4IW7A 3JU7A 2HUFA 4GSAA 3GZDA 3FDDA 4Y0IA 4MSOA 3ZZJA 1ASEA 3FVUA 2C7TA 2O0RA 4ISYA 1GDEA 2EZ2A 2VIAA 3VAXA 3NYTA 4AOAA 2HORA 4JEYA 1RV3A 4CBSA 5G4JA 1V2DA 1ELQA 3LV2A 2X5DA 3AEPA 1N2TA 4RJYA 3G0TA 4RKCA 3E9KA 4WYCA 1DTYA 3AATA 3LVKA 4JE5A 3EI6A 2ZP7A 2ZY2A 1LC8A 3ISLA 4RM1A 4WYGA 4IXZA 3FZ6A 3WY7A 2OATA 2CTZA 2DKBA 3HMUA 2QA3A 3TFTA 1TATA 4MQQA 1VJOA 1OHVA 1KMKA 2BI2A 2X3LA 3DZZA 4WXFA 2E7IA 3N4SA 1N8PA 1SZSA 1CL2A 4K2IA 1D7VA 1QIRA 3LVJA 2VMYA 1TOJA 3FD0A 3ELPA 1AKBA 3EIBA 1B9HA 2CB1A 2W8WA 2JG2A 5EUEA 2VMPA 2ZYJA 2QLRA 3B1CA 2AY1A 3QPGA 1C7GA 3BCAA 3KE3A 4LW4A 2CJGA 2YKYA 4MKKA 3N4RA 1YJSA 2VGSA 3VP6A 1BJWA 1MAQA 2OKKA 4EMYA 2CJDA 1RVUA 2VMQA 4EU1A 1O62A 2Z61A 2VMOA 1C9CA 1AIAA 1DJUA 3GWPA 4GDYA 2BI5A 3RI6A 1GBNA 3JWAA 4ZSWA 1GEWA 2DKJA 2VGWA 2W7GA 3UWCA 4E77A 2QSRA 2YHKA 3QGUA 2NMPA 2YOBA 1AKCA 4ZWVA 4QGRA 2D65A 1SZKA 2VMTA 3AEMA 3HLMA 1YJZA 4BA5A 2FM1A 3AEJA 4ITXA 3ASAA 4WXBA 3LVLB 1X0MA 5C6UA 2HUUA 5G0AA 3GZDC 1W3UA 2CH2A 2W7FA 4IYOB 4A0GA 3DXVA 2JJFA 4MY5A 4BMKA 3GBXA 2W8UA 1BJOB 2FQ6A 1S0AA 3KGWA 5EIGB 2WK8A 2ORDA 1KKJA 1CJ0A 1S07A 3QBOA 4F4EA 4W1WA 3N0LA 3ZZKA 3L44A 1QJ3A 1B9IA 2A1VA 3KGXA 4J5UA 1IAYA 1M6SA 4ZDOA 3WCOA 3NU8A 2BYLA 1CZEA 1M0QA 1SPAA 5DB5A 5EUDA 3DODA 4R5FA 1UU1A 2GB3A 2AATA 1TOGA 1W7NA 2VGTA 1ASMA 1QZ9A 3IF2A 3WCNA 1BKGA 1MDXA 3DXWA 2FNUA 1OHWA 1BQDA 4LW2A 4AH3A 5JAYA 4LNMA 2VMWA 3P1TA 1AJSB 1EQBA 3MBBA 2V0YA 2Q7WA 4WP0A 3PD6B 4M2MA 1MGVA 1G7WA 1Y4IA 2G7JA 2D66A 2JISA 2EH6A 3DR4A 1B5OA 2HP1A 4IYOA 4PFFA 1P3WA 1I29A 2VMVA 1QITA 4PIWA 3HBXA 4F5JA 1BJOA 3ATHA 3E2YA 3HDOA 5EIGA 4RIZA 5HDMA 3NTJA 3KKIA 1AY4A 2AEUA 3ECDA 3FQ7A 1AIBA 1O69A 1JS3A 2AY5A 2FN6A 3DYDA 4UHOA 4W8IA 1X2AA 3QI6A 5EFSA 2D64A 4WLJA 1BT4A 1GEXA 4IX8A 1VP4A 1C7NA 4L0OA 3BS8A 4JEVA 5FT4A 4ATPA 3FZ8A 1E5EA 4OTLA 3FFHA 1OXPA 1FC4A 1GD9A 4GE9A 4MKJA 2YCPA 1GCKA 1FG3A 1GEYA 3AEMC 5D95A 2VLHA 3AEJC 3ASBA 1M0OA 3EUCA 3F9TA 4ZM3A 3EZ1A 2F8JA 1DGEA 3MKJA 3M5UA 2ZUKA 4FFCA 3Q8NA 3PPLA 3H14A 1JS6A 2HOXA 1AJSA 3E2FA 3PD6A 1D7UA 2DGKA 3K7YA 5F8VA 1Z3ZA 4RKDA 1ARGA 1D7RA 2EZ1A 4E3QA 5M49A 2O1BA 4LC3A 1ASDA 4WXGA 1TARA 3LY1A 4B9BA 1CQ6A 2W7MA 3WKRA 3H9XA 2E7JA 2W7IA 3DR7A 5M46A 3W1HA 4XAUA 2E54A 2DGLA 1AHFA 2O7CA 4ZDLA 4F5HA 3HL2A 1ARHA 3FTBA 3F0HA 2VMUA 1SF2A 2D63A 4F5IA 1ASLA 3GSBA 4A0FA 1M0NA 2D5YA 1KMJA 1D7SA 3WX9A 7AATA 3PDBB 3ZRQA 2AY6A 2R0TA 2YKVA 1BQAA 1KKPA 1V2EA 2BWPA 1ASNA 1BJ4A 2ZSMA 2DGMA 3BWNA 4CXQA 1UU0A 1C0NA 2YRIA 4UQVA 2HOYA 3A9ZA 3FRKA 1RV4A 2CFBA 3DRDA 5E3KA 1PFFA 4A6TA 2BIAA 3GJUA 4R5ZA 1G4VA 4OCAA 4ADCA 3EI8A 1SZUA 3FSLA 2Z1YA 4TMRA 4F5MA 4HVKA 3IHJA 1S08A 2VMXA 3B1DA 4N0BA 3P6KA 1FG7A 1AJRA 1MLZA 1ZODA 2Z9WA 1WYVB 2WK7A 2RFVA 1ELUA 4E1OA 5LH9A 4P7YA 1M7YA 1I43A 4IXSA 4W1XA 1ARIA 4ZSYA 2QMAA 4Q76A 2OKJA 2CINA 4ADBA 3FFRA 1J32A 2VGVA 1PG8A 1AHXA 2BIEA 2BI9A 2Z9VA 3FDBA 1OXOA 1DJEA 1BJNA 4W91A 3CQ4A 3FVXA 1UKJA 2AY7A 2JJGA 3BV0A 3G8MA 2W8TA 3NUIA 1QGNA 1SFFA 3PDBA 1GC2A 4JF0A 3CAIA 3OP7A 3W1IA 1PMOA 4J8LA 5FT6A 3MAUA 4KYOA 2VMSA 2W7LA 3N4XA 2BYJA 4DQ6A 3FQ8A 2EO5A 2D61A 2AY2A 2W8JA 1GC0A 2WB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2K A;  2GSA A;  3COG A;  1ZOB A;  2CJH A;  4A00 A;  3TQX A;  4WLH A;  4W1V A;  4CBR A;  3B46 A;  4U1T A;  2ZSL A;  3UE8 A;  4HF8 A;  3A9X A;  4EB7 A;  2Z9X A;  4PFN A;  1G7X A;  3R4T A;  1H0C A;  1WYV A;  4ZLV A;  1ART A;  1CL1 A;  3MAF B;  1DKA A;  2X5F A;  3K28 A;  4N0W A;  3K40 A;  4A0R A;  1TOE A;  3BWN C;  3GET A;  4CVQ A;  3VK2 A;  3N5M A;  1YIY A;  4F5F A;  3BC8 A;  1X29 A;  4BHD A;  4JEX A;  4F5K A;  2ZJG A;  4EFF A;  5FT8 A;  3NX3 A;  1EJI A;  2Z1Z A;  2AY3 A;  1LK9 A;  4A6R A;  4MQP A;  4A0H A;  2FYF A;  5J8Q A;  4KAM A;  1WST A;  4RJ0 A;  1CQ7 A;  1WKH A;  3MAD A;  4IXO A;  4OMA A;  1B4X A;  3CQ6 A;  3EI9 A;  1T3I A;  3A2B A;  3BCX A;  1PMM A;  3QN6 A;  1AAM A;  2YCN A;  1DGD