1ANBA

Anionic trypsin mutant with ser 214 replaced by glu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVEWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the polar environment of Asp102 in trypsin: consequences of replacing conserved Ser214.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA02
1H9LB 1T32A 3BG4C 4AFZA 1W7XH 3I78A 1ETRH 1BZXE 1HAPH 2H9HA 1OWHA 1C1PA 3RU4D 2DE8A 7GCHF 1V6DA 2PR3A 4IMQA 1NRQH 1P2KA 1GI5A 1PPCE 3GOVB 5HM9A 2A5IA 3M37A 3RXFA 1UTNA 3LPRA 3O8CA 1TNLA 1HPGA 1C9TA 3NXPA 3A7WA 3A83A 1JXPA 1PYTC 5DO4H 1XXFA 3GDVA 3GDSA 1HYLA 1JIRA 1HXFH 3S7KB 1ZR0A 1O5GH 2XXLA 1NN6A 5C1XA 1RTKA 4KP0A 2SGQE 4THNH 1O2WA 2Q6DA 2V3HH 4YO9A 2ZG0H 1K28D 2FI4E 1QFKH 3RXJA 1DUEA 2QY0B 1YPHE 2GT7A 3RMNH 2FPZA 4D7FA 2PV9B 1GJ8B 3LGIA 3M61U 3M7QA 2HNTE 1MTVA 4AG1A 1AE8H 3BTQE 5ETXA 2QXIA 1IQFA 8KME2 2ZHFH 4HFPB 1IQMA 1ZHRA 1AN1E 1K1OA 1FN6A 3AASA 2AGEX 4I8KA 1GMDF 2EI8A 1FLEE 2OQUA 2B8OH 3B9FH 4DJZB 1NO9H 3RXAA 1Z8RA 1H9HE 3MTYA 3BV9B 3UTUH 1HAYB 1GVLA 1IQGA 1ANDA 5C5OA 5CHAC 2J9NA 1QA0A 1NESE 1BTWA 2SGAA 1BT7A 3ITIA 1EPTC 1TYNA 4VGCC 4X8SH 4R0IA 1O3MA 1EZUC 1L1JA 4KTUA 1JRTA 4JZIA 2B5TB 3S9BA 2Y5HA 2W3IA 1C5PA 1LPZB 3U1IB 1V2PT 1GBDA 1OWIA 1HIAA 1FDPA 3RU4E 1UTQA 1TNIA 3F9HA 3GISB 2PUXB 1ZMLA 2FO9A 2OTVA 1Y5BT 1G3BA 2GTBA 2EI7A 3T25A 1QIXB 3K6ZA 3FP6E 5DP4A 3PO1C 4ZXXH 2PWXA 1TALA 2ZDNA 1C4Y2 1TIOA 4OS7A 3VEQB 2I6QA 4J2YB 3BG8A 3KCGH 1V2RT 4ISLA 1FUJA 4FUBA 1A2CH 1DSUA 5F6MA 1OYTH 3ENSB 4U32A 5LPEA 5EXMA 4DURA 4Y8YA 2BD8A 1XUHA 2J38A 2IN2A 1T8OA 2XNIA 4UDWH 2WPLS 4X2VA 4FXGH 4XFQA 3MU0A 3ODDA 1V2VT 5K0HA 1N8OB 2C8YB 3CENA 3SV2H 3PLPA 4Y71A 2H9EH 4A7IB 3U69H 3P95A 2GP9B 2Y6TA 2UUFB 1UK3A 2RDLA 1DY8A 1VCWA 1GHBF 4OGYA 1F92A 2Z9GA 2Z9LA 3HATH 1ZPZA 4IBLH 3SU1A 3V3MA 1P2NA 1TPSA 1GI9B 8ESTE 1THPB 2P3FH 3QO6A 5F8XA 1OWEA 3SNBA 1LCYA 2EI6A 1LKAA 1K1PA 2J34A 6LPRA 3E90B 1YPJH 1XMNB 2RA3A 3HKIB 3SJIA 4A1XA 1F0UA 1SL3A 4FVBA 4FU8A 2QF3A 1O2IA 1ELBA 1Y3UA 2GZ7A 3M3SA 2FIRH 1OWKA 3MMGA 1B0FA 3VGCC 3KQBA 1HDTH 5FX5A 2OD3B 4OS2A 1RGQA 3NZIA 2ZPQA 3OY5U 1ZTLA 5JB9S 2P95A 4OS4A 1PYTD 3NKKA 1YPGH 1P04A 1CA8B 3ATIA 2Z94A 4CRDA 2CV3A 3QLPH 2NU4E 1H8DH 3MWIU 2VH6A 3Q3YA 1Z71A 3QZRA 1JBUH 1VGCC 1KDQB 1ZMJA 4AOQA 2AMPA 4ABHA 4XDEA 1HJAC 1THSH 1TNHA 1BOQA 2SGDE 3M5OA 1D6RA 1AMHA 1LHDH 2VWMA 4ISIH 3FVFB 1GCTC 2UWOA 2ZDVH 2VU8E 5EPYA 1EASA 2AIQA 3DHKH 4NGAH 3TIUA 3F9FA 1V2NT 4JZFH 3T27A 3IITA 3EYDA 4ZKNU 1CBWB 3UOUA 3E6PH 1UTJA 4AB8A 1LO6A 8LPRA 4WF8A 2QAAA 4KKDA 4NFEA 3URCA 4B75A 4GVUA 4Y11E 2QF0A 1TQ0B 3CS0A 1OXGA 5DP8A 3DT0H 3RXTA 1BRBE 1EQ9A 3MFJA 3L33A 1SGNE 1FAXA 1C1OA 1C2HA 5GWZA 3BTME 5AHGH 3Q00A 1UO6A 2ULLA 2Y81A 1ZSJA 3M36A 1EJAA 1DE7H 1UTPA 4WH8A 3TITA 5GIBA 3RMOH 3PM3A 1GJ9B 3RXKA 1MBMA 2G5VA 2BDBA 4GLYA 4Y0ZE 2VNTA 3ODFA 2VVUA 4D9RA 1O3PB 1UTMA 2BQ7B 2PW8H 2TGTA 4B73A 4JK6A 1MCVA 1YBWA 3T62A 1D6WA 1DXPA 1Y5UT 2OC0A 3I77A 1GHBG 1Z8IB 2BYAX 3ATLA 1O3CA 4X1QU 2CHAB 2IJOB 1G30B 1EPTA 1MAYA 1QL7A 5FCKA 4DT7B 1TOCB 1HAHH 1VJ9U 1C2DA 1O2KA 4YM9A 1RS0A 1O3KA 2QA9E 1K9OE 4X6OA 2BY6X 1OWJA 1O33A 1QURH 1AFQC 3EE0B 3A8AA 3B23B 4HTCH 2W7UA 1YLCA 5K7RA 5CHAB 4Y8XA 1B7XB 1ZHMA 2BQ6B 3A87A 1KXFA 1TGCA 1K21H 2BOHB 1ANCA 3RM0H 2FOBA 1PPBH 2HNTC 1SGTA 2C93B 2QYIA 1G32B 1GBMA 1KXBA 1QJ7B 2ZIQH 1GI4A 1WQSA 1HCGA 1GGDB 1RIWC 1VITG 1BCUH 3CP7A 2WPJS 1CT0E 3EA7A 4GSOA 1H1BA 4FVDA 2ANMH 5A2MH 1F0RA 1V2MT 2ZFSA 1A5GH 1L1NA 1SMFE 1FAKH 4CR9A 3SHAH 4NZLA 3O8DA 2OP9A 2NU3E 1GHVH 1EOLA 4X1SU 1GJ4H 4NG9H 2GX4A 2VIVA 1DFPA 3OU0A 4LOYH 4ZHAA 1AIXH 4CRGA 2QGRA 3RC6A 3QTOH 2CN0H 2TPIZ 2HNTF 4I8JA 3A7YA 3BTFE 3RLYH 4YT7H 2FTMA 1V2UT 1HBTH 3E0PB 4AX9H 3RXCA 5FBEA 3SQEE 1ANEA 1HAVA 1LVMA 1O2JA 2XW9A 3MHWU 4X1PU 1O30A 1SQOA 2P3UB 2O9QA 1L4DA 3MOCA 1SG8B 2Q1JA 1SLUB 3LC3A 1O2UA 5DPAA 1BB0B 3QTVH 1ARCA 1KLIH 4JZ1A 1XM1A 3TJVA 1RTLA 3GCHC 2ZGJA 3ZVGA 2VIDA 1NS3A 1D3TB 2ZPRA 1YCPH 1MTWA 5LPFA 1Q31A 1QNJA 2A7JA 3M5MA 4CRFA 1O3HA 2A32A 1A61H 1NROH 1BRUP 4ZMAH 1C5SA 2AS9A 1SI5H 1DWBH 4ZKRU 2Y5FA 2XYAA 3RUOA 1HJ9A 4RKJB 1GBJA 1GHAF 1MTNB 4IS5A 1CQQA 2HLCA 2VGCB 1B0EA 1PPHE 2EC9H 2Y82A 3GYLB 4XBDA 1AZZA 2WYJA 1CT2E 2FOHA 2BZAA 3RXRA 3ZVEA 6ESTA 2ZHQH 3F9GA 3RMLH 1C5QA 1C1SA 5L30H 1W13U 4K8BA 5EODA 5GDSH 1TRMA 3BTTE 1O0DH 2ZGCA 1UVUH 1UCYH 3H7TA 2BX3A 2Z9JA 1C5XB 3RMMH 2UUJB 1QJ6B 2XC4A 3M35A 3HK6B 2ODQA 4JYVH 5JBCS 4CH8B 2ZKSA 3KHVA 1SHYA 2Q6GA 1UVSH 1ZHPA 3E1XB 1P3EA 1TWXB 2XBVA 5FX6A 1GJBB 1Z8JB 5F8ZA 3UY9A 2GMTB 1O31A 4X2XA 4XBCA 1BMAA 2W7SA 5C1YA 2C8XB 5GJ4B 1ELDE 1L0ZA 1AD8H 1BHXF 2J4IA 3NCLA 1TMUH 2UUYA 2GDEH 1D3PB 1KSNA 4OS1A 1C9PA 4X6MA 1NT1A 2O8MA 3U1JB 2CF8H 1O2XA 3BSQA 2BQWB 1HAXB 2PHBA 5HMAA 1A46H 2H9TH 1HLTH 4NFFA 4UEHH 3URDA 2FI5E 1S83A 1G3CA 1Y3VA 1TBRH 3KQEA 3SUDA 2SGPE 2G8TA 1FY1A 5HYOA 4H6TA 2BD7A 4UFEH 4TYDA 3SOSA 5LGOA 2BDCA 5EOKA 2G52A 2OQ5A 5C1UA 1V2KT 1AZ8A 1O34A 3PMHB 5F03A 1LKBA 1GGDC 1RIWB 3Q3XA 1WOFA 1RD3B 3IG6B 2BDYA 1GBBA 1LVBA 1P12E 4YZUA 5EXLA 4NWKA 1VCQA 5T3HA 2BXUH 3K65B 1CGJE 2V3OH 1PFXC 3A86A 1NRPH 1Z6EA 1MTSA 1P9UA 