1ANBA

Anionic trypsin mutant with ser 214 replaced by glu
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVEWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the polar environment of Asp102 in trypsin: consequences of replacing conserved Ser214.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
molecule keywords ANIONIC TRYPSIN
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1anbA02
3NWUA 3T62A 1PPEE 3GCTG 2FX6A 2UUYA 4BANB 3PV4A 1HJ8A 1IQJA 1OSSA 4NA9H 1LKAA 3MU0A 1MAXA 1LVMA 2YOLA 3ODFA 1Y3UA 1UTOA 1UVTH 2AYWA 2W7UA 4JZIA 4MLFB 1SG8B 3GDSA 2GDDA 2OQ5A 2GTBA 1DWEH 2ZQ2A 1C4V2 1ORFA 4NIYA 4KTUA 1T8NA 4NZLA 1O5BB 1GMCG 1OXGA 2R3UA 1S5SA 3EYDA 1NT1A 2RDLA 2Y5GA 4RKOB 4WMEA 3EA7A 1GI1A 4K60A 1ZTJA 4AORA 1DANH 2P8OC 5GCHF 2C3SA 1TX7A 1FAKH 2VIVA 4TPYA 3RXQA 2FLBH 1P04A 3DA9B 3QGJA 5AVDA 3D49H 1BHXF 1O2MA 3SU0A 1Z8IB 1C5MD 4FUHA 1P3EA 4CBNA 1PPFE 5LGOA 2D2DA 4Y71A 3DT0H 4X1SU 3H7OA 1C2KA 1MCVA 3MU1A 3QTVH 4WY3A 4DG4A 3SGAE 4ZHLU 2G00A 2JH5D 2C90B 2CHAB 2HNTC 1MUEB 4A5TS 1QNJA 4IC5A 1C5SA 3S0NA 3O8RA 2H2ZA 4AG1A 2Z3CA 4ABGA 5DPAA 6GCHF 1ELVA 1C2HA 1GCTC 5A8YA 2WPJS 4GHTA 3HK6B 1VITF 1O2YA 1A5GH 2OBOA 3TK9A 1AE5A 1Y3YA 5E2PA 1XVMA 3ATMA 4K3JA 5I25A 1SGPE 3E0PB 2BY7X 4BAQB 1FI8A 1AI8H 3SV6A 2GGVB 3UUZA 2O8WA 2GX4A 4O03A 4GPGA 1C4Y2 1GJ5H 1C2GA 1O5GH 3MWIU 1IQEA 4BAOB 1PQ5A 1THRH 1GBDA 3PTBA 4I31A 5DK1A 4J1YA 3RXSA 1H9HE 3URDA 1YLDA 4E05H 3UNRA 1G3EA 4HZHA 3SU6A 3BV9B 3ZVBA 2AFQB 1ZHPA 2ZZUH 5DP9A 3PYHA 5E2OA 2O9QA 3LGTA 3QWCH 1CHGA 3RXFA 4B2CA 2VH6A 1G2LA 1GHVH 2NU3E 2FZZA 1OWEA 2ZU3A 4YLQH 2RCEA 2Z6BD 2PV9B 1LKBA 5C3NA 1YPKH 1NRRH 1NFUA 2BQWB 3KQCA 4HTCH 4J2YB 3RXCA 2G4TA 3SV7A 1GGDC 2VVCA 2A5AA 1MTUA 2BHGA 4I8GA 3FVFB 4AG2A 1GHAG 1P57B 2C8YB 3QO6A 1EAUA 3NKKA 5ESTE 2ZG0H 3VPKA 1CHOF 2O8UA 3MO6A 2BX3A 1O3HA 1QB1A 3H7TA 3S69A 2IJOB 1HIAB 1DLKB 1RS0A 2O8LA 2ZNKH 1GHAF 1VCWA 1KDQA 4X1PU 2FOHA 2ZC9H 1S85A 1YCPM 3E91A 3RXBA 1IQFA 5SGAE 2B8OH 1KXBA 2PLXA 4FUGA 1TX6A 3QZQA 3V0XA 3MNCA 2ZFTA 4AFQA 3KGPA 2XW9A 1SHYA 1MKWK 3ZVAA 4JK5A 1WU1A 1PFXC 3P92A 1UTMA 2G5NA 2OP9A 4KTSA 1B7XB 1TNGA 3GY5A 1ZJDA 1K2I1 5DP3A 1QQUA 1Y3VA 2ANKH 1WQSA 3E90B 1H4WA 2KAIB 2AGGX 1O2UA 1GHZA 1L4DA 3UWJH 1T8MA 2Y82A 4LZ4B 2QXJA 4YTAA 4DGJA 4CRCA 3DD2H 1C5ZB 5A8ZA 1P11E 3ATKA 1O2NA 3P8OA 1UK4A 3RXPA 1FIWA 4AB9A 4NFEA 4CRDA 2C8XB 1FZZA 1T4VH 3T5FH 1O38A 3WY8A 4I32A 5F8XA 1HUTH 4R0IA 1O2IA 8KME2 2GCHG 4JZDH 3M3TA 1AB9C 1F92A 3JZ2B 2XBVA 1TNKA 3M61U 2XC5A 1XUHA 3MHWU 3BG4B 3R3GB 2ZEBA 5FPSA 1F0SA 1JMOH 1V2RT 1CSOE 3KEEA 3M7QA 3RXVA 1GI3A 5LPRA 2CHAC 1QJ7B 1JIRA 1DICA 2HOBA 1L1JA 1PQAA 4CBOA 1MH0A 4I33A 3PO1B 4K1SA 1A7SA 1ARBA 1O3AA 2FOBA 3QK1A 3BTGE 4FUBA 1Q3XA 2FX4A 1O3PB 2ODYB 2BQ6B 5J4QA 2TGAA 3KIDU 2G52A 1AE8H 1CT0E 3SV2H 3SUEA 1C2MA 3B8JA 1DPOA 3UQOA 1P2JA 1K1MA 3DHKH 3LC3A 3Q76A 4Y8ZA 1SC8U 4ABDA 2ZDVH 4BAHB 3LPRA 2OD3B 1A0LA 3ZV9A 2ZHDA 1HAOH 1NM6A 2G81E 1IAUA 1MKWH 3SV9A 1THPB 3OU0A 3TPIZ 1HFDA 3P17H 3SU1A 1EATA 1F5LA 3GISB 1SQOA 1J9CH 3A8AA 1K1LA 1T7CA 1T8LA 2KAIA 1ID5H 1N6YA 1GBCA 1A0HB 3NPSA 4IBLH 5LPFA 4O9VA 2THFB 2VIWA 1CQQA 2ZTYA 1KXEA 2ODQA 1O2VA 1UCYK 1GJ7B 3TLOA 4B2AA 3PMJA 2HALA 1V2MT 1QL9A 1N8OB 2VVUA 3LGYA 2XXLA 3SN8A 5GIBA 4AN7A 3RMMH 1EZXC 3FFGA 4K8YA 1V2JT 3SNBA 3ZZ3A 3A7YA 1C1SA 1BJVA 1AKSB 3DUXH 1BITA 3LU9B 3PB1E 4ISHH 2OINA 3SNEA 3S9BA 1HNEE 5L6NH 3M7UA 2BZAA 3MMGA 3BTEE 4IC6A 1Z8RA 3I78A 2CXVA 1C1OA 2BX4A 4FUDA 3ZV8A 3A85A 1ESTA 5GPIB 2PR3A 4UDWH 5DG6A 1GHXH 1O5DH 1HIAA 1TPPA 2NWNA 1YPGH 1GJBB 1AMHA 1IQGA 3PWBA 3UNQA 1YPMH 2ZDKA 4XE4A 3T29A 2BOHB 2BD4A 1Y8TA 1BCUH 2P95A 4UEHH 2Y7XA 3ESTA 2GV7A 7ESTE 4FU8A 1FY5A 1TGBA 1RGQA 4LXBH 1GBHA 1Z1JA 7LPRA 1OPHB 2FP7B 2QXIA 3RUOA 2AMDA 1AWHB 3RLYH 3Q3KA 1MZAA 4E7NA 4X2XA 4CREA 2ZGCA 2G5VA 1O30A 2VIPA 1SLVB 2H1UA 3M3VA 1HXFH 4A1TA 2PKAB 2ALPA 2TGTA 3GY4A 2AGIX 2BZ6H 4INLA 4ESTE 1O33A 4AFZA 1SGTA 3UOPA 2ZGHA 2BD2A 2ZU1A 2XTTB 2NU4E 2D8WA 4GAWA 5T6GA 1GJ6A 1BDAA 2ODPA 2WV5A 1FY8E 5F03A 1O0DH 5C1UA 1IQLA 1EQ9A 5J4SA 3V3MA 1G3CA 1ARCA 4CHAB 2BTCE 3RC4A 4O3TA 3EA8A 4E7RG 3UNSA 4ZHAA 1BRAA 3HKJB 3GY8A 1LTOA 1PPBH 1GJ4H 1IQKA 3UR9A 2SGEE 1Y59T 2R0KA 1O35A 5E0GA 1OP2A 2BD9A 1ZGVA 1BMNH 2R3YA 1XKAC 1MTWA 2P59A 3BTTE 3VGCC 3EDXB 4O97A 2TPIZ 5EU8A 1EAWA 1HAGE 1DS2E 1QQ4A 4UD9H 1FDPA 1V2OT 1LHFH 1V2NT 1ABJH 3PLPA 1AZ8A 1GVKB 3E1XB 1ZSJA 5H4IB 2H9EH 3NZIA 4FUCA 1FN8A 2XYAA 3VB6A 1SGNE 3AASA 4YLUA 4I8KA 1L1NA 2QAAA 3D23A 1AVGH 3DFLA 4D7GA 4X8SH 1J8AA 4F49A 4WVPE 3N7OA 3ZZBA 2UWOA 2WPKS 2Q6FA 2ZIQH 1ZSLA 2F9VA 1O2WA 1UHBA 3RC5A 5JBCS 2BY8X 3KQDA 2AMQA 1LHDH 3BIUH 3OY5U 1FY3A 5AFZH 1ELBA 1UCYE 2FTLE 4KKDA 1GI8B 2H5DA 2VWOA 2GV6A 2FI5E 1P12E 5C67A 5HMAA 1E34B 1GGDB 3LOXA 5L2YH 5HYOA 1SSXA 2Z3DA 1CA0B 1ZHMA 2A4OA 1GDQA 2PTNA 2EI7A 3SNAA 1BMMH 1KXCA 3KQEA 4YZUA 5E0HA 5EPYA 1O3CA 5FX6A 1TA6A 1B0FA 3ZZ7A 5EW1H 2A5IA 3PLKA 4ABHA 3GCHC 1GBTA 1ZSKA 1VITH 4X1NU 5LH8A 2Q1JA 1O3EA 3TH2H 1UK3A 5FCRA 1V2UT 1GG6C 1QFKH 1TE0A 1UCYH 1GJ8B 3LONA 1H9LB 1HAVA 1RTFB 1NZQH 1BBRH 1TAWA 4NSVA 4BAMB 1YPHC 1JXPA 