A;  5M4B A;  1IX8 A;  1U08 A;  3USF A;  4GRX A;  4ZAH A;  4Y0H A;  1ASA A;  1D2F A;  1YOO A;  1YNU A;  2CH1 A;  1W23 A;  1LS3 A;  3F6T A;  2Z9U A;  3II0 A;  4UOY A;  4KXK A;  2EPJ A;  2HP2 A;  4PVF A;  2CST A;  1I48 A;  3JZL A;  3D6K A;  1AIC A;  1ASG A;  1UU2 A;  3MAF A;  2TPL A;  5E5I A;  2OGA A;  1AKA A;  1BW0 A;  2Z20 A;  1O4S A;  1W7M A;  1TOI A;  1IJI A;  4K2M A;  4WYE A;  1V72 A;  1G4X A;  3NDN A;  2AY9 A;  5D5S A;  2X8U A;  1KL2 A;  4JF1 A;  4M2J A;  2ZY3 A;  2JJH A;  2R5C B;  3FQA A;  3TFU A;  2BIG A;  4XEW A;  2EGY A;  3EZS A;  3WZF A;  4OBU A;  2C0R A;  1X28 A;  4XJP A;  1YJY A;  2W7D A;  3N75 A;  4CXR A;  2PB0 A;  3WGB A;  1AMR A;  1AY8 A;  2JGT A;  2JJE A;  3HVY A;  4MGR A;  2C81 A;  2W7K A;  1YAA A;  2CAN A;  1IUG A;  2QBT A;  3ZRP A;  3PAA A;  2D7Y A;  1TOK A;  1M32 A;  2AY4 A;  3WGC A;  9AAT A;  2GQN A;  5G4I A;  2VMZ A;  4OYT A;  5FT5 A;  4TN4 A;  1H1C A;  1TAS A;  3VOM A;  2XH1 A;  1AY5 A;  4ZAS A;  5EAV A;  2GMS A;  1CS1 A;  1Z7D A;  4EB5 A;  3AV7 A;  2VYC A;  2WK9 A;  3I16 A;  1S09 A;  3GR9 A;  2FNI A;  3OKS A;  4JE5 D;  3B8X A;  2AY8 A;  3AEN B;  4WB0 B;  5DJ1 A;  4AO4 A;  3EI5 A;  3WLX A;  4ADD A;  4F5L A;  2R5C A;  4GEB A;  5EUN A;  1ECX A;  1WYU B;  1XEY A;  3A8U X;  4IY7 A;  4TV7 A;  1IAX A;  5EQC A;  4OBV A;  4ITG A;  1IBJ A;  3WKS A;  4BQ0 A;  1KL1 A;  1TPL A;  5HHY A;  4NOG A;  3FKD A;  3NRA A;  4LNJ A;  1DFO A;  3QM2 A;  1QIS A;  2BI1 A;  3T32 A;  1AMS A;  2V1P A;  3I4J A;  3BWO A;  3H7F A;  1DJ9 A;  2R5E A;  3NUB A;  2BWO A;  3ZRR A;  1ARS A;  2E7U A;  3HQT A;  4H51 A;  2PB2 A;  3BB8 A;  3GZC A;  2GMU A;  3PGY A;  4JEW A;  1VEF A;  4ZDP A;  3A9Y A;  2D7Z A;  1OHY A;  4JEZ A;  4AO9 A;  5BJ3 A;  4XJL A;  3AEL A;  2W8V A;  2DOU A;  4MQR A;  1AAW A;  3AOV A;  1SVV A;  3AOW A;  2YKU A;  3FVS A;  1CQ8 A;  2VMR A;  2W7J A;  3RCH B;  3TAT A;  1I41 A;  3VK3 A;  1V2F A;  5DX5 A;  5EAA A;  3E2Z B;  1ASB A;  3B1E A;  1IVR A;  2OGE A;  2YRR A;  3AEN A;  3MEB A;  4U2H A;  4WB0 A;  4FL0 A;  5G09 A;  5AX8 A;  3W1J A;  5BJ4 A;  4ZM4 A;  1AHE A;  4GE7 A;  3LG0 A;  2WKA A;  3CQ5 A;  1WYU A;  3UAK A;  4A6U A;  5I92 A;  2HUI A;  1B8G A;  3EIA A;  3NNK A;  3PIU A;  1OAT A;  1LKC A;  2R2N A;  4OC9 A;  3NYS A;  2OQX A;  4XK1 A;  4O6Z A;  1M4N A;  1AHY A;  1O61 A;  2Z67 A;  4Q6R A;  3DC1 A;  5LHA A;  1QJ5 A;  3BCB A;  5IWQ A;  3PA9 A;  4LNL A;  1ORD A;  3VK4 A;  5G2Q A;  2HZP A;  4W5K A;  4ADE A;  4R2N A;  4AZK A;  1BS0 A;  5F9S A;  4DGT A;  2CY8 A;  1AHG A;  2AEV A;  1CZC A;  1GC3 A;  1WYT B;  4RIT A;  4UHN A;  2BHX A;  3MC6 A;  4XQ2 A;  4XJO A;  4A72 A;  2ZC0 A;  1ASC A;  4I8A A;  1MLY A;  1GC4 A;  3LVM A;  4ATQ A;  3BN1 A;  3G7Q A;  3NU7 A;  3FZ7 A;  4P3M A;  1B5P A;  3RCH A;  5M4D A;  1M0P A;  2PO3 A;  2HOZ A;  3RBL A;  3E2Z A;  4GE4 A;  4Y0D A;  1LW4 A;  4ZWM A;  3EI7 A;  4K2B A;  5HXX A;  1JG8 A;  4Q75 A;  1MAP A;  1RVY A;  1W7L A;  1MDZ A;  1LC7 A;  1E5F A;  3LWS A;  2XBN A;  2QB3 A;  4F5G A;  4WYA A;  3JW9 A;  1S06 A;  3RQ1 A;  1AMA A;  4RLG A;  1C4K A;  5TF5 A;  4BA4 A;  3NYU A;  3PDX A;  1LW5 A;  1LC5 A;  2VMN A;  4B98 A;  3QHX A;  1N31 A;  1YIZ A;  4R8D A;  2VI9 A;  3RUY A;  4UHM A;  3JTX A;  1WYT A;  2YKX A;  4WYD A;  2VLF A;  2C44 A;  4XJM A;  2W7H A;  3PJ0 A;  2VIB A;  3ELE A;  2BWN A;  5K8B A;  3L8A A;  4OT8 A;  1XI9 A;  2G6W A;  3CBF A;  2DR1 A;  1IX6 A;  3JWB A;  1MDO A;  2VGZ A;  3I5T A;  4E3R A;  1AX4 A;  2BKW A;  3E6G A;  4Q31 A;  4WBT A;  1C7O A;  1J04 A;  8AAT A;  1WKG A;  4DBC A;  1EG5 A;  3E77 A;  4RAE A;  2ZY5 A;  5E4Z A;  2QB2 A;  1IX7 A;  4WYF A;  3RBF A;  2VI8 A;  3HT4 A;  3AEO A;  1ASF A;  1AMQ A;  3DU4 A;  2YCT A;  4WD2 A;  5DJ9 A;  2BI3 A;  5G2P A;  3ACZ A;  3MC6 C;  3R9A A;  2VGU A;  3TCM A;  3FCR A;  1ZC9 A;  2W7E A;  2ZY4 A;  1JF9 A;  4AZJ A;  4IW7 A;  3JU7 A;  2HUF A;  4GSA A;  