1ANBA

Anionic trypsin mutant with ser 214 replaced by glu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVEWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANIONIC TRYPSIN
publication title Perturbing the polar environment of Asp102 in trypsin: consequences of replacing conserved Ser214.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA02
3PMJA 1GHXH 4KKDA 5AFYH 1DOJA 2I6SA 2BZAA 2FZZA 1VGCB 2JETB 3F9FA 4ZH8A 1C9PA 1NFXA 4OS6A 1FV9A 1G30B 1C5RA 1ZZZA 4PROA 1GI3A 2QIQA 1MKXH 1ZTLA 1TNLA 4AB9A 2H5DA 4BAKB 1P9UA 1BBRK 1E34B 1HBTH 1W13U 2XRCA 1HUTH 3TU7H 3ZZAA 1BA8B 2FLBH 4B76A 1C1WH 1P2MA 1IQKA 2SGDE 1SLWB 4I8JA 1RJXB 2SGEE 1ZMJA 4IBLH 4OS4A 1IQMA 3MU0A 1KLTA 4D8NA 3VB5A 1GBIA 3SV8A 1O3MA 2G00A 3UR9A 4NA7A 2FXRA 4XBCA 1W0ZU 1UMAH 1HJAC 1GBKA 4GVUA 1L1NA 4GPGA 3SGBE 1HPGA 1UTNA 2GT7A 1W0YH 4WJG2 4DGJA 1MBMA 3KQCA 2ZZUH 1VITH 1SOZA 2HGTH 2PSYA 1FY8E 3E91A 3OTJE 1DVAH 2ZG0H 5FHTA 2J2UA 3D62A 2ALVA 1LVMA 4WWYA 2ZGXH 1AE8H 4UFEH 1FLEE 1SGEE 4B75A 1O30A 4O03A 1GJ4H 1K22H 3F9EA 1XUJA 2HALA 4K60A 3PM3A 3SU3A 1AZ8A 1UVSH 1VJ9U 1NRNH 4Z6AH 4MNWA 1SG8B 3EDXB 3M36A 1ANDA 4JMYA 3SJOA 1AO5A 2V35A 1C5MD 3KL6A 3UREA 2GTBA 2WYJA 3SHCH 4HZHA 1IQGA 1BTPA 2HRVA 3EYDA 2Z6BD 1WYKA 1MH0A 2C8XB 4DIHH 3SORA 4UDWH 3A7XA 1HXEH 4A1XA 1ELFA 1PQ8A 2G81E 1SVPA 1OS8A 1F7ZA 1HRTH 1C4U2 3M5OA 3ZZ7A 3HATH 1CQQA 5DG6A 4NWLA 3ZYDA 3UR6A 2FYRA 2AMDA 1PYTC 2IOTA 2UWOA 1O2YA 4YO9A 1N1LA 1ELBA 4YOJA 1RD3B 2ZPRA 1TB6H 2PKSB 1ZTJA 2D2DA 4NGAH 3T29A 3S0NA 5E2OA 1CA0C 2A4GA 3UNSA 1AFQB 1JOUB 1IQHA 1O2VA 2QC2A 4F49A 3UIRA 2NWNA 2FS9A 2ZEBA 1ZHMA 1IQNA 4NFFA 3ZVEA 4B73A 1H1BA 1HAZB 1NZQH 6CHAC 1Q2WA 1YLDA 1N8OB 1ESTA 1EKBB 1XMNB 1Z6JH 1UHBA 3A82A 1CO7E 3RC4A 2OC7A 3BIUH 3MFJA 1DDJA 3P70B 2A0QB 4WY3A 1GWAA 1OWKA 2BY7X 3T27A 5ABWA 4MDSA 5ESTE 1SLVB 2BD2A 1AKSA 3H5CB 2ZDAH 1QR3E 1GI8B 2EA3A 2GV7A 5A8ZA 2NU0E 2SGPE 4O9VA 2SNVA 5CMXH 1SGNE 1PPFE 1D3QB 4ABFA 2BD4A 1B0FA 4JYVH 4UFGH 3D49H 3PYHA 1SB1H 3UWIA 2ODYB 1CGJE 1JRTA 1T4UH 2O8UA 2PUQH 2YOLA 4IMQA 4AG2A 2FX6A 3BTQE 1G32B 3ATKA 1ARCA 1RXPA 1GI7B 5LPFA 2ZHEH 1CA8B 1KIGH 2ZO3H 3ZZDA 1FONA 1QB1A 4WH8A 5EPNA 5F8ZA 1ZSKA 3NPSA 4U32A 3A7VA 2JETC 3ODFA 3M7QA 3SO3A 2VWNA 1LKBA 5GXPA 2Z3DA 1P8VC 2OC0A 2OLGA 1GHBF 2FX4A 5L2YH 1GJ5H 1F5RA 2TBSA 1LHGH 1FI8A 1GJDB 3ZVFA 2AFQB 3BTME 4ZKOU 3B23B 1O2HA 1Z1JA 3RXFA 2VVUA 4YM9A 3RMOH 2HPQH 3VB4A 1P3EA 1ZSLA 1T8MA 5I25A 3EA8A 3F68H 4WMEA 1QL8A 5C2ZA 2JH5D 1FIWA 2TGTA 2A7CA 3GICB 1C1NA 1NPMA 1QHRB 2BQ7B 5DGJA 1TX6A 1TALA 4Y76A 1ETTH 1EUFA 2P94A 3RXAA 4NCYA 2BLOA 4KTSA 4GHTA 1A5GH 1TMTH 2BQWB 3QX5H 6GCHF 1BBRE 1EP6A 2BHGA 2FESH 2Z3CA 4B71A 7ESTE 1QBVH 1TNGA 1NT1A 2ZI2H 1C4Y2 4K1EA 1O2KA 3SQEE 2VIDA 3S69A 2QF0A 2RG3A 1LHDH 1V2MT 5DP7A 1NM6A 9ESTA 3MHWU 2ZU2A 5DKMA 2ZHWH 1GHBG 1W2KH 5A2MH 2R3YA 3FP6E 1A5HA 1F92A 3PROA 4FUHA 3V0XA 5FBIA 1EXFA 1SGFA 1LHEH 4JCNA 2W7SA 1EAXA 4AOQA 2PWXA 2ZCKP 1O3GA 1DICA 4ZHLU 2P93A 3E90B 1S6HA 1AUJA 2RA0A 1O37A 2VJ1A 1DFPA 1GHYH 4ZXXH 4BXSA 3FAOA 1GG6C 3T25A 1HDTH 6GCHG 3MMGA 1TX8A 3SUFA 1OWDA 1FMGA 1DUEA 3RM2H 5EGMA 4X8SH 2BOHB 1XUFA 1XXFA 1BRCE 1YM0A 2BVRH 5JB8S 1W3CA 1C5UA 2UUKB 3P8NA 1A7SA 1O2ZA 1V2UT 1O5DH 1YPMH 1CBWB 3TH4H 5C5OA 1O3FA 3UOUA 3HKIB 3AW0A 4WXVA 2FOBA 1MKWK 2OBOA 1UO6A 1GBBA 1A0HB 4TWWA 4CRDA 3S9BA 3T28A 1Y8TA 2HWLB 2PKSC 1RS0A 2W5EA 1IQJA 1O31A 3ZZ8A 1C1SA 1NN6A 1P2NA 5A0BA 1HB0B 3ZVGA 3UWJH 1AFQC 1S81A 1GMHG 3TH3H 3TJVA 1EJAA 1FDPA 1NTPA 1V2RT 3OY5U 3SOSA 1DITH 1C1TA 1NRRH 4HFPB 1UTKA 1MTNB 3LJJA 1O2IA 1O3EA 1FQ3A 4MNYA 3ESTA 1GVKB 1WTHD 1S6FA 4Q80A 3RXLA 3FVFB 1P11E 3V3MA 3URCA 1M9UA 1GI0A 1GL1A 4DY7B 1QIXB 4YOIA 1KXAA 1BTUA 1PPCE 3NZIA 3HK3B 2P3FH 4NSYA 1SGRE 3ELAH 2Y6TA 2TRMA 1Z8RA 1E0FD 2ZDKA 2CN0H 1YP9A 2GDDA 4NIXA 2FM2A 3JZ1B 2LNCA 5TCCA 4O97A 1MTWA 2FPZA 3S9CA 1MAXA 2Z9JA 4X2XA 2O8LA 3UFAA 3SUDA 2R0KA 2OQ5A 5F03A 3U98H 2ZTZA 2XBXA 3TK6A 2O9QA 4BAOB 2GT8A 1T8OA 2YNBA 4IC5A 4AGKA 3GYMA 1HAPH 1T32A 3SNBA 5LGOA 1MAYA 3K6YA 1ZGVA 2C4FH 1G2LA 2CF9H 3QDZB 1HLTH 2BDHA 4ASHA 4TPIZ 2OBQA 3GY5A 2ZIQH 5DPAA 3QTVH 4E05H 8GCHF 1XKAC 1V2LT 1PPGE 1C5LH 2A7HA 4WF8A 4IMZA 4XE4A 1SR5C 2VWMA 1GJ6A 2V0BA 3E16B 3AAVA 1OWIA 1V2JT 1QA0A 4FUBA 2ASUB 3MU5A 2XC4A 1UK2A 3MH6A 1BCUH 2THFB 1EZXC 3R3GB 4ZKNU 4D76A 3RXJA 1OWHA 1THPB 1UTQA 3E8LA 4I8GA 1QQUA 4AYVB 1FAKH 4ABBA 1S5SA 5K0HA 3A87A 3OY6U 3SN8A 3A88A 2J34A 2ZFRH 1Z8JB 2XW9A 3EQ0H 4YT6H 1ELAA 2AYWA 3QTOH 1S82A 3E1XB 3BN9A 3MYWA 1BDAA 2BY6X 1G3CA 5A09A 2FI4E 2FOCA 1UTMA 1THSH 2B7DH 2ZF0H 4BOHA 5JPMH 2ANYA 2B9LA 1C1RA 1GI1A 3SUEA 8GCHG 3MNSA 4FUJA 1KLIH 5HXFA 3RXIA 4B1TA 3LH3A 2ZU1A 4ESTE 2Q6FA 1E38B 3RXVA 4DIIH 4UFDH 2VIWA 3W95A 1CVWH 1C9TA 3PWCA 3DFJA 3LKWA 1O3AA 5ETXA 1NC6A 4HTCH 3GY6A 2F3CE 3H7TA 1O3PB 1KXDA 1WV7H 1O35A 4IS5A 3PV4A 3SV2H 3I78A 4A1TA 3SU2A 2A4RA 3VB6A 3MO6A 1ANEA 2VVCA 1AU8A 2A1DB 3K6ZA 1V2VT 5IYTA 3BTGE 3KHVA 3L3TA 3P8GA 1HAXB 1OPHB 1UCYE 2GZ7A 2ZHFH 3RM0H 5GCHF 3ZVCA 4GHQA 1PQ5A 4CHAB 2FOMB 1F0RA 1GI9B 2WYGA 3TGJE 3LH1A 1B5GH 3DA9B 1O5GH 3N7OA 7GCHG 3PTNA 2HNTF 