3SUDA 1TMUH 1TONA 3CS0A 2ZTZA 5JB8S 5CHAC 1UVOA 4H4FA 3VB4A 2ALVA 1AFQC 2PSXA 3FP8E 4GCHG 1QA7A 3ZZAA 2Y7ZA 1SGRE 3RXEA 1O36A 1Y3WA 5DP8A 3TVJB 3A7ZA 2BMGB 3M5MA 5K0HA 1D3DB 4GCHF 1G2MA 2CV3A 1O2RA 2ZGXH 3OY6U 2AEIH 2GMTC 2QYIA 2A2XH 2P3TB 3RMOH 2Z9GA 3TJOA 3T2NA 2ZU5A 2V3HH 3RXDA 1MBMA 1BBRE 3ZZ4A 7GCHG 1UTQA 3SU3A 1HV7A 1O3OA 4XBCA 1OS8A 1J15A 1O5AB 2HNTF 2PFEA 3MOCA 4ABEA 2FO9A 3CP7A 2BLWA 1TYNA 2J9NA 3QDZB 4X2YA 4AZ2B 1LHGH 2Q6DA 2QY0B 3BTWE 4FU9A 1CA8B 5C1XA 1QJ6B 3GYMA 5C2ZA 1C2JA 5FPTA 1LPKB 1DOJA 3U69H 1D3QB 1EPTC 4CRGA 1HCGA 1ELFA 1PPCE 4X1QU 1TRNA 3E0NB 3UPEA 4WH8A 8ESTE 4GUXA 1SI5H 2BD7A 4Y0YE 2A45B 2AIPA 1O3GA 3A86A 1KSNA 2FIRH 4YOGA 1QTFA 3GY7A 3M7TA 5JYIA 1VITG 1W8BH 3UIRA 1A3BH 1PPGE 1Q31A 3VGCB 1EB1H 2CF8H 5GJ4B 1A2CH 3NCLA 1HJ9A 2FS8A 2ZDLA 4HI3A 4YO9A 5JBTA 4B73A 2XC4A 1ZMJA 1WOFA 3PM3A 1SGFG 4ABJA 3TK5A 1CGJE 2F3CE 2R0LA 2H9TH 4TWYA 5PTPA 1C2LA 4Y0ZE 4DT7B 1SHHB 1ZR0A 3ZVFA 3AAVA 4NIVA 3SUGA 1P2IA 3HPTB 1C5QA 4B2BA 3DFJA 4YOIA 1O2PA 2HGTH 1O37A 2WPMS 4D8NA 1SLUB 1SPJA 1EPTA 3NUMA 1YP9A 1MZDA 1ZPBA 3TGIE 2VWLA 2VWMA 1O3MA 1DWDH 3KHVA 1WTGH 1G36A 3NXPA 4TY6A 2UUKB 1F0UA 1AFEH 1EZQA 2GKVE 2IN2A 4K2YA 3RLWH 2IPHA 4IW4E 4INHA 1HLTH 3TU7H 2I6QA 3F68H 1MMJN 2C8ZB 3F1SB 4Q2KA 2A7CA 4NG9H 1DDJA 4CHAC 1UVSH 2XBYA 3LGUA 4IS5A 1BBRK 1J14A 2OC0A 1CHOG 4ABAA 1AHTH 2OCVB 1S0QA 3FP6E 3PTNA 3SQEE 1BTXA 1C1WH 2BD5A 1X7AC 4YT7H 3CENA 2BDBA 2J38A 1C1UH 1D3PB 1QY6A 2FOEA 1BRUP 2JH0D 1G3DA 4RKJB 2GD4B 1KLTA 1RIWC 4ISLA 2ZHFH 3U98H 4XDEA 1S0RA 1GI4A 2HLCA 1EOJA 2AIQA 3TH3H 1ANDA 1E37B 5A2MH 4ZUHA 3VXFH 3MH7A 1L4ZA 2QCYA 2ZDNA 1Z8JB 3RDZA 2BLQA 3C1KA 1O2SA 1FXYA 2CN0H 3V12A 2AERH 1FV9A 2J4IA 2P3FH 3KNXA 1TBRH 2FDAA 4A1XA 4Z0KA 5HXFA 4Q7ZA 2ZFRH 2ZF0H 2FEQH 9ESTA 4MPVA 4FVBA 4XBBA 4X0WU 2VWNA 2PHBA 3ZZ5A 5HM9A 1MTNB 1AU8A 3SGQE 3BTME 2P8OB 1BTPA 5F8TA 1UMAH 1O2QA 2FOAA 1SVPA 3MU8A 3FANA 1KXFA 1GDUA 3GY6A 3TGJE 1LVYA 4LOYH 3L6PA 4BXWA 4Q7XA 3ZYEA 1F7ZA 4X6MA 1DY8A 2VH0A 2DE9A 2TRMA 2W5EA 2A4QA 3PMAB 5EW2H 2H6MA 1T8OA 3MH5A 3ELAH 1ELGA 1THSH 1C5RA 2G8TA 1ZRKA 3ITIA 1XM1A 1DITH 2BLVA 1BTYA 1ZTKA 2VGCC 4Y7BA 4WXIA 5L30H 4FUEA 4Y10E 3SJ8A 1WYKA 4JMYA 4MNYA 1D4PB 1DX5M 5A0CA 1AD8H 2BVXH 1T32A 4OS2A 4ABIA 3KCGH 4Y11E 1LHCH 3LGIA 3MU5A 2QXHA 5EXLA 1TX8A 1MKXK 1AFQB 2OXSA 1GHYH 3P8NA 1OOKB 2R9PA 1FPCH 4OGXA 2BXTH 1J17T 1AVXA 3SJKA 4NGAH 1C2EA 4AX9H 1CBWB 1G30B 2VJ1A 1HYLA 3GOVB 3SW2B 4ZMAH 1BMAA 4AYYB 3LC5A 4X6PA 2Y5HA 3SJIA 1DE7H 2QGRA 1AUTC 2ZU2A 1ELAA 1NY22 3RXKA 3UREA 4BNRA 1TA2A 1XUFA 3NK8A 1LDTT 1XKBC 3RMNH 3FP7E 1MD7A 1O31A 1AIXH 1LHEH 1E35B 1BT7A 3RXIA 4DOQA 3LGVA 4INKA 1DXPA 1NFWA 3RXHA 1WBGB 1CA0C 2ZFQH 1MD8A 3HGPA 5EQSA 2NU2E 2ZPRA 4NCYA 1VJ9U 4Q80A 3SU2A 6LPRA 1YM0A 1KLJH 4VGCB 1ZPZA 2OUAA 3F9GA 2FYQA 1TALA 3I77A 4X2VA 2WUBA 2Z9KA 4Y76A 2P16A 1CT4E 2BDHA 3A8BA 3ZYDA 1QCPA 1GBFA 7KMEH 3ODDA 2QN5T 5A0AE 1EPTB 1YCPH 3T27A 2ZA5A 3BG4C 4ZROA 4M7GA 3UR6A 1TABE 3QZRA 4UFFH 2QF0A 1NN6A 1C9TA 1RTLA 6ESTA 1C1PA 4A92A 2ZCLP 3ZZDA 1K9OE 2F9OA 2ZDMA 2RA0A 2FOGA 1B0EA 1G37A 2ZKSA 2STAE 4Y6DA 4B76A 1AVWA 1C5VA 1C5NH 3MTYA 2ZTXA 1HPGA 3ZZ6A 5K7RA 3TJVA 1EZUC 1PQ8A 3LKWA 3MH4A 1VCPA 5DGJA 1YPJH 2B9LA 3F9EA 2FWWA 1RJXB 5DP4A 5BRRE 1O3FA 1UTJA 4TPIZ 1YPEH 1A1RA 1ELCA 2ZPQA 1LQDB 2ZHWH 2FODA 3OTJE 5HM2A 1S6FA 2SNVA 1ETTH 1BIOA 1MBQA 1S84A 4HGCA 4K5ZA 1EX3A 4NFFA 4DY7B 1P06A 1ELEE 3A89A 2WPHS 2BDCA 1MTNC 1AZZA 1GI7B 4FUFA 3M35A 2JH6D 5DP6A 1W3CA 4I8HA 3TH4H 1XUJA 1PYTD 1MTVA 1O2OA 1TNHA 2J34A 4K1TA 4X8VH 2F9PA 1Z71A 1XMNB 3I29A 1UK2A 1GJCB 1Z1IA 4Y79A 1FJSA 4AGKA 1O2GH 2AMPA 4CRBA 1O5FH 5EG4A 2BY6X 1A61H 3Q77A 1C1NA 5I46H 5IDKA 3K2UA 1GBBA 3RU4E 3MO9A 3FZDA 1V2VT 4IMZA 4ISNA 4UFEH 3T26A 3A81A 2BDIA 3TIUA 2ZFFH 4ZAEA 4MDSA 1D6WA 1QRWA 2C8WB 2P3UB 4MG3A 1ZHRA 4XFQA 3E16B 5TCAA 2FOMB 1ESBA 1TOMH 3TGKE 1TGTA 3HATH 4IGDA 1TMBH 3LGWA 1ETSH 2AH4X 1K1NA 1DXWA 3BTHE 3UFAA 3SNCA 1XUIA 1N6XA 1H8DH 2ANMH 4Y8XA 3AW1A 2V35A 3SUFA 3AAUA 1P9UA 2ILNA 2W26A 5C1YA 1O2ZA 1SQTA 1L2EA 4U2WA 2A32A 3EGKH 2NU1E 1VZQH 3F9HA 1IQIA 1VCQA 1D6RA 1YPLH 4FUIA 3P70B 5FPYA 2PTCE 3T25A 2BY9X 1WQVH 1TOCB 2FM2A 1BRCE 3K6YA 1ELDE 4D9RA 1C5LH 3SJ9A 1SMFE 1KDQB 2WPIS 4X2WA 3AW0A 1DUAA 5HGGA 1YPHE 4WWYA 2VIDA 4WF8A 3SI4H 4OS1A 3STIA 1RXPA 3U8OH 1AB9B 1DFPA 3RXOA 4Z6AH 5EXNA 4UFGH 2SGDE 3ZVCA 3S9AA 1F5RA 4CRAA 3U8RH 3W94A 2H5CA 2EC9H 5C5NA 1K28D 2ZFPH 3QTOH 1WV7H 2R2MB 1AY6H 1W7XH 4A7IB 2DE8A 1JRSA 3ZZ9A 1CGIE 4E06H 3RXRA 1NRPH 1HAPH 3P95A 3MO3A 1PYTC 5F8ZA 2ZU4A 3TJNA 1EP6A 3S7KB 1HAYB 3B9FH 1NFYA 1SLWB 1RTKA 1ANEA 1ELTA 1HGTH 2O8MA 1EJNA 3H5CB 4WXVA 1TNJA 2ZCHP 1GPZA 1TPSA 2OC1A 5TJXA 1SGEE 3QGNB 1DSTA 2FPZA 3SHAH 1QGFA 2QIQA 2V0BA 2WYJA 1QA0A 3A88A 4MTBA 2BXUH 4ZKNU 1UVUH 1DSUA 4U30A 4X6NA 1V2WT 1A5HA 4RSPA 3O8CA 2CMYA 1K1JA 4D9QA 1V3XA 2C93B 2VU8E 3BN9A 1P03A 4MVNA 1TBQH 3BG8A 5JBAS 1S83A 1HAZB 5ABWA 2D26C 1GBJA 1TGSZ 1MQ6A 2QC2A 1GMCF 3LH1A 4CRFA 1VJAU 1YBWA 2H9HA 4D7FA 1HRTH 1AQ7A 1NRSH 1ZMNA 3UOUA 4AYVB 1E36B 3MYWA 3O8BA 4NWLA 3JZ1B 4NZQA 1QBNA 1SGIB 1MTSA 1QHRB 2BVSH 1BMLA 