1ANNA

Annexin iv
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
GGTVKAASGFNAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN IV
publication title Three Dimensional Structure of Annexin IV
rcsb
molecule tags Calcium/phospholipid-binding protein
total genus 125
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 1995-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1annA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1annA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1annA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1annA03
2II2A 2IICA 1G5NA 1A8BA 1W7BA 2H0LA 2IE7A 1SAVA 1AVCA 1XJLA 1W45A 2IE6A 1YJ0A 1BC3A 2XO3A 4EVHA 1YCNA 1YIIA 2Q4CA 1N44A 2HYUA 4MDVA 4EVFA 1N41A 1HVDA 1HVEA 2HYVA 1M9IA 1AXNA 1ANNA 2HYWA 1HVFA 1BCZA 1HM6A 2ZHIA 3BRXA 4X9PA 1BCYA 1AOWA 1AVRA 1HAKA 1I4AA 1AIIA 1DK5A 1HVGA 2H0MA 2RANA 2H0KA 1ALAA 4MDUA 1BCWA 1AEIA 1BC1A 1N00A 1BO9A 1W3WA 2ZHJA 2XO2A 1ANWA 1AVHA 4HREA 1A8AA 1DM5A 2ZOCA 1BC0A 1MCXA 1N42A 1ANXA
chains in the Genus database with same CATH superfamily
2IICA 1A8BA 2IE7A 3L8NA 1XJLA 1W45A 3AJCA 4FQ0C 4JMIA 3SWVA 3SOHB 1YIIA 2Q4CA 4MDVA 2VXGA 1N41A 1C1KA 3ANYA 1HVDA 2HYVA 1M9IA 4OIYA 1ANNA 2HYWA 3BRXA 1BCZA 1BCYA 1AOWA 2RANA 1DK5A 3TW5A 1ALAA 1BCWA 1BC1A 3LTLA 1BC9A 3HJLA 2ZHJA 2ZOCA 2QEZA 4A4PA 2II2A 4D7QA 4KN7X 2IE6A 1YJ0A 4Z21A 1BC3A 1S9DE 4EVFA 1KU1A 1R4AE 1XT0B 1R8SE 2ZHIA 1RE0B 1AVRA 1I4AA 1AIIA 4KN4X 1AEIA 2XO2A 4FHRB 1A8AA 1DM5A 3USWA 1LKVX 1PBVA 3ABOA 1XSZA 1SAVA 1AVCA 4L5MA 2R09A 2XO3A 4C7PA 1HVEA 1AXNA 1HVFA 4X9PA 1HAKA 3AO0A 1R8QE 4MDUA 1N00A 1BO9A 4JMOA 1W3WA 3ABSA 1MCXA 1QC7A 2OY9A 1ANXA 4JK1X 1G5NA 1W7BA 2H0LA 4D7RA 2K6XA 4KMUX 4EVHA 1YCNA 4JXHA 1N44A 2HYUA 3USYA 1HM6A 1R8ME 2H0MA 1HVGA 2R0DA 4JWLA 2H0KA 3ABQA 4Q2SA 2HSNA 4C0AA 1UPTB 3ABRA 1ANWA 1AVHA 4HREA 1Q8DA 1BC0A 1N42A 1YGMA
chains in the Genus database with same CATH topology
2II2A 2IICA 1G5NA 1A8BA 1W7BA 2H0LA 2IE7A 1SAVA 1AVCA 1XJLA 1W45A 2IE6A 1YJ0A 1BC3A 2XO3A 4EVHA 1YCNA 1YIIA 2Q4CA 1N44A 2HYUA 4MDVA 4EVFA 1N41A 1HVDA 1HVEA 2HYVA 1M9IA 1AXNA 1ANNA 2HYWA 1HVFA 1BCZA 1HM6A 2ZHIA 3BRXA 4X9PA 1BCYA 1AOWA 1AVRA 1HAKA 1I4AA 1AIIA 1DK5A 1HVGA 2H0MA 2RANA 2H0KA 1ALAA 4MDUA 1BCWA 1AEIA 1BC1A 1N00A 1BO9A 1W3WA 2ZHJA 2XO2A 1ANWA 1AVHA 4HREA 1A8AA 1DM5A 2ZOCA 1BC0A 1MCXA 1N42A 1ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II2 A;  2IIC A;  1G5N A;  1A8B A;  1W7B A;  2H0L A;  2IE7 A;  1SAV A;  1AVC A;  1XJL A;  1W45 A;  2IE6 A;  