1LDTT 1HJ9A 2OC1A 1EAIA 1O3BA 1CBWC 5FX6A 3H7OA 4NWKA 1Y5BT 2A4QA 3LC5A 3ZZ4A 1AB9C 2BQ6B 1TPOA 3ZV8A 1OX1A 3CP7A 3TK9A 2PHBA 2JKHA 5EU8A 4ZHAA 1L4ZA 1F5LA 2R2MB 1YCPK 3NKKA 2DE9A 3D23A 1WQVH 5FPSA 1HAGE 1BT7A 1O3DA 1MTUA 4FUFA 1KLJH 1O2TA 1VR1H 1JWTA 5L2ZH 3PLKA 2BM2A 1FY4A 1TGTA 1MTNC 1EJNA 4X1RU 2QA9E 1UK3A 2GCHF 4YZUA 3SJIA 1TWXB 3BTFE 4O3TA 1IAUA 4X1QU 2BLVA 4JK5A 1A61H 1MKWH 1EZQA 1D9IA 3SNDA 3AW1A 2C8ZB 1VITF 1WCZA 5DO4H 4K8YA 1IOEA 1XM1A 2CHAB 3TITA 3TNSA 1TMUH 2HNTE 1D6WA 3CENA 1BTZA 2ZQ2A 3RXUA 2AH4X 1G9IE 2FEQH 1A4WH 4JYTA 4MPUA 1AZZA 1SGIB 2WUBA 1O2XA 2BXUH 3QO6A 5SGAE 4RKJB 3S7HB 1ORFA 1XUIA 1PYTD 2QN5T 2R3UA 1GHZA 5EQSA 1RTFB 3ATLA 4A7IB 1HAYB 1BJVA 1CGHA 4IW4E 1YPHE 4TWYA 2GCHG 3ATWA 4IC6A 1MMJN 1LKAA 2BD3A 4Y79A 1GI4A 2HLCA 1DLEA 2ZGHA 3JZ2B 1ZOMA 3M3SA 1C2JA 3PLBA 5FCKA 5BRRE 4Y0YE 3QZRA 1EZSC 1UVPA 2J95A 1YGCH 5DP8A 4IN1A 2P95A 1OYTH 4CRBA 1VITG 1E35B 1UTPA 3OX7U 1P04A 1SFIA 5C1UA 4HGCA 5EXMA 1CT4E 5FBEA 1W10U 4WMDA 3LPRA 1BRBE 1P2QA 1BOQA 2IJOB 3ODDA 5A8YA 1BRAA 1CU1A 1TQ7B 2G4TA 5L30H 1LO6A 1ABJH 1GMCF 1Y3YA 1GBLA 1YC0A 5T6DA 1ELGA 2WPMS 3O8CA 2WPLS 1GCTB 3E0NB 1ZPBA 5DP9A 2ZNKH 3I29A 3L33A 1Y3VA 1BMMH 4CBOA 1C2LA 2ZDMA 1W7XH 4X6OA 3RXMA 4H4FA 1OWEA 1ZJKA 1C1VH 5EOKA 1O5CB 1YPJH 1JIRA 1TA6A 1Y3WA 1SMFE 3QUMP 2Z9KA 1AI8H 3FANA 4R8TB 1C1QA 4UONA 1BQYA 1AUTC 4Q2KA 3EGKH 2ZDNA 1KTTB 1RIWB 2PFEA 1TNIA 1C1PA 1FJSA 1O2MA 1O2JA 1TOCB 1NROH 1O2SA 2FLRH 1TGCA 4QT8C 5AFZH 1MU8B 1SL3A 3OYPA 2UWLA 1GMCG 1NFUA 3UNRA 1AIXH 3GCOA 3ATIA 4A92A 1TOMH 2ULLA 1ZLRA 1P2KA 2Z9LA 4ABHA 1CSOE 4CHAC 1P06A 1Y59T 4OS2A 2DE8A 4JZ1A 1ELEE 3QK1A 4FU8A 3AAUA 1FN6A 1FIZA 1WU1A 3TK5A 2ZFSA 3M5LA 4A6LA 4FUEA 3GDUA 3LGYA 2FOEA 2ZP0H 2EC9H 2Y80A 4U01A 2G8TA 1PFXC 1TFXA 2GKVE 1DSUA 1TABE 1ARBA 3LC3A 3TNTA 2H1UA 2YNAA 1LMWB 1YCPM 3K2UA 1TBQH 1A1RA 2FODA 3Q3XA 1C1OA 1YYY1 3S9AA 3A7TA 3M3VA 2M5TA 3PO1B 4R0IA 3NXPA 4INKA 4B2CA 1CHOF 5EG4A 1SBWA 4ZHMU 2ZFQH 1TPAE 2Y5FA 1O33A 2D8WA 2H9EH 2OCVB 4ISOA 4A1VA 2G51A 1LPGB 1GDNA 4Y8XA 1DWEH 2VNTA 3OSYA 1CE5A 2H5CA 3BTTE 3T26A 1BTYA 2IPHA 2V3OH 2BY9X 1PPEE 1HAVA 1ZR0A 3FP7E 3ZZ6A 4CR9A 1GJ7B 2CHAC 4U2WA 3P8OA 1C2IA 1YCPH 2VH0A 4UFFH 2VIQA 5E8EH 5GWZA 4RKOB 3A84A 3MH7A 5AF9H 2ZCLP 1ETRH 2ZECA 3Q3YA 1J8AA 5BPEA 3B8JA 1K2I1 1Z8GA 1GJ9B 1KXCA 1VCQA 2Y82A 4AORA 1ZRBA 3CS7A 3UOPA 1CHOG 3KIDU 8LPRA 1ESAA 1VGCC 2BY5X 3QWCH 2FIRH 2FO9A 4K2YA 1LPZB 4LK4A 1UTOA 1P3CA 4D7FA 2VIVA 1ELVA 3RU4D 2AEIH 2ZTYA 3M37A 1HFDA 3LIWA 4ZKRU 4Y8ZA 1G3EA 2ZA5A 4JZDH 2J94A 4AX9H 2Y7ZA 1TNHA 3D65E 1YF4A 1GBCA 5GPIB 3RXRA 1X7AC 2BDGA 2XNIA 5J4SA 1SC8U 2BY8X 2ZHQH 1K28D 1O2NA 5HYOA 1C2HA 2BDYA 4X6MA 1O5FH 3RLWH 5I46H 2ZFFH 4NG9H 1LQDB 3MU4A 1EASA 4Y0ZE 3MTYA 2AIQA 2KAIA 1O39A 1GBTA 2BD9A 2ZWLH 2R2WU 1YPLH 1HJ8A 2ZU5A 5T3HA 1THRH 3A8CA 2QGRA 1QGFA 3GY4A 1D6RA 2A2XH 3M7TA 3SV7A 1JMOH 3BTEE 2ILNA 4J1YA 1T8NA 4KTUA 3ENSB 5B6OA 1GGDB 1FZZA 1NU7B 1ETSH 1J16A 1MTVA 1FPCH 2J9NA 4MNXA 4GUXA 2VH6A 2LPRA 1K1NA 2RDLA 1H9IE 5A0CA 2FOGA 1RIWC 1L1GA 3HPTB 4DT7B 4FXGH 5C20A 1H8DH 1LPKB 2VVVA 3A7ZA 2B8OH 4X8UH 1F0SA 5GDSH 1P02A 2Z94A 2C93B 2VGCB 1DM4B 1OOKB 3BEFB 4NA8A 4XSKU 4OS5A 1TGNA 1QJ1B 1GBJA 3RXHA 4CRGA 1O3IA 1O3JA 4XBBA 4I8KA 1PPZA 4ISLA 1OXGA 4FVBA 2BD5A 1FY1A 2G5NA 2D26C 4I8LA 5F6MA 1NESE 3NWUA 2ZGBH 3B9FH 1SI5H 3FP8E 1NO9H 1PQ7A 3KNXA 2QXIA 2XCNA 2A45B 1HYLA 5HM9A 3W94A 2OP9A 1DT2A 3EAJA 3TJNA 3SJ8A 1V2TT 5HGGA 1G36A 1A2CH 1BHXF 4X6NA 4D7GA 1ZSJA 2WPHS 5FX5A 3UNQA 3KN2A 1OWJA 1G37A 3RXCA 1TRMA 5ESBA 1ESBA 1L0ZA 4BAMB 1C5QA 1C2EA 3KGPA 4ABAA 1N8OC 1YPKH 1BIOA 1GHAF 3PO1C 2BD8A 4K5ZA 1S85A 2TGPZ 2A5KA 1P03A 4BXWA 1F0TA 1QBOA 2VIPA 3HK6B 1O2RA 1XVOA 5HM2A 1EB1H 4BTUB 2BYAX 2HNTC 5A8XA 5T6FA 2R0LA 3FZZA 5JBCS 1IQIA 2WPKS 1YKTA 5LH8A 3NK8A 5F8TA 1K9OE 1QL7A 1JXPA 3SZNA 1AQ7A 1IQEA 2GX4A 4NZLA 3RMMH 2GVFA 1QRXA 1BMAA 4ZUHA 3AVZA 1O5AB 2GCTB 4NIYA 2ESTE 4RSPA 3A89A 2NU4E 1N6XA 1P9SA 1C5YB 3MWIU 2WINI 4ABIA 2AGGX 1DS2E 6ESTA 1KXFA 3DUXH 1Z8IB 4NSVA 2ZCHP 1ZGIA 3BIVH 2BMGB 3GOVB 3TJUA 1SPJA 1O36A 1LVYA 1GI2A 1DWCH 3V13A 1HIAB 4CRCA 3QN7A 1BITA 1GL0E 3RXSA 2STBE 3A8DA 3RC5A 1GCDA 2ZU4A 2FDAA 1HGTH 4DW2U 2XBVA 4X8TH 3ZVBA 1K21H 2O8MA 4FUCA 1T7CA 3I77A 2ZKSA 4JK6A 1WOFA 1DSTA 1BRUP 4KGAA 2XBWA 1K1IA 2F9VA 5T6GA 4MG3A 1ZTKA 2GV6A 2QXJA 3SNCA 2BD7A 3M5NA 1VCPA 3STIA 1PPHE 2V6NA 3SU6A 1VJAU 1RGQA 4TPYA 2Y7XA 4I7YH 1NU9A 3U1JB 3SI3H 2SGQE 2TPIZ 1GI5A 1H8IH 1LHFH 1C5XB 1ZMNA 4I8HA 4Q7ZA 4UEHH 5JBTA 3BV9B 2PKAB 3A7YA 3PB1E 2XCFA 1B7XB 1D3TB 2RA3A 1W12U 1S0RA 3ZZCA 3O8RA 1HAVB 1GGDC 4AB8A 1TPSA 2BDAA 2H2ZA 3UTUH 4THNH 4AFZA 4RN6A 2F9OA 5J4QA 1K1OA 3K65B 2FOHA 2D1JA 4AG1A 2PV9B 4CH2B 2F9PA 1GPZA 1LCYA 7KMEH 1W8BH 5EQRA 1V2KT 5LPEA 2ZU3A 3VGCB 1Q3XA 5E0GA 1JIMA 4J2YB 2GMTB 4JZIA 5CE1A 5G4BA 2WUCA 2VGCC 1C5SA 1K1PA 2AIPA 2VINA 3V12A 3DHKH 1EAUA 2GZ8A 2EI7A 2QXHA 1KTSB 1XXDA 1ZHRA 4NA9H 2Q1JA 4WXIA 5GIBA 1S84A 3G01A 2Z3EA 4GCHF 5K7RA 1Z71A 1IHTH 2K1QA 2STAE 3A81A 3ZZ5A 2O8WA 1DXWA 2B0FA 5C3NA 2FI3E 1O38A 1RTKA 1FNIA 3ITIA 4HI3A 1SHHB 1O2QA 3LT3A 3T62A 