3EAJA 4JZ1A 3VB5A 2ZI2H 1QRZA 3VEQB 4JZEH 1M9UA 4JCNA 4IN1A 4YESB 5JDUB 1KXDA 3M5LA 1SGFA 1GBLA 3RXTA 4JZFH 5FX5A 2A7HA 3GDVA 1K21H 3BEUA 3RXMA 1OP8A 1S6HA 1SGQE 3TJUA 3S7HB 1BRBE 1SLXB 1U6QA 4TWWA 1L1GA 4B75A 3PROA 2HNTE 1GG6B 2A2QH 2TGPZ 3GCNA 1GCTB 1A46H 1H1BA 4NWKA 1SBWA 2FI4E 1TNIA 6GCHG 2PW8H 1GL1A 1K1PA 2ZPSA 4CR9A 4AFSA 1MU6B 2HPPH 2J92A 4MQAA 3M36A 3CS7A 3M37A 1OX1A 2UWLA 3KF2A 1O5CB 1Z8GA 3K6ZA 1TRYA 1JBUH 3SV8A 3VB3A 4XBDA 2A31A 4YT6H 1EOLA 1O3DA 2A1DB 1EAXA 3LJJA 1MCTA 1V2QT 3SORA 3ATWA 3U1IB 4DJZB 2UUJB 1C2FA 1BUIA 2ZHQH 1FUJA 1BTUA 2OLGA 1CVWH 1A5IA 1KTTB 3E3TA 2Z94A 6CHAC 5FXLA 3U1JB 2XWBI 1A3EH 1QURH 3BEFB 3BTFE 2QV1A 1BTZA 1O3NA 4H42U 2F91A 4AFUA 2VIQA 5GXPA 1HBTH 1BQYA 1N1LA 1IQNA 1H9IE 1C5OH 3P8FA 1CGHA 2ZHEH 4KTCA 3BIVH 1SFIA 1C9PA 1NESE 3RXAA 1W10U 1O2JA 1W11U 1EJAA 1SOZA 4XOJA 3SO3A 1UHBB 2Y81A 1AGJA 1FPHH 4ZKSU 1PQ7A 2PKSB 1DUEA 5A09A 3BTDE 3W95A 1LVOA 1EB2A 3A84A 3A8CA 2R2WU 2P94A 1XUGA 2BD8A 2ZFSA 3UTUH 3VFEA 1GI0A 4OS7A 3L33A 3TNSA 1HAVB 2Y6TA 1QBOA 2Z7FE 3PMHB 3RXJA 1O2TA 3MNSA 4LZ1H 1JRTA 1W0ZU 1UTNA 3OX7U 2BOKA 1BHXB 2FOFA 1P0SH 4ZHMU 4A6LA 1TPOA 1O2XA 1ANCA 3BEIB 1CT2E 3D65E 1C2DA 3BTKE 3QX5H 2UUFB 4K69A 1LMWB 5EODA 2WV4A 1TGNA 4ZH8A 2I6SA 1H8IH 1AO5A 3A7TA 8LPRA 1P3CA 1SGDE 1UVPA 4JYUH 2OC7A 2TIOA 3URCA 4MPWA 1ABIH 1TIOA 1A4WH 1AN1E 1OWKA 2SNWA 1T31A 1F5KU 2Q6GA 2SGQE 5EGMA 2FTMA 1O3IA 3ZZCA 3RM2H 1KTSB 4DURA 5CE1A 3IWMA 5G4BA 2GDEH 8GCHF 1WSSH 5GCHG 2HRVA 2HVXA 1TWXB 1C2IA 3M5NA 2V3OH 2W3KA 5ESBA 1FAXA 4QT8C 2XWAA 3A80A 1K22H 1XX9A 1ZYOA 8GCHG 5E0JA 1C1RA 2GP9B 1L0ZA 3LDXH 1C5XB 1KYNA 4I7YH 1KIGH 2FMJA 2YNBA 3RU4D 3MU4A 4MNVA 2OQUA 1V6DA 3MI4A 3GY3A 2EI8A 3SU5A 1ZTLA 2EI6A 1P09A 2JETC 1V2LT 2GCHF 1LPZB 4NSYA 2TGDA 1NU9A 1DVAH 1EKBB 1ZJKA 2FS9A 2O8TA 4B74A 2EA3A 5EPNA 4CR5A 3PO1C 3QN7A 3EA9A 1O2LA 3S9CA 2CGAA 2XBXA 4FU7A 1WAYB 1O3LA 3RXUA 2ZECA 1GWAA 4UONA 4A1VA 1Y5AT 2HWLB 1CE5A 1QRXA 1F0RA 1EJMA 1GBMA 1VGCC 4YOJA 9LPRA 5T6DA 5F6MA 4MNWA 1V2KT 1Y5BT 1HAHH 2GZ9A 1MKXH 1ACBE 2GMTB 1AWFH 1TB6H 1GBEA 3GCOA 5TCCA 1EP5A 1GJ9B 4IN2A 3IITA 1GL0E 1QL7A 2WUCA 1XUKA 1BOQA 2J94A 5FBEA 1TGCA 2QXGA 3P8GA 2G55A 4FXGH 5DKMA 1FNIA 1TQ7B 2SGAA 5AHGH 4B71A 2AS9A 4CH8B 3ATIA 4ISOA 1MQ5A 3VXEH 3RC6A 1LO6A 1ZLRA 2YNAA 1C1QA 5EOKA 1C1MA 1GMDG 4BTUB 1P2MA 3Q3YA 1EASA 2P93A 2XNIA 1W13U 1WUNH 4ABBA 1GI2A 1GMDF 1FONA 4THNH 1O34A 3UWIA 1CU1A 2BVRH 2LPRA 1EAIA 3G01A 1GCDA 3ATLA 2B0FA 1GBKA 1QL8A 2BDYA 4TY7A 5A8XA 3LJOA 5CMXH 1AKSA 2VGCB 1GBIA 1FLEE 2SGPE 1PPZA 4X8UH 1C5YB 1HJAB 1NC6A 2C4FH 2Z3EA 2OBQA 1F0TA 3AVZA 1YGCH 4ABFA 5FHTA 5L2ZH 5LPEA 3STJA 1TBZH 4X6OA 3SBKA 1Y3XA 2Z9JA 2J95A 1BZXE 2G4UA 2GZ8A 4BXSA 1C1VH 1GBAA 1BB0B 1Z6JH 4U32A 1SGYE 1W2KH 1CO7E 4F4OC 1GDNA 3ENSB 1Y5UT 2BLOA 1SR5C 1P02A 2BDGA 2BB4A 3RMLH 2Y5FA 1O2HA 4NIWA 1KLIH 3ZVGA 1P2QA 1SL3A 4KGAA 2XCFA 1WTHD 1BA8B 1IHTH 4FUJA 4WMDA 2FXRA 1OKXA 3P6ZB 1BJUA 2A4GA 1IOEA 1HB0B 4GSOA 4R8TB 4WH6A 5T3HA 1C5WB 4Q7YA 1ANBA 3GYLB 1GMHF 1NTPA 1TRMA 1FMGA 3IG6B 2UWPA 3RU4T 3SOSA 1KXAA 4ZXYH 2A7JA 1UTLM 2FI3E 3VB7A 4VGCC 2ESTE 3OSYA 2OC8A 4SGBE 4ZKRU 3GY2A 5AFYH 4OS4A 3UY9A 3ZZ8A 1TFXA 3KQBA 3MFJA 4X8TH 2F9BH 1ZZZA 1QB6A 3A83A 4ASHA 2ULLA 1SOTA 1P01A 3UQVA 1RFNA 1NPMA 2JETB 2TBSA 1G3BA 2Z9LA 5A0BA 5C5OA 2XCNA 3F9FA 1PPHE 1XXFA 4NA8A 4BOHA 3GCHB 1RIWB 2ZGBH 3K9XB 4Y7AA 1ESAA 2WPLS 1W0YH 4SGAE 1YC0A 4DIHH 1RRKA 3R0FA 4K1EA 5JPMH 2PSYA 5DJ7A 4AB8A 1ZOMA 1YCPK 4MNXA 3ZVDA 1Q2WA 2GCTB 1NRNH 1LQEA 3A7XA 3LT3A 2FOCA 1O3JA 2XBWA 1NFXA 2A4RA 2PUQH 2FLRH 3QLPH 3PMBB 2PWXA 4JK6A 2GT8A 3RXGA 5GDSH 5FBIA 3A7VA 3HKIB 4HFPB 5E8EH 4MPXA 1O32A 2RA3A 4BTIB 1GI9B 1NO9H 2BD3A 1GVLA 1LPGB 1DM4B 1C4U2 1LCYA 1DLEA 1VR1H 4OS5A 1ZGIA 3LIWA 4UFDH 2BY5X 1P10A 2GT7A 4O3UA 4X1RU 4FVDA 3A8DA 1UJ1A 2ZWLH 1BTHH 1EZSC 1OP0A 1IQMA 2J2UA 2ANYA 1V2PT 1P2NA 1QIXB 1HAXB 2PKAA 1NU7B 5FCKA 4Y8YA 1GI5A 2STBE 1DY9A 2LNCA 1O2KA 3SNDA 1HAIH 1TMTH 2PKSC 1YKTA 3PLBA 4B1TA 2VIOA 5DP5A 2F9UA 2GVFA 3PWCA 4DW2U 3O8DA 2Z9IA 1SQAA 1IHSH 2V6NA 1OYTH 2G51A 2PGBB 4MPUA 2B7DH 1OWHA 2F83A 3MNBA 1MU8B 1TLDA 5DP7A 1GJAB 3BF6H 3EQ0H 2PGQB 2NU0E 1AUJA 1JIMA 1GHBF 3MNXA 2Y80A 1P2OA 5AF9H 1V2TT 2FYRA 5T6FA 3K65B 4OS6A 4YM9A 1DWBH 1IQHA 1F2SE 3V7TA 3RXLA 3U8TH 1JWTA 1VGCB 4NA7A 5IYTA 1TPAE 3SQHE 1CBWC 4GVUA 2ZP0H 3D62A 1J16A 4DVAU 3T28A 1DT2A 1P8VC 2CJIA 3C27B 5EXMA 1P05A 1QJ1B 2ZCKP 3GDUA 3SJOA 1GMHG 2ZQ1A 3HK3B 1YLCA 2GZ7A 5ETXA 1GJDB 4XSKU 4JYTA 1C5PA 5JBBS 1YYY1 1G32B 2XC0A 3Q00A 4I8JA 2CF9H 4BAKB 2VNTA 3SI3H 1DWCH 1Z7KA 1TNLA 1FN6A 4KELA 3GICB 1ZMLA 1YF4A 7GCHF 1C5UA 1QBVH 1JOUB 4GHQA 4U01A 4DCDA 3B23B 3RM0H 1HXEH 1O3KA 1D3TB 1QR3E 4JYVH 1ZRBA 1OYQA 2ZDAH 1QB9A 1W12U 1V2ST 1E0FD 2ZO3H 2XRCA 2BM2A 2QA9E 1OWIA 4OGYA 1KY9A 4NIXA 1ETRH 2B5TB 1OWDA 1UTPA 3L3TA 5B6OA 1EXFA 1E38B 1XVOA 4WJG2 2D1JA 2VVVA 5EQRA 1S81A 1HJAC 3A82A 5DO4H 4ISIH 1C1TA 1UO6A 2RG3A 2SGFE 4ZKOU 2F9NA 3M3SA 2BDAA 1NROH 3TNTA 2JKHA 1T4UH 1GHWH 4H6SB 4AOQA 2ASUB 2WYGA 1D9IA 3EE0B 5CHAB 1BTWA 2FESH 1C5TA 2GCTC 1INCA 2BYAX 1SB1H 1WCZA 2K1QA 1FY1A 1P9SA 1LVBA 2BQ7B 2SFAA 2ZGJA 3TK6A 1FQ3A 2PUXB 1GVZA 3BSQA 3ZVEA 4BTTB 4IMQA 3SU4A 1OWJA 2HPQH 4CH2B 2W7SA 1A0JA 4UE7H 3HGNA 1O39A 1G9IE 2ANWA 4GLYA 3KN2A 3A7WA 1K1IA 1MAYA 1S82A 1W7GH 5GWZA 3FAOA 1XXDA 4KP0A 2IOTA 4DIIH 1UTKA 1NS3A 4I8LA 4H6TA 1Z6EA 1HDTH 1SFQB 3SZNA 3MH6A 1W14U 3SHCH 6CHAB 1NRQH 1SGCA 4RN6A 1RD3B 2WINI 1O3BA 3U9AH 3LH3A 2W3IA 1EUFA 1ZPCA 2VINA 4PROA 1FIZA 3TITA 1O5EH 4WMFA 1K1OA 1PJPA 3BTQE 2M5TA 5FAHA 2QF3A 3KL6A 1P2KA 5JB9S 1GHBG 2A5KA 2VB0A 2DUCA 3E8LA 3QUMP 4K8BA 1GI6A 3FZZA 4ZXXH 1N8OC 3RP2A 3SGBE 1FY4A 3GCTF 1TQ0B 3E6PH 3M5OA 5EQQA 3V13A 4AGJA 3F6UH 1B5GH 2A0QB 3A87A 4LK4A 5BPEA 4D76A 2EEKA 2AGEX 2OTVA 4TYDA 5C20A 3Q3XA 3OYPA