3GZD A;  3FDD A;  4Y0I A;  4MSO A;  3ZZJ A;  1ASE A;  3FVU A;  2C7T A;  2O0R A;  4ISY A;  1GDE A;  2EZ2 A;  2VIA A;  3VAX A;  3NYT A;  4AOA A;  2HOR A;  4JEY A;  1RV3 A;  4CBS A;  5G4J A;  1V2D A;  1ELQ A;  3LV2 A;  2X5D A;  3AEP A;  1N2T A;  4RJY A;  3G0T A;  4RKC A;  3E9K A;  4WYC A;  1DTY A;  3AAT A;  3LVK A;  4JE5 A;  3EI6 A;  2ZP7 A;  2ZY2 A;  1LC8 A;  3ISL A;  4RM1 A;  4WYG A;  4IXZ A;  3FZ6 A;  3WY7 A;  2OAT A;  2CTZ A;  2DKB A;  3HMU A;  2QA3 A;  3TFT A;  1TAT A;  4MQQ A;  1VJO A;  1OHV A;  1KMK A;  2BI2 A;  2X3L A;  3DZZ A;  4WXF A;  2E7I A;  1N8P A;  1SZS A;  1CL2 A;  4K2I A;  1D7V A;  1QIR A;  3LVJ A;  2VMY A;  1TOJ A;  3FD0 A;  3ELP A;  1AKB A;  3EIB A;  1B9H A;  2CB1 A;  2W8W A;  2JG2 A;  5EUE A;  2VMP A;  2ZYJ A;  2QLR A;  3B1C A;  2AY1 A;  3QPG A;  1C7G A;  3BCA A;  3KE3 A;  4LW4 A;  2CJG A;  2YKY A;  4MKK A;  1YJS A;  2VGS A;  3VP6 A;  1BJW A;  1MAQ A;  2OKK A;  4EMY A;  2CJD A;  1RVU A;  2VMQ A;  4EU1 A;  1O62 A;  2Z61 A;  2VMO A;  1C9C A;  1AIA A;  1DJU A;  3GWP A;  4GDY A;  2BI5 A;  3RI6 A;  1GBN A;  3JWA A;  4ZSW A;  1GEW A;  2DKJ A;  2VGW A;  2W7G A;  3UWC A;  4E77 A;  2YHK A;  3QGU A;  2NMP A;  2YOB A;  1AKC A;  4ZWV A;  4QGR A;  2D65 A;  1SZK A;  2VMT A;  3AEM A;  3HLM A;  1YJZ A;  4BA5 A;  2FM1 A;  3AEJ A;  4ITX A;  3ASA A;  4WXB A;  3LVL B;  1X0M A;  5C6U A;  2HUU A;  5G0A A;  3GZD C;  1W3U A;  2CH2 A;  2W7F A;  4IYO B;  4A0G A;  3DXV A;  2JJF A;  4MY5 A;  4BMK A;  3GBX A;  2W8U A;  1BJO B;  2FQ6 A;  1S0A A;  3KGW A;  5EIG B;  2WK8 A;  2ORD A;  1KKJ A;  1CJ0 A;  1S07 A;  3QBO A;  4F4E A;  4W1W A;  3N0L A;  3ZZK A;  3L44 A;  1QJ3 A;  1B9I A;  3KGX A;  4J5U A;  1IAY A;  1M6S A;  4ZDO A;  3WCO A;  3NU8 A;  2BYL A;  1CZE A;  1M0Q A;  1SPA A;  5DB5 A;  5EUD A;  3DOD A;  4R5F A;  1UU1 A;  2GB3 A;  2AAT A;  1TOG A;  1W7N A;  2VGT A;  1ASM A;  1QZ9 A;  3IF2 A;  3WCN A;  1BKG A;  1MDX A;  3DXW A;  2FNU A;  1OHW A;  1BQD A;  4LW2 A;  4AH3 A;  5JAY A;  4LNM A;  2VMW A;  3P1T A;  1AJS B;  1EQB A;  3MBB A;  2V0Y A;  2Q7W A;  4WP0 A;  3PD6 B;  4M2M A;  1MGV A;  1G7W A;  1Y4I A;  2D66 A;  2JIS A;  2EH6 A;  3DR4 A;  1B5O A;  2HP1 A;  4IYO A;  4PFF A;  1P3W A;  1I29 A;  2VMV A;  1QIT A;  4PIW A;  3HBX A;  4F5J A;  1BJO A;  3ATH A;  3E2Y A;  3HDO A;  5EIG A;  4RIZ A;  5HDM A;  3NTJ A;  3KKI A;  1AY4 A;  2AEU A;  3ECD A;  3FQ7 A;  1AIB A;  1O69 A;  1JS3 A;  2AY5 A;  2FN6 A;  3DYD A;  4UHO A;  4W8I A;  1X2A A;  3QI6 A;  5EFS A;  2D64 A;  4WLJ A;  1BT4 A;  1GEX A;  4IX8 A;  1VP4 A;  1C7N A;  4L0O A;  3BS8 A;  4JEV A;  5FT4 A;  4ATP A;  3FZ8 A;  1E5E A;  4OTL A;  3FFH A;  1OXP A;  1FC4 A;  1GD9 A;  4GE9 A;  4MKJ A;  2YCP A;  1GCK A;  1FG3 A;  1GEY A;  3AEM C;  5D95 A;  2VLH A;  3AEJ C;  3ASB A;  1M0O A;  3EUC A;  3F9T A;  4ZM3 A;  3EZ1 A;  2F8J A;  1DGE A;  3MKJ A;  3M5U A;  2ZUK A;  4FFC A;  3Q8N A;  3PPL A;  3H14 A;  1JS6 A;  2HOX A;  1AJS A;  3E2F A;  3PD6 A;  1D7U A;  2DGK A;  3K7Y A;  5F8V A;  1Z3Z A;  4RKD A;  1ARG A;  1D7R A;  2EZ1 A;  4E3Q A;  5M49 A;  2O1B A;  4LC3 A;  1ASD A;  4WXG A;  1TAR A;  3LY1 A;  4B9B A;  1CQ6 A;  2W7M A;  3WKR A;  2E7J A;  2W7I A;  3DR7 A;  5M46 A;  3W1H A;  4XAU A;  2E54 A;  2DGL A;  1AHF A;  2O7C A;  4ZDL A;  4F5H A;  3HL2 A;  1ARH A;  3FTB A;  3F0H A;  2VMU A;  1SF2 A;  2D63 A;  4F5I A;  1ASL A;  3GSB A;  4A0F A;  1M0N A;  2D5Y A;  1KMJ A;  1D7S A;  3WX9 A;  7AAT A;  3PDB B;  3ZRQ A;  2AY6 A;  2R0T A;  2YKV A;  1BQA A;  1KKP A;  1V2E A;  2BWP A;  1ASN A;  1BJ4 A;  2ZSM A;  2DGM A;  3BWN A;  4CXQ A;  1UU0 A;  1C0N A;  2YRI A;  4UQV A;  2HOY A;  3A9Z A;  3FRK A;  1RV4 A;  2CFB A;  3DRD A;  5E3K A;  1PFF A;  4A6T A;  2BIA A;  3GJU A;  4R5Z A;  1G4V A;  4OCA A;  4ADC A;  3EI8 A;  1SZU A;  3FSL A;  2Z1Y A;  4TMR A;  4F5M A;  4HVK A;  3IHJ A;  1S08 A;  2VMX A;  3B1D A;  4N0B A;  3P6K