3UUZA 1Y5UT 1SOTA 3MOCA 2PSXA 1UTJA 2ZHDA 4AFQA 4B74A 4Y7BA 3P6ZB 2FOFA 4DURA 4FU7A 1HCGA 3E3TA 1KDQA 2OUAA 2QXGA 3BTWE 5GCHG 1KY9A 1O2UA 4INHA 1SHYA 2KAIB 2XC5A 2ODPA 2AERH 3P17H 1EPTB 1ELDE 1EZUC 1NRSH 1RFNA 4MPXA 1QA7A 2ZDLA 1V2PT 3E6PH 1OYQA 4GCHG 1EP5A 2NU2E 4YLUA 1PQAA 1P10A 3Q77A 1S83A 5AVDA 1AWFH 4MQAA 3VXFH 2VU8E 1ZHPA 2ODQA 1EAWA 1J15A 1HNEE 1EQ9A 5JBAS 2A31A 2C3SA 3A8AA 1C5OH 1UVOA 1Z6EA 3MH5A 4IN2A 4DVAU 1O3NA 3RU4E 5EXLA 2QY0B 1SGPE 3NUMA 1BHXB 2FTMA 2XC0A 1W11U 4ZROA 1BTXA 1A46H 1C2MA 3MNCA 1AY6H 1NFWA 1F5KU 2AGEX 2QF3A 3PTBA 2GCTC 1Q31A 3RP2A 2NU1E 4WVPE 4FUGA 4ISNA 1QRWA 3K9XB 5LPRA 1ANBA 1O32A 1C5VA 4OGYA 3AASA 3A8BA 5DP4A 1TBZH 1TNKA 5C1YA 4BNRA 1SQTA 2OC8A 1W14U 3GY2A 2UUYA 1MTSA 4X0WU 1PJPA 5TCAA 3KEEA 1GDQA 2G4UA 2XXLA 1DY9A 3LGTA 5FAHA 3F9GA 3RMNH 4LXBH 4X1SU 1BB0B 5JB9S 1H9HE 1A3EH 4MPWA 4Z0KA 5C5NA 1C4V2 2IN2A 1ACBE 3O8BA 1P2OA 1ZPZA 3LU9B 1TRNA 2C8WB 1HAHH 3M61U 1T4VH 3Q3KA 3UPEA 1CT0E 2NU3E 1TYNA 3A80A 1O2LA 1D3DB 1V2QT 5C67A 4X2VA 3TJOA 1V2WT 2VIOA 2XWAA 1FPHH 3PMHB 4NIVA 2VWLA 3F6UH 5E0HA 1LHCH 1OP8A 5HMAA 3F9HA 4ABJA 4E06H 1KYNA 1MD7A 3MO3A 1FN8A 1AMHA 1L1JA 1YLCA 2ZQ1A 2SFAA 2EI8A 1KSNA 1HAIH 1O0DH 2A4OA 4GAWA 5E2PA 1DANH 2GGVB 3ZV9A 3M5MA 1D3PB 2P8OB 3HKJB 2J38A 4LZ4B 1P2IA 8KME2 2QCYA 5EQQA 1V2OT 3LGUA 1C2FA 4BAHB 2ZGCA 5E0JA 4WH6A 4BTTB 4U30A 1GJCB 1MCVA 4ABDA 3BG4B 1A3BH 2PLXA 3VGCC 2GMTC 2VB0A 1O3HA 1SLUB 3MH4A 3EA7A 2A5IA 1K1JA 4GLYA 8ESTE 3PMAB 1GBMA 3A7WA 1Z7KA 4BTIB 4TY6A 1TIOA 4I33A 4Q7XA 4AGJA 2PTNA 1OSSA 1QJ7B 1HIAA 1VZQH 1AVXA 1YPEH 5JYIA 3KF2A 1GG6B 2OQUA 1C2GA 2OINA 1UJ1A 1BTHH 4UD9H 1MD8A 1N6YA 3ZZBA 4X6PA 1SGYE 4K69A 2FS8A 5EW1H 3SU5A 2F83A 2BXTH 3SNEA 1GBAA 5FPYA 3SJ9A 1GBEA 1GBHA 4TY7A 4KELA 3DT0H 1EJMA 1MQ5A 3LGIA 3P95A 1W7GH 4H6SB 3SU0A 2AMQA 3QLPH 1C5NH 3MNXA 1YBWA 4VGCB 1UK4A 2VWOA 1HAOH 3RC6A 1OP0A 2W26A 4E7NA 2Q6GA 3C1KA 1EOJA 3RDZA 1EOLA 3ZVDA 3SHAH 2G5VA 1EPTC 2QYIA 1C2KA 2XWBI 1TA2A 1P12E 2UUFB 4Y11E 4X2WA 4OS7A 3RXDA 2BLWA 2PKAA 1MU6B 1XUHA 2F9BH 1XX9A 2H9HA 1F2SE 1OP2A 2ZFPH 2ALPA 1J17T 3TH2H 1E36B 4LOYH 1DXPA 3RXTA 1GBDA 4DOQA 3M7UA 4I32A 4JZEH 1O2OA 2SGFE 2WV5A 2BTCE 3BTHE 1GVLA 1SQAA 3KQDA 2CMYA 5PTPA 4ABEA 2QAAA 1YPGH 3BF6H 2CXVA 1MBQA 1O3OA 2AGIX 4MVNA 4BAQB 1SLXB 1GI6A 2AS9A 2ZPSA 4FUDA 2F91A 2BZ6H 4K8BA 4ZXYH 3UY9A 1DE7H 2G55A 3KQEA 1BUIA 1FUJA 3PWBA 4B2BA 3ZZ3A 3PMBB 1QBNA 2PUXB 1K1MA 1H9LB 1T31A 4H42U 2PW8H 4DJZB 1V2NT 2ANKH 1DY8A 4CREA 3RUOA 1JRSA 2FWWA 3T2NA 1HV7A 1QTFA 2BLQA 6LPRA 1MUEB 1TBRH 3SW2B 2PGBB 4K1TA 1FY3A 4GSOA 2PTCE 3SGQE 4MNVA 1ZPCA 1KDQB 3GDVA 3L6PA 4X2YA 3UQVA 3SGAE 1D4PB 1U6QA 4NZQA 3GCHB 4FU9A 5EODA 4X1NU 1ID5H 1CHGA 1GCTC 1QCPA 1AWHB 1BMLA 1XUKA 1AHTH 1EPTA 3RXOA 2ZFTA 4Y6DA 3LGWA 3ZVAA 1CT2E 3QZQA 2GD4B 2P59A 4YT7H 1O2WA 3GCTF 1Y5AT 1F0UA 4Y7AA 2HVXA 3UQOA 3Q76A 2FMJA 4ISIH 2HPPH 1TNJA 1K1LA 5H4IB 2P8OC 1H4WA 4SGAE 1L2EA 3BTDE 1G3BA 4XBDA 4Y10E 2DUCA 4YTAA 1VCWA 3MI4A 1BBRH 2BX3A 4I31A 2F9UA 1UCYK 3U9AH 2R9PA 4CH8B 3SV6A 4K3JA 3A86A 3BG4C 1A5IA 1DPOA 1EX3A 5DK1A 3RU4T 1BZXE 4K1SA 1DUAA 1NY22 3GY7A 1XKBC 2WPJS 3TGKE 1O5EH 1O2GH 3SJKA 1O3CA 2O8TA 3TIUA 3C27B 1C5PA 4B2AA 2W3IA 3GISB 3IWMA 1GMHF 3GCTG 1GMDF 3MO9A 2PR3A 5L6NH 1GJ8B 1OKXA 2FOAA 1NRQH 2BVSH 1O3KA 3P92A 1GJBB 5F8XA 3VEQB 4ZMAH 4MPVA 3MU1A 2P3UB 3VPKA 4OS1A 1GVZA 2CJIA 1IQFA 3GY8A 3TVJB 1UVTH 3RXBA 2H9TH 1LTOA 3MU8A 3SV9A 1GHVH 1C2DA 7LPRA 3VB3A 2FP7B 1T8LA 4SGBE 2V3HH 1PPBH 2A7JA 3VFEA 3BG8A 1ZYOA 1P57B 4WMFA 3F1SB 1SQOA 2CV3A 1L4DA 1A0LA 2J92A 1RRKA 2Y5HA 2Y81A 1AB9B 2CF8H 3U8OH 4AN7A 4VGCC 2GDEH 2FTLE 1AGJA 4BANB 1AVWA 4XOJA 3WY8A 3NCLA 2J4IA 3BEIB 3SNAA 2GP9B 3OU0A 1QL9A 4CBNA 1C5TA 1TAWA 4M7GA 4YESB 1AVGH 3RXKA 3KCGH 3TPIZ 1WAYB 1GJAB 1GMDG 1SSXA 1TQ0B 4JZFH 2RCEA 4AFSA 3BTKE 4FVDA 4D9QA 2ZC9H 1QNJA 1TMBH 2W7UA 2CGAA 3R0FA 4NFEA 4DCDA 1WSSH 2WPIS 3LJOA 1IHSH 1DX5M 3RLYH 1V3XA 1DLKB 4AYYB 1NFYA 1YPHC 3QGNB 4YOGA 3V7TA 3ATMA 4MTBA 4CRFA 5DP5A 1A0JA 1MKXK 3A83A 1P01A 3SU1A 3KQBA 5EW2H 5DJ7A 1GHAG 5IDKA 1SGFG 1P05A 5CHAB 2I6QA 5FCRA 1TPPA 5A0AE 3LONA 1C1UH 2FYQA 2A5AA 2Y5GA 1V6DA 4X1PU 2OXSA 2UWPA 4H6TA 2EEKA 2JH0D 1MCTA 4A5TS 2TGAA 2ZDVH 2BX4A 3TGIE 2ZPQA 2BVXH 4KP0A 3EE0B 5JDUB 1QJ6B 3GY3A 2G52A 1FXYA 3BEUA 1G3DA 4AFUA 1C5ZB 3RXPA 1SGCA 1O3LA 1NRPH 3DFLA 3HGPA 1Z1IA 4UE7H 2B5TB 1G2MA 1QB6A 1KXEA 1Y3XA 1WUNH 3GCHC 2TGDA 1TE0A 1QURH 1BJUA 5AHGH 1SGQE 5C1XA 3VB7A 1ELCA 3HGNA 3SUGA 1HJAB 2SNWA 1QQ4A 5EXNA 1INCA 1TGBA 1MQ6A 1MZAA 2BDBA 1UHBB 3RXQA 1HXFH 2UUJB 1DWDH 2QV1A 4YLQH 3MNBA 1LVOA 5JBBS 1WQSA 1P09A 1EB2A 4CR5A 7GCHF 1AKSB 3FFGA 5DP3A 4AZ2B 1E37B 1UVUH 1J14A 1WBGB 4F4OC 3EA9A 2BDIA 1IQLA 4LZ1H 4JYUH 1XUGA 1KXBA 1O5BB 2Q6DA 1P2JA 1JBUH 5TJXA 1C5WB 3E0PB 1SGDE 2ANWA 1AN1E 5DP6A 4NIWA 2BB4A 3QGJA 1AFEH 5GJ4B 4FUIA 1TX7A 3RMLH 2WV4A 2ZTXA 4OGXA 3CS0A 2OTVA 3ZZ9A 2C8YB 3URDA 2GZ9A 1ANCA 1SFQB 1QB9A 1LVBA 4XFQA 3STJA 1P0SH 3GCNA 3GYLB 3Q00A 1J9CH 1S0QA 2TIOA 3SQHE 2OD3B 2W3KA 2Z7FE 1UCYH 3VXEH 1DWBH 1QFKH 1V2ST 3IITA 2AMPA 2A2QH 4ISHH 3U69H 1UTLM 3M35A 2P16A 3BSQA 2H6MA 3U8RH 3RXEA 3S7KB 1GHWH 3DD2H 3A85A 1C1MA 3IG6B 3LDXH 3LGVA 3T5FH 1MZDA 4MLFB 4Y8YA 1RTLA 2BDCA 3LOXA 3GDSA 1GDUA 4Y71A 1CA0B 4D9RA 2EI6A 3O8DA 4XDEA 5FPTA 3M3TA 4IGDA 3TLOA 1LQEA 5EPYA 4TYDA 2Z9GA 1O34A 6CHAB 2Z9IA 2XTTB 1QRZA 2PGQB 3U8TH 1WTGH 1ELTA 1ABIH 1B0EA 1ZRKA 2P3TB 2A32A 1SGTA 4DG4A 1AD8H 1QY6A 1TGSZ 1AE5A 1FY5A 1NS3A 1EATA 4CRAA 1TRYA 4ZAEA 1BMNH 1BTWA 4ZKSU 2BOKA 2ZGJA 4O3UA 2SGAA 3P8FA 3PLPA 1FAXA 3SBKA 5FXLA 1GBFA 2XYAA 4E7RG 1CGIE 1Y3UA 2ANMH 1XVMA 4KTCA 3RXGA 1TLDA 5CHAC 2FI5E 3ZYEA 2HOBA 4Q7YA 1ZMLA 1TONA 3FZDA 2XBYA 1O2PA 1ZJDA 3SU4A 4X8VH 4ABGA 2C90B 3SI4H 2JH6D 2F9NA 3U1IB 4INLA 9LPRA