chains in the Genus database with same CATH superfamily
3NWUA 3T62A 1PPEE 3GCTG 2FX6A 2UUYA 4BANB 3PV4A 1HJ8A 1IQJA 1OSSA 4NA9H 1LKAA 3MU0A 1MAXA 1LVMA 2YOLA 3ODFA 1Y3UA 1UTOA 1UVTH 2AYWA 2W7UA 4JZIA 4MLFB 1SG8B 3GDSA 2GDDA 2OQ5A 2RDEA 2GTBA 1DWEH 2ZQ2A 1C4V2 1ORFA 4NIYA 4KTUA 1T8NA 4NZLA 1O5BB 1GMCG 1OXGA 2R3UA 1S5SA 3EYDA 1NT1A 2RDLA 2Y5GA 4RKOB 4WMEA 3EA7A 1GI1A 4K60A 1ZTJA 4AORA 1DANH 2P8OC 5GCHF 2EY4C 2C3SA 1TX7A 1FAKH 2VIVA 4TPYA 3RXQA 2FLBH 1P04A 3DA9B 3QGJA 5AVDA 3D49H 2JDID 1BHXF 1O2MA 3SU0A 1Z8IB 1C5MD 4FUHA 1P3EA 4CBNA 1PPFE 5LGOA 2D2DA 4Y71A 3DT0H 4X1SU 3H7OA 1C2KA 1MCVA 3MU1A 3QTVH 4WY3A 4DG4A 3F0OA 3SGAE 4ZHLU 2G00A 2JH5D 2C90B 2CHAB 2HNTC 1MUEB 4A5TS 1QNJA 4IC5A 1C5SA 3S0NA 3O8RA 2H2ZA 4AG1A 2Z3CA 4ABGA 5DPAA 6GCHF 1ELVA 1C2HA 1GCTC 5A8YA 2WPJS 4GHTA 3HK6B 1VITF 1O2YA 1A5GH 2OBOA 3TK9A 1AE5A 1Y3YA 5E2PA 1XVMA 3ATMA 4K3JA 4Q4LA 5I25A 1SGPE 3E0PB 2BY7X 4BAQB 1FI8A 1AI8H 3SV6A 2GGVB 3UUZA 2O8WA 2GX4A 4O03A 4GPGA 1C4Y2 1GJ5H 1C2GA 1O5GH 3MWIU 1IQEA 4BAOB 1PQ5A 1THRH 1GBDA 3PTBA 4I31A 5DK1A 4J1YA 3RXSA 1H9HE 4I86A 3URDA 1YLDA 4E05H 3UNRA 1G3EA 4HZHA 3SU6A 3BV9B 3ZVBA 2AFQB 1ZHPA 2ZZUH 5DP9A 3PYHA 5E2OA 2O9QA 3LGTA 3QWCH 3GS9A 1CHGA 3RXFA 4B2CA 2VH6A 4RT1A 1G2LA 1GHVH 2NU3E 2FZZA 1OWEA 2ZU3A 4YLQH 2RCEA 2Z6BD 2PV9B 1LKBA 5C3NA 1YPKH 1NRRH 1NFUA 2BQWB 3KQCA 4HTCH 4J2YB 3RXCA 2G4TA 3SV7A 1GGDC 2VVCA 3WW7A 2A5AA 1MTUA 2BHGA 4I8GA 3FVFB 4AG2A 1GHAG 1P57B 2C8YB 3QO6A 1EAUA 3NKKA 5ESTE 2ZG0H 3VPKA 1CHOF 2O8UA 3MO6A 2BX3A 1O3HA 1QB1A 3H7TA 3S69A 2IJOB 1HIAB 1DLKB 1RS0A 2O8LA 2ZNKH 1GHAF 1VCWA 1KDQA 4X1PU 5HIYA 2FOHA 3VG8A 2ZC9H 1COWD 1S85A 4TT3D 1YCPM 3E91A 3RXBA 1IQFA 5SGAE 2B8OH 1KXBA 2PLXA 4FUGA 1TX6A 3QZQA 3V0XA 3MNCA 2ZFTA 4AFQA 3KGPA 2XW9A 1SHYA 1MKWK 3ZVAA 4JK5A 5T1VA 1WU1A 1PFXC 3P92A 1UTMA 2G5NA 2OP9A 4KTSA 1B7XB 1TNGA 3GY5A 1ZJDA 1K2I1 5DP3A 1QQUA 1Y3VA 2ANKH 1WQSA 3E90B 1H4WA 2KAIB 2AGGX 1O2UA 1GHZA 1L4DA 3UWJH 1T8MA 2Y82A 4LZ4B 2QXJA 4YTAA 4DGJA 4CRCA 3DD2H 3NRLA 4AC9A 1C5ZB 3F2GA 5A8ZA 1P11E 3ATKA 1O2NA 3P8OA 1UK4A 3RXPA 1FIWA 4AB9A 4NFEA 4CRDA 2C8XB 3PRDA 1FZZA 1T4VH 2WSSD 3T5FH 1O38A 3WY8A 4I32A 5F8XA 5EJZA 1HUTH 4R0IA 1O2IA 8KME2 1H8ED 2GCHG 4JZDH 3M3TA 1AB9C 1F92A 3JZ2B 2XBVA 1TNKA 3M61U 2XC5A 1XUHA 3MHWU 3BG4B 3R3GB 2ZEBA 5FPSA 1F0SA 1JMOH 1V2RT 1CSOE 3KEEA 3M7QA 3RXVA 1GI3A 5LPRA 2CHAC 1QJ7B 1JIRA 1DICA 2HOBA 1L1JA 1PQAA 4CBOA 1MH0A 4I33A 3PO1B 4K1SA 1A7SA 1ARBA 1O3AA 2FOBA 3QK1A 3BTGE 4FUBA 1Q3XA 2FX4A 1O3PB 2ODYB 2BQ6B 5J4QA 2TGAA 3KIDU 2G52A 1AE8H 1CT0E 3SV2H 3SUEA 1C2MA 3B8JA 1DPOA 4YXWD 3UQOA 1P2JA 1K1MA 3DHKH 3LC3A 3Q76A 4Y8ZA 1SC8U 4ABDA 2ZDVH 4BAHB 3LPRA 2OD3B 1A0LA 3ZV9A 2KFWA 2ZHDA 1HAOH 1NM6A 2G81E 1IAUA 1MKWH 3N7EA 3SV9A 1THPB 5CHBA 3OU0A 3TPIZ 1HFDA 3P17H 3SU1A 1EATA 1F5LA 3GISB 1SQOA 1J9CH 3A8AA 1K1LA 1T7CA 1T8LA 2KAIA 1ID5H 1N6YA 1GBCA 1A0HB 3NPSA 4IBLH 5LPFA 4O9VA 2THFB 2VIWA 1CQQA 2ZTYA 1KXEA 2ODQA 1O2VA 1UCYK 1GJ7B 3TLOA 4B2AA 3PMJA 3F2HA 2HALA 5DN6D 1V2MT 1QL9A 1N8OB 3OEED 2VVUA 3LGYA 2XXLA 3PV5A 3SN8A 5GIBA 4AN7A 3RMMH 1EZXC 3FFGA 4K8YA 1V2JT 1UW7A 3SNBA 3ZZ3A 3A7YA 1C1SA 1BJVA 1AKSB 3DUXH 1BITA 3LU9B 3PB1E 4ISHH 2OINA 2EQNA 3SNEA 3S9BA 1HNEE 5L6NH 3M7UA 2BZAA 3MMGA 3BTEE 4IC6A 1Z8RA 3I78A 2CXVA 1C1OA 2J5UA 2BX4A 4FUDA 3ZV8A 3A85A 1ESTA 3OFND 5GPIB 2PR3A 4UDWH 5DG6A 1GHXH 1O5DH 1HIAA 1TPPA 2NWNA 5C94A 1YPGH 1GJBB 1AMHA 1IQGA 3PWBA 3UNQA 1YPMH 2ZDKA 4XE4A 5DSFA 3T29A 2BOHB 2BD4A 1Y8TA 1BCUH 2P95A 4UEHH 2Y7XA 3ESTA 2GV7A 7ESTE 4FU8A 1FY5A 1TGBA 1RGQA 4LXBH 1GBHA 1Z1JA 7LPRA 2WPDD 1OPHB 2FP7B 2QXIA 3RUOA 2AMDA 1AWHB 3RLYH 3H09A 3Q3KA 1MZAA 4E7NA 4X2XA 4CREA 2ZGCA 3FO8D 2G5VA 1O30A 2VIPA 1SLVB 2H1UA 3M3VA 1HXFH 2KCOA 4A1TA 2PKAB 2ALPA 2TGTA 3GY4A 2AGIX 2BZ6H 4INLA 4ESTE 1O33A 4AFZA 1SGTA 3UOPA 2ZGHA 2BD2A 2ZU1A 2XTTB 2NU4E 2D8WA 4GAWA 5T6GA 1GJ6A 1BDAA 2ODPA 2WV5A 1FY8E 5F03A 1O0DH 5C1UA 1IQLA 1EQ9A 5J4SA 3V3MA 1G3CA 1ARCA 4CHAB 2BTCE 3RC4A 4O3TA 3EA8A 4E7RG 3UNSA 4ZHAA 1BRAA 3HKJB 3GY8A 1LTOA 1PPBH 1GJ4H 1IQKA 3UR9A 2SGEE 1Y59T 2R0KA 1O35A 5E0GA 1OP2A 2BD9A 1ZGVA 1BMNH 2R3YA 1XKAC 1MTWA 2P59A 3BTTE 3VGCC 3EDXB 4O97A 2TPIZ 5EU8A 1EAWA 1HAGE 1DS2E 1QQ4A 4UD9H 1FDPA 1V2OT 1LHFH 1V2NT 1ABJH 3PLPA 1AZ8A 1GVKB 3E1XB 1ZSJA 5H4IB 2H9EH 3NZIA 3N7DA 4FUCA 1FN8A 2XYAA 3VB6A 1SGNE 3AASA 4YLUA 3OE7D 4I8KA 1L1NA 2QAAA 3D23A 1AVGH 3DFLA 4D7GA 4X8SH 1J8AA 