A;  1FG7 A;  1AJR A;  1MLZ A;  1ZOD A;  2Z9W A;  1WYV B;  2WK7 A;  2RFV A;  1ELU A;  4E1O A;  5LH9 A;  4P7Y A;  1M7Y A;  1I43 A;  4IXS A;  4W1X A;  1ARI A;  4ZSY A;  2QMA A;  4Q76 A;  2OKJ A;  2CIN A;  4ADB A;  3FFR A;  1J32 A;  2VGV A;  1PG8 A;  1AHX A;  2BIE A;  2BI9 A;  2Z9V A;  3FDB A;  1OXO A;  1DJE A;  1BJN A;  4W91 A;  3CQ4 A;  3FVX A;  1UKJ A;  2AY7 A;  2JJG A;  3BV0 A;  3G8M A;  2W8T A;  3NUI A;  1QGN A;  1SFF A;  3PDB A;  1GC2 A;  4JF0 A;  3CAI A;  3OP7 A;  3W1I A;  1PMO A;  4J8L A;  5FT6 A;  3MAU A;  4KYO A;  2VMS A;  2W7L A;  2BYJ A;  4DQ6 A;  3FQ8 A;  2EO5 A;  2D61 A;  2AY2 A;  2W8J A;  1GC0 A; 
#chains in the Genus database with same CATH topology
 4M2K A;  2GSA A;  3COG A;  1ZOB A;  2CJH A;  4A00 A;  3TQX A;  4WLH A;  4W1V A;  4CBR A;  3B46 A;  4U1T A;  2ZSL A;  3UE8 A;  5KTB A;  4HF8 A;  3A9X A;  4EB7 A;  2Z9X A;  4PFN A;  1G7X A;  3R4T A;  1H0C A;  1WYV A;  4ZLV A;  1ART A;  1CL1 A;  3MAF B;  1DKA A;  2X5F A;  3K28 A;  4N0W A;  3K40 A;  4A0R A;  1TOE A;  3BWN C;  3GET A;  4CVQ A;  3VK2 A;  3N5M A;  1YIY A;  4F5F A;  3BC8 A;  1X29 A;  4BHD A;  4JEX A;  4F5K A;  2ZJG A;  4EFF A;  5FT8 A;  3NX3 A;  1EJI A;  2Z1Z A;  2AY3 A;  1LK9 A;  4A6R A;  4MQP A;  4A0H A;  2FYF A;  5J8Q A;  4KAM A;  1WST A;  4RJ0 A;  1CQ7 A;  1WKH A;  3MAD A;  4IXO A;  4OMA A;  1B4X A;  3CQ6 A;  3EI9 A;  1T3I A;  3A2B A;  3BCX A;  1PMM A;  3QN6 A;  1AAM A;  2YCN A;  1DGD A;  5M4B A;  1IX8 A;  1U08 A;  3USF A;  4GRX A;  4ZAH A;  4Y0H A;  1ASA A;  1D2F A;  1YOO A;  1YNU A;  2CH1 A;  1W23 A;  1LS3 A;  3F6T A;  2Z9U A;  3II0 A;  4UOY A;  4KXK A;  2EPJ A;  2HP2 A;  4PVF A;  2CST A;  1I48 A;  3JZL A;  3D6K A;  1AIC A;  1ASG A;  1UU2 A;  3MAF A;  2TPL A;  5E5I A;  2OGA A;  1AKA A;  1BW0 A;  2Z20 A;  1O4S A;  1W7M A;  1TOI A;  1IJI A;  4K2M A;  4WYE A;  1V72 A;  1G4X A;  3NDN A;  2AY9 A;  5D5S A;  2X8U A;  1KL2 A;  4JF1 A;  4M2J A;  2ZY3 A;  2JJH A;  2R5C B;  3FQA A;  3TFU A;  2BIG A;  4XEW A;  2EGY A;  3EZS A;  3WZF A;  4OBU A;  2C0R A;  1X28 A;  4XJP A;  1YJY A;  2W7D A;  3N75 A;  4CXR A;  2PB0 A;  3WGB A;  1AMR A;  1AY8 A;  2JGT A;  2JJE A;  3HVY A;  4MGR A;  2C81 A;  2W7K A;  1YAA A;  2CAN A;  1IUG A;  2QBT A;  3ZRP A;  3PAA A;  2D7Y A;  1TOK A;  1M32 A;  2AY4 A;  3WGC A;  9AAT A;  2GQN A;  5G4I A;  2VMZ A;  4OYT A;  5FT5 A;  4TN4 A;  1H1C A;  1TAS A;  3VOM A;  2XH1 A;  1AY5 A;  4ZAS A;  5EAV A;  2GMS A;  1CS1 A;  1Z7D A;  4EB5 A;  3AV7 A;  2VYC A;  2WK9 A;  3I16 A;  1KAF A;  1S09 A;  3GR9 A;  2FNI A;  3OKS A;  4JE5 D;  3B8X A;  2AY8 A;  3AEN B;  4WB0 B;  5DJ1 A;  4AO4 A;  3EI5 A;  3WLX A;  4ADD A;  4F5L A;  2R5C A;  4GEB A;  5EUN A;  1ECX A;  1WYU B;  1XEY A;  3A8U X;  4IY7 A;  4TV7 A;  1IAX A;  5EQC A;  4OBV A;  4ITG A;  1IBJ A;  3WKS A;  4BQ0 A;  1KL1 A;  1TPL A;  5HHY A;  4NOG A;  3FKD A;  3NRA A;  4LNJ A;  1DFO A;  3QM2 A;  1QIS A;  2BI1 A;  3T32 A;  1AMS A;  2V1P A;  3I4J A;  3BWO A;  3H7F A;  1DJ9 A;  2R5E A;  3NUB A;  2BWO A;  3ZRR A;  1ARS A;  2E7U A;  3HQT A;  4H51 A;  2PB2 A;  3BB8 A;  3GZC A;  2GMU A;  3PGY A;  4JEW A;  1VEF A;  4ZDP A;  3A9Y A;  2D7Z A;  1OHY A;  4JEZ A;  4AO9 A;  5BJ3 A;  4XJL A;  3AEL A;  2W8V A;  2DOU A;  4MQR A;  1AAW A;  3AOV A;  1SVV A;  3AOW A;  2YKU A;  3FVS A;  1CQ8 A;  2VMR A;  2W7J A;  3RCH B;  3TAT A;  1I41 A;  3VK3 A;  1V2F A;  5DX5 A;  5EAA A;  3E2Z B;  3N7N A;  1ASB A;  3B1E A;  1IVR A;  2OGE A;  2YRR A;  3AEN A;  3MEB A;  4U2H A;  4WB0 A;  4FL0 A;  5G09 A;  5AX8 A;  3W1J A;  5BJ4 A;  4ZM4 A;  1AHE A;  4GE7 A;  3LG0 A;  2WKA A;  3CQ5 A;  1WYU A;  3UAK A;  4A6U A;  5I92 A;  2HUI A;  1B8G A;  3EIA A;  3NNK A;  3PIU A;  1OAT A;  1LKC A;  2R2N A;  4OC9 A;  3NYS A;  2OQX A;  4XK1 A;  4O6Z A;  1M4N A;  1AHY A;  1O61 A;  2Z67 A;  4Q6R A;  3DC1 A;  5LHA A;  2EYQ A;  1QJ5 A;  3BCB A;  5IWQ A;  3PA9 