1ANKA

The closed conformation of a highly flexible protein: the structure of e. coli adenylate kinase with bound amp and amppnp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The closed conformation of a highly flexible protein: the structure of E. coli adenylate kinase with bound AMP and AMPPNP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(phosphotransferase)
molecule keywords ADENYLATE KINASE
total genus 64
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1994-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ankA00
4HB4A 2ZS7A 4EQ6A 1ZM3A 3AVOA 1XPOA 5JHHB 1G3QA 4RD0A 2YJTD 2CJWB 2HUPA 5CM8B 1ZU4A 1M1YE 3RS5A 3EG5A 2C9CA 2JGNA 5FTNA 2NO7A 3WMGA 4BFTA 2P6UA 1YZNA 3MWJA 1GP2A 2WHXA 4URYR 3B1ZA 2JIZA 4LJ6A 5DE3A 3G0HA 4TL8A 4LHWA 1TU3A 5KO2A 4LJ8A 1E94E 5FTJA 5EE3A 4B3CA 3U3JA 2QSZA 5LDDC 5EE5B 3AVVA 4BZXA 2ZU0C 2XX3A 5TDHA 2AWNA 3AVPA 2J0SA 1IN6A 1C1YA 2BCGY 1HT2E 1S9HA 5CIQA 2W2TA 1DAHA 2IS6A 2B8WA 1XU4A 2C95A 2QM8A 4A2QA 3TSOA 4P4SB 1U99A 1S4QA 2ONKA 2ZR9A 4PZYA 4FI3C 2XJ4A 5CJ2A 1EFUA 4ZI3A 5AUOB 3ZQ6A 1E0KA 3M6AA 1L4UA 1XEWX 4M9ZA 4KITB 1KAOA 4TLEA 2F1IA 1T8TA 2W2VA 4WZBE 1YZUA 3FMFA 3AVUA 4NL4H 3GEIA 1U8AA 4DLYA 1N5JA 2ZSBA 4RFSA 4YMVA 4DSOA 4GL2A 3W3ZB 5DNYB 1QHYA 5JS8A 1DAKA 2KWIA 4IVRA 5FBVB 1RE0A 2WIBA 1ZYUA 2XXAA 4EJSA 2IYUA 3EIEA 2QMOA 3MWLA 4XOIA 6Q21A 3VR5A 5JEDA 3PENA 4CVNA 3HU1A 4DDVA 1IONA 4DRZA 1W2HA 2YC4C 3UG6A 4PSAA 5CYOA 1TF2A 2F3TA 2OE2A 2C99A 3LNCA 2ZE5A 4IDPA 4PANA 4EPVA 2GK7A 3RSOA 4XWOA 1GZSA 4LCBA 2NMVA 2AX4A 4LPKA 3LH5A 4R98A 3FE2A 3U44A 4YMUA 3AVXA 3SBDA 1MABA 2ZETA 1LS1A 1GNRA 3CX6A 4WXRA 4ILEA 4D26A 4F4CA 1KKMA 1YE8A 1G64A 1XTJA 2DCUA 1U0JA 3N2EA 3MD0A 5JJKA 5IK2A 1VDZA 2ZU6A 3BGWA 4OQMA 2YYZA 4D4MA 1P9NA 1PUIA 1TF5A 4GFDA 4LJ5A 4TMWA 5HE8A 4CW7A 4QBIA 5FUVA 3CNLA 3QKSA 4N0EA 2FEOA 1ESMA 4B3DA 2W83A 2I1QA 1MO6A 4G5RA 3WRYC 1YU9A 2XGJA 3A1UA 4DXAA 4X8OA 5JECA 3CRVA 2ODBA 5CB6A 4M1KA 4D0NA 1EGAA 3EZ2A 3KB2A 4ESVA 4HDQB 1Z6AA 2FSHA 1G18A 3B6EA 4PPQA 5EE0A 3AGQA 3GP8A 1G7SA 3KL4A 4TLAA 2CE7A 2ZRPA 2RAPA 3CWQA 3T1OA 3TK1A 3W90A 3W5JA 4CDGA 5F3WB 3A4MA 3W6OA 3LVRE 4FMDF 1HE8B 1SXJA 1AKEA 2IC5A 4B6EA 1U9IC 1W44A 5J4VA 5BWMA 1OFTA 2JLQA 3ADDA 3KKPA 2GXSA 2XB2A 2YC2C 1VTKA 3H84A 3I8SA 2IYQA 4LC0A 5FPTA 1XCGB 2ONJA 3FKSD 1TQ4A 1XTRA 2ZYWX 3LFUA 5FTKA 2QI9C 3VR4A 4AYTA 4DLTA 1DO2A 3CBQA 1L7VC 2JA1A 1X8LA 1E2NA 2CNWA 2MMCA 1YHNA 1SHZA 1Z6TA 5EE9A 4BPBA 3KZ1E 3P20A 1XZPA 1KY2A 1W46A 2QP9X 2R8RA 4V0OA 4ZKDA 4MDFA 2DWPA 4MRRA 3TGPA 5DHAA 2KB0A 3P27A 2WWWA 2ZEJA 4RVCA 4D2IA 2CVFA 3GQBA 1SVSA 2WSMA 2NPFA 3SJAA 2OHFA 2Q9AA 4EPYA 1GRNA 4Q21A 3PUXA 1W0KA 1W48A 1S9DA 2V55B 5HR5A 3M4YA 4I4LA 3A4LA 1KZGB 3FDIA 4YLGA 2Q9CA 5JJLA 4X8MA 1MABB 3IEUA 3HR8A 5JBQA 1QZXA 2GAOA 2AWOA 3W9YA 5DI3B 5H1YA 4UJ5A 3I3SR 1NKSA 4C0SA 4RD6A 1IHUA 1P2TA 1M7HA 1KSHA 4JVSB 3VMFA 4MKGA 4D80A 3M1IA 2LWIA 3K0FA 4LHZA 2VLIA 4BEJA 2ATVA 1Z29A 3QKSB 3IKJA 5G40A 2Y8EA 2WSSA 3NTUA 3SDZA 3KQLA 3CZQA 3EA5A 5HCIA 2F55A 1OW3B 1G16A 2QAGA 5TXGA 4LZZA 1R8QA 1SVMA 2C77A 1Q57A 3PEVA 1OIXA 5D3QA 3SU8A 3ZD6A 2N46A 1II8B 4J0QA 1XRJA 1KOFA 4KYUA 5JHGB 3IIJA 1XP8A 1R5OA 3GLFB 4NDZA 2J9RA 1OJLA 1HTWA 4MRSA 5JJIA 1OXVA 2PMKA 2WOOA 3MAAC 1S2MA 2NO1A 2BEJA 1SXJB 5DLQC 3UATA 3P1JA 4NONA 1CXZA 3LWNA 2F7SA 2D4HA 1P9RA 1JBKA 3R7WB 1KNXA 4LYHA 1A82A 2QBYA 1EFRD 2CLCX 1ETUA 3HWSA 3MRSA 4LDJA 4Q66C 2J41A 5D3MA 4KSBA 5FI1B 1KO8A 4GRAA 3C4JA 4OK5A 3R8CA 2C78A 4JLKA 4WIAA 4DCSA 5C2JB 2IBMA 3GLIA 3AKCA 4B3XA 1RIFA 3CKLA 4PZLA 1BMFA 4A0HA 4LJ7A 1XMSA 2ORVA 1OLOA 1PUJA 2BDTA 1G5PA 1V5WA 3BWDD 3W34A 2DPXA 1NJGA 3VKHA 5FTMA 3HU3A 1UKVY 1S1MA 4RD1A 4ZI2A 4CEIB 3CF0A 2P5TB 3LA6A 1ZCBA 4KBFA 3K0AA 3VR1A 1KMQA 2GZAA 4GMDA 3CPEA 2H57A 4OI0A 1T8UA 4TYQA 5JCPA 2HCBA 1KMHB 4NU0A 3B1WA 4ITRC 3V4RA 1MRNA 1ODFA 1FX0A 1G3MA 3L0OA 2DWOA 5K8UA 4A6PA 4DCVA 3O8DA 3P26A 2ZR0A 4TMXA 1ONBA 2O5VA 3K9NA 4JLAA 3QJYA 5JEEA 4IXNA 1YQTA 1OKKA 1FFHA 5JSZA 2PBRA 3QOFA 1UF9A 3HPQA 4URUR 4Q9KA 1W36C 4FXPA 1IM2A 1Q20A 2A9KA 2EQBA 4TLDA 3K0FB 2GWHA 2NOAA 5J40A 4EPXA 2BIFA 2JJ8A 2BMEA 3T5GA 1Z2CA 3SYKA 4KFTA 3JZMA 3WY9A 4LC1A 3A1WA 2V1UA 2PL3A 4L9WA 1UPTA 4XWKA 2OSBA 1JPJA 2VSOA 2FNAA 2BMDA 2GCNA 2RGNC 2WSSD 4NZYA 4RZ3A 3BOSA 3A1TA 1UBCA 1SGWA 3L8YA 1R0YA 4CZ2A 3MJHA 5P21A 2ZE6A 2O8BA 4YDHB 2J7KA 1OB2A 4HZUB 2GEVA 2G77B 1CU1A 4JIMA 2VRWA 2IWRA 2HYDA 1AA9A 3BD9A 3PITA 2O8FB 1E4VA 4FIDA 1F2TB 4OHYA 3GLFA 1D2MA 1ZCAA 2BMFA 3DVLA 1P6XA 1XJ0A 3TAHA 1E1RD 1VG0B 1N5IA 2WKPA 1U90A 2WTUA 1NMYA 3CLVA 3LW7A 2VA8A 4N1AA 4LJ9A 1KDTA 4TMTA 1VECA 3Q72A 4RFVA 3RRYA 3THXA 2EFEB 1TF7A 2QBYB 1L2TA 8OHMA 2HLDD 5D3MB 3BE4A 4GT1A 2OILA 2QE7A 5DYGA 3PVSA 4PTLA 1WQ1R 4UXJA 1BH2A 3UKDA 3LX8A 2GAAA 5LB4A 4CYMA 5FH9A 1MO4A 2H5EA 2J0UB 2R6CA 3CH5A 1T9HA 1XTIA 4KCGA 2V6IA 1G5TA 4Z1MD 4BLSA 2J7PD 4MUBA 4MYUA 4B44A 2ODWA 1Z5ZA 2CNWD 4EKDA 3RC8A 3Q85A 1N0VC 4NH0A 4XH9B 3L82B 1GOTA 1ZNWA 4Q47A 5AJWA 3CUEF 5EUMA 4V0ME 1OH6A 1VG9B 3FKSA 1OYWA 5FOXA 2A3RA 3SC3A 3UG7A 5FBRB 4C0BA 3R9XA 1NLYA 2RKOA 2YWHA 2OT3B 2QY9A 3C5CA 1HV8A 