1FXYA 1SGQE 1MUEB 3SUGA 2XWBI 1PQAA 3HGPA 2ZFFH 4BAHB 3UNSA 2BLOA 3RU4T 1DSTA 2BDHA 1OKXA 2WV4A 1AGJA 2WINI 1RJXB 2HRVA 1QBVH 3A7VA 2VVCA 3E3TA 1FV9A 4Z6AH 3GY3A 1JOUB 1XKAC 2FLRH 1T8LA 4B1TA 1GBKA 1BJUA 1LTOA 1GMHF 3T5FH 1DWDH 3QK1A 5EW1H 1RFNA 3RXEA 1UVPA 5C5NA 1GI0A 3RXUA 4Q80A 3MNBA 3I29A 5JPMH 4TWWA 1GL0E 2F9PA 1C1UH 2PTCE 2VVVA 2A2QH 1P8VC 4KTSA 4WXVA 4O3UA 3RXSA 4O97A 2ZU4A 1NU7B 1P02A 1C1MA 4X8UH 1HAZB 2ZO3H 3Q77A 1O2TA 3T28A 4BAMB 2YNAA 1O5CB 4XOJA 5FBIA 1GMHG 4ISNA 3LU9B 3L3TA 3SGAE 4WJG2 2PKSC 4K69A 1NFXA 3MO9A 2O8WA 3LGYA 1LPKB 1O3IA 3TPIZ 4H42U 1GJ5H 3M3VA 3VB4A 2Y7ZA 3SJ8A 3KGPA 3KEEA 4YLQH 1EOJA 1EPTB 1MKXH 4I32A 8GCHG 5A09A 6CHAC 2RG3A 3UPEA 1Y3XA 1V2LT 1TPAE 1NFWA 3KF2A 1WCZA 1GBTA 2R3YA 1NC6A 3MU8A 2ZQ1A 3TGKE 2KAIB 2PKAA 1D3QB 2GGVB 1GMDG 2F9VA 2K1QA 2ZDLA 3RXGA 2STBE 2OINA 2BVRH 4NSYA 1ELVA 5EQQA 1F5LA 4I8GA 1P11E 1O2LA 1XUFA 4K5ZA 4ZHLU 1MAXA 2VH0A 1B5GH 1GBAA 1FPHH 1SLWB 3AW1A 1INCA 3RLWH 3P8NA 2GZ9A 1A1RA 1MD8A 2FODA 2HPQH 5IDKA 1O39A 3EA9A 2UWLA 2A5KA 3ZYDA 1ZTJA 1ZJKA 2BD3A 4KTCA 1QB6A 3V13A 1ZYOA 4NA7A 1TRNA 3ZVAA 1YC0A 3ZV8A 3EGKH 1EZXC 1C1NA 1OWDA 1CGIE 3SI3H 3P70B 1XUGA 3MNXA 1TLDA 4A1VA 1PPZA 2ZHWH 3UQOA 3OSYA 3DD2H 1OOKB 1FY3A 1H8IH 1LHCH 2BLQA 1T31A 1UTKA 4K1SA 1S6HA 2FEQH 2BY7X 1Z6JH 4DOQA 2BD5A 1D4PB 3ZZ4A 2ZGXH 2G00A 2ZCHP 3QDZB 1EKBB 3SV8A 3DFLA 1UTOA 2VIWA 3TH3H 3U9AH 3O8RA 1ZRBA 1TX6A 2ZDKA 1ABJH 1BBRH 4AB9A 2J92A 2FWWA 4JCNA 4IW4E 1E35B 4H6SB 4MNYA 2ZQ2A 3BEIB 3Q3KA 4ZUHA 2XTTB 4MPXA 4O03A 2Q6FA 5DGJA 1LMWB 1TPOA 2ZZUH 4NIXA 2Z7FE 4Q7XA 1HAGE 1MTUA 2BY9X 1GVKB 3LH1A 5GCHG 5DP9A 1EJNA 4D7GA 1Q3XA 2FTLE 1SOZA 5E0JA 1DS2E 1RRKA 2P8OB 2Z9KA 3LGWA 1ZGVA 1TGSZ 3FP8E 4KELA 1TX8A 3SU0A 4B2BA 1AWHB 3GCTG 2QC2A 1MD7A 4NIWA 1WQVH 2ZTXA 3KNXA 1C1VH 1EAWA 1P03A 1K1MA 4GHTA 1WV7H 2ZFPH 1HNEE 2XC5A 5L2YH 1E34B 1N6XA 2A45B 2H5CA 2QCYA 5C20A 1XKBC 2TBSA 1NFUA 5DP5A 1BTXA 2W3KA 4BAKB 1DXWA 3SHCH 3BIUH 3MU5A 1G36A 1BBRE 1TMBH 3U8OH 1O2YA 1IHSH 3VB3A 4MQAA 3QGNB 1DWEH 4ABDA 4DIHH 1G3EA 1P2QA 2LPRA 1O2NA 1ELCA 1ZPBA 2FDAA 3NWUA 1QJ1B 2AIPA 5E2OA 1GMCG 1JRSA 3SGQE 1O2VA 2GCTB 4I7YH 1FPCH 1C1RA 1A0JA 1GMCF 1TB6H 3S9CA 2PTNA 2V35A 1J9CH 2BHGA 1LHFH 4X1NU 3AW0A 1ORFA 2VGCC 3S0NA 1O3FA 1SBWA 2D2DA 1SGDE 3SGBE 1W10U 2R2WU 1O3JA 2FXRA 2ZCLP 1GDQA 3ZZDA 3K2UA 4AG2A 1N1LA 2THFB 1CGHA 1J15A 1ELEE 1QRZA 1LVYA 1BITA 1BMNH 1TGBA 2A4GA 2G4UA 1O3EA 1PQ8A 3SJ9A 3BEFB 4GAWA 4CR5A 2XBWA 2A4RA 1LHEH 3VGCB 1U6QA 5J4SA 2H6MA 1E38B 1WYKA 1W7GH 1CBWC 5EPNA 2FYRA 2PGBB 3BN9A 4B71A 2ZFQH 3KIDU 4CHAC 3AAUA 1AFEH 1ANBA 4B76A 4ESTE 2VWLA 5CMXH 5GCHF 1DWCH 4FUHA 3HPTB 1T4VH 1LDTT 1H4WA 1OP0A 3RC4A 4IN1A 4WVPE 1AHTH 4FU7A 4GUXA 2OBQA 1O2OA 1Z1IA 3ZZ6A 2RA0A 3W95A 4X1RU 4Y10E 1BBRK 3SNDA 5GXPA 3PWBA 1Y8TA 1KDQA 1O3OA 1L1GA 3SNCA 2ZWLH 1IHTH 1NZQH 3AVZA 3E8LA 4A5TS 2ZECA 3HKJB 2ASUB 3A8BA 5DP7A 1ESTA 1UTLM 2R2MB 2STAE 4AFQA 4UONA 1F0SA 3BTEE 1WTHD 1ELFA 1YYY1 3LC5A 3C1KA 1TMTH 2BD9A 1BQYA 2ODYB 2ZI2H 3A82A 4HZHA 1K22H 2XBXA 1YCPM 3KN2A 3MH5A 1EZSC 1MU8B 2FLBH 5AF9H 3UNRA 3N7OA 4JMYA 1T8NA 1TBQH 4DVAU 1C5ZB 3SV6A 2GDDA 2FOAA 1AI8H 2A0QB 3GY2A 3LGUA 2R9PA 1HXEH 3SJOA 1HAIH 3OYPA 2JH5D 3SI4H 1V2OT 1ZMNA 2F3CE 3VPKA 2A31A 3LH3A 1O2SA 4ZAEA 1HAOH 1L4ZA 3TK5A 7ESTE 2P93A 2EEKA 1GJCB 4JZEH 1LQDB 1MKWK 1C4V2 2ZCKP 4ABBA 3U8TH 2B7DH 1OPHB 2IOTA 4OS5A 5EXNA 1O3NA 2FS8A 3M5LA 3MO3A 1IAUA 2JH6D 3A7ZA 2FZZA 3OTJE 3STIA 4LXBH 1MBQA 2C90B 2H1UA 2PLXA 4I31A 1O2PA 3GYMA 2NU1E 1SVPA 1KIGH 2C4FH 2ZTZA 2ZU1A 3M3TA 3LIWA 4FUIA 3E91A 1GJ7B 2VIOA 2ZDAH 5DP3A 1P9SA 3R3GB 2HWLB 1QQ4A 1GHAG 3TU7H 4Y79A 3RXDA 2B9LA 2VWNA 2BOKA 5LH8A 2A2XH 2FMJA 1W14U 3NUMA 4XBBA 5A0AE 4ZH8A 4CREA 3VFEA 1WUNH 4TPYA 3SV7A 3PYHA 3GY5A 1SGPE 2VIQA 1C5UA 5EQSA 2A5AA 1ZSLA 1A3BH 1PPEE 5JYIA 1RXPA 1DUAA 1AU8A 1ID5H 1BTUA 1HIAB 3P8OA 5C67A 3QUMP 1TX7A 3P8FA 1C5LH 3V7TA 4BXWA 2F9OA 4ABFA 3SNEA 1MH0A 2FOFA 2YOLA 1EZQA 1K1IA 1CO7E 2G55A 2P8OC 1JMOH 2TGPZ 1ELAA 2ESTE 4MNVA 2DE9A 5BRRE 4NA8A 1YM0A 4I8HA 1O5BB 2ZFRH 4UE7H 3UFAA 2GT8A 1D3DB 2UUKB 1TA2A 2C3SA 2GKVE 5G4BA 4BNRA 1BRAA 2GCHG 4IC5A 3KL6A 2G5NA 3KQDA 1A5IA 5AFYH 3BF6H 1W0ZU 1C5OH 1C4U2 5HM2A 1GWAA 2I6SA 3SU3A 4AFUA 1OP8A 2FX6A 4BAOB 2AMQA 4MTBA 4CRAA 2PUQH 1NFYA 1KLJH 1AQ7A 3FZDA 1V2ST 3BEUA 2XCNA 4R8TB 3A7TA 2LNCA 4BTUB 1YCPK 2QXJA 4OGXA 3FANA 3ZZ3A 1P3CA 1PPFE 2JKHA 4WMDA 1C2KA 1G2LA 5FHTA 4BTTB 2AH4X 1GBEA 1O37A 1C5YB 5E0GA 6CHAB 3FP7E 3BTKE 3UNQA 2G51A 3RXVA 4ZHMU 5CE1A 3GY7A 1O5AB 4MNXA 2WPIS 1GHZA 2XBYA 3FAOA 2ZGBH 3CS7A 1IOEA 5EGMA 3TK9A 4CBOA 1OSSA 4XE4A 5J4QA 2WPMS 1GHXH 1GVZA 3Q76A 1TGTA 2BX4A 1ELTA 1G2MA 1O2RA 1J8AA 1D9IA 5L2ZH 3STJA 1O38A 3PWCA 1FNIA 1NPMA 1DOJA 1UCYK 2Z3CA 1NY22 3HGNA 3ZZAA 1J17T 5EG4A 1FY5A 1GI8B 2ALPA 5FPTA 3M5NA 4ISOA 4SGAE 4CRBA 3PTBA 1QTFA 1O35A 1T4UH 1JWTA 3D65E 2AMDA 1YPMH 1AUTC 3ATWA 3UR9A 4PROA 2O8UA 1QGFA 4X2WA 1BTZA 1P2JA 5C3NA 1TAWA 2R0LA 2Y7XA 4WWYA 1AKSB 1QA7A 4LZ1H 1GDNA 2ZU2A 1SQTA 1DX5M 3RXHA 5A8YA 1F7ZA 2ZU3A 3P6ZB 1WAYB 1O5EH 4YT6H 4HGCA 4Y7AA 1MZDA 1P06A 3EA8A 4E06H 