A;  4LNL A;  1ORD A;  3VK4 A;  5G2Q A;  2HZP A;  4W5K A;  4ADE A;  4R2N A;  4AZK A;  1BS0 A;  5F9S A;  4DGT A;  2CY8 A;  1AHG A;  2AEV A;  1CZC A;  1GC3 A;  1WYT B;  4RIT A;  4UHN A;  2BHX A;  3MC6 A;  4XQ2 A;  4XJO A;  4A72 A;  2ZC0 A;  1ASC A;  4I8A A;  1MLY A;  1GC4 A;  3LVM A;  4ATQ A;  3BN1 A;  3G7Q A;  3NU7 A;  3FZ7 A;  4P3M A;  1B5P A;  3RCH A;  5M4D A;  1M0P A;  2PO3 A;  2HOZ A;  3RBL A;  3E2Z A;  4GE4 A;  4Y0D A;  1LW4 A;  4ZWM A;  3EI7 A;  4K2B A;  5HXX A;  1JG8 A;  4Q75 A;  1MAP A;  1RVY A;  1W7L A;  1MDZ A;  1LC7 A;  1E5F A;  3LWS A;  2FKI A;  2XBN A;  2QB3 A;  4F5G A;  4WYA A;  3JW9 A;  1S06 A;  3RQ1 A;  1AMA A;  4RLG A;  1C4K A;  5TF5 A;  4BA4 A;  3NYU A;  3PDX A;  1LW5 A;  1LC5 A;  2VMN A;  4B98 A;  3QHX A;  1N31 A;  1YIZ A;  4R8D A;  2VI9 A;  3RUY A;  4UHM A;  3JTX A;  1WYT A;  2YKX A;  4WYD A;  2VLF A;  2C44 A;  4XJM A;  2W7H A;  3PJ0 A;  2VIB A;  4H63 Q;  3ELE A;  2BWN A;  5K8B A;  3L8A A;  4OT8 A;  1XI9 A;  2G6W A;  3CBF A;  2DR1 A;  1IX6 A;  3JWB A;  1MDO A;  2VGZ A;  3I5T A;  4E3R A;  1AX4 A;  2BKW A;  3E6G A;  4Q31 A;  4WBT A;  1C7O A;  1J04 A;  8AAT A;  1WKG A;  4DBC A;  1EG5 A;  3E77 A;  4K05 A;  4RAE A;  2ZY5 A;  5E4Z A;  2QB2 A;  1IX7 A;  4WYF A;  3RBF A;  2VI8 A;  3HT4 A;  3AEO A;  1ASF A;  1AMQ A;  3DU4 A;  2YCT A;  4WD2 A;  5DJ9 A;  2BI3 A;  5G2P A;  3ACZ A;  3MC6 C;  3R9A A;  2VGU A;  3TCM A;  3FCR A;  1ZC9 A;  2W7E A;  2ZY4 A;  1JF9 A;  4AZJ A;  2KFP A;  4IW7 A;  3JU7 A;  2HUF A;  4GSA A;  3GZD A;  3FDD A;  4Y0I A;  4MSO A;  3ZZJ A;  1ASE A;  3FVU A;  2C7T A;  2O0R A;  4ISY A;  1GDE A;  2EZ2 A;  2VIA A;  3VAX A;  3NYT A;  4AOA A;  2HOR A;  4JEY A;  1RV3 A;  4CBS A;  5G4J A;  1V2D A;  1ELQ A;  3LV2 A;  2X5D A;  3AEP A;  1N2T A;  4RJY A;  3G0T A;  4RKC A;  3E9K A;  4WYC A;  1DTY A;  3AAT A;  3LVK A;  4JE5 A;  3EI6 A;  2ZP7 A;  2ZY2 A;  1LC8 A;  3ISL A;  4RM1 A;  4WYG A;  4IXZ A;  3FZ6 A;  3WY7 A;  2OAT A;  2CTZ A;  2DKB A;  3HMU A;  2QA3 A;  3TFT A;  1TAT A;  4MQQ A;  1VJO A;  1OHV A;  1KMK A;  2BI2 A;  2X3L A;  3DZZ A;  4WXF A;  2E7I A;  3N4S A;  1N8P A;  1SZS A;  1CL2 A;  4K2I A;  1D7V A;  1QIR A;  3LVJ A;  2VMY A;  1TOJ A;  3FD0 A;  3ELP A;  1AKB A;  3EIB A;  1B9H A;  2CB1 A;  2W8W A;  2JG2 A;  5EUE A;  2VMP A;  2ZYJ A;  2QLR A;  3B1C A;  2AY1 A;  3QPG A;  1C7G A;  3BCA A;  3KE3 A;  4LW4 A;  2CJG A;  2YKY A;  4MKK A;  3N4R A;  1YJS A;  2VGS A;  3VP6 A;  1BJW A;  1MAQ A;  2OKK A;  4EMY A;  2CJD A;  1RVU A;  2VMQ A;  4EU1 A;  1O62 A;  2Z61 A;  2VMO A;  1C9C A;  1AIA A;  1DJU A;  3GWP A;  4GDY A;  2BI5 A;  3RI6 A;  1GBN A;  3JWA A;  4ZSW A;  1GEW A;  2DKJ A;  2VGW A;  2W7G A;  3UWC A;  4E77 A;  2QSR A;  2YHK A;  3QGU A;  2NMP A;  2YOB A;  1AKC A;  4ZWV A;  4QGR A;  2D65 A;  1SZK A;  2VMT A;  3AEM A;  3HLM A;  1YJZ A;  4BA5 A;  2FM1 A;  3AEJ A;  4ITX A;  3ASA A;  4WXB A;  3LVL B;  1X0M A;  5C6U A;  2HUU A;  5G0A A;  3GZD C;  1W3U A;  2CH2 A;  2W7F A;  4IYO B;  4A0G A;  3DXV A;  2JJF A;  4MY5 A;  4BMK A;  3GBX A;  2W8U A;  1BJO B;  2FQ6 A;  1S0A A;  3KGW A;  5EIG B;  2WK8 A;  2ORD A;  1KKJ A;  1CJ0 A;  1S07 A;  3QBO A;  4F4E A;  4W1W A;  3N0L A;  3ZZK A;  3L44 A;  1QJ3 A;  1B9I A;  2A1V A;  3KGX A;  4J5U A;  1IAY A;  1M6S A;  4ZDO A;  3WCO A;  3NU8 A;  2BYL A;  1CZE A;  1M0Q A;  1SPA A;  5DB5 A;  5EUD A;  3DOD A;  4R5F A;  1UU1 A;  2GB3 A;  2AAT A;  1TOG A;  1W7N A;  2VGT A;  1ASM A;  1QZ9 A;  3IF2 A;  3WCN A;  1BKG A;  1MDX A;  3DXW A;  2FNU A;  1OHW A;  1BQD A;  4LW2 A;  4AH3 A;  5JAY A;  4LNM A;  2VMW A;  3P1T A;  1AJS B;  1EQB A;  3MBB A;  2V0Y A;  2Q7W A;  4WP0 A;  3PD6 B;  4M2M A;  1MGV A;  1G7W A;  1Y4I A;  2G7J A;  2D66 A;  2JIS A;  2EH6 A;  3DR4 A;  1B5O A;  2HP1 A;  4IYO A;  4PFF A;  1P3W A;  1I29 A;  2VMV A;  1QIT A;  4PIW A;  3HBX A;  4F5J A;  1BJO A;  3ATH A;  3E2Y A;  3HDO A;  