4F49A 4WVPE 2AHME 3N7OA 3ZZBA 2UWOA 2WPKS 2Q6FA 2ZIQH 1ZSLA 2F9VA 1O2WA 1UHBA 3RC5A 5JBCS 2BY8X 3KQDA 2AMQA 1LHDH 3BIUH 3OY5U 1FY3A 5AFZH 1ELBA 1UCYE 2FTLE 4KKDA 1GI8B 2H5DA 2VWOA 2GV6A 2FI5E 1P12E 2CK3D 5C67A 5HMAA 1E34B 1GGDB 3LOXA 5L2YH 5HYOA 1SSXA 2Z3DA 1CA0B 1ZHMA 2A4OA 1GDQA 2PTNA 2EI7A 3SNAA 1BMMH 1KXCA 3KQEA 4YZUA 5E0HA 5EPYA 1O3CA 5FX6A 1TA6A 1B0FA 3ZZ7A 5EW1H 2A5IA 3PLKA 4ABHA 3GCHC 1GBTA 1ZSKA 1VITH 4X1NU 5LH8A 2Q1JA 1O3EA 3FKSD 3TH2H 1UK3A 5FCRA 1V2UT 1GG6C 1QFKH 1TE0A 1UCYH 1GJ8B 3LONA 1H9LB 1HAVA 1RTFB 1NZQH 1BBRH 5EIYA 1TAWA 4NSVA 4BAMB 1YPHC 1JXPA 3SUDA 1TMUH 1TONA 3CS0A 1WDIA 2ZTZA 5JB8S 5CHAC 1UVOA 4H4FA 3VB4A 2ALVA 1AFQC 2PSXA 3FP8E 4GCHG 1QA7A 3ZZAA 2Y7ZA 1SGRE 2LP6A 3RXEA 1O36A 1Y3WA 2K0QA 5DP8A 3TVJB 3DSPA 3A7ZA 2BMGB 3M5MA 5K0HA 1D3DB 4GCHF 1G2MA 2CV3A 1O2RA 2ZGXH 3OY6U 2AEIH 2GMTC 2QYIA 2A2XH 2P3TB 3RMOH 2Z9GA 3TJOA 2QF4A 3UAIC 3T2NA 2ZU5A 2V3HH 3RXDA 1MBMA 1BBRE 2QF5A 3ZZ4A 7GCHG 1UTQA 3SU3A 1HV7A 1O3OA 4XBCA 1OS8A 1J15A 1O5AB 2HNTF 2PFEA 3MOCA 4ABEA 2FO9A 3CP7A 2BLWA 1TYNA 2J9NA 3QDZB 5HIZA 4X2YA 4AZ2B 1LHGH 2Q6DA 2QY0B 3BTWE 4FU9A 1CA8B 5C1XA 3DSOA 1QJ6B 3GYMA 5IK2D 5C2ZA 1C2JA 5FPTA 1LPKB 1DOJA 3U69H 1D3QB 1EPTC 4CRGA 1HCGA 1ELFA 1PPCE 2JJ1D 1TRNA 4X1QU 3E0NB 3UPEA 4WH8A 1VKYA 8ESTE 4GUXA 1SI5H 4P00A 2BD7A 4Y0YE 2A45B 2AIPA 1O3GA 3A86A 1KSNA 2FIRH 4YOGA 1QTFA 3GY7A 3M7TA 5JYIA 1VITG 1W8BH 3UIRA 1A3BH 1PPGE 1Q31A 3VGCB 1EB1H 2CF8H 1K0HA 5GJ4B 1A2CH 3NCLA 1HJ9A 2FS8A 2ZDLA 4HI3A 4YO9A 5JBTA 4B73A 2XC4A 5EJ1A 1ZMJA 1WOFA 3PM3A 1SGFG 4ABJA 1E1QD 3TK5A 1CGJE 2F3CE 2R0LA 2H9TH 4TWYA 5PTPA 1C2LA 4Y0ZE 4DT7B 1SHHB 1ZR0A 3ZVFA 3AAVA 4NIVA 3SUGA 1P2IA 3HPTB 1C5QA 4B2BA 3DFJA 4YOIA 1O2PA 2HGTH 1O37A 5KECA 2WPMS 1SKYE 2L6OA 4D8NA 1SLUB 1SPJA 1EPTA 3NUMA 1YP9A 1MZDA 1ZPBA 3TGIE 2VWLA 2VWMA 1O3MA 1DWDH 3KHVA 1WTGH 1G36A 3CNRA 3NXPA 4TY6A 2UUKB 1F0UA 1AFEH 1EZQA 2GKVE 2IN2A 4K2YA 3RLWH 2IPHA 4IW4E 4INHA 1HLTH 3TU7H 2I6QA 3F68H 1MMJN 2C8ZB 3F1SB 4Q2KA 2A7CA 4NG9H 1DDJA 1YY3A 4CHAC 1UVSH 2XBYA 3LGUA 4IS5A 1BBRK 1J14A 2OC0A 1CHOG 4ABAA 1AHTH 2OCVB 1S0QA 3FP6E 3PTNA 3SQEE 1BTXA 1C1WH 2BD5A 1X7AC 4YT7H 3CENA 2BDBA 2J38A 1C1UH 3SZEA 4HG6A 1D3PB 1QY6A 2FOEA 1BRUP 2JH0D 1G3DA 4RKJB 2GD4B 1KLTA 1RIWC 4ISLA 2ZHFH 3U98H 4XDEA 1S0RA 1GI4A 2HLCA 1EOJA 2AIQA 3TH3H 1ANDA 1E37B 5A2MH 4ZUHA 3VXFH 3MH7A 1L4ZA 2QCYA 2ZDNA 1Z8JB 3RDZA 2BLQA 3C1KA 1O2SA 1FXYA 2CN0H 3V12A 2AERH 1FV9A 2J4IA 2P3FH 2WHXA 3KNXA 1TBRH 2FDAA 4A1XA 4Z0KA 5HXFA 4Q7ZA 2ZFRH 2ZF0H 2FEQH 9ESTA 4MPVA 4FVBA 4XBBA 3F3BA 4X0WU 4Z1MD 2VWNA 2PHBA 3ZZ5A 5HM9A 1MTNB 1AU8A 3SGQE 3BTME 2P8OB 1BTPA 5F8TA 1UMAH 1O2QA 2FOAA 1SVPA 3MU8A 3FANA 1KXFA 1GDUA 3GY6A 3TGJE 1LVYA 4LOYH 3L6PA 4BXWA 4Q7XA 3ZYEA 1F7ZA 4X6MA 1DY8A 2VH0A 2DE9A 2TRMA 2W5EA 2A4QA 3PMAB 5EW2H 2H6MA 1T8OA 3MH5A 3ELAH 1ELGA 1THSH 1C5RA 2YMSB 2G8TA 1ZRKA 3ITIA 1XM1A 1DITH 2BLVA 1BTYA 1ZTKA 2VGCC 4Y7BA 4WXIA 5L30H 4FUEA 4Y10E 3SJ8A 2J98B 1WYKA 4JMYA 4MNYA 1D4PB 1DX5M 5A0CA 1AD8H 2BVXH 3FOAA 1T32A 4OS2A 4ABIA 3KYGA 3N99A 3KCGH 4Y11E 1LHCH 5KGOA 3LGIA 3MU5A 2QXHA 5EXLA 1TX8A 3DCLA 1MKXK 1AFQB 1NBME 2OXSA 1GHYH 3P8NA 1OOKB 2R9PA 1FPCH 4OGXA 2BXTH 1J17T 1AVXA 3SJKA 1S6LA 4NGAH 1C2EA 4AX9H 1CBWB 1G30B 2VJ1A 1HYLA 3GOVB 3SW2B 4ZMAH 1BMAA 4AYYB 3LC5A 4X6PA 2Y5HA 3SJIA 1DE7H 2QGRA 1AUTC 2ZU2A 1ELAA 1NY22 3RXKA 3UREA 4BNRA 1TA2A 1XUFA 3NK8A 1LDTT 4XRNA 1XKBC 3RMNH 3FP7E 1MD7A 1O31A 1AIXH 1LHEH 1E35B 1BT7A 3RXIA 4DOQA 3LGVA 4INKA 1DXPA 1NFWA 3RXHA 1WBGB 1CA0C 2ZFQH 1MD8A 3HGPA 5EQSA 2NU2E 2ZPRA 4NCYA 1VJ9U 4Q80A 3SU2A 6LPRA 1YM0A 1KLJH 4VGCB 1ZPZA 2OUAA 3F9GA 4F55A 2FYQA 1TALA 3I77A 4X2VA 2WUBA 2Z9KA 4Y76A 2P16A 1CT4E 2BDHA 3A8BA 3ZYDA 1QCPA 1GBFA 7KMEH 3ODDA 3KQ5A 2QN5T 5A0AE 1EPTB 1YCPH 3T27A 2ZA5A 3BG4C 4ZROA 4M7GA 3UR6A 1TABE 3QZRA 4UFFH 2QF0A 1NN6A 1C9TA 1RTLA 6ESTA 1C1PA 5GNDA 4A92A 2ZCLP 3ZZDA 1K9OE 2F9OA 2ZDMA 2RA0A 2FOGA 1B0EA 1G37A 2ZKSA 1WXRA 2STAE 4Y6DA 4B76A 1AVWA 1C5VA 1C5NH 3MTYA 2ZTXA 1HPGA 3ZZ6A 5K7RA 2VBCA 3TJVA 1EZUC 1PQ8A 3LKWA 3MH4A 1VCPA 5DGJA 2JJ2D 1YPJH 2B9LA 3F9EA 2FWWA 1RJXB 5DP4A 5BRRE 1O3FA 1UTJA 2LELA 4TPIZ 1YPEH 1A1RA 1ELCA 2ZPQA 1LQDB 2ZHWH 3FN8A 2FODA 3OTJE 5HM2A 1S6FA 2SNVA 1ETTH 1BIOA 1MBQA 1S84A 4HGCA 4K5ZA 1EX3A 4NFFA 4DY7B 1P06A 1ELEE 3A89A 3U28C 2WPHS 2BDCA 1MTNC 1AZZA 1GI7B 4FUFA 4RI0A 3M35A 2JH6D 5DP6A 1W3CA 3W1EA 4OM9A 4I8HA 3TH4H 1XUJA 1PYTD 1MTVA 1O2OA 1TNHA 2J34A 4K1TA 4X8VH 2F9PA 1Z71A 1XMNB 3I29A 1UK2A 1GJCB 1Z1IA 4Y79A 1FJSA 4AGKA 1O2GH 2AMPA 4CRBA 1O5FH 5EG4A 2BY6X 1A61H 3Q77A 1C1NA 5HKKD 5I46H 5IDKA 3K2UA 2KM0A 1GBBA 3RU4E 3MO9A 3FZDA 1V2VT 1BMFD 4IMZA 4ISNA 4P02A 4UFEH 3T26A 3A81A 2BDIA 3TIUA 2ZFFH 4ZAEA 4MDSA 1D6WA 1QRWA 2C8WB 2P3UB 4MG3A 1ZHRA 4XFQA 3E16B 5TCAA 2FOMB 1ESBA 1TOMH 3TGKE 1TGTA 3HATH 4IGDA 1TMBH 3LGWA 1ETSH 2AH4X 1W0JD 1K1NA 1DXWA 3BTHE 3UFAA 3SNCA 1XUIA 1N6XA 1H8DH 2ANMH 4Y8XA 3AW1A 2V35A 3SUFA 3AAUA 1P9UA 2ILNA 2W26A 5C1YA 1O2ZA 1SQTA 1L2EA 4U2WA 2A32A 3EGKH 2NU1E 1VZQH 3F9HA 2L74A 1IQIA 1VCQA 1D6RA 1YPLH 4FUIA 3P70B 5FPYA 2PTCE 3T25A 2BY9X 1WQVH 