chains in the Genus database with same CATH superfamily
3PMJA 1GHXH 4KKDA 5AFYH 1DOJA 2I6SA 2BZAA 2FZZA 1VGCB 2JETB 3F9FA 4ZH8A 1C9PA 1NFXA 4OS6A 1FV9A 1G30B 1C5RA 1ZZZA 4PROA 1GI3A 2QIQA 1MKXH 1ZTLA 1TNLA 4AB9A 2H5DA 4BAKB 1P9UA 1BBRK 1E34B 1HBTH 1W13U 2XRCA 1HUTH 3TU7H 3ZZAA 1BA8B 2FLBH 4B76A 1C1WH 1P2MA 1IQKA 2SGDE 1SLWB 4I8JA 1RJXB 2SGEE 1ZMJA 4IBLH 4OS4A 1IQMA 3MU0A 1KLTA 4D8NA 3VB5A 1GBIA 3SV8A 1O3MA 2G00A 3UR9A 3F0OA 4NA7A 2FXRA 4XBCA 1W0ZU 1UMAH 1HJAC 1GBKA 4GVUA 1L1NA 4GPGA 3SGBE 1HPGA 1UTNA 2GT7A 1W0YH 4WJG2 2AHME 4DGJA 1MBMA 3KQCA 2ZZUH 1VITH 4I86A 1SOZA 2HGTH 2PSYA 1FY8E 3E91A 3OTJE 1DVAH 2ZG0H 5FHTA 2J2UA 5CDFE 3D62A 2ALVA 1LVMA 4WWYA 2ZGXH 1AE8H 4UFEH 1FLEE 1SGEE 4B75A 1COWD 1O30A 4O03A 5FL7D 1GJ4H 1K22H 2V7QD 3F9EA 1XUJA 2HALA 4K60A 3PM3A 3SU3A 1AZ8A 1UVSH 1VJ9U 1NRNH 4Z6AH 4MNWA 1SG8B 3N7EA 3EDXB 3M36A 1ANDA 4JMYA 3SJOA 1AO5A 2V35A 1C5MD 3KL6A 3UREA 2GTBA 2KCYA 2WYJA 3SHCH 4HZHA 1IQGA 1BTPA 2HRVA 3EYDA 2Z6BD 1WYKA 1MH0A 2C8XB 4DIHH 3NRLA 3SORA 4UDWH 3A7XA 1HXEH 4A1XA 1ELFA 1PQ8A 2G81E 1SVPA 1OS8A 1F7ZA 1HRTH 1C4U2 3M5OA 3ZZ7A 3HATH 1CQQA 5DG6A 4NWLA 3ZYDA 3UR6A 2FYRA 2AMDA 1PYTC 2IOTA 2UWOA 1O2YA 4YO9A 1N1LA 1ELBA 4YOJA 1RD3B 2ZPRA 1TB6H 2PKSB 1ZTJA 2D2DA 4NGAH 2JJ1D 3T29A 3S0NA 5E2OA 1CA0C 2A4GA 2XNDD 3UNSA 1AFQB 1JOUB 1IQHA 1O2VA 2QC2A 4F49A 3UIRA 2NWNA 2QF4A 2FS9A 2ZEBA 1ZHMA 1IQNA 4NFFA 3ZVEA 4B73A 1H1BA 1HAZB 1NZQH 6CHAC 1Q2WA 1YLDA 1N8OB 1ESTA 1EKBB 1XMNB 1Z6JH 1UHBA 3A82A 1CO7E 3RC4A 2OC7A 3BIUH 3MFJA 1DDJA 3P70B 2A0QB 4WY3A 1GWAA 1OWKA 2BY7X 3T27A 5ABWA 4MDSA 5ESTE 1SLVB 2BD2A 1AKSA 3H5CB 2ZDAH 1QR3E 4RT1A 1GI8B 2EA3A 2GV7A 5A8ZA 2NU0E 2SGPE 4O9VA 2SNVA 5CMXH 1SGNE 1PPFE 3GS9A 1D3QB 4ABFA 2BD4A 1B0FA 4JYVH 4UFGH 3D49H 3PYHA 3PRBA 1SB1H 3UWIA 2ODYB 1CGJE 1JRTA 1T4UH 2O8UA 2PUQH 2YOLA 4IMQA 4AG2A 2FX6A 3BTQE 1G32B 3ATKA 1ARCA 1RXPA 1GI7B 5LPFA 2ZHEH 1CA8B 1KIGH 2ZO3H 3ZZDA 1FONA 1QB1A 4WH8A 5EPNA 5F8ZA 1ZSKA 3NPSA 4U32A 3A7VA 2JETC 3ODFA 3M7QA 3FO8D 3SO3A 2VWNA 1LKBA 5GXPA 2Z3DA 1P8VC 2OC0A 1GHBF 2OLGA 2FX4A 5L2YH 1GJ5H 1F5RA 2TBSA 1LHGH 1FI8A 1GJDB 3ZVFA 2AFQB 3BTME 4ZKOU 3B23B 1O2HA 1Z1JA 3RXFA 2VVUA 4YM9A 3RMOH 2HPQH 3VB4A 1P3EA 1ZSLA 1T8MA 5I25A 3EA8A 3F68H 4WMEA 1QL8A 5C2ZA 2JH5D 1FIWA 2TGTA 2A7CA 3VG8A 3GICB 1C1NA 1NPMA 1QHRB 2BQ7B 5DGJA 1TX6A 1TALA 4Y76A 1ETTH 1EUFA 2P94A 3RXAA 4NCYA 2BLOA 4KTSA 4GHTA 1A5GH 1TMTH 5EJLA 2BQWB 2WHXA 3QX5H 6GCHF 1BBRE 1EP6A 2BHGA 2FESH 2Z3CA 4B71A 7ESTE 1QBVH 1TNGA 1NT1A 2ZI2H 1C4Y2 4K1EA 1O2KA 3SQEE 2VIDA 3S69A 2QF0A 2RG3A 1LHDH 1V2MT 5DP7A 1NM6A 9ESTA 3MHWU 2ZU2A 3UB0A 5DKMA 2ZHWH 1GHBG 1W2KH 5A2MH 2R3YA 3FP6E 1A5HA 1F92A 3PROA 4FUHA 2EY4C 1E79D 3V0XA 5FBIA 1EXFA 1SGFA 1LHEH 4JCNA 2W7SA 1EAXA 4AOQA 2PWXA 2ZCKP 1O3GA 1DICA 2WZQA 4ZHLU 2P93A 3E90B 1S6HA 1AUJA 2RA0A 1O37A 2VJ1A 1DFPA 1GHYH 4ZXXH 4BXSA 3FAOA 1GG6C 3T25A 1HDTH 1YY3A 6GCHG 3MMGA 1TX8A 3SUFA 1OWDA 1FMGA 1DUEA 2J5UA 3RM2H 5EGMA 4X8SH 2BOHB 1XUFA 3F3BA 1XXFA 1BRCE 1YM0A 2BVRH 5JB8S 1W3CA 1C5UA 2UUKB 3P8NA 1A7SA 1O2ZA 1V2UT 1O5DH 1YPMH 2JJ2D 1CBWB 3TH4H 5C5OA 1O3FA 3UOUA 3HKIB 3AW0A 4WXVA 2FOBA 1MKWK 2OBOA 1UO6A 1GBBA 1A0HB 4TWWA 4CRDA 3S9BA 3T28A 1Y8TA 2HWLB 2PKSC 1RS0A 2W5EA 1IQJA 1O31A 3ZZ8A 1C1SA 1NN6A 1P2NA 5A0BA 1HB0B 3ZVGA 3UWJH 1AFQC 1S81A 1GMHG 3TH3H 3TJVA 1EJAA 1FDPA 1NTPA 1V2RT 3OY5U 3SOSA 1DITH 1C1TA 1NRRH 4HFPB 1UTKA 1MTNB 3LJJA 1O2IA 1O3EA 3WW7A 1FQ3A 4MNYA 3ESTA 1GVKB 1WTHD 1S6FA 1W0JD 4Q80A 3RXLA 3FVFB 3N7DA 3DSOA 1P11E 3V3MA 3URCA 1M9UA 1GI0A 1GL1A 4DY7B 1QIXB 4YOIA 1KXAA 1BTUA 1PPCE 1YLNA 3NZIA 3HK3B 2P3FH 4NSYA 1SGRE 3ELAH 2CK3D 3OTPA 2Y6TA 2TRMA 1Z8RA 4B6FA 1E0FD 2ZDKA 2CN0H 1YP9A 2GDDA 4NIXA 2FM2A 3JZ1B 2LNCA 5TCCA 4O97A 1MTWA 2FPZA 3S9CA 1MAXA 2Z9JA 4X2XA 2O8LA 3UFAA 3SUDA 2R0KA 2OQ5A 5KGOA 5F03A 3U98H 2ZTZA 2XBXA 3TK6A 2O9QA 4BAOB 2GT8A 2WSSD 1T8OA 2YNBA 4IC5A 4AGKA 3GYMA 1HAPH 1T32A 3SNBA 5LGOA 1MAYA 3K6YA 1ZGVA 2C4FH 1G2LA 2CF9H 3QDZB 1HLTH 2BDHA 4ASHA 4TPIZ 5F53A 2OBQA 3GY5A 2ZIQH 5DPAA 3QTVH 4E05H 8GCHF 1XKAC 1V2LT 1PPGE 1C5LH 2A7HA 2KZ4A 4IMZA 4WF8A 5CHBA 4XE4A 5KECA 1SR5C 2VWMA 1GJ6A 2V0BA 3E16B 3AAVA 3PV5A 1OWIA 1V2JT 1QA0A 2PP6A 2ASUB 4FUBA 3MU5A 2XC4A 1UK2A 2J98B 3MH6A 1BCUH 2THFB 1EZXC 3R3GB 4ZKNU 4D76A 3RXJA 1OWHA 1THPB 1UTQA 3E8LA 4I8GA 1QQUA 4AYVB 1FAKH 4ABBA 1S5SA 5K0HA 3A87A 3OY6U 3SN8A 3A88A 2J34A 2ZFRH 1Z8JB 2XW9A 3EQ0H 4YT6H 1ELAA 2AYWA 3QTOH 