4AORA 4U2WA 2FOCA 2HPPH 1AO5A 5FXLA 3WY8A 1NU9A 3TGIE 4AN7A 2OLGA 1P01A 1CE5A 6GCHG 4WMFA 1LQEA 5HGGA 3QZQA 4NIVA 1CA0C 3PMJA 3V0XA 1S5SA 4XSKU 4K60A 1BRCE 2R0KA 3UUZA 1KXDA 3V12A 2G81E 1F5KU 2OXSA 3UWIA 3SUEA 3LOXA 3A84A 1DDJA 4Q7YA 1GBLA 1LPGB 2H5DA 3BG4B 2GMTC 1ABIH 3TH4H 2V0BA 3E0NB 1C5VA 1W11U 1S0RA 1GI7B 1HJAB 4X0WU 3LKWA 4Y76A 2F9BH 1UVOA 1ZZZA 2O8LA 1VGCB 4Q2KA 1XVOA 2XCFA 5EW2H 1Q2WA 1X7AC 2Z6BD 1C5RA 3MNSA 4X2YA 1C2FA 4ABEA 1P05A 2QV1A 4LK4A 4RSPA 2A4OA 1EB1H 4BXSA 2ZC9H 3GY6A 1F0TA 2F91A 1WBGB 1TA6A 2OC8A 2BD4A 1ZPCA 9ESTA 1N6YA 2CF9H 4MPWA 2VINA 1AFQB 1MKXK 3TH2H 1ACBE 1YKTA 2NU0E 1GJDB 1AUJA 2JETC 3ZZ8A 1ETTH 1UK4A 3ESTA 2CMYA 5DG6A 1GHWH 3RXQA 5HXFA 2BZ6H 3MO6A 1DT2A 4INHA 2GCHF 1O3LA 1AB9C 1G9IE 1AWFH 2BLVA 2NWNA 1V2WT 2CHAC 3OX7U 1AB9B 1MMJN 4ASHA 1A3EH 3UWJH 2FM2A 4OS6A 6GCHF 1ZTKA 1QB1A 1UVTH 4D9QA 3IWMA 1MU6B 3SZNA 1PJPA 1EUFA 1W0YH 2A7CA 4DGJA 1BTPA 1SFIA 1DLEA 3A89A 1FIWA 1QL8A 1C2MA 1TRYA 3T29A 4CRCA 1EAXA 1SGCA 3MH6A 1SPJA 4ABJA 2FESH 2ZP0H 2ZU5A 3ZYEA 3PLBA 1Y3WA 1XVMA 1YLDA 1WSSH 2O8TA 5FPSA 4B2AA 3T2NA 1MQ6A 3ATKA 3SU4A 3LGVA 5JBTA 1EJMA 4ZKSU 1ZGIA 4B74A 1HUTH 2GVFA 1E37B 1Z1JA 3RM2H 2Y80A 2WPHS 1QY6A 3ATMA 1CU1A 1LVOA 1GI1A 4JZDH 2A1DB 2GV7A 2ZF0H 3P17H 1KTTB 2FX4A 3DA9B 2PFEA 3RXLA 1GI3A 3LJJA 4Y7BA 5T6GA 2TIOA 4MPUA 4DY7B 1BIOA 2OUAA 3GCNA 1SHHB 1SB1H 1IQEA 5BPEA 1IQIA 5GPIB 1SLVB 1HFDA 1O3AA 4UFFH 1S0QA 4F49A 3TNSA 1V2JT 4DCDA 1IQJA 1GJ6A 1O2ZA 3BTDE 1OX1A 5EU8A 3RP2A 1GHYH 4YOJA 3GCHB 4WMEA 4FU9A 3A8CA 1IQHA 2BTCE 9LPRA 1KLTA 1QHRB 1WTGH 1AKSA 1K1JA 1GL1A 1HRTH 3VB5A 4WY3A 2ZTYA 3ZZ7A 1XX9A 1GPZA 2ALVA 2BDGA 2OC7A 4FUCA 3M7UA 1O36A 2ZHEH 1XUIA 1BA8B 3A80A 1KXCA 1TQ7B 2RCEA 1KXEA 5I46H 3GDUA 4AGJA 5DP6A 2ILNA 2SFAA 2TRMA 3G01A 4U30A 3S9AA 3SU6A 2A7HA 2BMGB 2J2UA 1AVWA 1CT4E 1GBIA 3MU4A 4YESB 3PLKA 4E7RG 3MYWA 3BIVH 1VITF 5E2PA 1SGFA 1W3CA 3RDZA 5I25A 5A8ZA 4D76A 3VXEH 7LPRA 2ZGHA 4UD9H 5EQRA 3T26A 1ELGA 1TONA 3RXOA 1C2LA 3SNAA 1YPHC 4FUFA 5TCAA 2YNBA 3LT3A 2ZHDA 2PKAB 1UK2A 4CHAB 3B8JA 5L6NH 7GCHG 1QL9A 1TABE 4D8NA 1C1WH 3FFGA 4CBNA 2ZDMA 4K1EA 1NRNH 1TOMH 2QXHA 4ABAA 3QX5H 5E0HA 5F8TA 1P0SH 1DANH 2C8WB 3RC5A 1O2MA 3A8DA 1Y59T 2Z3EA 3RXBA 1A5HA 3ZVDA 1WU1A 1C1TA 3TJNA 2V6NA 2G4TA 1BTHH 1T7CA 2VB0A 5LPRA 3M7TA 1W2KH 2BDIA 1V2QT 5DJ7A 2SGEE 1DPOA 4AYYB 2SNWA 1GG6C 3FZZA 1C2EA 4DG4A 3BTGE 1VZQH 1C5NH 3JZ2B 4NWLA 1HAVB 1O5FH 1FQ3A 2BB4A 2HALA 3ZVFA 1GCDA 4AYVB 3TVJB 1SFQB 1ARBA 4HI3A 3ZVBA 1CVWH 1DY9A 1TNJA 4TY6A 3SW2B 1ZOMA 2FOGA 5ESTE 4INKA 1O5DH 2OC1A 5JBAS 4NCYA 1UHBB 5IYTA 3F68H 1P10A 3UIRA 3PTNA 4X8VH 4F4OC 1XUKA 4DIIH 2CGAA 3PV4A 1O3DA 4AZ2B 1SGYE 1Y3YA 4Q7ZA 1ZSKA 3LONA 3VXFH 1SSXA 1CHOF 1NM6A 2W26A 1OS8A 4FUJA 1TE0A 3VB7A 3GICB 3ZVCA 2ZEBA 3UOPA 5DKMA 1BUIA 1V2TT 3JZ1B 1G37A 1ESAA 3L6PA 3GY8A 2FOEA 1MZAA 1AVXA 1GBFA 2FS9A 4VGCB 4DW2U 1TBZH 2P59A 1SC8U 3EQ0H 4FUGA 4K1TA 1Z7KA 2D26C 4GCHF 1P09A 1SGIB 1OYQA 2AEIH 3ZZ5A 1C2GA 1O2HA 3ZZBA 2CXVA 4J1YA 1NTPA 2BD2A 2Z9IA 2AERH 1HB0B 2DUCA 4MDSA 3U8RH 1C2IA 3E16B 4AGKA 2BLWA 1CHOG 4E7NA 2AGIX 1JIMA 1O2QA 3SBKA 1GBCA 1QRXA 1CSOE 3EAJA 3TJOA 1SGFG 1YPKH 2AFQB 1E36B 3QGJA 2C8ZB 1S84A 2ZFTA 1VITH 5FPYA 2EA3A 2HGTH 1HV7A 1SGEE 1CA0B 2FYQA 3MI4A 1K1NA 3K6YA 4NIYA 2ANYA 2ZA5A 3QN7A 4RN6A 2VIPA 2F9NA 1MQ5A 2B0FA 2D8WA 5B6OA 1FI8A 1K2I1 5FCRA 3UQVA 3RXPA 2PSYA 5SGAE 1YGCH 1DICA 1GJAB 5AFZH 3SUFA 1C5WB 1FY4A 1N8OC 3U98H 1MKWH 1Y5AT 4MNWA 1ZLRA 3S7HB 1S85A 4IC6A 1V3XA 1QCPA 2XRCA 4IMZA 4WH6A 3PMAB 1A0HB 1XUJA 4IN2A 4I33A 2BDAA 1LHGH 1EB2A 1W8BH 1A7SA 1XXDA 4H4FA 2QXGA 1MCTA 3MH7A 1BJVA 1QR3E 1THRH 1G3DA 2ZPSA 1TNGA 2F9UA 2J95A 2J94A 2WUCA 4TWYA 1GG6B 4IGDA 1DLKB 1TNKA 4ZROA 3UREA 2WPKS 2ANWA 2PKSB 1P2OA 4K3JA 1QBNA 4YOGA 2NU2E 1EATA 2BY8X 1EAUA 1NRSH 1SR5C 1BMMH 1PQ7A 3UR6A 3RXIA 4U01A 2GCTC 4GCHG 3TGJE 3SV9A 3F9EA 4JK5A 2ZNKH 5A0BA 3RXMA 1GI2A 4ABIA 4O3TA 2OBOA 1SGRE 1EAIA 5FAHA 1BMLA 2TGAA 2GZ8A 4FUDA 3PMBB 1DVAH 1S81A 4BAQB 3A88A 4MG3A 4YTAA 1ZRKA 3GY4A 3PO1B 4KGAA 1VJAU 3A81A 3MU1A 2BM2A 3LGTA 4YOIA 2VJ1A 3SU5A 1HJ8A 2PGQB 3TLOA 4UFGH 2SGFE 2H2ZA 1T8MA 1MTNC 5PTPA 5JDUB 1FN8A 1DITH 4YLUA 4RKOB 1O3GA 3KQCA 2P3TB 3LDXH 1KYNA 1IQLA 1YPEH 1ESBA 3P92A 4TPIZ 1FONA 1M9UA 3DFJA 3O8BA 1KXAA 1P2IA 1CHGA 4O9VA 2TGDA 1DM4B 1PPGE 1NRRH 1KTSB 5TCCA 1E0FD 3TJUA 4ABGA 1P57B 4ZKOU 1AVGH 3R0FA 1C1QA 1UCYE 2Y5GA 5E8EH 2WV5A 3EDXB 2JETB 1O3BA 1EX3A 1EXFA 4M7GA 2R3UA 3D62A 1EP5A 4Y0YE 2P16A 1QB9A 1L2EA 3D49H 2WUBA 1GCTB 1H9IE 4K8YA 3S69A 1O2GH 5T6FA 5T6DA 1C5MD 1J16A 3MNCA 1A4WH 3BTHE 1BHXB 1TGNA 4BANB 2OCVB 5JBBS 4CH2B 4FUEA 4SGBE 1UJ1A 3GCTF 1W12U 1S82A 5AVDA 2BVSH 1QRWA 3DUXH 1TFXA 1BTYA 4GHQA 2GV6A 2A4QA 2QN5T 3NPSA 1VR1H 4I8LA 1YPLH 3C27B 4QT8C 3ZV9A 3ZZCA 1GI6A 2FP7B 7KMEH 3SN8A 3P8GA 2WYGA 1SQAA 2SNVA 1Z8GA 4E05H 5A8XA 4BTIB 4NSVA 3H7OA 2M5TA 3TNTA 2FOMB 4A1TA 1FMGA 3F1SB 1ZJDA 3TK6A 2UWPA 1IQKA 1FJSA 4GPGA 2XWAA 3A85A 1YP9A 1RTFB 1C5TA 2F83A 4X6PA 1IQNA 1OP2A 1PQ5A 1K1LA 3PROA 2AYWA 2BY5X 4A6LA 1FZZA 4MVNA 2D1JA 3SORA 1J14A 3D23A 1FY8E 3HK3B 4X8TH 1AE5A 2BXTH 1O32A 2AGGX 5C2ZA 1QQUA 1UHBA 1YF4A 4WXIA 1VCPA 3K9XB 4JYTA 4B2CA 2P94A 1TPPA 3W94A 1HGTH 4Y6DA 2KAIA 3BTWE 4Z0KA 2HOBA 8GCHF 4ISHH 1GDUA 4ZXYH 4MLFB 1SOTA 3SQHE 4NA9H 1A0LA 1KY9A 2BVXH 1F5RA 3OY6U 2ODPA 1QBOA 2XC0A 3MH4A 3ZZ9A 3VB6A 1GBHA 4AFSA 3NK8A 4Y8ZA 4JYUH 1BDAA 2PSXA 1UMAH 1EP6A 2W5EA 4NZQA 3AAVA 2VWOA 3SU2A 4INLA 3H5CB 2GD4B 5TJXA 1P2MA 4TY7A 5A0CA 3QWCH 4LZ4B 3SJKA 3F6UH 5JB8S 1AY6H 5H4IB 1C2JA 1S6FA 3A7XA 2IPHA 2ANKH 2Z3DA 3SO3A 4X6NA 5ESBA 2HVXA 4UFDH 2CJIA 2FI3E 4A92A 1F2SE 3PB1E 1FIZA 3LJOA 4MPVA 1SLXB 2JH0D 3GCOA 3ELAH 4BOHA 5ABWA 5DK1A 2QIQA 1ETSH 4K2YA