4O2LA 3RANA 4IOJA 5HTKA 2IW3A 5JI2E 1E2IA 1CR4A 1YR8A 3EARA 4OQLA 3AF4A 2UVQA 1II0A 3RHFA 1ELOA 4Q1DA 1DS6A 2W0MA 621PA 4UNSA 1OIVA 2IF0A 4RJLA 5HKKD 1W5SA 2VP4A 4JL5A 1SXJC 4G5QA 4BECA 5JSZB 3C5HA 1Q3HA 4RKFA 4ASUA 1NSFA 2GILA 2VIIA 2PZEA 2RCNA 2GNOA 3O8BA 1ZC4A 2FG5A 3GLGE 4AKGA 1AQYA 2R9VA 5CITA 4CEJA 3GJ7A 2IK8A 2ZS9A 3QEJA 3FTQA 2CMKA 3QXJA 1E2KA 1U0LA 2G1KA 1N5KA 1NBMD 5JI3E 4KYIB 3OAAD 2ZRBA 2Z4SA 2OXRA 2GJ9A 2PJRA 121PA 2QGZA 3Q3JB 2BV3A 5GVRA 1NJFA 2LKCA 1S3SA 4V02A 2ZJAA 2BMJA 3LBIA 4M1SA 3QPWA 2J3EA 5IK2D 2E87A 3I72A 2CE2X 4OJQA 3QEOA 4DKXA 1WP9A 2O8FA 4EAQA 1ZM2A 1IJFA 4DSUA 2QEQA 1F2TA 3QIAA 1JAHA 2GF0A 2XZPA 3SYNA 5SZHB 2W58A 3KX2A 4LI0A 2A78A 1UBEA 4LYFA 3WMFA 1TMKA 1LV7A 2JAQA 2XTMA 1KGDA 3PFIA 1GL6A 1VYVA 1N6IA 4XSGA 3TH5A 4AY2A 1KSFX 3C14C 1KDOA 2JJ2A 5BQ5A 3I32A 4G01B 4MITA 2QAGC 1XEXB 2GBLC 1GUAA 3ND9A 4IXMA 4P4SA 4JLOA 1KSJA 2CLDX 3VFDA 1P73A 1XFAA 3MGCA 2VYFA 1PZNA 1EWRA 1W36B 1E2FA 4DJTA 3T06B 2GXQA 1AKYA 1XD8A 3NEJA 3TAUA 1CF4A 4X8HA 4F4JA 3ZDQA 1E9FA 3CX7A 3W8RA 5L3QB 3SBEA 5TV2A 2WJYA 1ZD8A 3AF0A 4JZKA 4QGGA 4RSGA 1Z83A 2OFWA 4KFUA 4OI2A 3ZJYA 3PUZA 5E95A 3FFBA 4W9MC 2HV8A 4D4LA 1Y3AA 1G3UA 4RFSB 2JDID 1B0UA 2MSCB 5EQTA 5GADl 4DSTA 5B57C 1COWD 3RS2A 5CDFA 1E9RA 1WBDA 1A5TA 2XJ9A 4TMZA 4HLDA 2FZ4A 2JATA 3K0CA 1NI3A 1NN1A 4DLXA 1FP7A 4BEBA 5J4LA 4TTRA 4C0HA 4NYIR 5H8WA 1GL7A 3SNHA 2ZI3A 1JJ7A 4Q7MB 5BN3A 4AG6A 1D5CA 3FHOA 5L3RA 5SZJA 1M6NA 2PX3A 5EE1A 1QHIA 2QAJA 1MV5A 1W49A 3TUZC 2V8OA 4HI0E 1U8ZA 1JEEA 1LTQA 4Q00A 4DSNA 1HURA 3I5XA 4ZPXA 5TY0A 1NL3A 1P5ZB 2JLYA 1KI9A 2AL7A 4B75A 2W6ID 1T4GA 5FR2A 4B48A 3FOZA 2G83A 3NG1A 1ZAKA 1P9WA 4P4UA 4GSYA 2NO0A 4E07A 4M1TA 1TNDA 3ICQB 1JEDA 2CK3A 2FN4A 3OEED 4UNNA 1E98A 4YMWA 3GLGB 4GZMA 2FH5B 4Q1BA 3G82C 4F93B 1RRGA 4BWYA 1BKDR 1A2KC 3BC1A 5DISB 3ZZUA 1CJTC 2WPDA 1ZM7A 3PQCA 2ZI7A 1ZU5A 3CH4B 3A1VA 1M7BA 2CCKA 2N1BA 2REBA 2PZGA 2VP2A 1M34E 2PLFA 2VP5A 1P62B 3QXHA 2FF7A 2RGCA 4I1SA 4OK6A 4UNQA 1AGPA 2YOGA 3QNUA 3BXZA 4PFSA 2ORIA 5HCNA 2QP3A 5FPHA 2W6JA 1HQYE 1JQJC 4IKEA 5CDFE 4C2TA 1VIYA 1VHLA 4B34A 2QZ4A 3K70D 2FDCA 2OEPA 4Q4HB 3EC1A 3O8RA 3D31A 2R6FA 3QBVA 4M1WA 2W2XA 1NVUQ 3NC1C 1W0JD 2GRJA 4OQFA 3VQTA 2ZI6A 1FP6A 1NIJA 1Z0JA 2VP6A 3NWJA 3VR2A 4HLCA 2FSFA 3FVQA 1G21E 4LY6A 3WBJA 2X2EA 2BVNA 1IQPA 4DDUA 3PJRA 2CVHA 4PC1A 3GLHE 1T5LA 2B7BA 2BBTA 1GG2A 1N3BA 5FPSA 4WOPA 5IHPA 1JB1A 5HZKA 3QF4B 1BS1A 2DFLA 5TVKA 1T0JB 4EFMA 1XXHB 3QVUA 4XVQA 5DYIA 3W8NA 4CIDA 1Q22A 1XX6A 2FPKA 2UZ3A 2XZOA 1XB2A 2BBWA 3DEFA 2VP9A 1F3OA 4QBGB 2WM9B 3LXXA 5CYPA 821PA 3ZVMA 4BE7B 1GILA 3TR5A 3RLFA 4AK9A 5KNCA 1G8GA 1J8YF 4LYJA 3GD7A 4UQOA 4PO1A 2RGDA 1FOEB 4NE2A 4QNMA 2GETA 4S35A 4TL9A 4UJ3A 1KI7A 2RGGA 2GKSA 4I99A 3R8FA 3SFVA 4TYYA 3IILA 4KO8A 2PLRA 1US8A 2O8EA 1Q1BA 2D2FA 2ZM5A 3QG5A 3EWSA 3W6NA 4MGKR 3VAAA 1DELA 1XEWY 4OI1A 3IO5A 4A8JC 1FNMA 3W5IA 3WNDA 1BOFA 4AIIA 5AUPB 1EWQA 1PJRA 2VTKA 3OE7D 1XMVA 4QG7A 2R6GA 2XNSA 2QQ0A 3GCGA 3AP1A 3OHMA 4GOKA 1FW6A 4HDCA 4DBLC 3R7WA 5K8IA 2OG2A 2PZFA 1R5NA 1QRAA 1J99A 1Z08A 2GCPA 4C9BA 3SFZA 4D6PA 2ZRKA 4ABYA 1KI1A 2C9YA 4ZDKA 2QNRA 3QKTA 2ZVQX 3N2IA 2BC9A 3WP1B 3BH7A 4FWIB 2OZEA 1ANKA 4JSYA 1U94A 4JL8A 1Q1QA 1ZINA 1MH1A 4HB2A 3KFXA 1J7KA 1M74A 1VKJA 1VYUA 2DBYA 2ZTSA 5DN6D 1W36D 1PV4A 1KO1A 1SQ5A 4JBYA 4POAA 4QNRA 3ZGXA 5L8VA 1WE2A 1UDWA 4Q9LA 1OFHA 4CEIA 1A4RA 2EFCB 3K0AB 4GPTA 3LLMA 4Q03A 1Z07A 1E1QA 5FOVA 1QHXA 1IJEA 1IBRA 1CJKC 2WWFA 4A8JA 1FNNA 4BRUA 2OAQ1 1G8YA 2IF2A 4MRPA 1ZUIA 4FMBB 4LJYA 4OHWA 2IHYA 2FSIA 1FX0B 1G6HA 2RMKA 4PPFA 5EP1A 4XTRA 1XXHA 3GFOA 2Z6VA 2OBNA 3RSLA 4C0JA 1NNEA 5FL7D 1IXRC 1UFQA 1KIMA 3QVVA 2CHGA 1OH8A 4MYTA 5BXQC 3RS3A 3BFXA 4OHVA 4MGIR 3OFNA 4D81A 3KDSE 1XBTA 1RJ9B 1ZD9A 3CW2A 3OAAA 1NIPA 1GKUB 3THOA 5UKDA 3C41J 2VHTA 4JVNA 2WJVA 1US8B 2O8EB 1ZUHA 2ZAOA 1RVDA 4OL0A 5EXTA 3PEUA 1MKYA 1E2LA 3LAWA 3SS8A 5CK4A 3TRFA 4F92B 1AGRA 3H4MA 2HCJB 2AK2A 3IUYA 2FEMA 4HZUA 5SZKB 3T15A 2CL7X 4JT2A 1G17A 2VBCA 3BERA 1C9KA 1AZTA 3SR0A 1E96A 2A5DA 2CCGA 1NVVQ 1VIAA 1YR6A 3TW4A 1ZBDA 5FL7A 1FL9A 2AXPA 2P0EA 4URXR 1LY1A 4O25A 3FB4A 1E32A 1X1RA 4A1FA 3LY5A 2RGBA 5DI9A 3KJEA 3THXB 2ZE8A 4NP6A 3UWKA 4ARZA 1KK3A 5GJWC 2OUKA 1QG2A 3TVTA 3VR6A 3OIUA 3U7GA 1R7RA 2FMXA 1GWNA 4UNRA 3BIFA 1J90A 2GZHA 1XJCA 4KSCA 2GEUA 1II9A 2J0UA 2QMHA 4PC7A 2NQ2C 3U61B 1RYFA 1KDRA 4JYBA 3X1XA 2G9NA 2XOKD 4JJKA 2J46A 1E3MA 3BORA 4CT5A 4UKDA 2K5UA 1DVRA 2DB3A 4TL6A 2HXSA 1X8JA 2QE7D 3T12A 1XMIA 4WA7A 4QGHA 4A8JB 4JJZA 1NVWQ 2D7CA 5FUYA 3HR7A 1ZNXA 2FZLA 1AIPA 2HYIC 4PHTA 4Q02A 2WBLC 1B23P 2WV9A 3THYB 1O3YA 1AM4D 3BRWD 1A1VA 4YDSA 1FPMA 1N6HA 2ZSAA 2H8KA 3NC0C 2ECKA 4NYMQ 3CRRA 5HZHA 4GMXA 1KK0A 1G3RA 1CR0A 4X8LA 4XTCS 4CEJB 1NY6A 3GJ3A 5JRZA 2ZPTX 1NY5A 2C8VA 4G5SA 2J45A 3EZ7A 4RZUA 4V03A 2RGEA 4HUTA 1DAIA 2O0JA 3KQKA 1SKYB 3BFVA 2FFHA 2PEZA 4IVPA 3EC2A 4YQFA 5JMTA 1KJYA 1GITA 2XSZD 5C46F 1YVDA 4HUQB 1W4CA 2RGXA 1N6PA 4TZ6A 4HB3A 5KNBA 1MT0A 2A5FA 4JT4A 1H8ED 1WMSA 3PCRB 1ZM4A 2X19A 5G53C 4D4KA 3SI7A 3WYFA 4JVMA 1EFCA 1LF5A 3FGNA 2DFTA 4G3XA 1ZM9A 3NIBA 