1S82A 3E1XB 3BN9A 3MYWA 1BDAA 2BY6X 1G3CA 5A09A 2FI4E 2FOCA 1UTMA 1THSH 2B7DH 2ZF0H 4BOHA 5JPMH 2ANYA 2B9LA 1C1RA 1GI1A 3SUEA 8GCHG 3MNSA 4FUJA 4FETA 1KLIH 5HXFA 2M2AA 3RXIA 4B1TA 3LH3A 2ZU1A 4ESTE 1YWUA 2Q6FA 1E38B 3RXVA 4DIIH 4UFDH 2VIWA 3W95A 1CVWH 1C9TA 3PWCA 3DFJA 3LKWA 2F4LA 1O3AA 5ETXA 1NC6A 4HTCH 3GY6A 2F3CE 3H7TA 1O3PB 1KXDA 1WV7H 1O35A 4IS5A 3PV4A 3SV2H 3I78A 4A1TA 3SU2A 2A4RA 3VB6A 3MO6A 1ANEA 2VVCA 1AU8A 2A1DB 3K6ZA 1V2VT 5IYTA 3BTGE 3KHVA 3L3TA 3P8GA 1HAXB 1OPHB 1UCYE 2GZ7A 2ZHFH 3RM0H 5GCHF 3ZVCA 4GHQA 1PQ5A 4CHAB 2FOMB 1F0RA 1GI9B 2WYGA 3TGJE 3LH1A 1B5GH 3DA9B 1O5GH 3N7OA 7GCHG 3PTNA 2HNTF 1LDTT 1HJ9A 2OC1A 1EAIA 1O3BA 2J97A 1CBWC 5FX6A 3H7OA 4NWKA 1Y5BT 2A4QA 3LC5A 4ZCNA 3ZZ4A 1AB9C 2BQ6B 1TPOA 3ZV8A 1OX1A 3CP7A 3TK9A 2WV9A 2PHBA 2JKHA 2WPDD 4B6EA 5EU8A 4ZHAA 1L4ZA 1F5LA 2R2MB 1YCPK 3NKKA 2DE9A 3D23A 1WQVH 5FPSA 1HAGE 1BT7A 1O3DA 1MTUA 4FUFA 1KLJH 1O2TA 1VR1H 1JWTA 5L2ZH 3PLKA 2BM2A 1FY4A 1TGTA 1MTNC 1EJNA 4X1RU 2QA9E 1UK3A 2GCHF 4YZUA 5B6LA 3SJIA 1TWXB 3BTFE 2F43B 4O3TA 1IAUA 4X1QU 2BLVA 4JK5A 1A61H 4XRNA 1MKWH 1EZQA 1D9IA 3SNDA 3AW1A 2C8ZB 1VITF 1WCZA 5DO4H 4K8YA 1IOEA 1XM1A 2CHAB 3TITA 3TNSA 3DSPA 1TMUH 2HNTE 1D6WA 3CENA 1BTZA 2ZQ2A 4OM9A 3RXUA 2AH4X 1G9IE 2FEQH 1A4WH 2KFWA 4JYTA 2L74A 3MQKC 4MPUA 1AZZA 1SGIB 2WUBA 1O2XA 2BXUH 3QO6A 5IK2D 5SGAE 4RKJB 3S7HB 1ORFA 1XUIA 1PYTD 2QN5T 2R3UA 1GHZA 5EQSA 1RTFB 3ATLA 4A7IB 1HAYB 1BJVA 1CGHA 4IW4E 1YPHE 4TWYA 2GCHG 3ATWA 4IC6A 1MMJN 1LKAA 2BD3A 4Y79A 1GI4A 2HLCA 1DLEA 2ZGHA 3JZ2B 1ZOMA 3M3SA 1C2JA 3PLBA 5FCKA 5BRRE 4Y0YE 3QZRA 1EZSC 1UVPA 2J95A 1YGCH 5DP8A 4IN1A 2P95A 1OYTH 4CRBA 1VITG 1E35B 1UTPA 3OX7U 1P04A 1SFIA 5C1UA 4HGCA 5EXMA 1CT4E 5FBEA 4DT4A 1W10U 4WMDA 3LPRA 1BRBE 3SYJA 1P2QA 1BOQA 2IJOB 3ODDA 5A8YA 1KMHB 1BRAA 1NBME 2QF5A 1CU1A 1TQ7B 2G4TA 5L30H 1LO6A 1ABJH 1GMCF 1Y3YA 1GBLA 1YC0A 5T6DA 1ELGA 2WPMS 3O8CA 2WPLS 1GCTB 3E0NB 1ZPBA 5DP9A 2ZNKH 3I29A 3OE7D 3L33A 1Y3VA 1BMMH 4CBOA 1C2LA 2ZDMA 1W7XH 4X6OA 3RXMA 4H4FA 1OWEA 1ZJKA 1C1VH 5EOKA 1O5CB 1YPJH 1JIRA 1TA6A 1Y3WA 1SMFE 3QUMP 2Z9KA 1AI8H 3FANA 2YMSD 4R8TB 1C1QA 4UONA 1BQYA 1AUTC 4Q2KA 3EGKH 5C94A 2ZDNA 1KTTB 4ACBA 1RIWB 2PFEA 1TNIA 1C1PA 1FJSA 3WWFA 1O2MA 1O2JA 1TOCB 1NROH 1O2SA 2FLRH 1TGCA 4QT8C 5AFZH 1MU8B 1SL3A 3OYPA 2UWLA 1GMCG 1NFUA 3UNRA 1AIXH 3GCOA 3ATIA 4A92A 1TOMH 2ULLA 1ZLRA 1P2KA 2Z9LA 4ABHA 1CSOE 4CHAC 1P06A 1Y59T 4OS2A 2DE8A 4JZ1A 1ELEE 3QK1A 4FU8A 3AAUA 1FN6A 1FIZA 1WU1A 5HIZA 3TK5A 2ZFSA 4Q63A 3M5LA 4A6LA 3F2GA 4FUEA 3GDUA 3LGYA 1FX0B 2FOEA 2ZP0H 4F55A 2EC9H 2Y80A 4U01A 2G8TA 1PFXC 1TFXA 2GKVE 2J98A 1DSUA 1TABE 1ARBA 3LC3A 3TNTA 2H1UA 2YNAA 1LMWB 1YCPM 3K2UA 1TBQH 1A1RA 2FODA 3Q3XA 1C1OA 1YYY1 3S9AA 3A7TA 1K0HA 3M3VA 2M5TA 3PO1B 4R0IA 1EFRD 3NXPA 4INKA 4B2CA 1CHOF 5EG4A 1SBWA 4ZHMU 2ZFQH 4RT0A 1TPAE 2Y5FA 1O33A 2D8WA 2H9EH 2OCVB 4ISOA 4A1VA 2G51A 1LPGB 1GDNA 4Y8XA 1DWEH 2VNTA 3OSYA 1CE5A 2H5CA 3BTTE 3T26A 1BTYA 2IPHA 2V3OH 2BY9X 1PPEE 1HAVA 1ZR0A 2RFKC 3FP7E 3ZZ6A 4CR9A 1GJ7B 2CHAC 4U2WA 3P8OA 1C2IA 1YCPH 2VH0A 4UFFH 2VIQA 5E8EH 5GWZA 4RKOB 4F48B 3A84A 3MH7A 5AF9H 2ZCLP 1ETRH 2ZECA 3Q3YA 1J8AA 5BPEA 3B8JA 2YMSC 1K2I1 1Z8GA 1GJ9B 1KXCA 1VCQA 2Y82A 4AORA 1ZRBA 3CS7A 3UOPA 1CHOG 3KIDU 8LPRA 1ESAA 1VGCC 2BY5X 3QWCH 2FIRH 2FO9A 4K2YA 1LPZB 4LK4A 1UTOA 1P3CA 3EE7A 4D7FA 2VIVA 1ELVA 3RU4D 2AEIH 2ZTYA 3M37A 1HFDA 3LIWA 4ZKRU 4Y8ZA 1G3EA 2IJD1 2ZA5A 4JZDH 2J94A 1H8HD 4AX9H 2Y7ZA 1TNHA 3D65E 1YF4A 1GBCA 5GPIB 3RXRA 1X7AC 2BDGA 2XNIA 5J4SA 1SC8U 2BY8X 2ZHQH 2XOKD 1K28D 1O2NA 5HYOA 1C2HA 2BDYA 3DCLA 4X6MA 1O5FH 3RLWH 3F2HA 5I46H 2ZFFH 4NG9H 1LQDB 3MU4A 1EASA 4Y0ZE 2L6OA 3FKSD 3MTYA 2AIQA 2KAIA 1O39A 2V3MA 1GBTA 2BD9A 2ZWLH 2R2WU 3F2FA 1YPLH 1HJ8A 2ZU5A 5T3HA 1THRH 3A8CA 2QGRA 1QGFA 3GY4A 1D6RA 2A2XH 3M7TA 3SV7A 1JMOH 3BTEE 2ILNA 4J1YA 1T8NA 2KR7A 4KTUA 3ENSB 5B6OA 1GGDB 1FZZA 1NU7B 1ETSH 1J16A 1MTVA 1FPCH 2J9NA 4MNXA 4GUXA 2VH6A 2LPRA 1K1NA 2RDLA 1H9IE 5A0CA 2FOGA 1RIWC 1L1GA 3HPTB 4DT7B 4FXGH 5C20A 1H8DH 1LPKB 2VVVA 3A7ZA 2B8OH 4X8UH 1WXRA 1F0SA 5GDSH 1P02A 2Z94A 2C93B 2VGCB 1DM4B 1OOKB 3BEFB 2IPQX 4NA8A 4XSKU 4OS5A 1TGNA 1QJ1B 1GBJA 3RXHA 4CRGA 1O3IA 1O3JA 4XBBA 2HVYB 4I8KA 1PPZA 4ISLA 1OXGA 4FVBA 1UW7A 2BD5A 1FY1A 2G5NA 2D26C 4I8LA 5F6MA 1NESE 3NWUA 2ZGBH 3B9FH 1SI5H 3FP8E 1NO9H 1PQ7A 3KNXA 2QXIA 2XCNA 2A45B 1HYLA 5HM9A 3PV2A 3W94A 2OP9A 1DT2A 3EAJA 3TJNA 3SJ8A 1V2TT 5HGGA 2HLDD 1G36A 1A2CH 1BHXF 4X6NA 4D7GA 1ZSJA 2WPHS 5FX5A 3UNQA 3KN2A 1OWJA 1G37A 3RXCA 1TRMA 5KEDA 3CNRA 5ESBA 1ESBA 1L0ZA 4BAMB 1C5QA 1C2EA 3KGPA 4ABAA 1N8OC 1YPKH 1BIOA 1GHAF 3PO1C 2BD8A 4K5ZA 1S85A 2TGPZ 2A5KA 1P03A 4BXWA 1F0TA 2W6JD 1QBOA 2VIPA 3HK6B 1O2RA 1XVOA 5GNDA 5HM2A 1EB1H 4BTUB 2BYAX 2JIZD 2HNTC 5A8XA 5T6FA 2R0LA 3FZZA 5JBCS 5HKKD 1IQIA 2WPKS 1YKTA 5LH8A 3NK8A 5F8TA 1K9OE 1QL7A 1JXPA 3SZNA 1AQ7A 1IQEA 2GX4A 4NZLA 3RMMH 2GVFA 1QRXA 1BMAA 4ZUHA 3AVZA 1O5AB 2GCTB 4NIYA 2ESTE 4RSPA 3A89A 2NU4E 1N6XA 1P9SA 1C5YB 3MWIU 2WINI 4ABIA 2AGGX 1DS2E 6ESTA 1KXFA 3DUXH 1Z8IB 4NSVA 2ZCHP 1ZGIA 3BIVH 2BMGB 3GOVB 3TJUA 1MABB 