chains in the Genus database with same CATH superfamily
1H9LB 4B6FA 1T32A 3BG4C 4AFZA 1W7XH 3I78A 1ETRH 1BZXE 1HAPH 2H9HA 1OWHA 1C1PA 3RU4D 2DE8A 7GCHF 1V6DA 2PR3A 4IMQA 1NRQH 1P2KA 1GI5A 1PPCE 3GOVB 5HM9A 2HLDD 2A5IA 3M37A 3RXFA 1UTNA 5GNDA 3LPRA 3O8CA 1TNLA 1HPGA 1C9TA 3NXPA 3A7WA 3A83A 1JXPA 1PYTC 5DO4H 1XXFA 3GDVA 3GDSA 1HYLA 1JIRA 1HXFH 3S7KB 2J97A 1ZR0A 1O5GH 2XXLA 1NN6A 5C0UA 5C1XA 1RTKA 4KP0A 2SGQE 4THNH 1O2WA 2Q6DA 5B6LA 2V3HH 4YO9A 2ZG0H 1K28D 2FI4E 1QFKH 4YXWD 3RXJA 1DUEA 2QY0B 1YPHE 2GT7A 3RMNH 2FPZA 4D7FA 2PV9B 1GJ8B 3LGIA 3M61U 3M7QA 2HNTE 1MTVA 4AG1A 1AE8H 3BTQE 5ETXA 2QXIA 1IQFA 8KME2 2ZHFH 4HFPB 1IQMA 1ZHRA 1AN1E 1K1OA 1FN6A 3AASA 2AGEX 4I8KA 1GMDF 2EI8A 1FLEE 2OQUA 2B8OH 3B9FH 4DJZB 1NO9H 3RXAA 1Z8RA 3OFND 1H9HE 3MTYA 3BV9B 3UTUH 1HAYB 1GVLA 1IQGA 1ANDA 1VKYA 5C5OA 5CHAC 2J9NA 1QA0A 1NESE 1BTWA 2SGAA 1BT7A 3ITIA 1EPTC 1TYNA 4VGCC 4X8SH 4R0IA 1O3MA 1EZUC 1L1JA 4KTUA 1JRTA 4JZIA 2B5TB 3S9BA 2Y5HA 2W3IA 1C5PA 1LPZB 2RDEA 3U1IB 1V2PT 1GBDA 1OWIA 1HIAA 1FDPA 3RU4E 1UTQA 1TNIA 3F9HA 3GISB 2PUXB 1ZMLA 2FO9A 2OTVA 1Y5BT 1G3BA 2GTBA 2EI7A 3T25A 1QIXB 3K6ZA 3FP6E 5DP4A 3PO1C 4ZXXH 2PWXA 1TALA 2ZDNA 1C4Y2 1TIOA 2KR7A 4OS7A 3VEQB 2V3MA 2I6QA 4J2YB 3BG8A 3KCGH 1V2RT 4ISLA 1FUJA 4FUBA 3DSGA 1A2CH 1DSUA 2KM0A 1K0HA 5F6MA 1SQRA 1OYTH 3ENSB 4U32A 5LPEA 5EXMA 4DURA 4Y8YA 2BD8A 1XUHA 2J38A 1OHHD 2IN2A 1T8OA 2XNIA 4UDWH 2WPLS 4X2VA 4FXGH 4XFQA 3MU0A 3ODDA 1V2VT 5K0HA 1N8OB 2C8YB 3CENA 3SV2H 3PLPA 4Y71A 2H9EH 4A7IB 3U69H 3P95A 2GP9B 2Y6TA 2UUFB 1UK3A 2RDLA 3OEED 1DY8A 1S6LA 1VCWA 1GHBF 4OGYA 1F92A 2Z9GA 2Z9LA 3HATH 1ZPZA 4IBLH 3SU1A 3V3MA 1P2NA 1TPSA 1GI9B 8ESTE 2QE7D 1THPB 2AHME 2P3FH 3QO6A 3OE7D 5F8XA 1OWEA 2KFWA 3SNBA 1LCYA 2EI6A 1LKAA 1K1PA 2J34A 6LPRA 3E90B 1YPJH 1XMNB 2RA3A 3HKIB 3SJIA 4A1XA 1F0UA 1SL3A 4FVBA 3WWBA 4FU8A 2QF3A 1O2IA 1ELBA 1Y3UA 2GZ7A 3M3SA 2FIRH 1OWKA 3MMGA 1B0FA 3VGCC 3KQBA 1HDTH 5FX5A 2OD3B 4OS2A 1RGQA 3NZIA 2ZPQA 3OY5U 1ZTLA 5JB9S 2P95A 4OS4A 1PYTD 3EE7A 3NKKA 1YPGH 1P04A 1CA8B 3ATIA 2Z94A 4CRDA 2CV3A 3QLPH 2NU4E 1H8DH 3VG8A 3MWIU 2VH6A 3Q3YA 1Z71A 3QZRA 1JBUH 1VGCC 1KDQB 1ZMJA 4AOQA 2AMPA 4ABHA 4XDEA 1HJAC 1THSH 1TNHA 1BOQA 2SGDE 3M5OA 1D6RA 1AMHA 1LHDH 2VWMA 4ISIH 3FVFB 1GCTC 2UWOA 2ZDVH 2VU8E 5EPYA 1EASA 2AIQA 3DHKH 5FL7D 4NGAH 3TIUA 3F9FA 1V2NT 4JZFH 3T27A 3F2GA 3IITA 3EYDA 4ZKNU 1CBWB 3UOUA 3E6PH 1UTJA 4AB8A 1LO6A 8LPRA 4WF8A 2QAAA 4KKDA 4NFEA 3URCA 4B75A 4GVUA 4Y11E 2QF0A 1TQ0B 3CS0A 1OXGA 5DP8A 3DT0H 3RXTA 1BRBE 1EQ9A 3MFJA 3L33A 1SGNE 1FAXA 1C1OA 1C2HA 2J98B 5GWZA 3BTME 5AHGH 3Q00A 1UO6A 2ULLA 2Y81A 1ZSJA 3M36A 1EJAA 1DE7H 1UTPA 4WH8A 3TITA 2EY4C 5GIBA 3RMOH 2JDID 3PM3A 3U28C 1GJ9B 3RXKA 1MBMA 2G5VA 4FOUC 2BDBA 4GLYA 2K8IA 4Y0ZE 2VNTA 3ODFA 2VVUA 4D9RA 1O3PB 1UTMA 2BQ7B 2PW8H 2TGTA 4B73A 4JK6A 1MCVA 1YBWA 1YWUA 3T62A 1D6WA 1DXPA 1Y5UT 2OC0A 3I77A 1GHBG 1Z8IB 3OEHD 2BYAX 3ATLA 1O3CA 4X1QU 2CHAB 2IJOB 1G30B 1EPTA 1MAYA 1QL7A 5FCKA 4DT7B 1TOCB 1HAHH 1VJ9U 1C2DA 1O2KA 4YM9A 1RS0A 1O3KA 2QA9E 1K9OE 4X6OA 2WSSD 2BY6X 1OWJA 1O33A 2F43B 5EIYA 1E1QD 1QURH 1AFQC 3EE0B 3A8AA 3B23B 4HTCH 2W7UA 1YLCA 5K7RA 5CHAB 1W0KD 4Y8XA 1B7XB 1ZHMA 2BQ6B 3A87A 1KXFA 1TGCA 1K21H 2BOHB 1ANCA 3RM0H 2FOBA 1E79D 2EQNA 1PPBH 2HNTC 5KECA 1SGTA 2C93B 2QYIA 1G32B 1GBMA 4B6EA 1KXBA 1QJ7B 2ZIQH 1GI4A 1WQSA 1HCGA 1GGDB 1RIWC 1VITG 1BCUH 3CP7A 2JJ1D 2WPJS 1CT0E 3EA7A 4GSOA 1H1BA 4FVDA 2ANMH 5A2MH 3AK5A 1F0RA 1V2MT 2ZFSA 1A5GH 1L1NA 1SMFE 1FAKH 2WHXA 4CR9A 3SHAH 4NZLA 3O8DA 2OP9A 2NU3E 1GHVH 1EOLA 4X1SU 1GJ4H 4NG9H 2GX4A 2VIVA 1DFPA 3OU0A 1COWD 4LOYH 4ZHAA 1AIXH 4CRGA 2QGRA 3RC6A 3QTOH 1NBMD 2CN0H 2TPIZ 2HNTF 4I8JA 3A7YA 4P02A 3BTFE 3RLYH 4YT7H 2FTMA 1V2UT 1HBTH 3E0PB 4AX9H 3RXCA 5FBEA 3SQEE 1ANEA 1HAVA 1LVMA 1O2JA 2XW9A 3MHWU 5HKKD 4X1PU 1O30A 1SQOA 2P3UB 2YMSC 2O9QA 3SZEA 1L4DA 3MOCA 1SG8B 2Q1JA 1SLUB 3LC3A 1O2UA 5DPAA 1BB0B 3QTVH 1ARCA 1KLIH 4JZ1A 1XM1A 3TJVA 1RTLA 3GCHC 2ZGJA 3ZVGA 2VIDA 1NS3A 2CK3D 1D3TB 2ZPRA 1YCPH 1MTWA 5LPFA 1Q31A 1QNJA 2A7JA 3M5MA 4CRFA 1O3HA 1YY3A 1W0JD 2A32A 1A61H 1NROH 1BRUP 4ZMAH 1C5SA 2AS9A 1SI5H 1DWBH 4ZKRU 2Y5FA 2XYAA 3RUOA 1HJ9A 2JJ2D 4RKJB 1GBJA 1GHAF 1MTNB 4IS5A 1CQQA 2HLCA 2VGCB 1B0EA 1PPHE 2EC9H 2Y82A 3GYLB 4XBDA 1AZZA 2WYJA 1CT2E 2FOHA 2BZAA 3RXRA 3ZVEA 6ESTA 2ZHQH 3F9GA 3RMLH 1C5QA 1C1SA 5L30H 1W13U 4K8BA 5EODA 5GDSH 1TRMA 3BTTE 1O0DH 2ZGCA 1UVUH 1UCYH 3H7TA 2BX3A 2Z9JA 2KCYA 1C5XB 3RMMH 2UUJB 