4E22A 5KUTA 4U00A 3NKVA 1TX4B 4ZCLA 2ZJ8A 3DHWC 3EASA 1XEXA 2NG1A 2BKUA 4LV8B 3HYRA 3FYHA 2QU8A 1Z2AA 3EZFA 1JR3E 3UANA 4YMTA 2B6HA 3ZS8A 2D06A 4U7DA 4MA4A 4GP7A 4UNPA 2A5JA 4I1OA 4B73A 2WMNB 4KHZA 4TMKA 1WBBA 4TSFA 1Z28A 3F3YA 3ZS9A 1R0XA 5L3QA 3P4XA 3GLHB 4QBFA 2J0QA 4HEJA 1W4RA 5CLLA 2DY1A 1EFTA 1XTSA 4DLSA 3J81k 4IDHA 2CCJA 2FSGA 3AGPA 2GCOB 4ZCIA 1FUUA 1Q1ZA 1G3IA 3JVVA 1NG1A 2IEYA 2BOVA 2OCPA 1OXTA 3NXSA 3B1YA 2HEIA 4MRVA 1GFIA 2VO1A 4W5WA 2IUSA 4ACBA 1EFRA 2NZ8A 1G5RA 3EW9A 4NYJQ 1XPRA 3EZ6A 4M1OA 4P3YA 4Z8YA 3ADCA 1EG7A 1KJZA 2FU5C 1P4SA 4D4JA 2FV8A 4IHQA 4DVGA 1TPZA 4C30A 4QXAA 3A58B 2PMDA 3OE7A 1N0UA 2D7DA 4GZLA 4LHXA 4OJKA 1XCPA 2JLVA 2YWEA 5K8LA 4S2EA 1X6VA 3BBPA 2ZI5A 3KUDA 1UAAA 1O87A 3E5HA 3Q5EA 2Q9BA 3IDQA 2F1HA 1H65A 1KO5A 1T3SA 1YZTA 3SEAA 1IN4A 4HATA 3Q7PA 1XMJA 2ZRHA 4DLZA 4IEIA 4PR0A 1RZ3A 4B3GA 1D9XA 3U2QA 5BN4A 4CGZA 2AHOA 4KJZA 1T0HB 1PLJA 2W6IA 5KNDA 2ZYUX 2J0VA 2AN9A 4A6XA 1Z8FA 3GEEA 1NVXQ 2LCFA 5CK5A 4P31A 2KSQA 2VEDA 4Q9IA 3NDPA 5TARA 4FD2A 4R7ZA 3SJZA 3EAQA 2IYRA 2QENA 3NDBB 1D2EA 2ZRIA 3P32A 4IW3B 3UK6A 4MKHA 1GIAA 3QF7A 3GLGA 4PZZA 5AK0A 2EFHB 4LGMA 4M21A 5KPJA 3SQXA 2JJ1D 4B2LA 4LBWA 1NMZA 5J4HA 4FCWA 5JLJA 4F7WA 1OB5A 3EPLA 2P67A 4Z54A 2HT6A 2JASA 2Q3MA 3MUFA 1F6BA 1FUKA 4LV5B 2ZXUA 3PV0A 1KI6B 1E2HA 2FX3A 3AH8A 1UM8A 1DBSA 4TQUS 5AJVB 3GLHA 2V7QD 2G88A 3PIRA 3ZVNA 1N5LA 1S1CA 1VCOA 3UMFA 5EXSA 2FA9A 2B8TA 2ZJBA 4QOSA 4QBHA 4MYCA 4Q4HA 3RRNA 1JAIA 3NVAA 4OKSA 2XNDA 3MWKA 2DYKA 3T35A 1TAGA 4EJSC 3GFPA 4M8NE 4FW9A 2EW1A 3HJNA 1XEFA 5C4MA 2PCJA 4R71A 2ZRFA 1WXQA 3SJBA 1DADA 5KSPA 5TMPA 2VHJA 1NP6A 4JLVA 4WZ6A 3S1AB 3JVUA 4D82A 1N6KA 2ZR7A 3K9LA 4B6FA 2WWGA 2H16A 3PUVA 4BZPA 4EPWA 1EK0A 3B5JA 2FGKA 4JMPA 4Y0VA 3IEVA 4LK2A 1EX7A 1N2CE 4QM6A 2ZRAA 2G0TA 3H1TA 5AJZA 2A5YB 3QF4A 3L2OB 2FOLA 4EPTA 1OH7A 2CK3D 3AVQA 2OCYC 5FPKA 3N5CA 3W3AA 4JVLA 4ZDIA 1KI4A 1CEEA 2NPIA 1E2PA 1R5BA 1ESNA 3VU9A 4TWZA 3VR3A 1KAGA 1N6OA 3AKYA 2AKAB 4EDHA 2IYZA 4Q4JA 2H92A 1F5NA 3LBNA 1BYUA 2Z0MA 2V3CC 4M1MA 1NBMA 1GRQA 1CJMA 2OCAA 2P5SA 4IDOA 3RS7A 2C2HA 1N25A 1W1WA 2IYLD 5FOSA 1QG4A 2NO6A 3FMOB 1U8YA 1J8MF 1NN0A 4RCYA 2XAUA 3KJHA 1W0KD 3KFVA 2XTNA 4V0KA 2GF9A 1RYHA 1IN5A 4DLRA 2EYQA 5IT5A 1Z6XA 4RKEA 5JWHA 2X1VA 2WMOB 2YWGA 4KU4A 3H86A 4US0R 3WP0A 1G4UR 3TBKA 2QPOA 1NLZA 3D6TB 3DZ8A 1NF3A 1KTVA 4V0NA 3U7FB 1XD2A 4I81A 1KI6A 3T1QA 2WKQA 4URWR 4A0RA 1WB9A 5F98A 1LS6A 2QQEA 3ONWA 4H1UA 4LRWA 4TLBA 4XJXA 3WBKA 5L3SB 3K70B 4GOXA 4QKQA 3U5ZB 2AR7A 5IRCD 3B9PA 3BB4A 3H0KA 4IRUB 4XVRA 4ERNA 2XEXA 1QHGA 2GESA 4RZXA 2W00A 3TIFA 1T91A 1CULC 1U2RA 2KBEA 3LDAA 1E4YA 3PUWA 3FMIA 4B3BA 4DEYA 4DDTA 2XITA 2J7PA 3Q5DA 3VHXA 2VHUA 1HYQA 2C5LA 4Q4LA 1GM5A 3TMKA 4NCNA 2B21A 2IYWA 5KOYA 4TYNA 3K0CC 2Q6TA 1P3JA 3UPUA 1I2DA 4Q7JB 2E9SA 2VP0A 2ZVPX 1WA5A 1ZVQA 3TR0A 4PQFA 1GNPA 4XVUA 1CR1A 4B35A 1G6OA 4ESHA 4TTPA 2VQSA 5H68A 4B71A 3UWOA 3KQNA 2HT1A 4NMMA 1YJ5A 3RYTC 2MMGA 4IFEA 4RD4A 3AF1A 3WNCA 1HE1C 3X1WA 3EA0A 1TU4A 3QXSA 3U3RA 4LOAA 5DH9A 2HF9A 3FFAA 3VU9B 1VCNA 2N42A 1ZIPA 4NYJR 4Q1AA 5FFMA 1P61B 3EZ9A 2IX3A 1P7CA 1VCMA 1W4AA 3AKDA 5GVSA 3VTKA 4B43A 2GVDC 1T3HA 2WWIA 1RJ9A 1QVAA 5J47A 2YHSA 3AKEA 4PAMA 5HPYB 1SVLA 4M9SA 1YZGA 4NTZA 3U3KA 4NPHA 1YR7A 4RD2A 4A36A 5FR1A 3TLXA 2I4IA 3IO3A 1L8QA 4ASUD 1HUQA 1KI2A 2REXB 3X1YA 3K9GA 2WJGA 1G7TA 3K0EA 2A2ZA 4NKRA 1OKKD 2EWVA 3CR7A 4R2IA 3U4QB 5HKKA 2VHQA 3GEHA 3GPLA 4AKHA 1FTSA 1WCV1 5DHFA 2QT0A 5EZ5A 4JKIA 1YR9A 3CF6R 4DT1B 3NHBA 3CONA 2F43A 3BS4A 2VF8A 5KDDA 1KI8A 4MRNA 1TUIA 4QHTA 4ARZB 3LVQE 1ZIOA 2XNDD 4OI4A 5CIWA 3PUYA 1Q44A 3SHFA 3ZD7A 2GXUA 4YC7A 4JBWA 4E09A 4YONB 2IYXA 1YZLA 5E4FA 3B1XA 4L5BA 2H17A 1HQCA 1M8PA 1E9DA 3A8TA 1SULA 5EP2A 1BYIA 1CBUA 1Q0UA 1Z0AA 3KUCA 2ZRGA 1OXSC 3CNOA 4AI6A 2IUUA 4MGYR 5DO9A 2PCLA 2BM1A 1TUEA 4Q9HA 5LBIA 3LXRA 4EFLA 1N6RA 3FKQA 2OLKA 1VMAA 2P2LA 2H7VA 3LQRA 5B2ZA 4AKEA 2CBZA 4Q1EA 1CJUC 3CX8A 1L4YA 1MO5A 1AS2A 1E9AA 1OF1A 4QRHA 2QRZA 4TN1A 2JJ1A 4JL6A 4FCTA 2HXYA 5LD2B 1W2GA 3VNVA 3K9HA 4ZDWA 3THYA 1ZD1A 2YNMA 1XJQA 2P3SA 3UXMA 1Z0IA 3PXGA 1UDXA 4GP6A 4WW0A 3P4YA 4MDEA 4QFMA 2ZAMA 3TW8B 2ZI9A 1GKYA 2JIZD 1N6LA 3VKWA 1BIFA 4KBGA 1XDBA 2IL1A 1KSGA 2RH5A 3K70C 4PHFA 1SVWA 3OZXA 2ZS8A 1ZNYA 3RRZA 3ASZA 1MR3F 3Q9LA 2BJVA 3TNFA 5KSOA 1ZRHA 1KDPA 1M7GA 5FOUA 1T3LA 4DCTA 5BYKA 1GL9B 4HUQA 2R6DA 1J2JA 1X8KA 3QXXA 4H9GA 5GJCA 4BGDA 1R10A 1ZUNB 2SHKA 3SHWA 3DMNA 5LPNA 3F5FA 2WJJA 4D25A 4Q5IA 2D2EA 4DT1A 1Q3TA 2NGRA 2O8CB 2EVWX 3EPKA 2J59A 4O2RA 3AF2A 3ZQJA 4V0MA 3BAFA 1W47A 1E9BA 1GKIA 1VHTA 1EFHA 1OHHA 4AKIA 2ZI4A 2OO7A 2PJZA 3WMEA 3I5YA 5DIFA 3QUSA 2QA5A 2J5XA 5EXXA 1VG1A 2ANCA 1UKZA 4NHOA 1BMFD 1CLUA 1JR3D 3KTAB 2IXFA 3DPUA 4JLNA 2JLRA 4BASA 4Q7KA 4TSFD 3FHTA 3THWB 3KQUA 1OXUA 2KI5A 2MSDB 2GCOA 5EJEA 4V0LA 3X1DA 4EPRA 4HZIA 4AYXA 3KJGA 1OHHD 3QKRA 3C8UA 4IFBA 1JJVA 4XIGS 2EFDB 3CPJB 2A7QA 5J4YA 3ICEA 2ZJYA 3AP3A 1KHTA 1E2GA 4L15A 4I1VA 3T1VA 5M04A 5F9HA 5KHOC 2XTZA 4XSHA 1QF9A 3U60B 4IDQA 2ZRNA 3TUJC 4US2R 4PX9A 4NCHA 3OEHA 1UKYA 3TSWA 5A5GA 4DLVA 1G7CA 5A0FA 1G9XA 