1SPJA 1O36A 1LVYA 1GI2A 1DWCH 3V13A 1HIAB 4CRCA 5C17A 3QN7A 1BITA 1GL0E 3RXSA 2STBE 3A8DA 3RC5A 1GCDA 2ZU4A 5EJZA 2FDAA 1HGTH 4DW2U 2XBVA 4X8TH 3ZVBA 1K21H 2O8MA 4FUCA 3F0PA 1T7CA 3I77A 2ZKSA 4JK6A 1WOFA 1DSTA 1BRUP 4KGAA 2XBWA 1K1IA 2F9VA 5T6GA 4MG3A 1ZTKA 3OEHD 2GV6A 2QXJA 3SNCA 2BD7A 3M5NA 1VCPA 3STIA 1PPHE 3UAIC 2V6NA 3SU6A 1VJAU 1RGQA 4TPYA 2Y7XA 5C0TA 4I7YH 1NU9A 3U1JB 3SI3H 2SGQE 2TPIZ 1GI5A 1H8IH 1LHFH 3PRDA 1C5XB 1ZMNA 4I8HA 4Q7ZA 4UEHH 5JBTA 3BV9B 2PKAB 3A7YA 3PB1E 2XCFA 1B7XB 1D3TB 2RA3A 1W12U 1S0RA 3ZZCA 3O8RA 3KYGA 1HAVB 1GGDC 3FOAA 4AB8A 1TPSA 2BDAA 2H2ZA 3UTUH 5T1VA 4THNH 4AFZA 4RN6A 2F9OA 5J4QA 1K1OA 1E1QD 3K65B 2FOHA 2D1JA 4AG1A 2PV9B 4CH2B 2F9PA 1GPZA 4XD7D 1LCYA 7KMEH 1W8BH 5EQRA 1V2KT 5LPEA 2ZU3A 3VGCB 1Q3XA 5E0GA 1JIMA 4J2YB 2GMTB 4JZIA 5CE1A 5G4BA 2WUCA 2VGCC 1C5SA 1K1PA 2AIPA 2VINA 3V12A 2KM0A 1EAUA 3DHKH 2GZ8A 2EI7A 2QXHA 1KTSB 1XXDA 1ZHRA 4NA9H 2Q1JA 4HG6A 4WXIA 5GIBA 1S84A 3G01A 2Z3EA 4GCHF 1SQRA 5K7RA 1Z71A 1IHTH 2K1QA 2STAE 3A81A 3ZZ5A 2O8WA 1DXWA 2B0FA 5C3NA 2FI3E 1O38A 1RTKA 1FNIA 3ITIA 4HI3A 1SHHB 1O2QA 3LT3A 3T62A 3UUZA 1Y5UT 1SOTA 3MOCA 2PSXA 1UTJA 2ZHDA 4AFQA 4B74A 4Y7BA 3P6ZB 2FOFA 4DURA 4FU7A 1HCGA 3E3TA 4Z1MD 1KDQA 2OUAA 2QXGA 1W0KD 3BTWE 5GCHG 1KY9A 1O2UA 4INHA 1SHYA 2KAIB 3W1EA 2XC5A 2ODPA 5DN6D 2AERH 1SKYE 3P17H 1EPTB 1H8ED 1ELDE 1EZUC 1NRSH 3KYFA 1RFNA 4MPXA 1QA7A 2ZDLA 1V2PT 2K0QA 3E6PH 1OYQA 4GCHG 1EP5A 1WDIA 2NU2E 4YLUA 1PQAA 1P10A 3Q77A 1S83A 5AVDA 1AWFH 4MQAA 3VXFH 2VU8E 1ZHPA 2ODQA 1EAWA 1J15A 1HNEE 1EQ9A 5JBAS 2A31A 2C3SA 3A8AA 1C5OH 1UVOA 1Z6EA 3MH5A 4IN2A 4DVAU 1O3NA 3RU4E 5EXLA 2QY0B 1SGPE 3NUMA 1BHXB 2FTMA 2XC0A 1W11U 4ZROA 1BTXA 1A46H 1C2MA 3MNCA 3N99A 1AY6H 1NFWA 5DSFA 1F5KU 2AGEX 2QF3A 3PTBA 2GCTC 1Q31A 3RP2A 2NU1E 4WVPE 4FUGA 4ISNA 1QRWA 3K9XB 5LPRA 1ANBA 1O32A 1C5VA 4OGYA 3AASA 3A8BA 5DP4A 1TBZH 1TNKA 5C1YA 4BNRA 1SQTA 2OC8A 1W14U 3GY2A 2UUYA 1MTSA 4X0WU 1PJPA 5TCAA 3KEEA 1GDQA 2G4UA 2XXLA 3OFND 1DY9A 3LGTA 5FAHA 2KCOA 3F9GA 3RMNH 4LXBH 4X1SU 1BB0B 5JB9S 1H9HE 1A3EH 4MPWA 4Z0KA 5C5NA 1C4V2 2IN2A 1ACBE 3O8BA 1P2OA 1ZPZA 3LU9B 1TRNA 2C8WB 1HAHH 3M61U 1T4VH 4ACAA 3Q3KA 3UPEA 1CT0E 2NU3E 1TYNA 3A80A 1O2LA 1D3DB 1V2QT 5C67A 4X2VA 3TJOA 1V2WT 2VIOA 2XWAA 1FPHH 3PMHB 4NIVA 2VWLA 3DSGA 3F6UH 5E0HA 1LHCH 2EQNA 1OP8A 5HMAA 3F9HA 4ABJA 4E06H 1KYNA 1MD7A 3MO3A 1FN8A 1AMHA 1L1JA 1YLCA 2ZQ1A 2SFAA 2EI8A 1KSNA 1HAIH 1O0DH 2A4OA 4GAWA 5E2PA 1DANH 2GGVB 3ZV9A 3M5MA 1D3PB 2P8OB 3HKJB 2J38A 4LZ4B 1P2IA 8KME2 2QCYA 5EQQA 1V2OT 3LGUA 1C2FA 4BAHB 2ZGCA 5E0JA 4WH6A 4BTTB 4U30A 1GJCB 1MCVA 4ABDA 3BG4B 1A3BH 2PLXA 3VGCC 2GMTC 2VB0A 1O3HA 1SLUB 3MH4A 3EA7A 2A5IA 1K1JA 4GLYA 8ESTE 3PMAB 1GBMA 3A7WA 1Z7KA 4BTIB 4TY6A 1TIOA 4I33A 4Q7XA 4AGJA 2PTNA 1OSSA 1QJ7B 1HIAA 1VZQH 1AVXA 1YPEH 5JYIA 3KF2A 1OHHD 1GG6B 2OQUA 1C2GA 2OINA 1UJ1A 1BTHH 4UD9H 1MD8A 1N6YA 3ZZBA 4X6PA 1SGYE 4K69A 2FS8A 5EW1H 3SU5A 3H09A 2F83A 2BXTH 3SNEA 1GBAA 5FPYA 3SJ9A 1GBEA 1GBHA 4TY7A 4KELA 3DT0H 5HIYA 4M9FA 1EJMA 1MQ5A 3LGIA 3P95A 1W7GH 4TT3D 4H6SB 2W6ID 3SU0A 2AMQA 3QLPH 1C5NH 3MNXA 1YBWA 4VGCB 1UK4A 2VWOA 1HAOH 3RC6A 1OP0A 2W26A 4E7NA 2Q6GA 3C1KA 1EOJA 3RDZA 1EOLA 3ZVDA 3SHAH 2G5VA 1EPTC 2QYIA 1C2KA 2XWBI 1QZ8A 1TA2A 1P12E 2UUFB 4Y11E 4X2WA 4OS7A 3RXDA 2BLWA 2PKAA 1MU6B 1XUHA 2F9BH 1XX9A 2H9HA 1F2SE 1OP2A 2ZFPH 2ALPA 1J17T 3TH2H 1E36B 4LOYH 4AC9A 1DXPA 3RXTA 1GBDA 4DOQA 3M7UA 4I32A 4JZEH 1O2OA 2SGFE 2WV5A 2BTCE 3BTHE 1GVLA 1SQAA 3KQDA 2CMYA 5PTPA 4ABEA 3WWBA 2QAAA 1YPGH 3BF6H 4P02A 2CXVA 1MBQA 1O3OA 2AGIX 4MVNA 5C0UA 4BAQB 1SLXB 1GI6A 2AS9A 2ZPSA 4FUDA 2F91A 2BZ6H 4K8BA 4ZXYH 3UY9A 1DE7H 2G55A 3KQEA 1BUIA 1FUJA 3PWBA 4B2BA 3ZZ3A 3PMBB 1QBNA 2PUXB 2QE7D 1K1MA 1H9LB 1T31A 4H42U 2PW8H 4DJZB 1V2NT 2ANKH 1DY8A 4CREA 3RUOA 1JRSA 2FWWA 3T2NA 1HV7A 1QTFA 2BLQA 6LPRA 1MUEB 1TBRH 3SW2B 2PGBB 4K1TA 1FY3A 4GSOA 2PTCE 3SGQE 4MNVA 1ZPCA 1KDQB 3GDVA 3L6PA 4X2YA 3UQVA 3SGAE 4P00A 1D4PB 3U28C 1U6QA 4NZQA 3GCHB 4FU9A 5EODA 4X1NU 1ID5H 1CHGA 1GCTC 1QCPA 1AWHB 1BMLA 1XUKA 1AHTH 1EPTA 3RXOA 2ZFTA 4Y6DA 3LGWA 3ZVAA 1CT2E 3QZQA 2GD4B 2KX4A 2P59A 4YT7H 1O2WA 3GCTF 1Y5AT 1F0UA 4Y7AA 4YXWD 2HVXA 3UQOA 3Q76A 2FMJA 4ISIH 2HPPH 1TNJA 1K1LA 5H4IB 2P8OC 1H4WA 4SGAE 1L2EA 3BTDE 1G3BA 4XBDA 4Y10E 3OEED 2DUCA 4YTAA 1VCWA 3MI4A 1BBRH 2BX3A 4I31A 2F9UA 4ASUD 1UCYK 3U9AH 2R9PA 4CH8B 3SV6A 4K3JA 2GJGA 3A86A 3BG4C 1VKYA 1A5IA 1DPOA 1EX3A 5DK1A 3RU4T 1BZXE 4K1SA 1DUAA 1NY22 3GY7A 1XKBC 2WPJS 3TGKE 1O5EH 1O2GH 3SJKA 1O3CA 1NBMD 2O8TA 4Q4LA 3TIUA 3C27B 1C5PA 4B2AA 2W3IA 3GISB 3IWMA 1GMHF 3GCTG 1GMDF 3MO9A 2PR3A 5L6NH 1GJ8B 1OKXA 2FOAA 1NRQH 2BVSH 1O3KA 3P92A 1GJBB 5F8XA 3VEQB 4ZMAH 4MPVA 3MU1A 2P3UB 3VPKA 4OS1A 1GVZA 2CJIA 1IQFA 3GY8A 3TVJB 1UVTH 3RXBA 2H9TH 1LTOA 3MU8A 3SV9A 1GHVH 4TSFD 1C2DA 7LPRA 3VB3A 5EIYA 2FP7B 3FN8A 1T8LA 4SGBE 2V3HH 1PPBH 2A7JA 3VFEA 3BG8A 1ZYOA 1P57B 4WMFA 3F1SB 1SQOA 2CV3A 1L4DA 1A0LA 2J92A 1RRKA 2Y5HA 2Y81A 1AB9B 2CF8H 3U8OH 4AN7A 4VGCC 2GDEH 2FTLE 1AGJA 4BANB 1AVWA 4XOJA 3WY8A 3NCLA 2J4IA 3BEIB 3SNAA 2GP9B 3OU0A 2OK5A 1QL9A 