1QJ6B 2XC4A 3M35A 3HK6B 2ODQA 4JYVH 5JBCS 4CH8B 2ZKSA 3W1EA 3KHVA 1SHYA 2Q6GA 1UVSH 1ZHPA 3E1XB 1P3EA 1TWXB 2XBVA 5FX6A 1GJBB 1Z8JB 5F8ZA 3UY9A 2GMTB 1O31A 3DSPA 4X2XA 4XBCA 1BMAA 2W7SA 5C1YA 2C8XB 5GJ4B 1ELDE 1L0ZA 1AD8H 1BHXF 2J4IA 3NCLA 1TMUH 2UUYA 2GDEH 1D3PB 1KSNA 4OS1A 1C9PA 4X6MA 1NT1A 2O8MA 3U1JB 2CF8H 1O2XA 3BSQA 2BQWB 1HAXB 2PHBA 5HMAA 1A46H 2H9TH 1HLTH 4NFFA 4UEHH 3URDA 2FI5E 1S83A 1G3CA 1Y3VA 1TBRH 3KQEA 3SUDA 2SGPE 2G8TA 1FY1A 5HYOA 2RFKC 4H6TA 2BD7A 4UFEH 4TYDA 3SOSA 5LGOA 2BDCA 5EOKA 2G52A 2OQ5A 5C1UA 1V2KT 1AZ8A 1O34A 3PMHB 5F03A 1LKBA 1GGDC 1RIWB 2XNDD 3Q3XA 1WOFA 1RD3B 3IG6B 2BDYA 1GBBA 1LVBA 1P12E 4YZUA 5EXLA 4NWKA 1VCQA 5T3HA 2BXUH 3K65B 1CGJE 2V3OH 1PFXC 3A86A 1NRPH 1Z6EA 1MTSA 5KEDA 1P9UA 1FXYA 1SGQE 1MUEB 3SUGA 2XWBI 1PQAA 3HGPA 2ZFFH 4BAHB 3UNSA 2BLOA 4XRNA 3RU4T 1DSTA 2BDHA 1OKXA 2WV4A 1AGJA 2WINI 1RJXB 2HRVA 1QBVH 3A7VA 2VVCA 5EJ1A 3E3TA 1FV9A 4Z6AH 3GY3A 1JOUB 1XKAC 2FLRH 1T8LA 4B1TA 1GBKA 1BJUA 1LTOA 1GMHF 3T5FH 1DWDH 3QK1A 5EW1H 1RFNA 3RXEA 1UVPA 5C5NA 1GI0A 3RXUA 4Q80A 3MNBA 3I29A 5JPMH 1H8ED 4TWWA 1GL0E 2F9PA 1C1UH 2PTCE 2VVVA 2A2QH 1P8VC 4KTSA 4WXVA 4O3UA 3RXSA 4O97A 2ZU4A 1NU7B 1P02A 1C1MA 4X8UH 1HAZB 1KMHB 2ZO3H 3Q77A 1O2TA 3T28A 4BAMB 2YNAA 1O5CB 4XOJA 5FBIA 1GMHG 4ISNA 3LU9B 3L3TA 3SGAE 4WJG2 2PKSC 4K69A 1NFXA 3MO9A 2O8WA 3LGYA 1LPKB 1O3IA 3TPIZ 4H42U 1GJ5H 3M3VA 3VB4A 2Y7ZA 3SJ8A 3KGPA 2YMSB 3KEEA 4YLQH 1EOJA 1EPTB 1MKXH 4I32A 8GCHG 5A09A 6CHAC 2HVYB 2RG3A 3UPEA 1Y3XA 1V2LT 1TPAE 1NFWA 1NBME 1WCZA 3KF2A 1GBTA 2R3YA 1NC6A 3MU8A 2ZQ1A 3TGKE 2KAIB 2PKAA 1D3QB 2GGVB 1GMDG 2F9VA 2K1QA 2ZDLA 3RXGA 2STBE 2OINA 2BVRH 4NSYA 1ELVA 5EQQA 1F5LA 4I8GA 1P11E 1O2LA 1XUFA 4K5ZA 5F53A 4ZHLU 1MAXA 2VH0A 1B5GH 1GBAA 1FPHH 1SLWB 3AW1A 1INCA 3RLWH 3P8NA 2GZ9A 1A1RA 1MD8A 2FODA 2HPQH 5IDKA 1O39A 3EA9A 2UWLA 2A5KA 3ZYDA 1ZTJA 1ZJKA 2BD3A 4KTCA 1QB6A 3V13A 1ZYOA 4NA7A 1TRNA 3ZVAA 1YC0A 3ZV8A 3EGKH 1EZXC 1C1NA 1OWDA 1CGIE 2LP6A 3SI3H 3F2FA 3P70B 1XUGA 3MNXA 1TLDA 4A1VA 1PPZA 2ZHWH 3UQOA 3OSYA 1EFRD 3DD2H 1OOKB 1FY3A 1H8IH 1LHCH 2BLQA 1T31A 1UTKA 4K1SA 1S6HA 2FEQH 2BY7X 1Z6JH 4DOQA 2BD5A 1D4PB 3ZZ4A 2ZGXH 2KZ4A 2G00A 2ZCHP 3QDZB 1EKBB 3SV8A 3DFLA 1UTOA 2VIWA 3TH3H 3U9AH 3O8RA 1ZRBA 1TX6A 2ZDKA 3OTPA 1ABJH 1BBRH 4AB9A 2J92A 2FWWA 4JCNA 4IW4E 1E35B 4H6SB 4MNYA 2ZQ2A 3BEIB 3Q3KA 4ZUHA 2XTTB 4MPXA 4O03A 2Q6FA 5DGJA 1LMWB 1TPOA 2ZZUH 4NIXA 2Z7FE 4Q7XA 1HAGE 1MTUA 2BY9X 1GVKB 3LH1A 5GCHG 5DP9A 1EJNA 4D7GA 1Q3XA 2FTLE 1SOZA 5E0JA 1DS2E 1RRKA 2P8OB 2Z9KA 3LGWA 1ZGVA 1TGSZ 3FP8E 4KELA 1TX8A 3SU0A 4B2BA 1AWHB 3GCTG 2QC2A 1MD7A 4NIWA 1WQVH 2ZTXA 3KNXA 1C1VH 1EAWA 1P03A 1K1MA 3PV5A 4GHTA 1WV7H 2ZFPH 1HNEE 2XC5A 5L2YH 1E34B 1N6XA 4I86A 2A45B 2H5CA 2QCYA 5C20A 1XKBC 2TBSA 1NFUA 5DP5A 2LELA 1BTXA 2W3KA 4BAKB 1DXWA 3SHCH 3BIUH 3MU5A 1G36A 1BBRE 1TMBH 3U8OH 1O2YA 1IHSH 3VB3A 4MQAA 3QGNB 1DWEH 4ABDA 4DIHH 1G3EA 1P2QA 1H8HD 2LPRA 1O2NA 1ELCA 1ZPBA 2FDAA 3NWUA 1QJ1B 2AIPA 5E2OA 1GMCG 1JRSA 3SGQE 1O2VA 2GCTB 4I7YH 1FPCH 1C1RA 1A0JA 1GMCF 1TB6H 3S9CA 2PTNA 2V35A 1J9CH 2BHGA 1LHFH 4X1NU 4Z1MD 3AW0A 1ORFA 2VGCC 3S0NA 1O3FA 1SBWA 2D2DA 1YLNA 1SGDE 3SGBE 1W10U 2R2WU 1O3JA 2FXRA 2ZCLP 2WPDD 1GDQA 3ZZDA 3FOAA 3K2UA 4AG2A 4F48B 1N1LA 2THFB 2KCAA 1CGHA 1J15A 1ELEE 1QRZA 1LVYA 1BITA 1BMNH 1TGBA 2A4GA 2G4UA 1O3EA 1PQ8A 3SJ9A 3BEFB 4GAWA 4CR5A 2XBWA 2A4RA 1LHEH 3VGCB 1U6QA 5J4SA 4M9FA 2H6MA 1E38B 1WYKA 1W7GH 1CBWC 5EPNA 2FYRA 2PGBB 3BN9A 4B71A 2L74A 2ZFQH 3KIDU 4CHAC 3AAUA 1AFEH 1ANBA 4B76A 4ESTE 1QZ8A 2VWLA 5CMXH 5GCHF 1DWCH 4FUHA 3HPTB 1T4VH 1LDTT 1H4WA 1OP0A 3RC4A 1UW7A 4IN1A 4WVPE 1AHTH 4FU7A 4GUXA 2OBQA 1O2OA 1Z1IA 3ZZ6A 2RA0A 3W95A 4X1RU 4Y10E 1BBRK 3SNDA 5GXPA 3PWBA 1Y8TA 1KDQA 1O3OA 1L1GA 3SNCA 2ZWLH 1IHTH 1NZQH 3AVZA 3E8LA 2KCPA 4A5TS 2ZECA 3HKJB 2ASUB 3A8BA 3F2HA 5DP7A 1ESTA 4RT0A 1UTLM 3F3BA 2R2MB 2STAE 4AFQA 4UONA 1F0SA 3BTEE 1WTHD 1ELFA 1YYY1 3LC5A 3C1KA 1TMTH 2BD9A 1BQYA 2ODYB 2ZI2H 3A82A 4HZHA 1K22H 2XBXA 1YCPM 3KN2A 3MH5A 1EZSC 1MU8B 2FLBH 5AF9H 3UNRA 3N7OA 4JMYA 1T8NA 1TBQH 4DVAU 1C5ZB 3SV6A 2GDDA 2FOAA 1AI8H 2A0QB 3GY2A 3LGUA 2R9PA 1HXEH 3SJOA 1HAIH 3OYPA 4Q63A 3WWFA 2JH5D 3SI4H 1V2OT 1ZMNA 2F3CE 3VPKA 2A31A 3LH3A 1O2SA 2J5UA 4ZAEA 1HAOH 1L4ZA 3TK5A 7ESTE 2P93A 2EEKA 1GJCB 4JZEH 1LQDB 1MKWK 1C4V2 2ZCKP 4ABBA 3U8TH 2B7DH 1OPHB 2IOTA 4OS5A 5EXNA 5C94A 1O3NA 2FS8A 3M5LA 3MO3A 1IAUA 2JH6D 3A7ZA 2FZZA 2IPQX 3OTJE 3STIA 4LXBH 1MBQA 2C90B 2H1UA 2PLXA 4I31A 1O2PA 3GYMA 2NU1E 1SVPA 1KIGH 2C4FH 2ZTZA 2ZU1A 3M3TA 3LIWA 4FUIA 3E91A 1GJ7B 2VIOA 2ZDAH 5DP3A 1P9SA 3R3GB 2HWLB 1QQ4A 1GHAG 4ACBA 3TU7H 4Y79A 3RXDA 2B9LA 2VWNA 2BOKA 5LH8A 2A2XH 2FMJA 1W14U 3NUMA 4XBBA 5A0AE 4ZH8A 4CREA 3VFEA 1WUNH 4TPYA 5EJZA 3SV7A 3PYHA 3GY5A 1SGPE 2VIQA 1C5UA 5EQSA 2A5AA 2M2AA 4ASUD 1ZSLA 1A3BH 1PPEE 5JYIA 1RXPA 1DUAA 1AU8A 1ID5H 1BTUA 1HIAB 3P8OA 5C67A 3QUMP 3MQKC 1TX7A 3P8FA 1C5LH 3V7TA 4BXWA 2F9OA 4ABFA 4XD7D 3SNEA 1MH0A 2FOFA 2YOLA 1EZQA 1K1IA 1CO7E 2G55A 2P8OC 1WXRA 1JMOH 2TGPZ 1ELAA 2ESTE 4MNVA 2DE9A 5BRRE 4NA8A 1YM0A 4I8HA 1O5BB 2ZFRH 