1R0WA 1AS3A 3MCAA 2BWJA 4W5JA 3CM0A 1Z6YA 2RB4A 5AUQA 2IA5A 3GFTA 3SJCA 4PQYA 3DZDA 4B74A 2OCBA 2OFXA 3L43A 4M53A 3MJRA 4TYWA 4BFSA 3B1VA 3IHLA 2EYUA 4K46A 1Z22A 2GZDA 3AEZA 4DC9A 1QBKC 5JRJA 1HH4A 4PSKA 2WWYA 3BB3A 3BH0A 3DOEA 2AKYA 3KKOA 3ZVRA 2BM0A 2OV2A 1I4DD 3E70C 4PC6A 4JLJA 5L3VA 2DR3A 2TMKA 4LBZA 2MSEB 1RKBA 2OXCA 2ZRDA 4DB2A 1W7AA 1PLLA 1ZW6A 3IBYA 3CWZA 4NBSA 3KXLA 4URVR 4D0LB 1TQ2A 3L0IB 5AJYA 1GSIA 1RW4A 4FWTA 1NMXA 4L16A 1K5DA 3KXKA 4KVGA 3IPXA 1TQDA 3RRMA 2ZUBA 5H70A 3T61A 5F9FA 2C96A 1DAFA 4BLQA 3EWAA 4MKFA 1U98A 1XPUA 5KDOA 1JI0A 3PR1A 2J1LA 1G7RA 3VHLB 4C3ZA 1AK2A 1R8SA 2ZRJA 4C7OB 2YOFA 1KYIA 2BBSA 4CRWB 2A30A 4A2PA 5FOWA 3KTAA 3ZVLA 3GJ5A 1G41A 4TYPA 2ZRCA 3THWA 4N0DA 2WICA 5LB2A 1E79D 2HJGA 3NEYA 1Q12A 1OH5A 1LF0A 1TL7C 2WZQA 3A4NA 3PG5A 1A7JA 1VPLA 1AQUA 2R6AA 3OIVA 4C0KA 1FMLA 1I2MA 4HLQB 2FFAA 2FPLA 2V4ZA 5FTLA 3AM1A 4P0TA 1JALA 5E3HA 4BRWA 3MG9A 1S3GA 1SXJD 1MOZA 4B3FX 3AP2A 4MH0R 2KE5A 2GTPA 4B47A 5KYKA 3S1AA 3B13B 1P75A 3RNLA 1ZJ6A 1EESA 4HLUA 2E1RA 3NH6A 4A15A 2CLSA 4BFZA 1LB1B 1UBGA 2F9MA 4KV9A 2WWHA 5EXPA 2BBOA 4NYIQ 3PEYA 1G8HA 1X86B 2CL0X 2IT1A 3SZRA 1NG9A 2X8AA 1P2SA 3CIOA 4NCIA 4O0MA 1VG8A 1Z0KA 1VYTA 3QKUA 1DARA 4BLTA 2IS4A 2RGNA 3B82A 4C4PA 4W5HA 3CRW1 5G41A 2EU8A 3MWYW 3T5DA 2ZUCA 1XNJA 3ZYCA 3OFND 4DZZA 4DEXA 1CRQA 2ZREA 4Q4JB 1RC8A 2C04A 3GJ8A 1G19A 1OXXK 3U3MA 4IEEA 1E6CA 4L4UA 1MRSA 1SXJE 3I8XA 5FUXA 1Y63A 4PC2A 3B85A 5ELXA 1G291 3MMPA 1G8FA 4AC9A 1Z6GA 2JLWA 5EP3A 3QPUA 2WJHA 3IIMA 2ZITA 4BFYA 4DCNA 4RZ2A 3AVWA 4OK3A 1E2MA 2CDNA 2AD5A 4TTQA 3F0TA 1SVIA 521PA 3X2SA 3REGA 2XOKA 4KFSA 3RWMB 3WYAA 3M0EA 1XD2B 4M4SA 1N0WA 1NVVR 1XCMA 4WAUA 4B2PA 3EX7C 4LX0A 2V1XA 3A6PC 2GA8A 2C9OA 3QE0A 5L3SA 2V54A 2QRNA 3TSZA 2V6JA 4DLUA 2D62A 4PC3A 5C4GB 5C18A 4A4DA 4PPNA 2ANBA 1FMJA 3ADBA 2V7QA 3QPVA 2P6NA 2QN6A 1XXHE 1NN5A 1OFUX 2JLZA 2R44A 3D7MA 4LJ4A 4EUNA 3DM5A 2IYSA 1RRCA 1IAQA 1DPFA 2ZJ2A 1TEXA 2ZANA 3DDCA 3LV8A 4I1UA 2BHRA 2F1JA 2ZQ5A 4JLPA 4IDNA 3R9WA 4Q1CA 1CP2A 2ZRMA 1Z47A 3QI2A 1I4TD 1V43A 3LW8A 4FMCB 4OHZA 4BLOA 4KFRA 1CR2A 4CT4B 3N70A 2O0HA 2D74A 5ANRB 4EFNA 3LLUA 2QPAA 5KPDA 1IXZA 4LBVA 4Q48A 1SVKA 1E2QA 1R2QA 1H8HA 1R4AA 1XWIA 4BFXA 1WRBA 4LHYA 2QTFA 2R65A 3I92A 3DMDA 4GNKA 4PHHA 3WYGA 4DHEA 4GI7A 2IHBA 4DUGA 4OYHA 3AB3A 5EZ6B 5CM9C 3T34A 4BFUA 3KKMA 1IOZA 4G0NA 3LBHA 1U9IA 1E9CA 1OPXA 1Z3IX 2F6RA 3HU2A 1IY2A 4Y0AA 1DG1G 2QORA 4ZO4A 5EUQB 2ODEA 1ZC3A 4M2LA 1HEIA 1E0JA 1T5IA 2C03A 4TT3D 2H1LA 2GJSA 3K1JA 3MLEA 3VX3A 5FOTA 1KI3A 2O0KA 3B78A 1OV4A 2J87A 4PQRA 5GJBA 1FQJA 1E1QD 2O52A 1RRPA 4BFWA 2ZJ5A 2Q3FA 2ZE7A 3CB4A 1XF9A 5KSYA 1GAJA 2XB4A 3EIQA 3U4QA 3BFKA 2P6RA 2ZRLA 1ZP6A 2NTYC 5KDLA 1P60A 3GJ0A 2WKRA 4PO8A 4BQSA 1JR6A 3QBTA 4BUJA 4YXWD 4MUAA 4P32A 1ZNZA 2F9LA 2IXGA 4M1YA 2F43B 2VL7A 5FI0B 1DAMA 4D0GA 1W0JA 3X1ZA 3GMTA 4ZCMA 4ZV4A 4AYWA 3B8HA 3HYTA 1RRFA 2DFKB 4Q4AA 3C7KA 3REFA 1OSNA 2I1VB 3K09C 2OLJA 2WVJA 3KKQA 3LO5A 1KO4A 4TL7A 4HB0A 1OE0A 4HAUA 1DAEA 4NCKA 4NCJA 3U7EB 2ORWA 4PPGA 1AJEA 4KI0A 4LBYA 1YRAA 2OFOA 2GJKA 1IXSB 5HE9A 1FQKA 2UZIR 2GVZC 3B9QA 1DE0A 2QM7A 2AK3A 3BK7A 3CR8A 3GJXC 1P72A 4P4TA 1HT1E 4DDWA 5GJVC 1QHHA 4ZDJA 2IYTA 2O8DA 1ZMXA 4RY2A 4HAVA 2CEAA 3GLIE 1IN7A 4G1UC 3SOPA 1LFDB 3OESA 4TQ9A 3NH9A 5FUWA 2W0SA 4PAQA 1DOAA 3EPJA 3QSYA 4R2HA 1Z06A 3OEEA 2B92A 3RC3A 2P65A 5BN5A 1JXMA 1NBME 1H8EA 2VPPA 2ZJZA 1E9SA 3WXMA 3IQXA 2YV5A 4H1VA 5JZVA 4Q9JA 2ERXA 2OESA 1NKTA 4DIEA 4URZR 5SZIA 4KLNA 1SZPA 1S8FA 2IUTA 3ZZ0A 4CF7A 3DOFA 4QL3A 2L0XA 3OIWA 2JLSA 1GTVA 2HDNB 3RDPA 1K8RA 4M0LA 721PA 1UBFA 4MQBA 3JZAA 4U5XA 3ASYA 1CS4C 1CRPA 3EXAA 4W7SA 1PLKA 2VF7A 2CHVA 3A1SA 4HAWA 2QGNA 1P2VA 3TQCA 2KBFA 5E7MA 3AQ4A 1X1SA 3UIEA 2VH5R 4B2IA 3RS4A 1BO6A 1CIPA 1LVGA 2O8CA 1DAGA 2OBMA 1F2UB 1UEJA 2RHMA 3QQ5A 1KNQA 3DKPA 1XTKA 2WOJA 1SVOA 3GJ4A 4PO9A 2QMEA 4FINA 5B58C 3TE6A 3RVBA 4Q4AB 1E2JA 1UADA 4LWZA 3BB1A 3SYLA 1E99A 2X2FA 2FPMA 3GLFE 2W6JD 4LV6A 2ZROA 4QJ3A 3TKLA 5JFGA 1TADA 4PHGA 3KKNA 1SKQA 2ERYA 2YWFA 4KVAA 1CKEA 4HDOB 2ZIAA 1GVNB 5IDVA 3Q7QA 4YXWA 1YZKA 2WWXA 4M22A 2FFBA 4GBMA 4M9XA 3I61A 1KO7A 3ZLJA 4BLPA 2C98A 3QKRB 3R9IA 2QTVB 1QHSA 1QHHB 2FFQA 2WPDD 2IYVA 4UXIA 1F60A 2QROA 2XZLA 1OIWA 2BEKA 3AVTA 4AWXA 3NBYC 2YVUA 2JJ2D 2ZSDA 3NBZC 4Q19A 4KLZA 3U44B 2UKDA 1UJ2A 4TT3A 1K6MA 5JWRA 2ODNA 3QXCA 2FE4A 2G1JA 3CRQA 3WHLA 2JCSA 4Q1FA 3ZIAD 1DTSA 2BJWA 2D3WA 3V00A 1NSTA 2AD1A 2V9PA 1Z63A 2XSZA 1U0HC 2BCJQ 4Q18A 1U81A 4DUGD 2GHIA 4HAXA 2ZSEA 4OQNA 3WHKA 5F2EA 2WAXA 3EPHA 1D9ZA 4IOKA 3AUYA 1T6NA 1FTNA 1J70A 4XD7D 5J4KA 2IS1A 4F4IA 3CPHA 3SQWA 1Z0DA 2QT1A 1DEKA 2X77A 1KK2A 1OT3A 1KJWA 4DIDA 3U6BA 2Q3HA 4WXPA 2HF8A 1QDEA 4OBEA 2ZJOA 4IOMA 2EFGA 4QM7A 3QENA 2QMUA 2JLXA 4F38A 4O3MA 5FBWB 2RGAA 3TJZA 1EX6A 2REOA 4WVFA 1WDTA 1X3SA 4UXHA 3CNNA 3W6PA 2QP4A 2PEYA 4A92A 2H18A 4CEHA 2CXXA 4A0FA 4II7A 3T1TA 3K0SA 1F2UA 4BLRA 4B33A 2ZYTX 2QPTA 2JDIA 3DL0A 1HA3A 3HPRA 2GK6A 2RHDA 4AD8A 1PVOA 1M2OB 5JS7A 5BW8A 3B7GA 2LKDA 2IWHA 5J5CA 3L0PA 2YZ2A 3IHWA 5B30A 1G8PA 3O8CA 2QSYA 1E69A 1E79A 3AVYA 3LD9A 4L9SA 3SE0A 