4CBNA 1C5TA 1TAWA 4M7GA 4YESB 1AVGH 3RXKA 3KCGH 3TPIZ 1WAYB 1GJAB 1GMDG 1SSXA 1TQ0B 4JZFH 2RCEA 4AFSA 3BTKE 4FVDA 1E1RD 4D9QA 2ZC9H 1QNJA 1TMBH 2W7UA 2CGAA 3R0FA 4NFEA 4DCDA 1WSSH 2WPIS 3LJOA 1IHSH 1DX5M 3RLYH 1V3XA 1DLKB 4AYYB 1NFYA 1YPHC 2KCAA 2RDEA 3QGNB 4YOGA 3V7TA 3ATMA 4MTBA 4CRFA 5DP5A 1A0JA 2JDID 1MKXK 3A83A 1P01A 3SU1A 3KQBA 5EW2H 2VBCA 5DJ7A 1GHAG 5IDKA 1SGFG 1P05A 5CHAB 2I6QA 5FCRA 1TPPA 2LP6A 5A0AE 3LONA 1C1UH 2FYQA 2LELA 2A5AA 2Y5GA 1V6DA 4X1PU 2OXSA 2K8IA 2UWPA 5EJ1A 4H6TA 2EEKA 2JH0D 1MCTA 4A5TS 2TGAA 2ZDVH 2BX4A 3TGIE 2ZPQA 2BVXH 4KP0A 3EE0B 5JDUB 1QJ6B 3GY3A 2G52A 1FXYA 3BEUA 1G3DA 4AFUA 1C5ZB 3RXPA 1SGCA 1O3LA 1NRPH 3DFLA 3HGPA 1Z1IA 4UE7H 2B5TB 1G2MA 1QB6A 1KXEA 1Y3XA 1WUNH 3GCHC 2TGDA 1TE0A 1QURH 1BJUA 5AHGH 1SGQE 5C1XA 3VB7A 1ELCA 3HGNA 3SUGA 1HJAB 2SNWA 3SZEA 1QQ4A 5EXNA 1INCA 3KQ5A 1TGBA 1MQ6A 1MZAA 1S6LA 2BDBA 1UHBB 3RXQA 1HXFH 2UUJB 1DWDH 2QV1A 4YLQH 3MNBA 1LVOA 5JBBS 1WQSA 1P09A 1EB2A 4CR5A 7GCHF 1AKSB 3FFGA 5DP3A 4AZ2B 1E37B 1UVUH 1J14A 1WBGB 4F4OC 3EA9A 2BDIA 1IQLA 4LZ1H 4JYUH 1XUGA 1KXBA 1O5BB 2Q6DA 1P2JA 1JBUH 5TJXA 1C5WB 3E0PB 1SGDE 2ANWA 1AN1E 5DP6A 4NIWA 2BB4A 3QGJA 1AFEH 5GJ4B 4FUIA 1TX7A 3RMLH 2WV4A 2ZTXA 4OGXA 3CS0A 2OTVA 3ZZ9A 2C8YB 3URDA 2GZ9A 1ANCA 1SFQB 1QB9A 1LVBA 4XFQA 3STJA 1P0SH 3GCNA 3GYLB 3Q00A 1J9CH 1S0QA 2TIOA 3SQHE 2OD3B 2W3KA 2Z7FE 1UCYH 3VXEH 1DWBH 1QFKH 1V2ST 3IITA 2AMPA 2A2QH 4ISHH 3U69H 1UTLM 4RI0A 3M35A 2P16A 3BSQA 2H6MA 1BMFD 3U8RH 3RXEA 3S7KB 1GHWH 2KCPA 3DD2H 3OAAD 3A85A 1C1MA 3IG6B 3LDXH 3LGVA 3T5FH 1MZDA 4MLFB 4Y8YA 1RTLA 3ZIAD 2BDCA 3LOXA 3GDSA 1GDUA 4Y71A 1CA0B 4D9RA 2EI6A 3O8DA 4XDEA 5FPTA 3M3TA 4IGDA 3TLOA 1LQEA 4FOUC 5EPYA 4TYDA 2Z9GA 1O34A 6CHAB 2Z9IA 2XTTB 1QRZA 2PGQB 3U8TH 1WTGH 1ELTA 1ABIH 1B0EA 1ZRKA 2P3TB 2A32A 1SGTA 4DG4A 1AD8H 1QY6A 1TGSZ 1AE5A 1FY5A 1NS3A 1EATA 4CRAA 1TRYA 4ZAEA 1BMNH 1BTWA 4ZKSU 2BOKA 2ZGJA 4O3UA 2SGAA 3P8FA 3PLPA 1FAXA 3SBKA 5FXLA 1GBFA 2XYAA 4E7RG 1CGIE 1Y3UA 2ANMH 1XVMA 4KTCA 3RXGA 1TLDA 5CHAC 2FI5E 3ZYEA 2HOBA 4Q7YA 1ZMLA 1TONA 3FZDA 2XBYA 1O2PA 1ZJDA 3SU4A 4X8VH 2YMSB 4ABGA 2C90B 3SI4H 2JH6D 2F9NA 3U1IB 3AK5A 4INLA 9LPRA
chains in the Genus database with same CATH topology
3PMJA 1GHXH 4KKDA 5AFYH 1DOJA 2I6SA 2BZAA 2FZZA 1VGCB 2JETB 3F9FA 4ZH8A 1C9PA 1NFXA 4OS6A 1FV9A 1G30B 1C5RA 1ZZZA 4PROA 1GI3A 2QIQA 1MKXH 1ZTLA 1TNLA 4AB9A 2H5DA 4BAKB 1P9UA 1BBRK 1E34B 1HBTH 1W13U 2XRCA 1HUTH 3TU7H 3ZZAA 1BA8B 2FLBH 4B76A 1C1WH 1P2MA 1IQKA 2SGDE 1SLWB 4I8JA 1RJXB 2SGEE 1ZMJA 4IBLH 4OS4A 1IQMA 3MU0A 1KLTA 4D8NA 3VB5A 1GBIA 3SV8A 1O3MA 2G00A 3UR9A 4NA7A 2FXRA 4XBCA 1W0ZU 1UMAH 1HJAC 1GBKA 4GVUA 1L1NA 4GPGA 3SGBE 1HPGA 1UTNA 2GT7A 1W0YH 4WJG2 4DGJA 1MBMA 3KQCA 2ZZUH 1VITH 1SOZA 2HGTH 2PSYA 1FY8E 3E91A 3OTJE 1DVAH 2ZG0H 5FHTA 2J2UA 3D62A 2ALVA 1LVMA 4WWYA 2ZGXH 1AE8H 4UFEH 1FLEE 1SGEE 4B75A 1O30A 4O03A 1GJ4H 1K22H 3F9EA 1XUJA 2HALA 4K60A 3PM3A 3SU3A 1AZ8A 1UVSH 1VJ9U 1NRNH 4Z6AH 4MNWA 1SG8B 3EDXB 3M36A 1ANDA 4JMYA 3SJOA 1AO5A 2V35A 1C5MD 3KL6A 3UREA 2GTBA 2WYJA 3SHCH 4HZHA 1IQGA 1BTPA 2HRVA 3EYDA 2Z6BD 1WYKA 1MH0A 2C8XB 4DIHH 3SORA 4UDWH 3A7XA 1HXEH 4A1XA 1ELFA 1PQ8A 2G81E 1SVPA 1OS8A 1F7ZA 1HRTH 1C4U2 3M5OA 3ZZ7A 3HATH 1CQQA 5DG6A 4NWLA 3ZYDA 3UR6A 2FYRA 2AMDA 1PYTC 2IOTA 2UWOA 1O2YA 4YO9A 1N1LA 1ELBA 4YOJA 1RD3B 2ZPRA 1TB6H 2PKSB 1ZTJA 2D2DA 4NGAH 3T29A 3S0NA 5E2OA 1CA0C 2A4GA 3UNSA 1AFQB 1JOUB 1IQHA 1O2VA 2QC2A 4F49A 3UIRA 2NWNA 2FS9A 2ZEBA 1ZHMA 1IQNA 4NFFA 3ZVEA 4B73A 1H1BA 1HAZB 1NZQH 6CHAC 1Q2WA 1YLDA 1N8OB 1ESTA 1EKBB 1XMNB 1Z6JH 1UHBA 3A82A 1CO7E 3RC4A 2OC7A 3BIUH 3MFJA 1DDJA 3P70B 2A0QB 4WY3A 1GWAA 1OWKA 2BY7X 3T27A 5ABWA 4MDSA 5ESTE 1SLVB 2BD2A 1AKSA 3H5CB 2ZDAH 1QR3E 1GI8B 2EA3A 2GV7A 5A8ZA 2NU0E 2SGPE 4O9VA 2SNVA 5CMXH 1SGNE 1PPFE 1D3QB 4ABFA 2BD4A 1B0FA 4JYVH 4UFGH 3D49H 3PYHA 1SB1H 3UWIA 2ODYB 1CGJE 1JRTA 1T4UH 2O8UA 2PUQH 2YOLA 4IMQA 4AG2A 2FX6A 3BTQE 1G32B 3ATKA 1ARCA 1RXPA 1GI7B 5LPFA 2ZHEH 1CA8B 1KIGH 2ZO3H 3ZZDA 1FONA 1QB1A 4WH8A 5EPNA 5F8ZA 1ZSKA 3NPSA 4U32A 3A7VA 2JETC 3ODFA 3M7QA 3SO3A 2VWNA 1LKBA 5GXPA 2Z3DA 1P8VC 2OC0A 2OLGA 1GHBF 2FX4A 5L2YH 1GJ5H 1F5RA 2TBSA 1LHGH 1FI8A 1GJDB 3ZVFA 2AFQB 3BTME 4ZKOU 3B23B 1O2HA 1Z1JA 3RXFA 2VVUA 4YM9A 3RMOH 2HPQH 3VB4A 1P3EA 1ZSLA 1T8MA 5I25A 3EA8A 3F68H 4WMEA 1QL8A 5C2ZA 2JH5D 1FIWA 2TGTA 2A7CA 3GICB 1C1NA 1NPMA 1QHRB 2BQ7B 5DGJA 1TX6A 1TALA 4Y76A 1ETTH 1EUFA 2P94A 3RXAA 4NCYA 2BLOA 4KTSA 4GHTA 1A5GH 1TMTH 2BQWB 3QX5H 6GCHF 1BBRE 1EP6A 2BHGA 2FESH 2Z3CA 4B71A 7ESTE 1QBVH 1TNGA 1NT1A 2ZI2H 1C4Y2 4K1EA 1O2KA 3SQEE 2VIDA 3S69A 2QF0A 2RG3A 1LHDH 1V2MT 5DP7A 1NM6A 9ESTA 3MHWU 2ZU2A 5DKMA 2ZHWH 1GHBG 1W2KH 5A2MH 2R3YA 3FP6E 1A5HA 1F92A 3PROA 4FUHA 3V0XA 5FBIA 1EXFA 1SGFA 1LHEH 4JCNA 2W7SA 1EAXA 4AOQA 2PWXA 2ZCKP 1O3GA 1DICA 4ZHLU 2P93A 3E90B 1S6HA 1AUJA 2RA0A 1O37A 2VJ1A 1DFPA 1GHYH 4ZXXH 4BXSA 3FAOA 1GG6C 3T25A 1HDTH 6GCHG 3MMGA 1TX8A 3SUFA 1OWDA 1FMGA 1DUEA 3RM2H 5EGMA 4X8SH 2BOHB 1XUFA 1XXFA 1BRCE 1YM0A 2BVRH 5JB8S 1W3CA 1C5UA 2UUKB 3P8NA 1A7SA 1O2ZA 1V2UT 1O5DH 1YPMH 1CBWB 