4UE7H 3UFAA 2GT8A 1D3DB 2UUKB 1TA2A 2C3SA 2GKVE 5G4BA 3UAIC 4BNRA 1BRAA 2GCHG 4IC5A 3KL6A 2G5NA 3KQDA 1A5IA 5AFYH 3BF6H 1W0ZU 1C5OH 4OM9A 4RI0A 5C17A 1C4U2 5HM2A 1GWAA 2I6SA 3SU3A 4AFUA 1OP8A 5C0TA 2FX6A 4BAOB 2AMQA 4MTBA 4CRAA 2PUQH 1NFYA 1KLJH 2IJD1 1AQ7A 3FZDA 1V2ST 3BEUA 2XCNA 4R8TB 3A7TA 2LNCA 4BTUB 1YCPK 2JIZD 2QXJA 4OGXA 3FANA 3ZZ3A 1P3CA 1PPFE 2JKHA 4WMDA 1C2KA 1G2LA 5FHTA 4BTTB 2AH4X 1GBEA 1O37A 2QF5A 1C5YB 5E0GA 6CHAB 3FP7E 3BTKE 3UNQA 2G51A 3RXVA 4ZHMU 5CE1A 3GY7A 1O5AB 4MNXA 2WPIS 1GHZA 2XBYA 3FAOA 2ZGBH 3CS7A 1IOEA 5EGMA 3TK9A 4CBOA 1OSSA 4XE4A 5J4QA 2WPMS 1GHXH 1GVZA 3Q76A 5T1VA 1TGTA 2BX4A 1ELTA 1G2MA 1O2RA 1J8AA 1D9IA 5L2ZH 3STJA 1O38A 3PWCA 1FNIA 1NPMA 1DOJA 1UCYK 2Z3CA 1NY22 3HGNA 3ZZAA 1J17T 5EG4A 1FY5A 1GI8B 2ALPA 5FPTA 3M5NA 4ISOA 4SGAE 4CRBA 3PTBA 1QTFA 1O35A 1T4UH 1JWTA 3D65E 2AMDA 3H09A 1YPMH 1AUTC 3ATWA 3UR9A 4PROA 2O8UA 1QGFA 4X2WA 1BTZA 1P2JA 5C3NA 1TAWA 2R0LA 1SKYE 2Y7XA 1AKSB 1QA7A 3OAAD 4WWYA 4LZ1H 1GDNA 2ZU2A 4AC9A 1SQTA 1DX5M 2W6JD 3RXHA 5A8YA 1F7ZA 2ZU3A 3P6ZB 1WAYB 1O5EH 4YT6H 4HGCA 4Y7AA 1MZDA 1P06A 3EA8A 4E06H 4AORA 4U2WA 2FOCA 2HPPH 1AO5A 5FXLA 3WY8A 1NU9A 3TGIE 4AN7A 2OLGA 1P01A 1CE5A 6GCHG 4WMFA 1LQEA 5HGGA 3QZQA 4NIVA 1CA0C 3PMJA 3V0XA 1S5SA 4XSKU 4K60A 1BRCE 2R0KA 3UUZA 1KXDA 3V12A 2G81E 1F5KU 2OXSA 3UWIA 3SUEA 3LOXA 3A84A 1MABB 1DDJA 3PV2A 4Q7YA 1GBLA 1LPGB 2H5DA 3BG4B 2GMTC 1ABIH 3TH4H 2V0BA 3E0NB 1C5VA 1W11U 1S0RA 1GI7B 1HJAB 3FKSD 3LKWA 4X0WU 4Y76A 2F9BH 1UVOA 1ZZZA 2O8LA 1VGCB 3PRDA 4Q2KA 1XVOA 2XCFA 5EW2H 1Q2WA 1X7AC 2Z6BD 3UB0A 1C5RA 3MNSA 4X2YA 1C2FA 4ABEA 1P05A 2QV1A 4LK4A 4RSPA 2A4OA 1EB1H 4BXSA 2ZC9H 3GY6A 1F0TA 2F91A 1WBGB 1TA6A 2OC8A 2BD4A 1ZPCA 9ESTA 1N6YA 2CF9H 4MPWA 2VINA 1AFQB 1MKXK 3TH2H 1ACBE 1YKTA 2NU0E 1GJDB 2WZQA 1AUJA 2JETC 3ZZ8A 1ETTH 1UK4A 3ESTA 2CMYA 5DG6A 1GHWH 3RXQA 5HXFA 2BZ6H 3MO6A 1DT2A 4INHA 2GCHF 1O3LA 1AB9C 1G9IE 1AWFH 2BLVA 2NWNA 1V2WT 2CHAC 3OX7U 1AB9B 1MMJN 4ASHA 1A3EH 2XOKD 3DCLA 3UWJH 2FM2A 4OS6A 6GCHF 1ZTKA 1QB1A 1UVTH 4D9QA 3IWMA 1MU6B 3SZNA 1PJPA 1EUFA 1W0YH 2A7CA 4TT3D 4DGJA 1BTPA 1SFIA 1DLEA 3A89A 1FIWA 1QL8A 1C2MA 1TRYA 3T29A 4CRCA 1EAXA 1SGCA 4DT4A 3N7EA 3MH6A 1SPJA 4ABJA 2FESH 2ZP0H 2ZU5A 3ZYEA 3PLBA 1Y3WA 1XVMA 1YLDA 1WSSH 2O8TA 3KYFA 5FPSA 4B2AA 3T2NA 1MQ6A 3ATKA 3SU4A 3LGVA 5JBTA 1EJMA 4ZKSU 1ZGIA 4B74A 1HUTH 2GVFA 1E37B 1Z1JA 3RM2H 2Y80A 2WPHS 1QY6A 3ATMA 1CU1A 1LVOA 1GI1A 4JZDH 2A1DB 2GV7A 2ZF0H 3P17H 1KTTB 2FX4A 2V7QD 3DA9B 2PFEA 3RXLA 1GI3A 3LJJA 4Y7BA 5T6GA 2TIOA 4MPUA 4DY7B 1BIOA 2OUAA 5HIYA 3GCNA 1SHHB 1SB1H 3DSOA 1IQEA 5BPEA 1IQIA 5GPIB 1SLVB 1HFDA 1O3AA 4UFFH 1S0QA 4F49A 3TNSA 1V2JT 4DCDA 1IQJA 1GJ6A 1O2ZA 3BTDE 5DN6D 3ZIAD 1OX1A 5EU8A 3RP2A 2L6OA 2K0QA 1GHYH 4YOJA 3FO8D 3GCHB 4WMEA 4FU9A 3A8CA 1IQHA 2BTCE 9LPRA 1KLTA 1QHRB 1WTGH 1AKSA 1K1JA 1GL1A 1HRTH 3VB5A 4WY3A 2ZTYA 3ZZ7A 1XX9A 1GPZA 2ALVA 2BDGA 2OC7A 4FUCA 3M7UA 1O36A 2ZHEH 1XUIA 1BA8B 3A80A 1KXCA 1TQ7B 2RCEA 5DSFA 1KXEA 5I46H 3GDUA 4AGJA 5DP6A 2ILNA 2SFAA 2TRMA 3G01A 4U30A 3S9AA 3SU6A 2A7HA 2BMGB 2J2UA 1AVWA 1CT4E 1GBIA 3MU4A 4YESB 3PLKA 4E7RG 3MYWA 2J98A 3BIVH 1VITF 5E2PA 1SGFA 1W3CA 3RDZA 5I25A 5A8ZA 4D76A 3VXEH 7LPRA 2ZGHA 4UD9H 5EQRA 3T26A 1ELGA 1TONA 3RXOA 1C2LA 3SNAA 1YPHC 4FUFA 5TCAA 2YNBA 3LT3A 2ZHDA 2PKAB 1UK2A 4CHAB 3B8JA 5L6NH 7GCHG 1QL9A 1TABE 4D8NA 1C1WH 3FFGA 4CBNA 2ZDMA 4K1EA 1NRNH 1TOMH 2QXHA 4ABAA 3QX5H 5E0HA 5F8TA 1P0SH 1DANH 2C8WB 3RC5A 1O2MA 3A8DA 1Y59T 2Z3EA 3RXBA 1A5HA 3ZVDA 1WU1A 1C1TA 3TJNA 2V6NA 2G4TA 1BTHH 1T7CA 2VB0A 5LPRA 3M7TA 1W2KH 2BDIA 1V2QT 5DJ7A 2SGEE 1DPOA 4AYYB 2SNWA 1GG6C 3FZZA 1C2EA 4DG4A 3BTGE 1VZQH 1C5NH 3JZ2B 4NWLA 1HAVB 1O5FH 1FQ3A 2BB4A 2HALA 3ZVFA 1GCDA 4AYVB 3TVJB 1SFQB 1ARBA 4HI3A 3ZVBA 1CVWH 1DY9A 1TNJA 4TY6A 3SW2B 1ZOMA 2FOGA 5ESTE 4INKA 1O5DH 2OC1A 5JBAS 4NCYA 1UHBB 2WV9A 3F68H 5IYTA 1P10A 3UIRA 3PTNA 4X8VH 4F4OC 3SYJA 1XUKA 4DIIH 2CGAA 3PV4A 1O3DA 4AZ2B 1SGYE 1Y3YA 4Q7ZA 1ZSKA 3LONA 3VXFH 1SSXA 1CHOF 1NM6A 2W26A 1OS8A 4FUJA 1TE0A 3VB7A 3GICB 3ZVCA 2ZEBA 3UOPA 5DKMA 1BUIA 1V2TT 2QF4A 3JZ1B 1G37A 1ESAA 3L6PA 3GY8A 2FOEA 1MZAA 1AVXA 1GBFA 2FS9A 4VGCB 4DW2U 1TBZH 2P59A 1SC8U 3EQ0H 4FUGA 4K1TA 1Z7KA 2D26C 4GCHF 1P09A 1SGIB 1OYQA 2AEIH 3N7DA 3ZZ5A 1C2GA 1O2HA 3FN8A 3ZZBA 2CXVA 4J1YA 1NTPA 2BD2A 2Z9IA 2AERH 1HB0B 2DUCA 4MDSA 3U8RH 1C2IA 3E16B 4AGKA 2BLWA 1CHOG 4E7NA 2AGIX 1JIMA 1O2QA 3SBKA 1GBCA 1QRXA 1CSOE 3EAJA 2GJGA 3TJOA 1SGFG 1YPKH 2AFQB 1E36B 3QGJA 2C8ZB 1S84A 2ZFTA 1VITH 5FPYA 2EA3A 2HGTH 1HV7A 1SGEE 1CA0B 2FYQA 3MI4A 1K1NA 3K6YA 4NIYA 2ANYA 2ZA5A 3QN7A 4RN6A 2VIPA 2F9NA 1MQ5A 1FX0B 2B0FA 2D8WA 5B6OA 1FI8A 1K2I1 3PRBA 5FCRA 2KX4A 3UQVA 3RXPA 2PSYA 5SGAE 1YGCH 3WW7A 1DICA 1GJAB 5AFZH 3SUFA 1C5WB 1FY4A 1N8OC 3U98H 1MKWH 1Y5AT 4MNWA 1ZLRA 3S7HB 1S85A 4IC6A 1V3XA 1QCPA 2XRCA 4IMZA 4WH6A 3PMAB 1A0HB 1XUJA 4IN2A 4I33A 2BDAA 1LHGH 1EB2A 1W8BH 1A7SA 1XXDA 4H4FA 2QXGA 1MCTA 3MH7A 1BJVA 1QR3E 1THRH 1G3DA 2ZPSA 1TNGA 2F9UA 2J95A 2J94A 2WUCA 1BMFD 4TWYA 1GG6B 4IGDA 1DLKB 1TNKA 4ZROA 3UREA 2WPKS 2ANWA 2PKSB 1P2OA 