4C7OA 3RAPR 2Z5FA 3U6KA 1RPZA 3VKGA 4DB4A 4KXFB 3ECCA 4Z1MA 4N3NA 4HSEA 2BKEA 3UMSA 5AUNB 3IQWA 3IGFA 2AFHE 1P2UA 2HLDA 4PXAA 5A4JA 2Z83A 2PT5A 1G4AE 3B60A 4C2UA 1G20E 4Z51A 3C16C 2NZJA 3MSXA 1OFIA 1JXOA 1QHNA 3GJ6A 2QL6A 3G5UA 1HY3A 4FMCF 2DHRA 2GJ8A 4K8OA 1F48A 1NN3A 1SKYE 5KSZA 1E1RA 1W5TA 3FHCB 3NHAA 4F91B 2F3RA 2FWRA 5DI3A 1KKLA 1XTQA 2ZYVX 4HAZA 1A2BA 5FBQB 5BYJA 3B2EA 4US1R 4BFVA 4YMSA 1IN8A 3Q8XB 3AF3A 2PH1A 1FZQA 5B64A 4JLDA 1JNYA 3QY0A 1WF3A 4M9QA 1KY3A 2HJVA 3OF5A 4G5GA 4XD7A 3U3OA 3CRMA 3ZZTA 4LUCA 5LD2C 4FN5A 1UKEA 5AR1A 3R20A 4IJMA 3ETLA 2DWQA 4LHVA 3K09A 4QGAA 5JWOA 2QAGB 3AUXA 4Z8XA 4JBXA 4A9AA 2ZUDA 3TVDA 1KK1A 4WZAE 2R62A 1JQLB 3EIHA 4WBSA 4IOLA 1II8A 5K8TA 3ZIAA 1KZ7B 1D6JA 2GJAA 4FMDB 4LSGA 4TQAA 1D8TA 5FL3A 4LJAA 4DWJA 4E5UA 5CB8A 3ADKA 5KU1A 3VNUA 3KB1A 3CF2A 3VX4A 4MGZR 4XWAA 1IY0A 3DO6A 1AS0A 3UMRA 4DCUA 4IVQA 4JS0A 2GEDA 4QGFA 4CEHB 3RS0A 1EXMA 1LNZA 1VCIA 4R9UC 3C15C 1DG3A 2GBLA 2Q21A 3LRPA 4LYAA 2Z43A 4MKIA 3HP1A 5E7JA 1RFLA 2B7CA 5DN6A 2ZSFA 3BH6A 2VSFA 3GLIB 4DLWA 2NO9A 3KXIA 5IF9A 1GDDA 3A36A 3E1SA 1JR3A 4KODA 4EIWA 2OAP1 4TZ0A 3LQQA 1Q21A 1QVRA 4ZKEA 4ZIRB 3V9PA 4NYMR 1TEVA 5JCZA 4Q01A 4JYCA 4RCZA 4QJ5A 1E0AA 1AZSC 4B76A 3I73A 3ND8A 2FJUA 3TQFA 3RWOA 4B32A 5E7IA 3CO5A 4QJ4A 5CJPA 1R0ZA 4A0GA 2IS2A 3DM9B 4L8GA 2QG6A 1KMHA 4FCVA 2I3BA 1S96A 4PSVA 3IIKA 3K8YA 5TB5A 3D8BA 1Z0FA 2R2AA 3O47A 3OIYA 1AN0A 2CHQA 1SHKA 4ACAA 3DKVA 3NBFA 4OQXA 3L8ZA 5FPYA 4EQ6B 2DFNA 5EP4A 1NLFA 2A5GA 2NIPA 1TQ6A 4AURA 5C1BA 2CJWA 2YKGA 4ON9A 2F1RA 4RD3A 4LPSA 2JEOA 1TTTA 2PX0A 4TLCA 3A37A 3V4FA 1NRJB 4HYYA 3RABA 2O8BB 3AV0B 1JPNA 3FPAA 3I1FA 1MO3A 1YZQA 1OYYA 4P33A 4U02A 4HAYA 1CJVC 2CL6X 3PEWA 5AWFC 2VHCA 4PAOA 3OEHD 5DSZA 1I4LD 5DGXA 4AG5A 2KJQA 4TMVA 2IXEA 5G3YA 3D3QA 2QTHA 2Z4RA 1H8HD 4E03A 4GOJA 1N6NA 2G3YA 3WRXC 2OBLA 3HDTA 4QHYA 3CZPA 2JLUA 2G0NA 2EWWA 4JLBA 2WIAA 3KQHA 3QG1A 3SN6A 4C0QC 2IEZA 3WNBA 3TUIC 4A82A 1S0UA 4G5OA 1LW7A 221PA 2GDJA 1W4BA 3I62A 5G3ZA 3U7HB 2IYYA 1E9EA 2AXNA 3FWYA 1COWA 1YRBA 3IBGA 1GRRA 4BZQA 3NBXX 4A2WA 3KJIA 1DO0A 3I4LA 1XZQA 4QC2A 2WJIA 5CLQA 4C0LA 4ZIRA 4K81B 2G6BA 3H2YA 2OM2A 1CTQA 1C4OA 1E2DA 3IPYA 3MFYA 2GXAA 1YKSA 1XD9A 3FMPB 1K5GA 4QHSA 1Q1EA 3BJIC 2FGJA 4GDFA 2AFIE 2QUZA 2YINC 1E0SA 2PT7A 1E2EA 1GNQA 2XXAB 2WAYA 4JKYA 3F8TA 4Q7LA 4EJSB 4JSTA 3LX5A 1G1MA 1UEIA 5KTYA 2ASEA 4C0AC 5FBLB 1IY1A 4OHXA 2YOHA 2ATXA 421PA 2Q0HA 2VSXA 3L0SA 4JLMA 3K53A 1JECA 4HLUC 5AJXA 1R6BX 4MYHA 4KAXA 2O8DB 3ZH9B 3E2IA 1D2NA
chains in the Genus database with same CATH superfamily
1ESCA 4HB4A 4TKVA 1A77A 1ZM3A 4ENVA 1U02A 2EZUA 1Y7LA 3ZCUA 4LTNA 3F3MA 2C3MA 4ETMA 1Q84A 4PAWA 5A04A 1FXWF 1M1YE 3D8TA 2FK8A 5D84A 3UHPA 1P74A 1EWYA 2C9CA 5K3FA 1PGOA 2JGNA 1NAIA 3KELA 4IIJF 4R01A 5FX2A 1TYBE 3S70A 2GD6A 1G0OA 3CEJA 1D1SA 4RBNA 4CMEA 3MTBA 4LJ6A 1JHVA 1RI5A 4AMZA 5CFPA 5DE3A 4TL8A 3AEUA 2XQVA 1NUUA 2VDWA 5CH8A 4B3CA 4ISCA 2Y1XA 2PD6A 2QUBA 1PTJA 5K5EA 2QSZA 4BQEA 1YOVB 3AVVA 4FB5A 3OZSA 3IDZA 4XVCA 1RKXA 2B20A 5ADWA 4U9UA 3A3NA 3X2FA 5TDHA 2AWNA 2XKBA 2ZWPA 3QW4B 4B7AA 3KOUA 3ONVA 4PXSA 4FS8A 1DLJA 1T8SA 2B8WA 4GI1A 4NHEA 3RREA 4Y2QA 4A2QA 1Y5IA 2I2AA 3DTVB 5EKDA 2YHIB 2CFCA 3OJLA 4QOEA 1W88A 1ZK0A 1EGMB 2QRQA 1FP1D 3CMMA 1DEAA 1PWHA 1XRNA 4XYEA 5K20A 3K96A 4U39A 4ZI3A 2W2KA 1JEYA 3M6AA 2H1WA 5HDQA 2PKRA 1XEWX 2CHFA 1OI3A 2FW7A 2XCSB 3UWPA 4ZVQA 1G20B 3JWPA 2DPMA 5CXUA 2JI7A 4UPEA 4ZHSA 1XZIA 5JSYA 1E61A 4HN4B 1JT9A 1DIAA 1LJUA 1UJ6A 2JIMA 3ONNA 5CLIA 2GPJA 1N5JA 3LU1A 2J3MA 2ZXEA 3LKZA 4RFSA 4GL2A 1QHYA 1Y81A 3KPWA 1I7DA 1ZGAA 1A7AA 1FBNA 2Z5GA 3P0HA 4IVRA 5FBVB 3MPOA 5L51A 2WIBA 3FWHA 3T0GA 1INLA 2LR0A 3RV3A 3TLGA 3WIEA 2FPOA 4RVGA 1WG8A 4AZ3A 4EJSA 2HIGA 5LXTF 4DMRA 5A7GA 4JB2A 6Q21A 3I9V6 3VO2A 2I6XA 4GMFA 4XX0B 4DDVA 3HU1A 5JEDA 4NABA 2JG3A 4MR9B 4MPPA 1BFKA 2OE2A 2QTVA 3M2TA 3SLGA 4EDFA 2ZE5A 5P8WA 2GK7A 3RSOA 4O4JA 1ZLYA 3SQOA 4KB5A 4RWEA 1BU5A 4IF6A 2AX4A 4LPKA 3LH5A 4R98A 3D59A 5KVCA 4B85A 1SUIA 3U44A 4EUSA 2ZETA 1CDDA 3K73O 4WXRA 5AH0A 3SGLA 2HHHB 2TMDA 3O6VA 5TT1A 4NOJA 5C7LO 3LUJA 1YS1X 3LWBA 2WZBA 1GARA 1IM5A 3MD0A 5COAA 3MTQA 5LC1A 2ZU6A 5C8YF 5ICFA 1XCBA 4WY8A 4EATA 1D6NA 3UYKA 3IVMA 3WBBA 4QTYA 4LJ5A 4TMWA 2FR8C 2FWBA 5JS1A 1DNPA 3CNLA 1K3TA 4N0EA 1VKNA 2Z1MA 3OOJA 3IALA 3ZWBA 5KX5F 5K6RA 3ZLTA 3L7AA 5LZ7A 1P17A 5FLXA 3ZCQA 2PYZA 4QODA 3B6KA 5DDIP 1W1UA 3Q0IA 3A05A 1WMAA 5FJIA 3FIUA 1L5LA 5JECA 3CRVA 3SXJA 5ICCA 1WSAA 3DS8A 2HK7A 4PXYA 1VPEA 2B82A 2JEZA 1Z6AA 3IMFA 4I4IA 3ITDA 3D43A 1NATA 4OP2A 4OOFA 5EE0A 1PEAA 3J7AC 1I3OA 4I8DA 1G7SA 4TLAA 1BVRA 2CE7A 1FB5A 1KZYC 3E9MA 4CDGA 2UAGA 2N47A 3W5JA 3BHMA 2IYFA 3FPHA 1WXGA 3LF1A 3A9CA 2HJ9A 1U9IC 3I5AA 3L04A 1OFTA 1T10A 4E3WA 1S02A 2VRCD 2NU9A 4QDJA 3DEYX 3IR6A 5HIMA 1G20A 4ZYYA 1ISMA 2P8JA 3I8SA 1NF2A 1J0AA 3AUKA 4LC0A 4EI8A 2ONJA 1QGED 4RV4A 4TWRA 2IOFA 1E3QA 3LFUA 2ZYWX 3U4IA 5FYQA 3VR4A 4DLTA 1C81A 2B4TO 4YRFA 2FN7A 3AR8A 1DO2A 3P7MA 3D6AA 3SHQA 4AYTA 2C7OA 1L7VC 1WCWA 4QECA 3FVRA 3GIWA 4FFDA 3OQOA 1WULS 2V97A 1BS2A 1P1FA 3KZ1E 5CFRA 1WCYA 2D2IA 