5EIG A;  4RIZ A;  5HDM A;  3NTJ A;  3KKI A;  1AY4 A;  2AEU A;  3ECD A;  3FQ7 A;  1AIB A;  1O69 A;  1JS3 A;  2AY5 A;  2FN6 A;  3DYD A;  4UHO A;  4W8I A;  1X2A A;  3QI6 A;  5EFS A;  2D64 A;  4WLJ A;  1BT4 A;  1GEX A;  4IX8 A;  1VP4 A;  1C7N A;  4L0O A;  3BS8 A;  4JEV A;  5FT4 A;  4ATP A;  3FZ8 A;  1E5E A;  4OTL A;  3FFH A;  1OXP A;  1FC4 A;  1GD9 A;  4GE9 A;  4MKJ A;  2YCP A;  1GCK A;  1FG3 A;  1GEY A;  3AEM C;  5D95 A;  2VLH A;  3AEJ C;  3ASB A;  1M0O A;  3EUC A;  3F9T A;  4ZM3 A;  3EZ1 A;  2F8J A;  1DGE A;  3MKJ A;  3M5U A;  2ZUK A;  4FFC A;  3Q8N A;  3PPL A;  3H14 A;  1JS6 A;  2HOX A;  1AJS A;  3E2F A;  3PD6 A;  1D7U A;  2DGK A;  3K7Y A;  5F8V A;  1Z3Z A;  4RKD A;  1ARG A;  1D7R A;  2EZ1 A;  4E3Q A;  5M49 A;  2O1B A;  4LC3 A;  1ASD A;  4WXG A;  1TAR A;  3LY1 A;  4B9B A;  1CQ6 A;  2W7M A;  3WKR A;  3H9X A;  2E7J A;  2W7I A;  3DR7 A;  5M46 A;  3W1H A;  4XAU A;  2E54 A;  2DGL A;  1AHF A;  2O7C A;  4ZDL A;  4F5H A;  3HL2 A;  1ARH A;  3FTB A;  3F0H A;  2VMU A;  1SF2 A;  2D63 A;  4F5I A;  1ASL A;  3GSB A;  4A0F A;  1M0N A;  2D5Y A;  1KMJ A;  1D7S A;  3WX9 A;  7AAT A;  3PDB B;  3ZRQ A;  2AY6 A;  2R0T A;  2YKV A;  1BQA A;  1KKP A;  1V2E A;  2BWP A;  1ASN A;  1BJ4 A;  2ZSM A;  2DGM A;  3BWN A;  4CXQ A;  1UU0 A;  1C0N A;  2YRI A;  4UQV A;  2HOY A;  3A9Z A;  3FRK A;  1RV4 A;  2CFB A;  3DRD A;  5E3K A;  1PFF A;  4A6T A;  2BIA A;  3GJU A;  4R5Z A;  1G4V A;  4OCA A;  4ADC A;  3EI8 A;  1SZU A;  3FSL A;  2Z1Y A;  4TMR A;  4F5M A;  4HVK A;  3IHJ A;  1S08 A;  2VMX A;  3B1D A;  4N0B A;  3P6K A;  1FG7 A;  1AJR A;  1MLZ A;  1ZOD A;  2Z9W A;  1WYV B;  2WK7 A;  2RFV A;  1ELU A;  4E1O A;  5LH9 A;  4P7Y A;  1M7Y A;  1I43 A;  4IXS A;  4W1X A;  1ARI A;  4ZSY A;  2QMA A;  4Q76 A;  2OKJ A;  2CIN A;  4ADB A;  3FFR A;  1J32 A;  2VGV A;  1PG8 A;  1AHX A;  2BIE A;  2BI9 A;  2Z9V A;  3FDB A;  1OXO A;  1DJE A;  1BJN A;  4W91 A;  3CQ4 A;  3FVX A;  1UKJ A;  2AY7 A;  2JJG A;  3BV0 A;  3G8M A;  2W8T A;  3NUI A;  1QGN A;  1SFF A;  3PDB A;  1GC2 A;  4JF0 A;  3CAI A;  3OP7 A;  3W1I A;  1PMO A;  4J8L A;  5FT6 A;  3MAU A;  4KYO A;  2VMS A;  2W7L A;  3N4X A;  2BYJ A;  4DQ6 A;  3FQ8 A;  2EO5 A;  2D61 A;  2AY2 A;  2W8J A;  1GC0 A;  2WB6 A; 
#chains in the Genus database with same CATH homology
 4M2K A;  2GSA A;  3COG A;  1ZOB A;  2CJH A;  4A00 A;  3TQX A;  4WLH A;  4W1V A;  4CBR A;  3B46 A;  4U1T A;  2ZSL A;  3UE8 A;  5KTB A;  4HF8 A;  3A9X A;  4EB7 A;  2Z9X A;  4PFN A;  1G7X A;  3R4T A;  1H0C A;  1WYV A;  4ZLV A;  1ART A;  1CL1 A;  3MAF B;  1DKA A;  2X5F A;  3K28 A;  4N0W A;  3K40 A;  4A0R A;  1TOE A;  3BWN C;  3GET A;  4CVQ A;  3VK2 A;  3N5M A;  1YIY A;  4F5F A;  3BC8 A;  1X29 A;  4BHD A;  4JEX A;  4F5K A;  2ZJG A;  4EFF A;  5FT8 A;  3NX3 A;  1EJI A;  2Z1Z A;  2AY3 A;  1LK9 A;  4A6R A;  4MQP A;  4A0H A;  2FYF A;  5J8Q A;  4KAM A;  1WST A;  4RJ0 A;  1CQ7 A;  1WKH A;  3MAD A;  4IXO A;  4OMA A;  1B4X A;  3CQ6 A;  3EI9 A;  1T3I A;  3A2B A;  3BCX A;  1PMM A;  3QN6 A;  1AAM A;  2YCN A;  1DGD A;  5M4B A;  1IX8 A;  1U08 A;  3USF A;  4GRX A;  4ZAH A;  4Y0H A;  1ASA A;  1D2F A;  1YOO A;  1YNU A;  2CH1 A;  1W23 A;  1LS3 A;  3F6T A;  2Z9U A;  3II0 A;  4UOY A;  4KXK A;  2EPJ A;  2HP2 A;  4PVF A;  2CST A;  1I48 A;  3JZL A;  3D6K A;  1AIC A;  1ASG A;  1UU2 A;  3MAF A;  2TPL A;  5E5I A;  2OGA A;  1AKA A;  1BW0 A;  2Z20 A;  1O4S A;  1W7M A;  1TOI A;  1IJI A;  4K2M A;  4WYE A;  1V72 A;  1G4X A;  3NDN A;  2AY9 A;  5D5S A;  2X8U A;  1KL2 A;  4JF1 A;  4M2J A;  2ZY3 A;  2JJH A;  2R5C B;  3FQA A;  3TFU A;  2BIG A;  4XEW A;  2EGY A;  3EZS A;  3WZF A;  4OBU A;  2C0R A;  1X28 A;  4XJP A;  1YJY A;  2W7D A;  3N75 A;  4CXR A;  2PB0 A;  3WGB A;  1AMR A;  1AY8 A;  2JGT A;  2JJE A;  3HVY A;  4MGR A;  2C81 A;  2W7K A;  1YAA A;  2CAN A;  1IUG A;  2QBT A;  3ZRP A;  3PAA A;  2D7Y A;  1TOK A;  1M32 