4K3JA 1QBNA 4YOGA 2NU2E 1EATA 2BY8X 1EAUA 1NRSH 1SR5C 2KCOA 1BMMH 1PQ7A 3UR6A 3RXIA 4U01A 2GCTC 4GCHG 3TGJE 3SV9A 3F9EA 4JK5A 2ZNKH 4ACAA 5A0BA 4P00A 3RXMA 1GI2A 4ABIA 4O3TA 2OBOA 1SGRE 1EAIA 5FAHA 1BMLA 2TGAA 2GZ8A 4FUDA 3PMBB 1DVAH 1S81A 4BAQB 3A88A 4MG3A 4YTAA 1ZRKA 3GY4A 3PO1B 4KGAA 1VJAU 3A81A 3MU1A 2BM2A 3LGTA 4YOIA 2VJ1A 4HG6A 1HJ8A 2PGQB 3SU5A 3TLOA 4UFGH 2SGFE 2H2ZA 1T8MA 1MTNC 5PTPA 5JDUB 1FN8A 1DITH 4YLUA 4RKOB 1O3GA 3KQCA 2P3TB 3LDXH 1KYNA 1IQLA 2F4LA 1YPEH 1ESBA 3P92A 4TPIZ 5CHBA 1E1RD 1FONA 1M9UA 4FETA 3DFJA 3O8BA 1KXAA 1P2IA 1CHGA 4O9VA 2TGDA 1DM4B 1PPGE 1NRRH 1KTSB 2YMSD 5TCCA 1E0FD 3TJUA 4ABGA 1P57B 4ZKOU 1AVGH 3R0FA 1C1QA 1UCYE 2Y5GA 5E8EH 2WV5A 3EDXB 3F0PA 2JETB 1O3BA 1EX3A 1EXFA 4M7GA 2R3UA 3D62A 1EP5A 4Y0YE 2P16A 1QB9A 1L2EA 3D49H 2WUBA 1GCTB 1H9IE 4K8YA 3S69A 1O2GH 5T6FA 5T6DA 1C5MD 1J16A 3MNCA 1A4WH 3BTHE 1BHXB 1TGNA 4BANB 2OCVB 5JBBS 4CH2B 4FUEA 4SGBE 1UJ1A 3GCTF 2PP6A 1W12U 1S82A 5AVDA 2BVSH 1QRWA 3DUXH 1TFXA 1BTYA 4GHQA 2GV6A 2A4QA 2QN5T 3NPSA 1VR1H 4I8LA 1YPLH 3C27B 4QT8C 3ZV9A 4TSFD 3ZZCA 4ZCNA 1GI6A 2FP7B 7KMEH 3SN8A 3P8GA 2WYGA 1SQAA 2SNVA 1Z8GA 4E05H 5HIZA 5A8XA 4BTIB 4NSVA 2W6ID 3H7OA 3KYGA 3CNRA 2M5TA 3TNTA 2FOMB 4A1TA 1FMGA 3F1SB 1ZJDA 3TK6A 3GS9A 2UWPA 1IQKA 1FJSA 4GPGA 2XWAA 3A85A 1YP9A 1RTFB 1C5TA 2F83A 4X6PA 3NRLA 1IQNA 1OP2A 3N99A 1PQ5A 1K1LA 3PROA 2AYWA 2BY5X 4A6LA 1FZZA 4MVNA 4F55A 2D1JA 3SORA 1J14A 3D23A 1FY8E 3HK3B 4X8TH 1AE5A 2BXTH 1O32A 2AGGX 5C2ZA 1QQUA 1UHBA 1WDIA 4Q4LA 1YF4A 4WXIA 1VCPA 3K9XB 2VBCA 4JYTA 4B2CA 2P94A 4RT1A 1TPPA 3W94A 1HGTH 4Y6DA 2KAIA 3BTWE 4Z0KA 2HOBA 8GCHF 4ISHH 1GDUA 4ZXYH 5IK2D 4MLFB 1SOTA 3SQHE 4NA9H 1A0LA 1KY9A 2BVXH 1F5RA 3OY6U 2ODPA 1QBOA 2XC0A 3MH4A 3ZZ9A 3VB6A 1GBHA 4AFSA 3NK8A 4Y8ZA 4JYUH 1BDAA 2PSXA 1UMAH 1EP6A 2W5EA 4NZQA 3AAVA 2VWOA 5KGOA 3SU2A 4INLA 3H5CB 5EJLA 2GD4B 5TJXA 1P2MA 4TY7A 5A0CA 3QWCH 4LZ4B 3SJKA 3F6UH 5JB8S 3KQ5A 2OK5A 1AY6H 5H4IB 1C2JA 1S6FA 3A7XA 2IPHA 2ANKH 2Z3DA 3SO3A 4X6NA 5ESBA 2HVXA 4UFDH 2CJIA 5CDFE 2FI3E 4A92A 1F2SE 3PB1E 1FIZA 3LJOA 4MPVA 1SLXB 2JH0D 3GCOA 3ELAH 4BOHA 5ABWA 3F0OA 5DK1A 2QIQA 1ETSH 4K2YA
chains in the Genus database with same CATH topology
1H9LB 1T32A 3BG4C 4AFZA 1W7XH 3I78A 1ETRH 1BZXE 1HAPH 2H9HA 1OWHA 1C1PA 3RU4D 2DE8A 7GCHF 1V6DA 2PR3A 4IMQA 1NRQH 1P2KA 1GI5A 1PPCE 3GOVB 5HM9A 2A5IA 3M37A 3RXFA 1UTNA 3LPRA 3O8CA 1TNLA 1HPGA 1C9TA 3NXPA 3A7WA 3A83A 1JXPA 1PYTC 5DO4H 1XXFA 3GDVA 3GDSA 1HYLA 1JIRA 1HXFH 3S7KB 1ZR0A 1O5GH 2XXLA 1NN6A 5C1XA 1RTKA 4KP0A 2SGQE 4THNH 1O2WA 2Q6DA 2V3HH 4YO9A 2ZG0H 1K28D 2FI4E 1QFKH 3RXJA 1DUEA 2QY0B 1YPHE 2GT7A 3RMNH 2FPZA 4D7FA 2PV9B 1GJ8B 3LGIA 3M61U 3M7QA 2HNTE 1MTVA 4AG1A 1AE8H 3BTQE 5ETXA 2QXIA 1IQFA 8KME2 2ZHFH 4HFPB 1IQMA 1ZHRA 1AN1E 1K1OA 1FN6A 3AASA 2AGEX 4I8KA 1GMDF 2EI8A 1FLEE 2OQUA 2B8OH 3B9FH 4DJZB 1NO9H 3RXAA 1Z8RA 1H9HE 3MTYA 3BV9B 3UTUH 1HAYB 1GVLA 1IQGA 1ANDA 5C5OA 5CHAC 2J9NA 1QA0A 1NESE 1BTWA 2SGAA 1BT7A 3ITIA 1EPTC 1TYNA 4VGCC 4X8SH 4R0IA 1O3MA 1EZUC 1L1JA 4KTUA 1JRTA 4JZIA 2B5TB 3S9BA 2Y5HA 2W3IA 1C5PA 1LPZB 3U1IB 1V2PT 1GBDA 1OWIA 1HIAA 1FDPA 3RU4E 1UTQA 1TNIA 3F9HA 3GISB 2PUXB 1ZMLA 2FO9A 2OTVA 1Y5BT 1G3BA 2GTBA 2EI7A 3T25A 1QIXB 3K6ZA 3FP6E 5DP4A 3PO1C 4ZXXH 2PWXA 1TALA 2ZDNA 1C4Y2 1TIOA 4OS7A 3VEQB 2I6QA 4J2YB 3BG8A 3KCGH 1V2RT 4ISLA 1FUJA 4FUBA 1A2CH 1DSUA 5F6MA 1OYTH 3ENSB 4U32A 5LPEA 5EXMA 4DURA 4Y8YA 2BD8A 1XUHA 2J38A 2IN2A 1T8OA 2XNIA 4UDWH 2WPLS 4X2VA 4FXGH 4XFQA 3MU0A 3ODDA 1V2VT 5K0HA 1N8OB 2C8YB 3CENA 3SV2H 3PLPA 4Y71A 2H9EH 4A7IB 3U69H 3P95A 2GP9B 2Y6TA 2UUFB 1UK3A 2RDLA 1DY8A 1VCWA 1GHBF 4OGYA 1F92A 2Z9GA 2Z9LA 3HATH 1ZPZA 4IBLH 3SU1A 3V3MA 1P2NA 1TPSA 1GI9B 8ESTE 1THPB 2P3FH 3QO6A 5F8XA 1OWEA 3SNBA 1LCYA 2EI6A 1LKAA 1K1PA 2J34A 6LPRA 3E90B 1YPJH 1XMNB 2RA3A 3HKIB 3SJIA 4A1XA 1F0UA 1SL3A 4FVBA 4FU8A 2QF3A 1O2IA 1ELBA 1Y3UA 2GZ7A 3M3SA 2FIRH 1OWKA 3MMGA 1B0FA 3VGCC 3KQBA 1HDTH 5FX5A 2OD3B 4OS2A 1RGQA 3NZIA 2ZPQA 3OY5U 1ZTLA 5JB9S 2P95A 4OS4A 1PYTD 3NKKA 1YPGH 1P04A 1CA8B 3ATIA 2Z94A 4CRDA 2CV3A 3QLPH 2NU4E 1H8DH 3MWIU 2VH6A 3Q3YA 1Z71A 3QZRA 1JBUH 1VGCC 1KDQB 1ZMJA 4AOQA 2AMPA 4ABHA 4XDEA 1HJAC 1THSH 1TNHA 1BOQA 2SGDE 3M5OA 1D6RA 1AMHA 1LHDH 2VWMA 4ISIH 3FVFB 1GCTC 2UWOA 2ZDVH 2VU8E 5EPYA 1EASA 2AIQA 3DHKH 4NGAH 3TIUA 3F9FA 1V2NT 4JZFH 3T27A 3IITA 3EYDA 4ZKNU 1CBWB 3UOUA 3E6PH 1UTJA 4AB8A 1LO6A 8LPRA 4WF8A 2QAAA 4KKDA 4NFEA 3URCA 4B75A 4GVUA 4Y11E 2QF0A 1TQ0B 3CS0A 1OXGA 5DP8A 3DT0H 3RXTA 1BRBE 1EQ9A 3MFJA 3L33A 1SGNE 1FAXA 1C1OA 1C2HA 5GWZA 3BTME 5AHGH 3Q00A 1UO6A 2ULLA 2Y81A 1ZSJA 3M36A 1EJAA 1DE7H 1UTPA 4WH8A 3TITA 5GIBA 3RMOH 3PM3A 1GJ9B 3RXKA 1MBMA 2G5VA 2BDBA 4GLYA 4Y0ZE 2VNTA 3ODFA 2VVUA 4D9RA 1O3PB 1UTMA 2BQ7B 2PW8H 2TGTA 4B73A 4JK6A 1MCVA 1YBWA 3T62A 1D6WA 1DXPA 1Y5UT 2OC0A 3I77A 1GHBG 1Z8IB 2BYAX 3ATLA 1O3CA 4X1QU 2CHAB 2IJOB 1G30B 1EPTA 1MAYA 1QL7A 5FCKA 4DT7B 1TOCB 1HAHH 1VJ9U 1C2DA 1O2KA 4YM9A 1RS0A 1O3KA 2QA9E 1K9OE 4X6OA 2BY6X 1OWJA 1O33A 1QURH 1AFQC 3EE0B 3A8AA 3B23B 4HTCH 2W7UA 1YLCA 5K7RA 5CHAB 4Y8XA 1B7XB 