2PRJA 4AM8A 3LP5A 1W46A 2VUSA 3MMXA 2ZT8A 2R8RA 3IV9A 3LL7A 1U80A 2DWPA 3SVLA 3TGPA 2HMUA 4OIMA 4EKNB 2WWWA 2ZEJA 3BIXA 3IAHA 2GB4A 2HX1A 4RVCA 1SHTX 1SVSA 1B16A 2JIQA 2WSMA 3COPA 2NPFA 5A2GA 3QEBZ 3WA6A 1GRNA 3PGKA 4Q21A 3FPBA 1YQXA 1LEHA 3C1UA 4BPRA 2V55B 3UK0A 3JV7A 2DEUA 1OI2A 3LUFA 3ZGVA 1SCKA 1KZGB 3FDIA 4YLGA 5LNK6 2VJMB 2J3DA 2PSFA 4EX6A 5JJLA 2ZYGA 1TJNA 1X13A 1QFSA 1XFDA 2YTZA 4DR6B 2GAOA 4Z7NB 3R0ZA 5H1YA 3PC6A 4UJ5A 1SZJG 3QU7A 4JVSB 2XB6A 1KA9H 1KJ8A 3B89A 3M1IA 3CZ5A 4FBLA 3WZLA 4Q16A 4BDSA 1VSUA 1WCIA 5D85A 2WFLB 4BEJA 1PL0A 1ZD3A 4LRQA 4QXRA 3PXCX 1Q7TA 2QUHA 4EO7A 1T3GA 1FUIA 1VFPA 2Y8EA 3WB2A 1JAYA 2WU0A 3NTUA 2NSDA 4AO7A 3O4GA 3KQLA 1BHJA 1EE1A 1WR8A 4PVDA 4AUEA 2F55A 4MS1A 5IVPA 1LLCA 3OVMA 2QAGA 5I6DA 3HR4A 1F06A 2A3NA 1Y6GA 2BR3A 2W2LA 1Q57A 5SY9A 1OIXA 3SU8A 4FDMA 1E7WA 1II8B 4KYUA 5U4QA 3UHAA 4AZ0B 4P08A 3HA3A 3IIJA 4UE2A 3SLRA 4ALIA 1R5OA 1CP3A 1A4IA 1OJLA 2GBFA 4AROA 3OCUA 2ZTMA 1OXVA 1U7DA 3WR5A 1VIDA 4F46A 3ZIUA 1S2MA 4P2GA 1Z45A 5IT9A 5TF4A 1PNOA 1C9MA 2OGWA 5AXAA 2F7SA 3NT4A 4X45A 3RE1A 3V3KA 1TKRA 1Z2OX 1P9RA 2R1VA 3LX4A 3R7WB 3L0BA 5CDGA 4KR0A 1OASA 3GJSA 1X80A 2XKJE 1C7FA 1ETUA 1RMQA 1V47A 3N6RA 4Q66C 2IIPA 4MCIA 3DOUA 1KO8A 1ULAA 3U1TA 2MINA 4G0YA 2I03A 3DKKA 5D7BA 1XZ8A 3MWGA 4DCSA 4E94A 2OXIA 4HQRA 2VK2A 4Z5XA 4W9NC 1K1EA 2YW2A 4OKNA 3AKCA 4B3XA 4AULA 1RIFA 4EYOA 1EZZA 4L4SA 4WDRA 4DXDA 3E9RA 5BR8B 4A0HA 4LJ7A 1HPLA 3S8EA 5AT1A 4ZU3A 1M8GA 1J24A 1OLOA 2UZ1A 4JH0A 1P4GA 2BDTA 4R8SA 2I7TA 3UO8B 4DTIA 5ILOA 2DPXA 1NJGA 2I78A 4H1HA 4C7MA 3HU3A 5JY1A 1OLXA 3JR7A 2JARA 1TK9A 5IKOA 4RD1A 2QSJA 2P5TB 4KBFA 4YJ2A 3K0AA 3OKPA 1KMQA 3KUKA 2AF3C 3CJQA 4ITVA 1G38A 2ZCUA 1IHPA 3UPDA 1KMHB 1NE2A 1SHJA 1A9QA 3B1WA 3FZNA 4ITRC 4NU0A 2XHEA 4QPCA 3L0OA 5IFKA 1G3MA 1Y42X 2DWOA 1OX6A 4PRZA 1N5RA 3MCVA 4ZEMA 1ML4A 3L01A 5TQJA 4DCVA 4TMXA 4BQQA 3F7TA 3K9NA 1SWVA 3MNFA 3QJYA 1T5HX 4D9MA 5JEEA 1FFHA 1NOIA 2DBZA 2PBRA 4HTFB 3HPQA 3PE6A 4FNOA 4FXPA 4TVBA 2EQBA 2A9KA 4TLDA 3WIUA 5BN1A 2D1YA 2P3OA 3K0FB 4LWOA 3G5AA 3PI7A 1Y1KE 3ZE7A 4D45A 4UULA 7YASA 1Z2CA 4KDRA 2ACVA 5IAJA 3JZMA 4B7ZA 4LC1A 1POWA 1TIPA 4BIIA 4RTMA 3OJCA 5FUQA 5L6MB 1UPTA 1GN9A 2CSXA 2VSOA 1JPJA 3I6QA 4B9EA 1EYZA 4RS4A 1XAJA 3RUHA 3A1TA 4C04A 4WOCA 1SAYA 5T8KA 1R0YA 2VAPA 3SAJA 3R3XA 1MPTA 2FZEA 1DC4A 1YQDA 1PHPA 2J7KA 1NUAA 2L19A 2SECE 3SYTA 3OZIA 3OZAA 3UW1A 3ZQKA 2Q28A 3IEXA 2HYDA 4EWLA 3ODGA 1E4VA 4IDDA 5GP1A 3W9BA 4ZO7A 2J9ZB 3IMCA 1D2MA 3JVIA 4IWNA 1FS6A 2OQRA 1P6XA 5JALA 5LYJB 1E1RD 4MKXA 4GI2A 2WKPA 4UHCA 3AJ9A 4JZYA 1NMYA 3FPLA 1GZVA 2VZ9A 3OWXA 3HN2A 3FFXA 3O83A 3BF7A 3OQ1A 4RA6A 4YUYA 3LT1A 1ZXXA 3IXQA 1VECA 2EL7A 3STXA 3B8EA 2D59A 3S55A 3L40A 4F5WA 1CUBA 2C57A 2EFEB 2V58A 2VDKB 3M82A 4RPIA 3TGWA 1L2TA 3WGGA 1KEKA 2HLDD 3BE4A 4C14A 2LNDA 2OILA 2QX7A 2VPTA 1MUUA 2BFPA 2POQX 2HA7A 1T1IA 4UXJA 3OLXA 3UKDA 4CYMA 3STTA 1MO4A 2J0UB 1RSZA 3AUJB 3CH5A 5C32A 1UXHA 4MDYA 1T9HA 3UV3A 1VPTA 1RAAA 2J7PD 3DAFA 4MYUA 1SBIA 4L0QA 4NH0A 1Z5VA 2EFJA 3EXFB 1GOTA 5KTRA 3L06A 4MX8A 5AJWA 1DKUA 1E1YA 5CVEA 3Q15C 1PIWA 1KPGA 2G36A 2ZG6A 3IQFA 5AESA 2INGX 3IVAA 3WL4A 1T4CA 5I3CA 1X0VA 1FIUA 4O2BF 3QLJA 3WL8A 4EHIA 2YS7A 3ZUGA 2L42A 3UAVA 3NHYA 4IOJA 4ZVMA 3WJ2A 1LPNA 2RIRA 1PBTA 3H8JA 4PG4A 4UUOA 3HA2A 4OQLA 2WSLA 1AGYA 4Q1DA 5F5NA 4IIGA 2W0MA 1N2BA 2VDLB 3TFQA 621PA 1EWKA 1G5HA 4UNSA 1Q14A 2IF0A 3PJGA 3AEXA 1WZNA 1W5SA 3NPMA 4IINA 4I3FA 4XSVA 4J0FA 3LYUA 5A3JA 2VP4A 3KOWA 4JL5A 4PEVA 5B7GA 1B1AA 4PYRA 3MMZA 3C5HA 1L1RA 2NUAA 4HDNB 2PXHA 4KO2S 5LLSA 3OA0A 1KP2A 3BK1A 3KOMA 4YCSA 1P0CA 2G1PA 2RCNA 3O8BA 4C01A 1ZC4A 3B53X 4EG6A 3GLGE 1AQYA 5CITA 3JTEA 3GJ7A 2CFTA 2IK8A 3DQPA 5I7WA 4DNQA 3QXJA 1E2KA 1R0SA 1O54A 1R4MB 2PT9A 3T52A 5IJ0A 1R6VA 1UWKA 4L5JA 1K9SA 4MWSA 1HG1A 4U6NA 3FW1A 5JI3E 3GLTA 2PJRA 2OXRA 2GJ9A 3MUOA 2QGZA 3A3YA 2X0DA 3Q3JB 3P9CA 4GI3A 4LMBA 3F7NA 4CI9A 3ZUPA 1ABFA 2AMFA 2J3EA 2E87A 2R60A 2CE2X 2ZVJA 1JR2A 3E1GA 1S2LA 3QEOA 4KQGA 4ZEOA 3T7DA 3H5NA 2O8FA 1TQ8A 1PKXA 2XZPA 4Y18A 5C5EA 3SYNA 4F9TA 1YU6A 4Y2SA 5SZHB 2CN1A 4RMIA 1UBEA 1LV7A 3FROA 4XSGA 3TH5A 1GL6A 4AY2A 2B3TA 4V0RA 1U7WA 2HK9A 1CQZA 1RMTA 4C5AA 2XLCA 4UZFA 3A7DA 2PAFA 2W2OA 3MT0A 3ME5A 4KQHA 5AQ1A 5F7XA 1A2QA 1KDOA 1ZITA 1SUEA 5BQ5A 4G01B 4MITA 3LQKA 2O3JA 3TDNA 2GBLC 2HQRA 5I7VA 2XH8A 4U7TB 2C7QA 1DZ3A 1J49A 4U7JA 2QM0A 3I6IA 4P4SA 3GMIA 1CERA 5E38A 1LTKA 3A9RA 2GH1A 3ROZA 3BTSA 1EWRA 1D0SA 2XGSA 3E3OA 4BMDA 4DJTA 3AHFA 1XDZA 2CNLA 2I55A 3T06B 5JROA 3TAUA 2QTTA 1CF4A 4X8HA 3IFSA 3IR7A 1V3UA 3CX7A 5DRTA 3TYXA 1RM5A 1SJ9A 4O4LF 4WOKA 5L3QB 3FVVA 1MVNA 3AF0A 5REQA 4JZKA 2PGDA 1NYTA 4NH4A 5B55A 5BUZA 2O7VA 2X23A 2FZWA 3CMCO 2EFYA 3GVCA 3PTLA 5E95A 2OC9A 3OJOA 2VHYA 4OMCA 1B93A 2WG2A 5IYZA 4R1LA 1NI4A 2BE9A 2MSCB 1NW7A 3X0DA 1QZTA 5B1HA 2V7PA 5BR1A 4DNOA 3DQZA 4DSTA 5B57C 3JWIA 1DXOA 3C5WP 4Y6GB 5EJMA 4ZOLB 3DAGA 2GA9A 4EA7A 3HDJA 1R4NB 2EG5A 2P35A 3UJPA 2O3TA 2B5OA 3LC0A 2XJ9A 1MQ9A 2BR5A 2VCEA 3RODA 4HNGA 2BFAA 3F78A 4OGFA 4HLDA 2JATA 4GKAA 3NOXA 1NN1A 4DLXA 1F1JA 4GU5A 4C0HA 4YRNA 3PL5A 