1TOCB 2FM2A 1BRCE 3K6YA 1ELDE 4D9RA 1C5LH 3SJ9A 1SMFE 1KDQB 2W6ID 2WPIS 1W0KD 4X2WA 3AW0A 1DUAA 5HGGA 1YPHE 4WWYA 2VIDA 4WF8A 3SI4H 4OS1A 3STIA 1RXPA 3U8OH 1AB9B 1DFPA 3RXOA 4Z6AH 1FX0B 5EXNA 2V3MA 2SGDE 4UFGH 3S9AA 3ZVCA 1F5RA 4CRAA 3U8RH 3W94A 2PP6A 2H5CA 2EC9H 5C5NA 1K28D 5F53A 2ZFPH 3QTOH 1SQRA 1WV7H 2R2MB 1AY6H 1W7XH 4A7IB 2GJGA 2DE8A 1JRSA 3ZZ9A 1CGIE 4E06H 3RXRA 1NRPH 1HAPH 3P95A 3MO3A 1PYTC 5F8ZA 2ZU4A 2F4LA 3TJNA 1EP6A 3S7KB 1HAYB 3B9FH 1NFYA 1SLWB 1RTKA 1ANEA 3SYJA 1ELTA 1HGTH 2O8MA 1EJNA 5KEDA 3H5CB 4WXVA 4ACAA 1TNJA 2ZCHP 1GPZA 2F43B 1TPSA 2OC1A 5TJXA 1SGEE 3QGNB 1DSTA 2FPZA 3SHAH 1QGFA 2QIQA 2V7QD 2V0BA 2WYJA 3ZIAD 1QA0A 3A88A 4MTBA 2BXUH 4ZKNU 1UVUH 1DSUA 4U30A 4X6NA 1V2WT 1A5HA 4RSPA 3O8CA 2CMYA 1K1JA 4D9QA 1V3XA 2C93B 2VU8E 3BN9A 1P03A 4MVNA 1TBQH 3BG8A 5EJLA 5JBAS 1S83A 1HAZB 4TSFD 5ABWA 2D26C 1GBJA 1TGSZ 1MQ6A 2QC2A 1GMCF 3LH1A 4CRFA 1VJAU 1YBWA 2H9HA 4D7FA 1HRTH 1AQ7A 1NRSH 1ZMNA 3UOUA 3AK5A 4AYVB 1E36B 3MYWA 3O8BA 4NWLA 3JZ1B 4NZQA 2YMSC 1QBNA 1SGIB 1MABB 2IPQX 1MTSA 1QHRB 2BVSH 1BMLA 3EAJA 4JZ1A 3VB5A 2ZI2H 1QRZA 3VEQB 4JZEH 4RT0A 1M9UA 4JCNA 4IN1A 4YESB 5JDUB 1KXDA 3M5LA 1SGFA 1GBLA 3RXTA 4JZFH 5FX5A 2A7HA 3GDVA 1K21H 3BEUA 3RXMA 1OP8A 1S6HA 1SGQE 3TJUA 3S7HB 1BRBE 1SLXB 1U6QA 4TWWA 1L1GA 4B75A 3PROA 2HNTE 1GG6B 2A2QH 2TGPZ 3GCNA 1GCTB 1A46H 1H1BA 4NWKA 1SBWA 2FI4E 1TNIA 6GCHG 4B6EA 2PW8H 1GL1A 1K1PA 2ZPSA 4CR9A 2HLDD 4AFSA 1MU6B 2HPPH 2J92A 4MQAA 2KX4A 3M36A 3CS7A 3M37A 1OX1A 2UWLA 1KMHB 3KF2A 1O5CB 1Z8GA 3K6ZA 1TRYA 1JBUH 3SV8A 3VB3A 4XBDA 2A31A 4YT6H 1EOLA 1O3DA 2A1DB 1EAXA 3LJJA 1MCTA 1V2QT 3SORA 2IJD1 3ATWA 3U1IB 4DJZB 2UUJB 1C2FA 1BUIA 2ZHQH 1FUJA 1BTUA 2OLGA 1CVWH 1A5IA 1KTTB 2J97A 3E3TA 2Z94A 6CHAC 5FXLA 3U1JB 1YWUA 2XWBI 1A3EH 1QURH 3BEFB 3BTFE 2QV1A 1BTZA 1O3NA 4H42U 2F91A 4AFUA 3MQKC 2VIQA 5GXPA 1HBTH 1BQYA 1N1LA 1IQNA 1H9IE 1C5OH 3P8FA 1CGHA 2ZHEH 4KTCA 3BIVH 1SFIA 1C9PA 1NESE 3RXAA 1W10U 2RFKC 1O2JA 1W11U 1EJAA 1SOZA 4XOJA 3SO3A 1UHBB 2Y81A 1AGJA 2WV9A 1FPHH 2J98A 4ZKSU 1PQ7A 2PKSB 1DUEA 5A09A 3BTDE 3W95A 1LVOA 1EB2A 3A84A 3A8CA 2R2WU 2P94A 2KR7A 4DT4A 1XUGA 2BD8A 2KCAA 5FL7D 2ZFSA 3UTUH 3VFEA 1GI0A 4OS7A 4FOUC 3L33A 3TNSA 1HAVB 2Y6TA 1QBOA 2Z7FE 3PMHB 3RXJA 1O2TA 3MNSA 4LZ1H 1JRTA 1W0ZU 1UTNA 3OX7U 2BOKA 1BHXB 2FOFA 1P0SH 4XD7D 4ZHMU 4A6LA 1TPOA 1O2XA 1ANCA 3BEIB 1CT2E 3D65E 1C2DA 3BTKE 3OAAD 3QX5H 2UUFB 4K69A 1LMWB 5EODA 2WV4A 1TGNA 4ZH8A 2I6SA 1H8IH 1AO5A 3A7TA 8LPRA 1P3CA 1SGDE 1UVPA 4JYUH 2OC7A 2TIOA 3URCA 1NBMD 4MPWA 1ABIH 1TIOA 1A4WH 1AN1E 1OWKA 2SNWA 1T31A 1F5KU 2Q6GA 2SGQE 5EGMA 2FTMA 1O3IA 3ZZCA 3RM2H 1KTSB 4ZCNA 4DURA 5CE1A 3IWMA 5G4BA 2GDEH 8GCHF 1WSSH 5GCHG 2HRVA 2HVXA 1TWXB 1C2IA 3M5NA 2V3OH 2W3KA 5ESBA 1FAXA 4QT8C 2XWAA 2QE7D 3A80A 1K22H 1XX9A 1ZYOA 8GCHG 5E0JA 1C1RA 2GP9B 1L0ZA 3LDXH 1C5XB 1KYNA 4I7YH 1KIGH 2FMJA 2YNBA 3RU4D 3MU4A 1H8HD 4MNVA 2OQUA 1V6DA 2YMSD 3MI4A 3GY3A 2EI8A 3SU5A 1ZTLA 1E1RD 1P09A 2EI6A 2JETC 1V2LT 2GCHF 1LPZB 4NSYA 2TGDA 1NU9A 1DVAH 1EKBB 1ZJKA 2FS9A 2O8TA 4B74A 2EA3A 5EPNA 4CR5A 3PO1C 3QN7A 3EA9A 1O2LA 3S9CA 2CGAA 2XBXA 4FU7A 1WAYB 1O3LA 3RXUA 2K8IA 2ZECA 1GWAA 4UONA 3PV2A 4A1VA 1Y5AT 2HWLB 2W6JD 1CE5A 1QRXA 3EE7A 1F0RA 1EJMA 1GBMA 1VGCC 4YOJA 4ACBA 9LPRA 4FETA 5T6DA 5F6MA 4MNWA 1V2KT 1Y5BT 1HAHH 2GZ9A 1MKXH 1ACBE 2GMTB 1AWFH 1TB6H 1GBEA 3GCOA 5TCCA 1EP5A 1GJ9B 2WZQA 5C17A 4IN2A 3IITA 1GL0E 1QL7A 2WUCA 1XUKA 1BOQA 1YLNA 2J94A 5FBEA 1TGCA 2QXGA 3P8GA 2G55A 4FXGH 5DKMA 1FNIA 1TQ7B 2SGAA 5AHGH 4B71A 2AS9A 4CH8B 3ATIA 4ISOA 1MQ5A 3VXEH 3RC6A 1LO6A 2OK5A 1ZLRA 2YNAA 1C1QA 5EOKA 1C1MA 1GMDG 4BTUB 1P2MA 5C0TA 3Q3YA 1EASA 2P93A 2XNIA 1W13U 1WUNH 4ABBA 1GI2A 1E79D 1GMDF 1FONA 4THNH 1O34A 3UWIA 1CU1A 2HVYB 2BVRH 2LPRA 1EAIA 3G01A 1GCDA 3ATLA 2B0FA 1GBKA 1QL8A 2BDYA 3OEHD 4TY7A 4B6FA 3LJOA 5A8XA 5CMXH 1AKSA 2VGCB 1GBIA 1FLEE 2SGPE 5C0UA 1PPZA 4X8UH 1C5YB 1HJAB 1NC6A 2C4FH 2Z3EA 2OBQA 1F0TA 3AVZA 1YGCH 4ABFA 5FHTA 5L2ZH 5LPEA 3STJA 1TBZH 4X6OA 3SBKA 1Y3XA 2Z9JA 2J95A 1BZXE 2G4UA 2GZ8A 4BXSA 1C1VH 1GBAA 1BB0B 1Z6JH 4U32A 1SGYE 1W2KH 3OTPA 5B6LA 1CO7E 4F4OC 2KCYA 1GDNA 3ENSB 1Y5UT 2BLOA 1SR5C 1P02A 2BDGA 2BB4A 3RMLH 2Y5FA 1O2HA 4NIWA 1KLIH 3ZVGA 1P2QA 1SL3A 4KGAA 2XCFA 1WTHD 1BA8B 1IHTH 4FUJA 4WMDA 2FXRA 1OKXA 3P6ZB 1BJUA 2A4GA 1IOEA 1HB0B 4GSOA 4R8TB 4WH6A 5T3HA 1C5WB 4Q7YA 1ANBA 3GYLB 1GMHF 1NTPA 1TRMA 1FMGA 3IG6B 2UWPA 3RU4T 3SOSA 1KXAA 4ZXYH 2A7JA 1UTLM 2FI3E 3VB7A 4VGCC 2ESTE 3OSYA 2OC8A 3WWBA 4SGBE 4ZKRU 3GY2A 5AFYH 4OS4A 3UY9A 3ZZ8A 1TFXA 3KQBA 3MFJA 4X8TH 4ASUD 2F9BH 1ZZZA 1QB6A 3A83A 4ASHA 2ULLA 1SOTA 1P01A 3UQVA 1RFNA 2KZ4A 1NPMA 2JETB 2TBSA 1G3BA 2Z9LA 5A0BA 5C5OA 2XCNA 3F9FA 1PPHE 1XXFA 4NA8A 1QZ8A 4BOHA 3GCHB 1RIWB 2ZGBH 3K9XB 4Y7AA 1ESAA 2WPLS 1W0YH 4SGAE 1YC0A 4DIHH 1RRKA 3R0FA 4K1EA 5JPMH 2PSYA 5DJ7A 4AB8A 1ZOMA 1YCPK 4MNXA 3ZVDA 1Q2WA 2GCTB 1NRNH 1LQEA 3A7XA 2XOKD 2FOCA 3LT3A 1O3JA 2JIZD 2XBWA 1NFXA 3PRBA 2A4RA 2PUQH 2FLRH 3QLPH 3PMBB 2PWXA 4JK6A 2GT8A 3RXGA 5GDSH 5FBIA 3A7VA 3HKIB 4HFPB 4Q63A 5E8EH 4MPXA 1O32A 2RA3A 4BTIB 1GI9B 1NO9H 2BD3A 