1ZHMA 2BQ6B 3A87A 1KXFA 1TGCA 1K21H 2BOHB 1ANCA 3RM0H 2FOBA 1PPBH 2HNTC 1SGTA 2C93B 2QYIA 1G32B 1GBMA 1KXBA 1QJ7B 2ZIQH 1GI4A 1WQSA 1HCGA 1GGDB 1RIWC 1VITG 1BCUH 3CP7A 2WPJS 1CT0E 3EA7A 4GSOA 1H1BA 4FVDA 2ANMH 5A2MH 1F0RA 1V2MT 2ZFSA 1A5GH 1L1NA 1SMFE 1FAKH 4CR9A 3SHAH 4NZLA 3O8DA 2OP9A 2NU3E 1GHVH 1EOLA 4X1SU 1GJ4H 4NG9H 2GX4A 2VIVA 1DFPA 3OU0A 4LOYH 4ZHAA 1AIXH 4CRGA 2QGRA 3RC6A 3QTOH 2CN0H 2TPIZ 2HNTF 4I8JA 3A7YA 3BTFE 3RLYH 4YT7H 2FTMA 1V2UT 1HBTH 3E0PB 4AX9H 3RXCA 5FBEA 3SQEE 1ANEA 1HAVA 1LVMA 1O2JA 2XW9A 3MHWU 4X1PU 1O30A 1SQOA 2P3UB 2O9QA 1L4DA 3MOCA 1SG8B 2Q1JA 1SLUB 3LC3A 1O2UA 5DPAA 1BB0B 3QTVH 1ARCA 1KLIH 4JZ1A 1XM1A 3TJVA 1RTLA 3GCHC 2ZGJA 3ZVGA 2VIDA 1NS3A 1D3TB 2ZPRA 1YCPH 1MTWA 5LPFA 1Q31A 1QNJA 2A7JA 3M5MA 4CRFA 1O3HA 2A32A 1A61H 1NROH 1BRUP 4ZMAH 1C5SA 2AS9A 1SI5H 1DWBH 4ZKRU 2Y5FA 2XYAA 3RUOA 1HJ9A 4RKJB 1GBJA 1GHAF 1MTNB 4IS5A 1CQQA 2HLCA 2VGCB 1B0EA 1PPHE 2EC9H 2Y82A 3GYLB 4XBDA 1AZZA 2WYJA 1CT2E 2FOHA 2BZAA 3RXRA 3ZVEA 6ESTA 2ZHQH 3F9GA 3RMLH 1C5QA 1C1SA 5L30H 1W13U 4K8BA 5EODA 5GDSH 1TRMA 3BTTE 1O0DH 2ZGCA 1UVUH 1UCYH 3H7TA 2BX3A 2Z9JA 1C5XB 3RMMH 2UUJB 1QJ6B 2XC4A 3M35A 3HK6B 2ODQA 4JYVH 5JBCS 4CH8B 2ZKSA 3KHVA 1SHYA 2Q6GA 1UVSH 1ZHPA 3E1XB 1P3EA 1TWXB 2XBVA 5FX6A 1GJBB 1Z8JB 5F8ZA 3UY9A 2GMTB 1O31A 4X2XA 4XBCA 1BMAA 2W7SA 5C1YA 2C8XB 5GJ4B 1ELDE 1L0ZA 1AD8H 1BHXF 2J4IA 3NCLA 1TMUH 2UUYA 2GDEH 1D3PB 1KSNA 4OS1A 1C9PA 4X6MA 1NT1A 2O8MA 3U1JB 2CF8H 1O2XA 3BSQA 2BQWB 1HAXB 2PHBA 5HMAA 1A46H 2H9TH 1HLTH 4NFFA 4UEHH 3URDA 2FI5E 1S83A 1G3CA 1Y3VA 1TBRH 3KQEA 3SUDA 2SGPE 2G8TA 1FY1A 5HYOA 4H6TA 2BD7A 4UFEH 4TYDA 3SOSA 5LGOA 2BDCA 5EOKA 2G52A 2OQ5A 5C1UA 1V2KT 1AZ8A 1O34A 3PMHB 5F03A 1LKBA 1GGDC 1RIWB 3Q3XA 1WOFA 1RD3B 3IG6B 2BDYA 1GBBA 1LVBA 1P12E 4YZUA 5EXLA 4NWKA 1VCQA 5T3HA 2BXUH 3K65B 1CGJE 2V3OH 1PFXC 3A86A 1NRPH 1Z6EA 1MTSA 1P9UA 1FXYA 1SGQE 1MUEB 3SUGA 2XWBI 1PQAA 3HGPA 2ZFFH 4BAHB 3UNSA 2BLOA 3RU4T 1DSTA 2BDHA 1OKXA 2WV4A 1AGJA 2WINI 1RJXB 2HRVA 1QBVH 3A7VA 2VVCA 3E3TA 1FV9A 4Z6AH 3GY3A 1JOUB 1XKAC 2FLRH 1T8LA 4B1TA 1GBKA 1BJUA 1LTOA 1GMHF 3T5FH 1DWDH 3QK1A 5EW1H 1RFNA 3RXEA 1UVPA 5C5NA 1GI0A 3RXUA 4Q80A 3MNBA 3I29A 5JPMH 4TWWA 1GL0E 2F9PA 1C1UH 2PTCE 2VVVA 2A2QH 1P8VC 4KTSA 4WXVA 4O3UA 3RXSA 4O97A 2ZU4A 1NU7B 1P02A 1C1MA 4X8UH 1HAZB 2ZO3H 3Q77A 1O2TA 3T28A 4BAMB 2YNAA 1O5CB 4XOJA 5FBIA 1GMHG 4ISNA 3LU9B 3L3TA 3SGAE 4WJG2 2PKSC 4K69A 1NFXA 3MO9A 2O8WA 3LGYA 1LPKB 1O3IA 3TPIZ 4H42U 1GJ5H 3M3VA 3VB4A 2Y7ZA 3SJ8A 3KGPA 3KEEA 4YLQH 1EOJA 1EPTB 1MKXH 4I32A 8GCHG 5A09A 6CHAC 2RG3A 3UPEA 1Y3XA 1V2LT 1TPAE 1NFWA 3KF2A 1WCZA 1GBTA 2R3YA 1NC6A 3MU8A 2ZQ1A 3TGKE 2KAIB 2PKAA 1D3QB 2GGVB 1GMDG 2F9VA 2K1QA 2ZDLA 3RXGA 2STBE 2OINA 2BVRH 4NSYA 1ELVA 5EQQA 1F5LA 4I8GA 1P11E 1O2LA 1XUFA 4K5ZA 4ZHLU 1MAXA 2VH0A 1B5GH 1GBAA 1FPHH 1SLWB 3AW1A 1INCA 3RLWH 3P8NA 2GZ9A 1A1RA 1MD8A 2FODA 2HPQH 5IDKA 1O39A 3EA9A 2UWLA 2A5KA 3ZYDA 1ZTJA 1ZJKA 2BD3A 4KTCA 1QB6A 3V13A 1ZYOA 4NA7A 1TRNA 3ZVAA 1YC0A 3ZV8A 3EGKH 1EZXC 1C1NA 1OWDA 1CGIE 3SI3H 3P70B 1XUGA 3MNXA 1TLDA 4A1VA 1PPZA 2ZHWH 3UQOA 3OSYA 3DD2H 1OOKB 1FY3A 1H8IH 1LHCH 2BLQA 1T31A 1UTKA 4K1SA 1S6HA 2FEQH 2BY7X 1Z6JH 4DOQA 2BD5A 1D4PB 3ZZ4A 2ZGXH 2G00A 2ZCHP 3QDZB 1EKBB 3SV8A 3DFLA 1UTOA 2VIWA 3TH3H 3U9AH 3O8RA 1ZRBA 1TX6A 2ZDKA 1ABJH 1BBRH 4AB9A 2J92A 2FWWA 4JCNA 4IW4E 1E35B 4H6SB 4MNYA 2ZQ2A 3BEIB 3Q3KA 4ZUHA 2XTTB 4MPXA 4O03A 2Q6FA 5DGJA 1LMWB 1TPOA 2ZZUH 4NIXA 2Z7FE 4Q7XA 1HAGE 1MTUA 2BY9X 1GVKB 3LH1A 5GCHG 5DP9A 1EJNA 4D7GA 1Q3XA 2FTLE 1SOZA 5E0JA 1DS2E 1RRKA 2P8OB 2Z9KA 3LGWA 1ZGVA 1TGSZ 3FP8E 4KELA 1TX8A 3SU0A 4B2BA 1AWHB 3GCTG 2QC2A 1MD7A 4NIWA 1WQVH 2ZTXA 3KNXA 1C1VH 1EAWA 1P03A 1K1MA 4GHTA 1WV7H 2ZFPH 1HNEE 2XC5A 5L2YH 1E34B 1N6XA 2A45B 2H5CA 2QCYA 5C20A 1XKBC 2TBSA 1NFUA 5DP5A 1BTXA 2W3KA 4BAKB 1DXWA 3SHCH 3BIUH 3MU5A 1G36A 1BBRE 1TMBH 3U8OH 1O2YA 1IHSH 3VB3A 4MQAA 3QGNB 1DWEH 4ABDA 4DIHH 1G3EA 1P2QA 2LPRA 1O2NA 1ELCA 1ZPBA 2FDAA 3NWUA 1QJ1B 2AIPA 5E2OA 1GMCG 1JRSA 3SGQE 1O2VA 2GCTB 4I7YH 1FPCH 1C1RA 1A0JA 1GMCF 1TB6H 3S9CA 2PTNA 2V35A 1J9CH 2BHGA 1LHFH 4X1NU 3AW0A 1ORFA 2VGCC 3S0NA 1O3FA 1SBWA 2D2DA 1SGDE 3SGBE 1W10U 2R2WU 1O3JA 2FXRA 2ZCLP 1GDQA 3ZZDA 3K2UA 4AG2A 1N1LA 2THFB 1CGHA 1J15A 1ELEE 1QRZA 1LVYA 1BITA 1BMNH 1TGBA 2A4GA 2G4UA 1O3EA 1PQ8A 3SJ9A 3BEFB 4GAWA 4CR5A 2XBWA 2A4RA 1LHEH 3VGCB 1U6QA 5J4SA 2H6MA 1E38B 1WYKA 1W7GH 1CBWC 5EPNA 2FYRA 2PGBB 3BN9A 4B71A 2ZFQH 3KIDU 4CHAC 3AAUA 1AFEH 1ANBA 4B76A 4ESTE 2VWLA 5CMXH 5GCHF 1DWCH 4FUHA 3HPTB 1T4VH 1LDTT 1H4WA 1OP0A 3RC4A 4IN1A 4WVPE 1AHTH 4FU7A 4GUXA 2OBQA 1O2OA 1Z1IA 3ZZ6A 2RA0A 3W95A 4X1RU 4Y10E 1BBRK 3SNDA 5GXPA 3PWBA 1Y8TA 1KDQA 1O3OA 1L1GA 3SNCA 2ZWLH 1IHTH 1NZQH 3AVZA 3E8LA 4A5TS 2ZECA 3HKJB 2ASUB 3A8BA 5DP7A 1ESTA 1UTLM 2R2MB 2STAE 4AFQA 4UONA 1F0SA 3BTEE 1WTHD 1ELFA 1YYY1 3LC5A 3C1KA 1TMTH 2BD9A 1BQYA 2ODYB 2ZI2H 3A82A 4HZHA 1K22H 2XBXA 1YCPM 3KN2A 3MH5A 1EZSC 1MU8B 2FLBH 5AF9H 3UNRA 3N7OA 4JMYA 1T8NA 1TBQH 4DVAU 1C5ZB 3SV6A 2GDDA 2FOAA 1AI8H 2A0QB 3GY2A 3LGUA 2R9PA 1HXEH 3SJOA 1HAIH