1EQUA 1GL7A 3WJ1A 5K0SA 3R5KA 3SNHA 5L7WA 1W5EA 1WU8A 4RVUA 3S2YA 1JJ7A 3C3AA 4YRRA 1JKMA 3T0IA 5BN3A 5I47A 5L3RA 1DQPA 3UXYA 3ZKWB 1AQIA 3VR0A 2VAMA 2XCOA 2QAJA 2KQUA 4Q7QA 1N7JA 3CTPA 1RI4A 5HUQA 3TUZC 3EXHA 4Q00A 2QN8A 1U1FA 3QMVA 2C5SA 4JP2A 4ZT4A 1R8JA 1QQTA 3U7JA 3IQGX 4MV0A 1KI9A 4B75A 4E2XA 2WJZB 3H5AA 2FEKA 1R12A 4JCCA 3UWMA 5BSFA 5B7PA 1T4GA 3O4FA 1RIIA 3T3PB 3OZFA 3NG1A 1P2FA 2LZ0A 1XDSA 2NO0A 3ENZA 4GSYA 4I6GA 4E07A 3KQPA 1RZUA 3EG9B 2BZGA 3OEED 3DZJA 4PW0A 4YCLA 1EAYA 1L7AA 1SZDA 3BN3A 5AK4A 4RSRA 2M6LA 3RSCA 4DDHA 2FH5B 3P2YA 3WRWA 2EOAA 1IC6A 3BEDA 1RRGA 4LXIA 4BWYA 5DISB 2JBAA 2Q07A 2WPDA 3T7CA 1ZM7A 2D54A 5GTDA 5IM4F 2WQZA 2BSAA 4N6GA 2IPMA 3W8FA 4L8YA 6YASA 5DOZA 5J2UB 4RFLA 2WIKA 4JNCA 3EIFA 4R69A 5D7NA 4RVFA 4B79A 1PD1A 2N1BA 4E7OA 2DERA 1E5DA 5I9NA 3AU8A 2AR9A 3QXHA 2RGCA 1FU7A 2VJPA 4QT4A 3AIMA 1FU4A 1FVHA 4JB0A 3D6FA 1BU8A 4U9HS 3RCBA 1V11B 3QUQA 3EBPA 5GZ6A 4XD2A 2EGUA 5FPHA 1BHQ1 3THSA 2IQIA 4ZU1X 4YFVA 3VSEA 1W29A 4Y2GA 4K9MA 1L8XA 4GD3Q 4I8IA 5CB4B 3CN9A 5JC1A 4C2TA 3ZX4A 1T25A 3VKUA 3WWZA 2YS6A 2HF2A 1PZHA 3O91A 2P5YA 2IV3A 1F0PA 2YZ7A 3AX6A 4EHHA 1Z35A 2JJMA 1BCSB 3IJRA 1JDTA 2I4TA 1JWAB 1QE5A 2BD0A 1NSYA 3IUEA 3PXDA 5IUNC 2AOWA 3B1FA 1J0BA 3KWLA 3R7AA 4GOMD 4ZOLA 1I4EB 1OFUA 4A73A 4LGVA 1CZLA 3NWEA 4DM7A 2ZI6A 1JKJB 3IUBA 3NWJA 1SG0A 2E18A 4ETIA 3FVQA 3FR8A 4DDUA 1EVJA 2DWUA 2X2EA 2X5OA 4M8SA 3MQ2A 4MEAA 4R51A 4PC1A 5KJCA 1BVHA 2O50A 4FKZA 3GLHE 1Q7RA 3FI0A 3EQ2A 1ES9A 2OXTA 1JS1X 2VF2A 1N3BA 2JFOA 3LRTA 3VPCA 3KQSA 4C1NA 4P92A 3IYLW 4WMLA 4AY3A 1QQ5A 1C3OB 4WOPA 1JB1A 1EZ1A 1C3VA 2FN3A 1WDKA 2FRVA 2O7SA 3QF4B 1BS1A 3ZKWA 3K9FC 1M5RA 3O75A 2R48A 4EFMA 3PK0A 3QVUA 3C70A 1H2HA 1XE3A 2PJDA 1RJDA 3P9XA 3EXHB 4XVQA 1KYYA 4WRRA 5J3JA 1XX6A 4EL0A 1WOMA 2UZ3A 3BHJA 1CY2A 3F3SA 5BW6B 2WD8A 4ICIA 2IH4A 2VG8A 3B7PA 3E4CA 5KNDD 4XB2A 3RLFA 2XGMA 4I66A 1G8GA 3I9NA 2IV7A 1UC8A 2XE7A 3GD7A 3STWA 1RBZA 1YIDA 3LM8A 4UQOA 4UPVA 4BNFA 1LD3A 1U4SA 1H2WA 2HREA 3PPXA 2RGGA 1KAHA 4YLEA 1KPIA 4NAVA 3IILA 1TZCA 1YR1A 3FSRA 1US8A 2O8EA 4DCPA 2P4SA 1R6XA 3QG5A 3W6NA 3H7AA 3TTVA 4NCBA 1DELA 3QVGA 4ECEA 5ED4A 1OA1A 4C7XA 4CU2A 1XV5A 1I3NA 2PJUA 2BZ1A 3OTIA 3B9BA 1YJXA 1GZUA 3EGXB 4B7UA 5IG2A 1JZQA 3AIOA 2BH2A 1GAEO 2MYPA 3EFHA 1F14A 5DHSA 3A1FA 3RBAA 4Z4IA 3OHMA 5SYAA 3LNTA 3GP8A 5TLSA 3ZE9A 1NM5A 4M8KA 1C1DB 5K8IA 2OG2A 3F7OA 2NZYA 2PSEA 3OCVA 4YP7A 3U37A 2GCPA 1H0RA 1J99A 1SB8A 2MT9A 2NM0A 3ORYA 4NS4A 4C9BA 4TVSA 3ZC3A 5DASA 4ABYA 2X76A 1NXQA 3FYUC 5A5DA 2OO5C 3LBAA 5AJTA 4BNNA 3MILA 5AXBA 3W5HA 2ZVQX 2HJHA 3R3HA 3KSDO 1KU6A 3OCCA 3KCNA 2AFHB 2VT3A 4YWJA 4FWIB 1DB3A 1Q0ZA 2Z2XA 3PPVA 2ABWA 3GA0A 1ADBA 1NJ6A 1U94A 2GVNA 4F3CA 5E2AA 2TYSB 3KFXA 2V45A 4HB2A 1J7KA 3EUEA 5HK9A 3TDMA 5L8VA 1O96A 3VV3A 3UMMA 2COEA 1D8AA 4JBYA 1NVFA 1ZL2A 3ZGXA 3C6BA 2G76A 1OR8A 5AVRA 1WLSA 2PRIA 4LXGA 1OFHA 4Q9LA 1T0BA 3IXLA 3IDSA 2EFCB 3VYUB 1VI6A 4I1YA 1G9SA 4GOOD 5KBYA 5KIAA 3C6KA 5IM5A 2A0KA 2QD1A 1RCUA 4A8JA 4BRUA 1FNNA 3E9YA 3NTXA 1U3FA 3OU2A 5DK6A 1J2UA 4H59A 4LJYA 4YDQA 1MIHA 2IHYA 1ISFA 1MC5A 1FX0B 2YJ5A 1G6HA 4JUCA 5BORA 1NNI1 4H31A 2NP6A 2G40A 2DQKA 3EVZA 4XTRA 3PNMA 1DU4A 1JB9A 1V8OA 4KOEC 5I3ZA 2OBNA 4CR7A 2Q5CA 2QLLA 1Q95A 1B15A 3RC2A 2DWCA 1KIMA 3BMQA 3FOAA 2GHRA 3DJFA 3PUHA 5CRIA 3TL2A 4ARSA 2UYCA 4I1PA 1QRSA 4AAYA 5G1OA 2YY6A 1PBNA 2QVGA 2VNKA 3OFNA 3JYHA 3O9MA 4MGIR 4K28A 2NX2A 1G2OA 5EZQA 3JAKB 2DTDA 1ZD9A 3KSBC 1POXA 3ZXIA 1FRZA 3GG2A 3KSMA 2FVYA 2ZZKA 4M9RA 5I5GA 5UKDA 4JVNA 2WJVA 2JKZA 2Y6VA 4Y2VA 1US8B 4IUBS 3WGMA 2FEXA 1M1XB 3H99A 1E2LA 4YS6A 2RFLA 3AJEA 3EQ9A 3TRFA 4F92B 2AK2A 3A31A 2FEMA 1YRHA 3LGAA 2CL7X 3QI7A 1K5HA 1NXVA 4QFDA 1G17A 3SR0A 5JXHA 1C9KA 2VT7A 5CDHA 2A5DA 1NVVQ 4ND3A 1UAGA 2PH5A 1FL9A 2PH3A 3NHZA 3SBXA 2P0EA 3EOAI 1LY1A 1THGA 4ZI5A 3SJUA 1EUZA 3DP7A 4WKCA 1U3UA 4A1FA 4B9AA 5CT8A 3IT3A 3LFHA 4FGWA 5LM3A 1IB6A 3RU9A 1QM5A 5DI9A 1K9VF 5K0TA 1KQ3A 3HP7A 2Q1XA 1YA4A 4NP6A 4JYAB 1FK8A 4HNQA 3IOMA 2OUKA 4YBZA 4HUJA 4NDNE 3U7GA 2AF4C 2QTCA 2JLBA 4Z1OA 2UXCB 3Q7EA 2FOIA 4DMFA 3E6AA 1XJCA 4KSCA 2JIOA 2YJNA 5HQTA 3RYCB 1II9A 1BGXT 3EGCA 1R8XA 4C0KA 1RM4A 1RYFA 4WJZA 1TZMA 3GDOA 4LVUA 4ZYUA 3EXIA 3KBOA 3FCYA 5DTRA 2VCYA 1XN1A 3G0DA 5ALYA 2D7JA 1M10A 2O2SA 2G9NA 3RI3A 2C59A 4ZQCB 1XWFA 3BORA 1OA0A 4IDEA 1JFFB 2OUIA 3EFBA 2PFKA 1DBPA 1PQPA 3ESXA 1R0RE 3H8VA 3JZDA 5DP1A 1DMSA 4NZPA 4OB7A 3WJAA 1XMIA 3N2KA 4OU5A 2YBEA 1NVTA 4WA7A 5KWIA 5A4IS 3G13A 5CX1A 2G5TA 4UBNA 4HNVA 3OX4A 2ZAYA 2JAHA 2PKXA 5JNVA 1ICEA 1ZNXA 2AMVA 2FZLA 5HZMA 1AIPA 2C4HA 2DAPA 1PT7A 3GW8A 3HMQA 3FLEA 4C2AA 2WU4A 1VE1A 2WV9A 1O3YA 1QR6A 3EEQA 1I94B 1HYEA 3INNA 1C7IA 1XF1A 2G28A 5EYPB 5KOIA 4YDSA 2CJFA 4L76A 1N6HA 2ZSAA 1EVEA 4CIXA 3NC0C 3IAFA 3OPYA 1BGWA 2HFKA 4YCAA 5D1HA 1IAVA 1YGYA 3QVOA 2RBGA 3N58A 3WZMA 1NVMB 1CR0A 4GPAA 4X7PA 4XTCS 2HH9A 4CEJB 1L5FA 5LL6P 2ZPTX 4BMPB 3O90A 3EZ7A 1PFKA 2OYRA 2Q4TA 4G5XA 1CZOA 3RO7A 2O0JA 4RH0A 4LDZA 3TXAA 4CODB 1KJYA 1GITA 5FF9A 4HUQB 1EVIA 3ZZ1A 1C4KA 1A5ZA 2RGXA 3LQYA 3ZGNA 3ER8A 3JQCA 2AN3A 3MD9A 5KNBH 3ZJ4A 