1GVLA 1LPGB 1DM4B 1C4U2 1LCYA 1DLEA 1VR1H 4OS5A 1ZGIA 3LIWA 4UFDH 2BY5X 1P10A 2GT7A 4O3UA 4X1RU 4FVDA 3A8DA 1UJ1A 2ZWLH 1BTHH 1EZSC 1OP0A 1IQMA 2J2UA 2ANYA 1V2PT 1P2NA 1QIXB 1HAXB 2PKAA 1NU7B 5FCKA 4Y8YA 1GI5A 2STBE 1DY9A 2LNCA 1O2KA 3SNDA 1HAIH 1TMTH 2PKSC 1YKTA 3PLBA 4B1TA 2VIOA 5DP5A 2F9UA 2GVFA 3PWCA 4DW2U 3O8DA 2Z9IA 1SQAA 1IHSH 2V6NA 1OYTH 2G51A 2PGBB 4MPUA 2B7DH 1OWHA 2F83A 3MNBA 1MU8B 1TLDA 5DP7A 1GJAB 3BF6H 3EQ0H 2PGQB 2NU0E 1AUJA 1JIMA 1GHBF 3MNXA 2Y80A 1P2OA 5AF9H 1V2TT 2FYRA 5T6FA 3K65B 4OS6A 4YM9A 1DWBH 1IQHA 1F2SE 3V7TA 3RXLA 3U8TH 1JWTA 1VGCB 4NA7A 5IYTA 1TPAE 3SQHE 1CBWC 4GVUA 2ZP0H 3D62A 1J16A 4DVAU 3T28A 1DT2A 1P8VC 2CJIA 3C27B 5EXMA 1P05A 1QJ1B 2ZCKP 3GDUA 3SJOA 1GMHG 2ZQ1A 3HK3B 1YLCA 2GZ7A 5ETXA 1GJDB 4XSKU 2KCPA 4JYTA 1C5PA 5JBBS 1YYY1 1G32B 2XC0A 3Q00A 4I8JA 2CF9H 4BAKB 2VNTA 3SI3H 1DWCH 1Z7KA 1TNLA 1FN6A 4KELA 2M2AA 3GICB 1ZMLA 1YF4A 7GCHF 1C5UA 1QBVH 1JOUB 4GHQA 4U01A 4DCDA 3B23B 4F48B 3RM0H 1HXEH 1O3KA 1D3TB 1QR3E 4JYVH 1ZRBA 1OYQA 2ZDAH 1QB9A 1W12U 1V2ST 1E0FD 2ZO3H 2XRCA 2BM2A 2QA9E 1OWIA 4OGYA 3DSGA 1KY9A 4NIXA 1ETRH 2B5TB 1OWDA 1UTPA 3L3TA 5B6OA 1EXFA 1E38B 1XVOA 4WJG2 2D1JA 2VVVA 5EQRA 1OHHD 5CDFE 1S81A 1HJAC 3A82A 5DO4H 4ISIH 1C1TA 1UO6A 2RG3A 2SGFE 4ZKOU 2F9NA 3M3SA 2BDAA 1NROH 3TNTA 2JKHA 1T4UH 1GHWH 4H6SB 4AOQA 2ASUB 2WYGA 1D9IA 3EE0B 5CHAB 1BTWA 2FESH 1C5TA 2GCTC 1INCA 2BYAX 1SB1H 1WCZA 2K1QA 1FY1A 1P9SA 2XNDD 1LVBA 2BQ7B 2SFAA 2ZGJA 3TK6A 1FQ3A 2PUXB 1GVZA 3BSQA 3ZVEA 4BTTB 4IMQA 3SU4A 1OWJA 2HPQH 4CH2B 2W7SA 1A0JA 4UE7H 3F2FA 3HGNA 1O39A 1G9IE 2ANWA 4GLYA 3KYFA 3WWFA 3KN2A 3A7WA 1K1IA 1MAYA 1S82A 1W7GH 5GWZA 3FAOA 1XXDA 4KP0A 2IOTA 4M9FA 4DIIH 1UTKA 1NS3A 4I8LA 4H6TA 1Z6EA 1HDTH 1SFQB 3SZNA 3MH6A 1W14U 3SHCH 6CHAB 1NRQH 1SGCA 4RN6A 1RD3B 2WINI 1O3BA 3U9AH 3LH3A 2W3IA 1EFRD 1EUFA 1ZPCA 2VINA 4PROA 1FIZA 3TITA 1O5EH 4WMFA 1K1OA 1PJPA 3BTQE 2M5TA 5FAHA 2QF3A 3KL6A 1P2KA 5JB9S 1GHBG 2A5KA 2VB0A 2DUCA 3E8LA 3QUMP 4K8BA 1GI6A 3FZZA 4ZXXH 1N8OC 3RP2A 3SGBE 3UB0A 1FY4A 3GCTF 1TQ0B 3E6PH 3M5OA 5EQQA 3V13A 4AGJA 3F6UH 1B5GH 3F0PA 2A0QB 3A87A 4LK4A 5BPEA 4D76A 2EEKA 2AGEX 2OTVA 4TYDA 5C20A 3Q3XA 3OYPA
chains in the Genus database with same CATH topology
3NWUA 3T62A 1PPEE 3GCTG 2FX6A 2UUYA 4BANB 3PV4A 1HJ8A 1IQJA 1OSSA 4NA9H 1LKAA 3MU0A 1MAXA 1LVMA 2YOLA 3ODFA 1Y3UA 1UTOA 1UVTH 2AYWA 2W7UA 4JZIA 4MLFB 1SG8B 3GDSA 2GDDA 2OQ5A 2GTBA 1DWEH 2ZQ2A 1C4V2 1ORFA 4NIYA 4KTUA 1T8NA 4NZLA 1O5BB 1GMCG 1OXGA 2R3UA 1S5SA 3EYDA 1NT1A 2RDLA 2Y5GA 4RKOB 4WMEA 3EA7A 1GI1A 4K60A 1ZTJA 4AORA 1DANH 2P8OC 5GCHF 2C3SA 1TX7A 1FAKH 2VIVA 4TPYA 3RXQA 2FLBH 1P04A 3DA9B 3QGJA 5AVDA 3D49H 1BHXF 1O2MA 3SU0A 1Z8IB 1C5MD 4FUHA 1P3EA 4CBNA 1PPFE 5LGOA 2D2DA 4Y71A 3DT0H 4X1SU 3H7OA 1C2KA 1MCVA 3MU1A 3QTVH 4WY3A 4DG4A 3SGAE 4ZHLU 2G00A 2JH5D 2C90B 2CHAB 2HNTC 1MUEB 4A5TS 1QNJA 4IC5A 1C5SA 3S0NA 3O8RA 2H2ZA 4AG1A 2Z3CA 4ABGA 5DPAA 6GCHF 1ELVA 1C2HA 1GCTC 5A8YA 2WPJS 4GHTA 3HK6B 1VITF 1O2YA 1A5GH 2OBOA 3TK9A 1AE5A 1Y3YA 5E2PA 1XVMA 3ATMA 4K3JA 5I25A 1SGPE 3E0PB 2BY7X 4BAQB 1FI8A 1AI8H 3SV6A 2GGVB 3UUZA 2O8WA 2GX4A 4O03A 4GPGA 1C4Y2 1GJ5H 1C2GA 1O5GH 3MWIU 1IQEA 4BAOB 1PQ5A 1THRH 1GBDA 3PTBA 4I31A 5DK1A 4J1YA 3RXSA 1H9HE 3URDA 1YLDA 4E05H 3UNRA 1G3EA 4HZHA 3SU6A 3BV9B 3ZVBA 2AFQB 1ZHPA 2ZZUH 5DP9A 3PYHA 5E2OA 2O9QA 3LGTA 3QWCH 1CHGA 3RXFA 4B2CA 2VH6A 1G2LA 1GHVH 2NU3E 2FZZA 1OWEA 2ZU3A 4YLQH 2RCEA 2Z6BD 2PV9B 1LKBA 5C3NA 1YPKH 1NRRH 1NFUA 2BQWB 3KQCA 4HTCH 4J2YB 3RXCA 2G4TA 3SV7A 1GGDC 2VVCA 2A5AA 1MTUA 2BHGA 4I8GA 3FVFB 4AG2A 1GHAG 1P57B 2C8YB 3QO6A 1EAUA 3NKKA 5ESTE 2ZG0H 3VPKA 1CHOF 2O8UA 3MO6A 2BX3A 1O3HA 1QB1A 3H7TA 3S69A 2IJOB 1HIAB 1DLKB 1RS0A 2O8LA 2ZNKH 1GHAF 1VCWA 1KDQA 4X1PU 2FOHA 2ZC9H 1S85A 1YCPM 3E91A 3RXBA 1IQFA 5SGAE 2B8OH 1KXBA 2PLXA 4FUGA 1TX6A 3QZQA 3V0XA 3MNCA 2ZFTA 4AFQA 3KGPA 2XW9A 1SHYA 1MKWK 3ZVAA 4JK5A 1WU1A 1PFXC 3P92A 1UTMA 2G5NA 2OP9A 4KTSA 1B7XB 1TNGA 3GY5A 1ZJDA 1K2I1 5DP3A 1QQUA 1Y3VA 2ANKH 1WQSA 3E90B 1H4WA 2KAIB 2AGGX 1O2UA 1GHZA 1L4DA 3UWJH 1T8MA 2Y82A 4LZ4B 2QXJA 4YTAA 4DGJA 4CRCA 3DD2H 1C5ZB 5A8ZA 1P11E 3ATKA 1O2NA 3P8OA 1UK4A 3RXPA 1FIWA 4AB9A 4NFEA 4CRDA 2C8XB 1FZZA 1T4VH 3T5FH 1O38A 3WY8A 4I32A 5F8XA 1HUTH 4R0IA 1O2IA 8KME2 2GCHG 4JZDH 3M3TA 1AB9C 1F92A 3JZ2B 2XBVA 1TNKA 3M61U 2XC5A 1XUHA 3MHWU 3BG4B 3R3GB 2ZEBA 5FPSA 1F0SA 1JMOH 1V2RT 1CSOE 3KEEA 3M7QA 3RXVA 1GI3A 5LPRA 2CHAC 1QJ7B 1JIRA 1DICA 2HOBA 1L1JA 1PQAA 4CBOA 1MH0A 4I33A 3PO1B 4K1SA 1A7SA 1ARBA 1O3AA 2FOBA 3QK1A 3BTGE 4FUBA 1Q3XA 2FX4A 1O3PB 2ODYB 2BQ6B 5J4QA 2TGAA 3KIDU 2G52A 1AE8H 1CT0E 3SV2H 3SUEA 1C2MA 3B8JA 1DPOA 3UQOA 1P2JA 1K1MA 3DHKH 3LC3A 3Q76A 4Y8ZA 1SC8U 4ABDA 2ZDVH 4BAHB 3LPRA 2OD3B 1A0LA 3ZV9A 2ZHDA 1HAOH 1NM6A 2G81E 1IAUA 1MKWH 3SV9A 1THPB 3OU0A 3TPIZ 1HFDA 3P17H 3SU1A 1EATA 1F5LA 3GISB 1SQOA 1J9CH 3A8AA 1K1LA 1T7CA 1T8LA 2KAIA 1ID5H 1N6YA 1GBCA 1A0HB 3NPSA 4IBLH 5LPFA 4O9VA 2THFB 2VIWA 1CQQA 2ZTYA 1KXEA 2ODQA 1O2VA 1UCYK 1GJ7B 3TLOA 4B2AA 3PMJA 2HALA 1V2MT 1QL9A 1N8OB 2VVUA 3LGYA 2XXLA 3SN8A 5GIBA 4AN7A 3RMMH 1EZXC 