1YJ0 A;  1BC3 A;  2XO3 A;  4EVH A;  1YCN A;  1YII A;  2Q4C A;  1N44 A;  2HYU A;  4MDV A;  4EVF A;  1N41 A;  1HVD A;  1HVE A;  2HYV A;  1M9I A;  1AXN A;  1ANN A;  2HYW A;  1HVF A;  1BCZ A;  1HM6 A;  2ZHI A;  3BRX A;  4X9P A;  1BCY A;  1AOW A;  1AVR A;  1HAK A;  1I4A A;  1AII A;  1DK5 A;  1HVG A;  2H0M A;  2RAN A;  2H0K A;  1ALA A;  4MDU A;  1BCW A;  1AEI A;  1BC1 A;  1N00 A;  1BO9 A;  1W3W A;  2ZHJ A;  2XO2 A;  1ANW A;  1AVH A;  4HRE A;  1A8A A;  1DM5 A;  2ZOC A;  1BC0 A;  1MCX A;  1N42 A;  1ANX A; 
#chains in the Genus database with same CATH topology
 2IIC A;  1A8B A;  2IE7 A;  3L8N A;  1XJL A;  1W45 A;  3AJC A;  4FQ0 C;  4JMI A;  3SWV A;  3SOH B;  1YII A;  2Q4C A;  4MDV A;  2VXG A;  1N41 A;  1C1K A;  3ANY A;  1HVD A;  2HYV A;  1M9I A;  4OIY A;  1ANN A;  2HYW A;  3BRX A;  1BCZ A;  1BCY A;  1AOW A;  2RAN A;  1DK5 A;  3TW5 A;  1ALA A;  1BCW A;  1BC1 A;  3LTL A;  1BC9 A;  3HJL A;  2ZHJ A;  2ZOC A;  2QEZ A;  4A4P A;  2II2 A;  4D7Q A;  4KN7 X;  2IE6 A;  1YJ0 A;  4Z21 A;  1BC3 A;  1S9D E;  4EVF A;  1KU1 A;  1R4A E;  1XT0 B;  1R8S E;  2ZHI A;  1RE0 B;  1AVR A;  1I4A A;  1AII A;  4KN4 X;  1AEI A;  2XO2 A;  4FHR B;  1A8A A;  1DM5 A;  3USW A;  1LKV X;  1PBV A;  3ABO A;  1XSZ A;  1SAV A;  1AVC A;  4L5M A;  2R09 A;  2XO3 A;  4C7P A;  1HVE A;  1AXN A;  1HVF A;  4X9P A;  1HAK A;  3AO0 A;  1R8Q E;  4MDU A;  1N00 A;  1BO9 A;  4JMO A;  1W3W A;  3ABS A;  1MCX A;  1QC7 A;  2OY9 A;  1ANX A;  4JK1 X;  1G5N A;  1W7B A;  2H0L A;  4D7R A;  2K6X A;  4KMU X;  4EVH A;  1YCN A;  4JXH A;  1N44 A;  2HYU A;  3USY A;  1HM6 A;  1R8M E;  2H0M A;  1HVG A;  2R0D A;  4JWL A;  2H0K A;  3ABQ A;  4Q2S A;  2HSN A;  4C0A A;  1UPT B;  3ABR A;  1ANW A;  1AVH A;  4HRE A;  1Q8D A;  1BC0 A;  1N42 A;  1YGM A; 
#chains in the Genus database with same CATH homology
 2II2 A;  2IIC A;  1G5N A;  1A8B A;  1W7B A;  2H0L A;  2IE7 A;  1SAV A;  1AVC A;  1XJL A;  1W45 A;  2IE6 A;  1YJ0 A;  1BC3 A;  2XO3 A;  4EVH A;  1YCN A;  1YII A;  2Q4C A;  1N44 A;  2HYU A;  4MDV A;  4EVF A;  1N41 A;  1HVD A;  1HVE A;  2HYV A;  1M9I A;  1AXN A;  1ANN A;  2HYW A;  1HVF A;  1BCZ A;  1HM6 A;  2ZHI A;  3BRX A;  4X9P A;  1BCY A;  1AOW A;  1AVR A;  1HAK A;  1I4A A;  1AII A;  1DK5 A;  1HVG A;  2H0M A;  2RAN A;  2H0K A;  1ALA A;  4MDU A;  1BCW A;  1AEI A;  1BC1 A;  1N00 A;  1BO9 A;  1W3W A;  2ZHJ A;  2XO2 A;  1ANW A;  1AVH A;  4HRE A;  1A8A A;  1DM5 A;  2ZOC A;  1BC0 A;  1MCX A;  1N42 A;  1ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...