3ZCTA 3E2MA 4MYSA 1H8ED 4Q7EA 2CUKA 1ZM4A 1ZXLA 2V0NA 2X19A 4GR5A 3SI7A 5DN6D 4JVMA 1KYZA 5DHTA 3G1UA 1OXKB 1L8OA 1P5FA 3B20A 4U6SA 1LX6A 4JB3A 1DMRA 3ZE6A 2BKUA 4JCOA 5DEIA 3NJ8A 1Z2AA 3UANA 3V6MA 2B6HA 4KQ9A 1VPVA 4J0HA 4MA4A 4YT8A 1R1DA 1J9EA 4OMUA 4UNPA 1N0IA 4YV2A 3DMPA 3IXMA 3L8MA 4I1OA 4IHJB 3ZPXA 4CLRA 1G21B 4RF5A 3NI2A 3RKRA 3FSGD 3WTBA 3EXIB 3P4XA 4QBFA 3ZDCA 2HIHA 5D3ZA 4KRFA 4IDHA 2FZKA 3AGPA 3VVLA 2HTFA 1Q1ZA 1G3IA 3OOYA 3JVVA 3PC4A 2FI1A 2FFJA 4FS3A 2IEYA 4KQXA 4TZKA 1H2XA 1OXTA 2OCPA 2QR3A 4MRVA 4CKWB 1I5RA 1GFIA 1U9CA 4KLAA 4PLZA 4RMHA 4ACBA 1EFRA 4ZVPA 2BTEA 2NZ8A 2GPTA 3EZ6A 3QLUC 3H2ZA 1G2IA 1KZ9A 2CF6A 3ADCA 1XRRA 3UJ9A 1M1NB 2BFDB 4JC8A 3WLSA 1XVIA 4OQZA 2GEFA 5DX1A 3ASVA 4C30A 3A58B 2PMDA 3P45A 3QYFA 3NX4A 2W6ZA 3OE7A 3A6DA 4ND6A 4ECAA 1CRZA 1XCPA 3GLVA 2JFVA 4NFHA 5K8LA 2ARKA 4OHPA 5KVVA 3KUDA 3RAEC 1ND5A 1CVIA 2WD9A 3F6PA 4HQLA 2XUGA 3VJKA 3KSUA 4E70A 1UAAA 2Q9BA 4ZOCA 2F1HA 1H65A 1WSDA 3PDWA 5CXXA 1EEHA 2PVCA 3SEAA 5MN5A 4W5NA 2C0QA 3U9SA 1ZSYA 1SUDA 1JEAA 4KRYA 3PVCA 4U2CA 3QMWA 3IP7A 3WO1A 4DYVA 4TUYB 3M6UA 4QFCA 4EHKA 3FAKA 5KNLA 3U2QA 4DLLA 3U09A 3CVXA 3HI4A 3A1EA 4MR8B 1Z5NA 1YDHA 3LOPA 2O2EA 3BCSA 3HE3A 1ESEA 1ZUD1 1Z75A 1M9NA 3TX6A 5CR9A 1Z8FA 3FYDA 4X1IA 5LA6A 3ZJUA 3GEEA 3MS7A 2LCFA 4XYGA 3OQMA 1J2EA 1K75A 2QENA 3D8SA 1G8SA 2H2FA 1Y1LA 2FKAA 4GYYA 4E1AA 3NRBA 2QD5A 4K9NA 5EZYB 3U7QB 3GLGA 1ORRA 2GJ4A 4FFSA 3EF0A 3T9BA 1TT5A 4HH0A 2JJ1D 4Y6QA 1YI0A 4I6EA 3JWEA 4R8LA 3V8BA 4LBWA 4V3CA 1SD2A 1NMZA 5J4HA 3W5SA 5JLJA 4OSOA 1E77A 3SMVA 2HWKA 2X9NA 2H51A 1F6BA 1FUKA 3FCSB 1Y1SA 2JD0A 4G5YA 4O1IA 4M0PA 2A86A 4LV5B 5E6SA 2F1OA 1NQ5A 1P1BA 2SICE 1DZIA 3PV0A 4LYGA 1L5ZA 5B2EA 1KI6B 1EGQA 4GLOA 1UM8A 3O9VA 4PR3A 4TQUS 1XTPA 2R85A 2RI0A 4QU9A 4QVIA 4RGBA 3FHLA 3SE7A 1YS9A 3F9RA 1CUXA 3D4NA 1RAGA 1ZH4A 4QDOA 2CXNA 8LDHA 1RYMA 3H2KA 4L0MA 2FA9A 2DPYA 1HC7A 1I2BA 4AG3A 2W6CX 3I0MA 4Z2YA 1OV6A 2ZUUA 3P9SA 4I4TB 4QOSA 1E89A 4MYCA 3CNHA 4YP0A 2V5UA 2I2XB 4A16A 1BN6A 1JAIA 3DC2A 3G5TA 1KC3A 3P9KA 3IEPA 1FMCA 4N3BA 5LQSA 2BP7A 3EBLA 2XNDA 3JYPA 1TAGA 3QWFA 1MB2A 3AI2A 4YCBA 4A10A 3OC6A 3HJNA 2IPXA 2WIDA 2QRKA 3CN7A 1EP1B 1Q7CA 2DULA 4WINA 1WXQA 5AVXA 4RSMA 1CJSA 3TZEA 2X0IA 5J2TB 4D9KA 1F5SA 2PD4A 2W43A 4KPUB 3GD5A 3ZH9B 2ZR7A 4GKBA 4V0QA 1RWOA 4B6FA 2HRRA 2R8BA 1JF8A 4BZPA 4EPWA 2FGKA 3QUCA 4W1QA 4IEFB 4UFNA 1N2CE 4ZJPA 1EG2A 2G0TA 3C3DA 1DBIA 3H1TA 4KIJA 2K7FA 2G06A 4MVJD 4EPTA 2X2OA 3P9YA 1WAMA 1V95A 3W3AA 4ENSA 4ZDIA 3WDKA 1BCRA 1YB4A 2Q5FA 3UAZA 1UBNA 3ANXA 4PIPA 4XIYA 5DOVA 1XZMA 4YQEA 1E2PA 3ITNA 4REMA 4TUYA 4K9OA 2OM6A 5AKYA 4E31A 4TWZA 3UT0A 1IUNA 3VR3A 2JHGA 2Z8XA 1YQQA 1BXZA 4QYMA 1VA5A 2B9VA 4TXMA 3C6XA 3K6RA 3FTNA 4QUBA 1IPEA 1DINA 1PNVA 3KDAA 1NULA 2R66A 3FBWA 2IYZA 5T6BA 3ULKA 3CLTD 3OCXA 4YCJA 4ZWNA 1QQ6A 2GX6A 3DWFA 1JQ3A 1Y8RB 1VB5A 1DX4A 1JEQB 2GZSA 3LBNA 4IM7A 5E9QA 2X4DA 5LZ5A 1CE8B 3T5AA 2OCAA 4DV2B 2DG2A 5AIAA 3O8LA 3RS7A 1I32A 1RZRD 2Z6AA 2VZ8A 2J4FA 1CUAA 1UDBA 4UEWA 1W1WA 2J6HA 4N3AA 1LGYA 4RHYA 2NO4A 5LJIA 3UW3A 3KQVA 4RCYA 4JX9A 1L7RA 2H4JA 4J1TC 5CK4A 4MLPA 4V0KA 2GF9A 4FFPA 5F1KA 2FETA 4PYKA 3EZGA 4RKEA 2JPDA 5JWHA 2WMOB 2YWGA 4US0R 3H86A 1Q6YA 3WP0A 3N75A 5L6LB 1IUKA 1ORIA 3AQIA 3PX3A 4MWGA 4G5HA 1AX9A 3ZDDA 3W8EA 3BMCB 4LDPA 3A9WA 3RAJA 4EUHA 1I3KA 1CZHA 4EECA 4I81A 3R6LA 3EIWA 1KI6A 5C8XA 2Q1YA 5I7FA 4OV6B 2Q5LA 4B81A 4QYWA 2PL1A 4CLOB 4F4FA 3QWBA 5JW6A 1XZLA 2J3IA 5KI6A 3ONDA 4TT8A 3U5ZB 5KZMB 2HR1A 1XTUA 3B9PA 4PNHA 3IUSA 4EEZA 4EY7A 1A9ZA 1H3NA 4I9GA 1C0LA 5TPWA 5FT9A 1IUOA 2GESA 1J20A 4RZXA 5A4KA 4RK1A 1T2NA 3F73A 1U9YA 3BWVA 4ND8A 2V7TA 3G0OA 2NU7B 3LDAA 2CFRA 2VRCA 4DDTA 5JOQA 1AMNA 2XITA 3I1JA 3LHKA 3Q5DA 4OGKA 3SZGA 3UJ6A 2VHUA 3FCOA 3TNYA 2B21A 2VPYA 2D1FA 4KQEA 5E8RA 2Q7DA 1BFUA 1U9ZA 4RPLA 1GGKA 3OICA 3IERA 1KMMA 3SJ7A 1EFKA 2CUTA 2VP0A 2ZVPX 4X60A 3SOZA 1ZVQA 3TR0A 1GNPA 4LZJA 4UHBA 4XVUA 2XB2A 1XMQB 2QTGA 1KDVA 4H2DA 4ESHA 1ZRMA 4DL9A 3UWOA 1JLMA 2QVZX 4NMMA 3VVBA 4O02B 4ZAYA 3RU3A 5FO1A 5YASA 4XGKA 1VLJA 5DB4A 2V6BA 3AF1A 3WNCA 4BV3A 3X1WA 1BCRB 3D0QA 2D3TA 4TQGA 3R3JA 2FSPA 3RGWS 1CEXA 1QJCA 4BRSA 1HQKA 1M72A 2AI2A 4J43A 2V59A 1ENPA 4HXFB 3VO1A 4BO1A 2FW9A 5DBIA 1I0ZA 2HADA 3NLLA 1L5QA 1P61B 3LQ2A 4FSXA 1P7CA 4GP9A 5FFMA 3BMOA 3VTZA 2IX3A 2P9CA 3I9MA 4NC9A 3VTKA 4B43A 2O05A 3G2QA 4MWEA 1RJ9A 3SM3A 2PRSA 1H85A 3R5SA 2YHSA 3OIDA 2J3HA 3BUSA 3M6WA 1JIXA 2PPLA 2OGTA 2E4WA 4UMDA 1SVLA 3WJ7A 4D8WA 4ID3A 1AB6A 1KXZA 2XMZA 2RHLA 5EJ4A 3WSWA 1UOOA 2WF9A 4F2HA 3TRHA 3BE5A 3GFGA 4G1VA 4LTDA 1HZJA 1LZKA 1NQWA 2ST1A 3TPCA 3TQOA 2Z8ZA 4MS4A 2CXOA 4ASUD 1WW2A 4W7IA 1KI2A 2REXB 5F78A 3QEAZ 5A9TA 4R2IA 4RACA 1ESZA 2IZ5A 3NYQA 4TN5A 4CLXA 3U4QB 2VHQA 2DUUA 3N8IA 3VPXA 4AKHA 3G59A 5EZ5A 3DGFC 5AW5A 1RVV1 1U0RA 3O0TA 4UCWA 5K3DA 5LUAA 1T6BY 2NNWB 3NHBA 3AEKB 3I9KA 4BNYA 3OUZA 1T13A 4CCYA 4MRNA 3JPWA 1TUIA 2WP0A 1Z7BA 4CLOA 3LVQE 5CIWA 4BX8A 1Q44A 1Z36A 4R0VA 4DQ0A 3FPEA 3I52A 2YBDA 3KUUA 3U56A 5ALXA 3V7UA 2WM3A 4JI6B 4LF5B 2W6MA 4D4HA 2DT5A 5TPWB 3CVWA 3OX3A 2R11A 2FZGA 3AY3A 3ROQA 1E18A