3TH4H 5C5OA 1O3FA 3UOUA 3HKIB 3AW0A 4WXVA 2FOBA 1MKWK 2OBOA 1UO6A 1GBBA 1A0HB 4TWWA 4CRDA 3S9BA 3T28A 1Y8TA 2HWLB 2PKSC 1RS0A 2W5EA 1IQJA 1O31A 3ZZ8A 1C1SA 1NN6A 1P2NA 5A0BA 1HB0B 3ZVGA 3UWJH 1AFQC 1S81A 1GMHG 3TH3H 3TJVA 1EJAA 1FDPA 1NTPA 1V2RT 3OY5U 3SOSA 1DITH 1C1TA 1NRRH 4HFPB 1UTKA 1MTNB 3LJJA 1O2IA 1O3EA 1FQ3A 4MNYA 3ESTA 1GVKB 1WTHD 1S6FA 4Q80A 3RXLA 3FVFB 1P11E 3V3MA 3URCA 1M9UA 1GI0A 1GL1A 4DY7B 1QIXB 4YOIA 1KXAA 1BTUA 1PPCE 3NZIA 3HK3B 2P3FH 4NSYA 1SGRE 3ELAH 2Y6TA 2TRMA 1Z8RA 1E0FD 2ZDKA 2CN0H 1YP9A 2GDDA 4NIXA 2FM2A 3JZ1B 2LNCA 5TCCA 4O97A 1MTWA 2FPZA 3S9CA 1MAXA 2Z9JA 4X2XA 2O8LA 3UFAA 3SUDA 2R0KA 2OQ5A 5F03A 3U98H 2ZTZA 2XBXA 3TK6A 2O9QA 4BAOB 2GT8A 1T8OA 2YNBA 4IC5A 4AGKA 3GYMA 1HAPH 1T32A 3SNBA 5LGOA 1MAYA 3K6YA 1ZGVA 2C4FH 1G2LA 2CF9H 3QDZB 1HLTH 2BDHA 4ASHA 4TPIZ 2OBQA 3GY5A 2ZIQH 5DPAA 3QTVH 4E05H 8GCHF 1XKAC 1V2LT 1PPGE 1C5LH 2A7HA 4WF8A 4IMZA 4XE4A 1SR5C 2VWMA 1GJ6A 2V0BA 3E16B 3AAVA 1OWIA 1V2JT 1QA0A 4FUBA 2ASUB 3MU5A 2XC4A 1UK2A 3MH6A 1BCUH 2THFB 1EZXC 3R3GB 4ZKNU 4D76A 3RXJA 1OWHA 1THPB 1UTQA 3E8LA 4I8GA 1QQUA 4AYVB 1FAKH 4ABBA 1S5SA 5K0HA 3A87A 3OY6U 3SN8A 3A88A 2J34A 2ZFRH 1Z8JB 2XW9A 3EQ0H 4YT6H 1ELAA 2AYWA 3QTOH 1S82A 3E1XB 3BN9A 3MYWA 1BDAA 2BY6X 1G3CA 5A09A 2FI4E 2FOCA 1UTMA 1THSH 2B7DH 2ZF0H 4BOHA 5JPMH 2ANYA 2B9LA 1C1RA 1GI1A 3SUEA 8GCHG 3MNSA 4FUJA 1KLIH 5HXFA 3RXIA 4B1TA 3LH3A 2ZU1A 4ESTE 2Q6FA 1E38B 3RXVA 4DIIH 4UFDH 2VIWA 3W95A 1CVWH 1C9TA 3PWCA 3DFJA 3LKWA 1O3AA 5ETXA 1NC6A 4HTCH 3GY6A 2F3CE 3H7TA 1O3PB 1KXDA 1WV7H 1O35A 4IS5A 3PV4A 3SV2H 3I78A 4A1TA 3SU2A 2A4RA 3VB6A 3MO6A 1ANEA 2VVCA 1AU8A 2A1DB 3K6ZA 1V2VT 5IYTA 3BTGE 3KHVA 3L3TA 3P8GA 1HAXB 1OPHB 1UCYE 2GZ7A 2ZHFH 3RM0H 5GCHF 3ZVCA 4GHQA 1PQ5A 4CHAB 2FOMB 1F0RA 1GI9B 2WYGA 3TGJE 3LH1A 1B5GH 3DA9B 1O5GH 3N7OA 7GCHG 3PTNA 2HNTF 1LDTT 1HJ9A 2OC1A 1EAIA 1O3BA 1CBWC 5FX6A 3H7OA 4NWKA 1Y5BT 2A4QA 3LC5A 3ZZ4A 1AB9C 2BQ6B 1TPOA 3ZV8A 1OX1A 3CP7A 3TK9A 2PHBA 2JKHA 5EU8A 4ZHAA 1L4ZA 1F5LA 2R2MB 1YCPK 3NKKA 2DE9A 3D23A 1WQVH 5FPSA 1HAGE 1BT7A 1O3DA 1MTUA 4FUFA 1KLJH 1O2TA 1VR1H 1JWTA 5L2ZH 3PLKA 2BM2A 1FY4A 1TGTA 1MTNC 1EJNA 4X1RU 2QA9E 1UK3A 2GCHF 4YZUA 3SJIA 1TWXB 3BTFE 4O3TA 1IAUA 4X1QU 2BLVA 4JK5A 1A61H 1MKWH 1EZQA 1D9IA 3SNDA 3AW1A 2C8ZB 1VITF 1WCZA 5DO4H 4K8YA 1IOEA 1XM1A 2CHAB 3TITA 3TNSA 1TMUH 2HNTE 1D6WA 3CENA 1BTZA 2ZQ2A 3RXUA 2AH4X 1G9IE 2FEQH 1A4WH 4JYTA 4MPUA 1AZZA 1SGIB 2WUBA 1O2XA 2BXUH 3QO6A 5SGAE 4RKJB 3S7HB 1ORFA 1XUIA 1PYTD 2QN5T 2R3UA 1GHZA 5EQSA 1RTFB 3ATLA 4A7IB 1HAYB 1BJVA 1CGHA 4IW4E 1YPHE 4TWYA 2GCHG 3ATWA 4IC6A 1MMJN 1LKAA 2BD3A 4Y79A 1GI4A 2HLCA 1DLEA 2ZGHA 3JZ2B 1ZOMA 3M3SA 1C2JA 3PLBA 5FCKA 5BRRE 4Y0YE 3QZRA 1EZSC 1UVPA 2J95A 1YGCH 5DP8A 4IN1A 2P95A 1OYTH 4CRBA 1VITG 1E35B 1UTPA 3OX7U 1P04A 1SFIA 5C1UA 4HGCA 5EXMA 1CT4E 5FBEA 1W10U 4WMDA 3LPRA 1BRBE 1P2QA 1BOQA 2IJOB 3ODDA 5A8YA 1BRAA 1CU1A 1TQ7B 2G4TA 5L30H 1LO6A 1ABJH 1GMCF 1Y3YA 1GBLA 1YC0A 5T6DA 1ELGA 2WPMS 3O8CA 2WPLS 1GCTB 3E0NB 1ZPBA 5DP9A 2ZNKH 3I29A 3L33A 1Y3VA 1BMMH 4CBOA 1C2LA 2ZDMA 1W7XH 4X6OA 3RXMA 4H4FA 1OWEA 1ZJKA 1C1VH 5EOKA 1O5CB 1YPJH 1JIRA 1TA6A 1Y3WA 1SMFE 3QUMP 2Z9KA 1AI8H 3FANA 4R8TB 1C1QA 4UONA 1BQYA 1AUTC 4Q2KA 3EGKH 2ZDNA 1KTTB 1RIWB 2PFEA 1TNIA 1C1PA 1FJSA 1O2MA 1O2JA 1TOCB 1NROH 1O2SA 2FLRH 1TGCA 4QT8C 5AFZH 1MU8B 1SL3A 3OYPA 2UWLA 1GMCG 1NFUA 3UNRA 1AIXH 3GCOA 3ATIA 4A92A 1TOMH 2ULLA 1ZLRA 1P2KA 2Z9LA 4ABHA 1CSOE 4CHAC 1P06A 1Y59T 4OS2A 2DE8A 4JZ1A 1ELEE 3QK1A 4FU8A 3AAUA 1FN6A 1FIZA 1WU1A 3TK5A 2ZFSA 3M5LA 4A6LA 4FUEA 3GDUA 3LGYA 2FOEA 2ZP0H 2EC9H 2Y80A 4U01A 2G8TA 1PFXC 1TFXA 2GKVE 1DSUA 1TABE 1ARBA 3LC3A 3TNTA 2H1UA 2YNAA 1LMWB 1YCPM 3K2UA 1TBQH 1A1RA 2FODA 3Q3XA 1C1OA 1YYY1 3S9AA 3A7TA 3M3VA 2M5TA 3PO1B 4R0IA 3NXPA 4INKA 4B2CA 1CHOF 5EG4A 1SBWA 4ZHMU 2ZFQH 1TPAE 2Y5FA 1O33A 2D8WA 2H9EH 2OCVB 4ISOA 4A1VA 2G51A 1LPGB 1GDNA 4Y8XA 1DWEH 2VNTA 3OSYA 1CE5A 2H5CA 3BTTE 3T26A 1BTYA 2IPHA 2V3OH 2BY9X 1PPEE 1HAVA 1ZR0A 3FP7E 3ZZ6A 4CR9A 1GJ7B 2CHAC 4U2WA 3P8OA 1C2IA 1YCPH 2VH0A 4UFFH 2VIQA 5E8EH 5GWZA 4RKOB 3A84A 3MH7A 5AF9H 2ZCLP 1ETRH 2ZECA 3Q3YA 1J8AA 5BPEA 3B8JA 1K2I1 1Z8GA 1GJ9B 1KXCA 1VCQA 2Y82A 4AORA 1ZRBA 3CS7A 3UOPA 1CHOG 3KIDU 8LPRA 1ESAA 1VGCC 2BY5X 3QWCH 2FIRH 2FO9A 4K2YA 1LPZB 4LK4A 1UTOA 1P3CA 4D7FA 2VIVA 1ELVA 3RU4D 2AEIH 2ZTYA 3M37A 1HFDA 3LIWA 4ZKRU 4Y8ZA 1G3EA 2ZA5A 4JZDH 2J94A 4AX9H 2Y7ZA 1TNHA 3D65E 1YF4A 1GBCA 5GPIB 3RXRA 1X7AC 2BDGA 2XNIA 5J4SA 1SC8U 2BY8X 2ZHQH 1K28D 1O2NA 5HYOA 1C2HA 2BDYA 4X6MA 1O5FH 3RLWH 5I46H 2ZFFH 4NG9H 1LQDB 3MU4A 1EASA 4Y0ZE 3MTYA 2AIQA 2KAIA 1O39A 1GBTA 2BD9A 2ZWLH 2R2WU 1YPLH 1HJ8A 2ZU5A 5T3HA 1THRH 3A8CA 2QGRA 1QGFA 3GY4A 1D6RA 2A2XH 3M7TA 3SV7A 1JMOH 3BTEE 2ILNA 4J1YA 1T8NA 4KTUA 3ENSB 5B6OA 1GGDB 1FZZA 1NU7B 1ETSH 1J16A 1MTVA 1FPCH 2J9NA 4MNXA 4GUXA 2VH6A 2LPRA 1K1NA 2RDLA 1H9IE 5A0CA 2FOGA 1RIWC 1L1GA 3HPTB 4DT7B 4FXGH 5C20A 1H8DH 1LPKB 2VVVA 3A7ZA 2B8OH 4X8UH 1F0SA 5GDSH 1P02A 2Z94A 2C93B 2VGCB 1DM4B 1OOKB 3BEFB 4NA8A 4XSKU 4OS5A 1TGNA 1QJ1B 1GBJA 3RXHA 4CRGA 1O3IA 1O3JA 4XBBA