A;  2AY4 A;  3WGC A;  9AAT A;  2GQN A;  5G4I A;  2VMZ A;  4OYT A;  5FT5 A;  4TN4 A;  1H1C A;  1TAS A;  3VOM A;  2XH1 A;  1AY5 A;  4ZAS A;  5EAV A;  2GMS A;  1CS1 A;  1Z7D A;  4EB5 A;  3AV7 A;  2VYC A;  2WK9 A;  3I16 A;  1S09 A;  3GR9 A;  2FNI A;  3OKS A;  4JE5 D;  3B8X A;  2AY8 A;  3AEN B;  4WB0 B;  5DJ1 A;  4AO4 A;  3EI5 A;  3WLX A;  4ADD A;  4F5L A;  2R5C A;  4GEB A;  5EUN A;  1ECX A;  1WYU B;  1XEY A;  3A8U X;  4IY7 A;  4TV7 A;  1IAX A;  5EQC A;  4OBV A;  4ITG A;  1IBJ A;  3WKS A;  4BQ0 A;  1KL1 A;  1TPL A;  5HHY A;  4NOG A;  3FKD A;  3NRA A;  4LNJ A;  1DFO A;  3QM2 A;  1QIS A;  2BI1 A;  3T32 A;  1AMS A;  2V1P A;  3I4J A;  3BWO A;  3H7F A;  1DJ9 A;  2R5E A;  3NUB A;  2BWO A;  3ZRR A;  1ARS A;  2E7U A;  3HQT A;  4H51 A;  2PB2 A;  3BB8 A;  3GZC A;  2GMU A;  3PGY A;  4JEW A;  1VEF A;  4ZDP A;  3A9Y A;  2D7Z A;  1OHY A;  4JEZ A;  4AO9 A;  5BJ3 A;  4XJL A;  3AEL A;  2W8V A;  2DOU A;  4MQR A;  1AAW A;  3AOV A;  1SVV A;  3AOW A;  2YKU A;  3FVS A;  1CQ8 A;  2VMR A;  2W7J A;  3RCH B;  3TAT A;  1I41 A;  3VK3 A;  1V2F A;  5DX5 A;  5EAA A;  3E2Z B;  3N7N A;  1ASB A;  3B1E A;  1IVR A;  2OGE A;  2YRR A;  3AEN A;  3MEB A;  4U2H A;  4WB0 A;  4FL0 A;  5G09 A;  5AX8 A;  3W1J A;  5BJ4 A;  4ZM4 A;  1AHE A;  4GE7 A;  3LG0 A;  2WKA A;  3CQ5 A;  1WYU A;  3UAK A;  4A6U A;  5I92 A;  2HUI A;  1B8G A;  3EIA A;  3NNK A;  3PIU A;  1OAT A;  1LKC A;  2R2N A;  4OC9 A;  3NYS A;  2OQX A;  4XK1 A;  4O6Z A;  1M4N A;  1AHY A;  1O61 A;  2Z67 A;  4Q6R A;  3DC1 A;  5LHA A;  2EYQ A;  1QJ5 A;  3BCB A;  5IWQ A;  3PA9 A;  4LNL A;  1ORD A;  3VK4 A;  5G2Q A;  2HZP A;  4W5K A;  4ADE A;  4R2N A;  4AZK A;  1BS0 A;  5F9S A;  4DGT A;  2CY8 A;  1AHG A;  2AEV A;  1CZC A;  1GC3 A;  1WYT B;  4RIT A;  4UHN A;  2BHX A;  3MC6 A;  4XQ2 A;  4XJO A;  4A72 A;  2ZC0 A;  1ASC A;  4I8A A;  1MLY A;  1GC4 A;  3LVM A;  4ATQ A;  3BN1 A;  3G7Q A;  3NU7 A;  3FZ7 A;  4P3M A;  1B5P A;  3RCH A;  5M4D A;  1M0P A;  2PO3 A;  2HOZ A;  3RBL A;  3E2Z A;  4GE4 A;  4Y0D A;  1LW4 A;  4ZWM A;  3EI7 A;  4K2B A;  5HXX A;  1JG8 A;  4Q75 A;  1MAP A;  1RVY A;  1W7L A;  1MDZ A;  1LC7 A;  1E5F A;  3LWS A;  2FKI A;  2XBN A;  2QB3 A;  4F5G A;  4WYA A;  3JW9 A;  1S06 A;  3RQ1 A;  1AMA A;  4RLG A;  1C4K A;  5TF5 A;  4BA4 A;  3NYU A;  3PDX A;  1LW5 A;  1LC5 A;  2VMN A;  4B98 A;  3QHX A;  1N31 A;  1YIZ A;  4R8D A;  2VI9 A;  3RUY A;  4UHM A;  3JTX A;  1WYT A;  2YKX A;  4WYD A;  2VLF A;  2C44 A;  4XJM A;  2W7H A;  3PJ0 A;  2VIB A;  4H63 Q;  3ELE A;  2BWN A;  5K8B A;  3L8A A;  4OT8 A;  1XI9 A;  2G6W A;  3CBF A;  2DR1 A;  1IX6 A;  3JWB A;  1MDO A;  2VGZ A;  3I5T A;  4E3R A;  1AX4 A;  2BKW A;  3E6G A;  4Q31 A;  4WBT A;  1C7O A;  1J04 A;  8AAT A;  1WKG A;  4DBC A;  1EG5 A;  3E77 A;  4K05 A;  4RAE A;  2ZY5 A;  5E4Z A;  2QB2 A;  1IX7 A;  4WYF A;  3RBF A;  2VI8 A;  3HT4 A;  3AEO A;  1ASF A;  1AMQ A;  3DU4 A;  2YCT A;  4WD2 A;  5DJ9 A;  2BI3 A;  5G2P A;  3ACZ A;  3MC6 C;  3R9A A;  2VGU A;  3TCM A;  3FCR A;  1ZC9 A;  2W7E A;  2ZY4 A;  1JF9 A;  4AZJ A;  2KFP A;  4IW7 A;  3JU7 A;  2HUF A;  4GSA A;  3GZD A;  3FDD A;  4Y0I A;  4MSO A;  3ZZJ A;  1ASE A;  3FVU A;  2C7T A;  2O0R A;  4ISY A;  1GDE A;  2EZ2 A;  2VIA A;  3VAX A;  3NYT A;  4AOA A;  2HOR A;  4JEY A;  1RV3 A;  4CBS A;  5G4J A;  1V2D A;  1ELQ A;  3LV2 A;  2X5D A;  3AEP A;  1N2T A;  4RJY A;  3G0T A;  4RKC A;  3E9K A;  4WYC A;  1DTY A;  3AAT A;  3LVK A;  4JE5 A;  3EI6 A;  2ZP7 A;  2ZY2 A;  1LC8 A;  3ISL A;  4RM1 A;  4WYG A;  4IXZ A;  3FZ6 A;  3WY7 A;  2OAT A;  2CTZ A;  2DKB A;  3HMU A;  2QA3 A;  3TFT A;  1TAT A;  4MQQ A;  1VJO A;  1OHV A;  1KMK A;  2BI2 A;  2X3L A;  3DZZ A;  4WXF A;  2E7I A;  3N4S A;  1N8P A;  1SZS A;  1CL2 A;  4K2I A;  1D7V A;  1QIR A;  3LVJ A;  2VMY A;  1TOJ A;  3FD0 A;  3ELP A;  1AKB A;  3EIB A;  1B9H A;  2CB1 A;  2W8W A;  2JG2 A;  5EUE A;  2VMP A;  