3FFGA 4K8YA 1V2JT 3SNBA 3ZZ3A 3A7YA 1C1SA 1BJVA 1AKSB 3DUXH 1BITA 3LU9B 3PB1E 4ISHH 2OINA 3SNEA 3S9BA 1HNEE 5L6NH 3M7UA 2BZAA 3MMGA 3BTEE 4IC6A 1Z8RA 3I78A 2CXVA 1C1OA 2BX4A 4FUDA 3ZV8A 3A85A 1ESTA 5GPIB 2PR3A 4UDWH 5DG6A 1GHXH 1O5DH 1HIAA 1TPPA 2NWNA 1YPGH 1GJBB 1AMHA 1IQGA 3PWBA 3UNQA 1YPMH 2ZDKA 4XE4A 3T29A 2BOHB 2BD4A 1Y8TA 1BCUH 2P95A 4UEHH 2Y7XA 3ESTA 2GV7A 7ESTE 4FU8A 1FY5A 1TGBA 1RGQA 4LXBH 1GBHA 1Z1JA 7LPRA 1OPHB 2FP7B 2QXIA 3RUOA 2AMDA 1AWHB 3RLYH 3Q3KA 1MZAA 4E7NA 4X2XA 4CREA 2ZGCA 2G5VA 1O30A 2VIPA 1SLVB 2H1UA 3M3VA 1HXFH 4A1TA 2PKAB 2ALPA 2TGTA 3GY4A 2AGIX 2BZ6H 4INLA 4ESTE 1O33A 4AFZA 1SGTA 3UOPA 2ZGHA 2BD2A 2ZU1A 2XTTB 2NU4E 2D8WA 4GAWA 5T6GA 1GJ6A 1BDAA 2ODPA 2WV5A 1FY8E 5F03A 1O0DH 5C1UA 1IQLA 1EQ9A 5J4SA 3V3MA 1G3CA 1ARCA 4CHAB 2BTCE 3RC4A 4O3TA 3EA8A 4E7RG 3UNSA 4ZHAA 1BRAA 3HKJB 3GY8A 1LTOA 1PPBH 1GJ4H 1IQKA 3UR9A 2SGEE 1Y59T 2R0KA 1O35A 5E0GA 1OP2A 2BD9A 1ZGVA 1BMNH 2R3YA 1XKAC 1MTWA 2P59A 3BTTE 3VGCC 3EDXB 4O97A 2TPIZ 5EU8A 1EAWA 1HAGE 1DS2E 1QQ4A 4UD9H 1FDPA 1V2OT 1LHFH 1V2NT 1ABJH 3PLPA 1AZ8A 1GVKB 3E1XB 1ZSJA 5H4IB 2H9EH 3NZIA 4FUCA 1FN8A 2XYAA 3VB6A 1SGNE 3AASA 4YLUA 4I8KA 1L1NA 2QAAA 3D23A 1AVGH 3DFLA 4D7GA 4X8SH 1J8AA 4F49A 4WVPE 3N7OA 3ZZBA 2UWOA 2WPKS 2Q6FA 2ZIQH 1ZSLA 2F9VA 1O2WA 1UHBA 3RC5A 5JBCS 2BY8X 3KQDA 2AMQA 1LHDH 3BIUH 3OY5U 1FY3A 5AFZH 1ELBA 1UCYE 2FTLE 4KKDA 1GI8B 2H5DA 2VWOA 2GV6A 2FI5E 1P12E 5C67A 5HMAA 1E34B 1GGDB 3LOXA 5L2YH 5HYOA 1SSXA 2Z3DA 1CA0B 1ZHMA 2A4OA 1GDQA 2PTNA 2EI7A 3SNAA 1BMMH 1KXCA 3KQEA 4YZUA 5E0HA 5EPYA 1O3CA 5FX6A 1TA6A 1B0FA 3ZZ7A 5EW1H 2A5IA 3PLKA 4ABHA 3GCHC 1GBTA 1ZSKA 1VITH 4X1NU 5LH8A 2Q1JA 1O3EA 3TH2H 1UK3A 5FCRA 1V2UT 1GG6C 1QFKH 1TE0A 1UCYH 1GJ8B 3LONA 1H9LB 1HAVA 1RTFB 1NZQH 1BBRH 1TAWA 4NSVA 4BAMB 1YPHC 1JXPA 3SUDA 1TMUH 1TONA 3CS0A 2ZTZA 5JB8S 5CHAC 1UVOA 4H4FA 3VB4A 2ALVA 1AFQC 2PSXA 3FP8E 4GCHG 1QA7A 3ZZAA 2Y7ZA 1SGRE 3RXEA 1O36A 1Y3WA 5DP8A 3TVJB 3A7ZA 2BMGB 3M5MA 5K0HA 1D3DB 4GCHF 1G2MA 2CV3A 1O2RA 2ZGXH 3OY6U 2AEIH 2GMTC 2QYIA 2A2XH 2P3TB 3RMOH 2Z9GA 3TJOA 3T2NA 2ZU5A 2V3HH 3RXDA 1MBMA 1BBRE 3ZZ4A 7GCHG 1UTQA 3SU3A 1HV7A 1O3OA 4XBCA 1OS8A 1J15A 1O5AB 2HNTF 2PFEA 3MOCA 4ABEA 2FO9A 3CP7A 2BLWA 1TYNA 2J9NA 3QDZB 4X2YA 4AZ2B 1LHGH 2Q6DA 2QY0B 3BTWE 4FU9A 1CA8B 5C1XA 1QJ6B 3GYMA 5C2ZA 1C2JA 5FPTA 1LPKB 1DOJA 3U69H 1D3QB 1EPTC 4CRGA 1HCGA 1ELFA 1PPCE 4X1QU 1TRNA 3E0NB 3UPEA 4WH8A 8ESTE 4GUXA 1SI5H 2BD7A 4Y0YE 2A45B 2AIPA 1O3GA 3A86A 1KSNA 2FIRH 4YOGA 1QTFA 3GY7A 3M7TA 5JYIA 1VITG 1W8BH 3UIRA 1A3BH 1PPGE 1Q31A 3VGCB 1EB1H 2CF8H 5GJ4B 1A2CH 3NCLA 1HJ9A 2FS8A 2ZDLA 4HI3A 4YO9A 5JBTA 4B73A 2XC4A 1ZMJA 1WOFA 3PM3A 1SGFG 4ABJA 3TK5A 1CGJE 2F3CE 2R0LA 2H9TH 4TWYA 5PTPA 1C2LA 4Y0ZE 4DT7B 1SHHB 1ZR0A 3ZVFA 3AAVA 4NIVA 3SUGA 1P2IA 3HPTB 1C5QA 4B2BA 3DFJA 4YOIA 1O2PA 2HGTH 1O37A 2WPMS 4D8NA 1SLUB 1SPJA 1EPTA 3NUMA 1YP9A 1MZDA 1ZPBA 3TGIE 2VWLA 2VWMA 1O3MA 1DWDH 3KHVA 1WTGH 1G36A 3NXPA 4TY6A 2UUKB 1F0UA 1AFEH 1EZQA 2GKVE 2IN2A 4K2YA 3RLWH 2IPHA 4IW4E 4INHA 1HLTH 3TU7H 2I6QA 3F68H 1MMJN 2C8ZB 3F1SB 4Q2KA 2A7CA 4NG9H 1DDJA 4CHAC 1UVSH 2XBYA 3LGUA 4IS5A 1BBRK 1J14A 2OC0A 1CHOG 4ABAA 1AHTH 2OCVB 1S0QA 3FP6E 3PTNA 3SQEE 1BTXA 1C1WH 2BD5A 1X7AC 4YT7H 3CENA 2BDBA 2J38A 1C1UH 1D3PB 1QY6A 2FOEA 1BRUP 2JH0D 1G3DA 4RKJB 2GD4B 1KLTA 1RIWC 4ISLA 2ZHFH 3U98H 4XDEA 1S0RA 1GI4A 2HLCA 1EOJA 2AIQA 3TH3H 1ANDA 1E37B 5A2MH 4ZUHA 3VXFH 3MH7A 1L4ZA 2QCYA 2ZDNA 1Z8JB 3RDZA 2BLQA 3C1KA 1O2SA 1FXYA 2CN0H 3V12A 2AERH 1FV9A 2J4IA 2P3FH 3KNXA 1TBRH 2FDAA 4A1XA 4Z0KA 5HXFA 4Q7ZA 2ZFRH 2ZF0H 2FEQH 9ESTA 4MPVA 4FVBA 4XBBA 4X0WU 2VWNA 2PHBA 3ZZ5A 5HM9A 1MTNB 1AU8A 3SGQE 3BTME 2P8OB 1BTPA 5F8TA 1UMAH 1O2QA 2FOAA 1SVPA 3MU8A 3FANA 1KXFA 1GDUA 3GY6A 3TGJE 1LVYA 4LOYH 3L6PA 4BXWA 4Q7XA 3ZYEA 1F7ZA 4X6MA 1DY8A 2VH0A 2DE9A 2TRMA 2W5EA 2A4QA 3PMAB 5EW2H 2H6MA 1T8OA 3MH5A 3ELAH 1ELGA 1THSH 1C5RA 2G8TA 1ZRKA 3ITIA 1XM1A 1DITH 2BLVA 1BTYA 1ZTKA 2VGCC 4Y7BA 4WXIA 5L30H 4FUEA 4Y10E 3SJ8A 1WYKA 4JMYA 4MNYA 1D4PB 1DX5M 5A0CA 1AD8H 2BVXH 1T32A 4OS2A 4ABIA 3KCGH 4Y11E 1LHCH 3LGIA 3MU5A 2QXHA 5EXLA 1TX8A 1MKXK 1AFQB 2OXSA 1GHYH 3P8NA 1OOKB 2R9PA 1FPCH 4OGXA 2BXTH 1J17T 1AVXA 3SJKA 4NGAH 1C2EA 4AX9H 1CBWB 1G30B 2VJ1A 1HYLA 3GOVB 3SW2B 4ZMAH 1BMAA 4AYYB 3LC5A 4X6PA 2Y5HA 3SJIA 1DE7H 2QGRA 1AUTC 2ZU2A 1ELAA 1NY22 3RXKA 3UREA 4BNRA 1TA2A 1XUFA 3NK8A 1LDTT 1XKBC 3RMNH 3FP7E 1MD7A 1O31A 1AIXH 1LHEH 1E35B 1BT7A 3RXIA 4DOQA 3LGVA 4INKA 1DXPA 1NFWA 3RXHA 1WBGB 1CA0C 2ZFQH 1MD8A 3HGPA 5EQSA 2NU2E 2ZPRA 4NCYA 1VJ9U 4Q80A 3SU2A 6LPRA 1YM0A 1KLJH 4VGCB 1ZPZA 2OUAA 3F9GA 2FYQA 1TALA 3I77A 4X2VA 2WUBA 2Z9KA 4Y76A 2P16A 1CT4E 2BDHA 3A8BA 3ZYDA 1QCPA 1GBFA 7KMEH 3ODDA 2QN5T 5A0AE 1EPTB 1YCPH 3T27A 2ZA5A 3BG4C 4ZROA 4M7GA 3UR6A 1TABE 3QZRA 4UFFH 2QF0A 1NN6A 1C9TA 1RTLA 6ESTA 1C1PA 4A92A 2ZCLP 3ZZDA 1K9OE 2F9OA 2ZDMA 2RA0A 2FOGA 1B0EA 1G37A 2ZKSA 2STAE 4Y6DA 4B76A 1AVWA 1C5VA 1C5NH 3MTYA 2ZTXA 1HPGA 3ZZ6A 5K7RA 3TJVA 1EZUC 1PQ8A 3LKWA 3MH4A 1VCPA 5DGJA 1YPJH 2B9LA 3F9EA 2FWWA 1RJXB 5DP4A 5BRRE 1O3FA 1UTJA 4TPIZ 1YPEH 1A1RA