2ZYJ A;  2QLR A;  3B1C A;  2AY1 A;  3QPG A;  1C7G A;  3BCA A;  3KE3 A;  4LW4 A;  2CJG A;  2YKY A;  4MKK A;  3N4R A;  1YJS A;  2VGS A;  3VP6 A;  1BJW A;  1MAQ A;  2OKK A;  4EMY A;  2CJD A;  1RVU A;  2VMQ A;  4EU1 A;  1O62 A;  2Z61 A;  2VMO A;  1C9C A;  1AIA A;  1DJU A;  3GWP A;  4GDY A;  2BI5 A;  3RI6 A;  1GBN A;  3JWA A;  4ZSW A;  1GEW A;  2DKJ A;  2VGW A;  2W7G A;  3UWC A;  4E77 A;  2QSR A;  2YHK A;  3QGU A;  2NMP A;  2YOB A;  1AKC A;  4ZWV A;  4QGR A;  2D65 A;  1SZK A;  2VMT A;  3AEM A;  3HLM A;  1YJZ A;  4BA5 A;  2FM1 A;  3AEJ A;  4ITX A;  3ASA A;  4WXB A;  3LVL B;  1X0M A;  5C6U A;  2HUU A;  5G0A A;  3GZD C;  1W3U A;  2CH2 A;  2W7F A;  4IYO B;  4A0G A;  3DXV A;  2JJF A;  4MY5 A;  4BMK A;  3GBX A;  2W8U A;  1BJO B;  2FQ6 A;  1S0A A;  3KGW A;  5EIG B;  2WK8 A;  2ORD A;  1KKJ A;  1CJ0 A;  1S07 A;  3QBO A;  4F4E A;  4W1W A;  3N0L A;  3ZZK A;  3L44 A;  1QJ3 A;  1B9I A;  2A1V A;  3KGX A;  4J5U A;  1IAY A;  1M6S A;  4ZDO A;  3WCO A;  3NU8 A;  2BYL A;  1CZE A;  1M0Q A;  1SPA A;  5DB5 A;  5EUD A;  3DOD A;  4R5F A;  1UU1 A;  2GB3 A;  2AAT A;  1TOG A;  1W7N A;  2VGT A;  1ASM A;  1QZ9 A;  3IF2 A;  3WCN A;  1BKG A;  1MDX A;  3DXW A;  2FNU A;  1OHW A;  1BQD A;  4LW2 A;  4AH3 A;  5JAY A;  4LNM A;  2VMW A;  3P1T A;  1AJS B;  1EQB A;  3MBB A;  2V0Y A;  2Q7W A;  4WP0 A;  3PD6 B;  4M2M A;  1MGV A;  1G7W A;  1Y4I A;  2G7J A;  2D66 A;  2JIS A;  2EH6 A;  3DR4 A;  1B5O A;  2HP1 A;  4IYO A;  4PFF A;  1P3W A;  1I29 A;  2VMV A;  1QIT A;  4PIW A;  3HBX A;  4F5J A;  1BJO A;  3ATH A;  3E2Y A;  3HDO A;  5EIG A;  4RIZ A;  5HDM A;  3NTJ A;  3KKI A;  1AY4 A;  2AEU A;  3ECD A;  3FQ7 A;  1AIB A;  1O69 A;  1JS3 A;  2AY5 A;  2FN6 A;  3DYD A;  4UHO A;  4W8I A;  1X2A A;  3QI6 A;  5EFS A;  2D64 A;  4WLJ A;  1BT4 A;  1GEX A;  4IX8 A;  1VP4 A;  1C7N A;  4L0O A;  3BS8 A;  4JEV A;  5FT4 A;  4ATP A;  3FZ8 A;  1E5E A;  4OTL A;  3FFH A;  1OXP A;  1FC4 A;  1GD9 A;  4GE9 A;  4MKJ A;  2YCP A;  1GCK A;  1FG3 A;  1GEY A;  3AEM C;  5D95 A;  2VLH A;  3AEJ C;  3ASB A;  1M0O A;  3EUC A;  3F9T A;  4ZM3 A;  3EZ1 A;  2F8J A;  1DGE A;  3MKJ A;  3M5U A;  2ZUK A;  4FFC A;  3Q8N A;  3PPL A;  3H14 A;  1JS6 A;  2HOX A;  1AJS A;  3E2F A;  3PD6 A;  1D7U A;  2DGK A;  3K7Y A;  5F8V A;  1Z3Z A;  4RKD A;  1ARG A;  1D7R A;  2EZ1 A;  4E3Q A;  5M49 A;  2O1B A;  4LC3 A;  1ASD A;  4WXG A;  1TAR A;  3LY1 A;  4B9B A;  1CQ6 A;  2W7M A;  3WKR A;  3H9X A;  2E7J A;  2W7I A;  3DR7 A;  5M46 A;  3W1H A;  4XAU A;  2E54 A;  2DGL A;  1AHF A;  2O7C A;  4ZDL A;  4F5H A;  3HL2 A;  1ARH A;  3FTB A;  3F0H A;  2VMU A;  1SF2 A;  2D63 A;  4F5I A;  1ASL A;  3GSB A;  4A0F A;  1M0N A;  2D5Y A;  1KMJ A;  1D7S A;  3WX9 A;  7AAT A;  3PDB B;  3ZRQ A;  2AY6 A;  2R0T A;  2YKV A;  1BQA A;  1KKP A;  1V2E A;  2BWP A;  1ASN A;  1BJ4 A;  2ZSM A;  2DGM A;  3BWN A;  4CXQ A;  1UU0 A;  1C0N A;  2YRI A;  4UQV A;  2HOY A;  3A9Z A;  3FRK A;  1RV4 A;  2CFB A;  3DRD A;  5E3K A;  1PFF A;  4A6T A;  2BIA A;  3GJU A;  4R5Z A;  1G4V A;  4OCA A;  4ADC A;  3EI8 A;  1SZU A;  3FSL A;  2Z1Y A;  4TMR A;  4F5M A;  4HVK A;  3IHJ A;  1S08 A;  2VMX A;  3B1D A;  4N0B A;  3P6K A;  1FG7 A;  1AJR A;  1MLZ A;  1ZOD A;  2Z9W A;  1WYV B;  2WK7 A;  2RFV A;  1ELU A;  4E1O A;  5LH9 A;  4P7Y A;  1M7Y A;  1I43 A;  4IXS A;  4W1X A;  1ARI A;  4ZSY A;  2QMA A;  4Q76 A;  2OKJ A;  2CIN A;  4ADB A;  3FFR A;  1J32 A;  2VGV A;  1PG8 A;  1AHX A;  2BIE A;  2BI9 A;  2Z9V A;  3FDB A;  1OXO A;  1DJE A;  1BJN A;  4W91 A;  3CQ4 A;  3FVX A;  1UKJ A;  2AY7 A;  2JJG A;  3BV0 A;  3G8M A;  2W8T A;  3NUI A;  1QGN A;  1SFF A;  3PDB A;  1GC2 A;  4JF0 A;  3CAI A;  3OP7 A;  3W1I A;  1PMO A;  4J8L A;  5FT6 A;  3MAU A;  4KYO A;  2VMS A;  2W7L A;  3N4X A;  2BYJ A;  4DQ6 A;  3FQ8 A;  2EO5 A;  2D61 A;  2AY2 A;  2W8J A;  1GC0 A;  2WB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...