1ANWA

The effect of metal binding on the structure of annexin v and implications for membrane binding
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
319
structure length
319
Chain Sequence
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title The effect of metal binding on the structure of annexin V and implications for membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid-binding protein
total genus 124
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anwA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anwA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anwA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anwA03
1BC3A 2HYVA 1SAVA 1AXNA 1YJ0A 2HYWA 1W45A 1I4AA 1N44A 1G5NA 2ZHJA 1HAKA 2IICA 2H0MA 1N00A 1XJLA 1BCWA 4X9PA 2HYUA 1DK5A 1ANWA 1W7BA 1AVCA 1HVDA 1BCYA 1AOWA 1A8AA 2IE7A 4EVHA 1HVEA 2XO2A 1YIIA 1A8BA 1MCXA 1AEIA 1DM5A 2Q4CA 2H0LA 1HM6A 4MDVA 2ZOCA 1BCZA 3BRXA 2RANA 2ZHIA 1W3WA 1BO9A 2IE6A 1N41A 1ALAA 2II2A 2XO3A 1AVRA 1YCNA 1HVGA 1ANNA 2H0KA 4MDUA 1HVFA 4EVFA 1ANXA 1AVHA 1M9IA 1N42A 4HREA 1BC0A 1BC1A 1AIIA
chains in the Genus database with same CATH superfamily
2HYVA 1Q8DA 1AXNA 3AJCA 4HREA 2IICA 1N00A 1R8QE 3SWVA 1BCWA 1R8ME 4X9PA 1ANWA 1HVDA 1KU1A 1AOWA 4EVHA 1HVEA 2HSNA 3HJLA 4Q2SA 1YIIA 4KN4X 2R0DA 3ABQA 2OY9A 2II2A 1N41A 2XO3A 3USWA 1AVRA 3USYA 1ANXA 3TW5A 1R4AE 3ABRA 4OIYA 1AIIA 4JXHA 2HYWA 1W45A 2ZHJA 1S9DE 3ABSA 1XJLA 1BC9A 1YGMA 2VXGA 2IE7A 4JWLA 1A8BA 2H0LA 1HM6A 2ZOCA 1BCZA 3BRXA 2RANA 1BO9A 1XT0B 4Z21A 1XSZA 2H0KA 1RE0B 1HVFA 1AVHA 3LTLA 1M9IA 4FHRB 1BC0A 3L8NA 2ZHIA 1YJ0A 1I4AA 1N44A 2H0MA 2HYUA 4L5MA 2R09A 2XO2A 1C1KA 2Q4CA 1PBVA 4JMOA 4D7QA 1W3WA 4KN7X 3SOHB 1ANNA 4MDUA 4EVFA 1BC1A 1BC3A 4D7RA 1SAVA 4JMIA 1G5NA 1HAKA 3ANYA 3ABOA 4C0AA 1DK5A 1W7BA 1AVCA 4KMUX 4A4PA 1BCYA 4JK1X 1A8AA 2K6XA 2QEZA 4C7PA 1MCXA 1AEIA 1DM5A 1LKVX 3AO0A 4MDVA 4FQ0C 1R8SE 2IE6A 1ALAA 1YCNA 1HVGA 1UPTB 1N42A 1QC7A
chains in the Genus database with same CATH topology
1BC3A 2HYVA 1SAVA 1AXNA 1YJ0A 2HYWA 1W45A 1I4AA 1N44A 1G5NA 2ZHJA 1HAKA 2IICA 2H0MA 1N00A 1XJLA 1BCWA 4X9PA 2HYUA 1DK5A 1ANWA 1W7BA 1AVCA 1HVDA 1BCYA 1AOWA 1A8AA 2IE7A 4EVHA 1HVEA 2XO2A 1YIIA 1A8BA 1MCXA 1AEIA 1DM5A 2Q4CA 2H0LA 1HM6A 4MDVA 2ZOCA 1BCZA 3BRXA 2RANA 2ZHIA 1W3WA 1BO9A 2IE6A 1N41A 1ALAA 2II2A 2XO3A 1AVRA 1YCNA 1HVGA 1ANNA 2H0KA 4MDUA 1HVFA 4EVFA 1ANXA 1AVHA 1M9IA 1N42A 4HREA 1BC0A 1BC1A 1AIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BC3 A;  2HYV A;  1SAV A;  1AXN A;  1YJ0 A;  2HYW A;  1W45 A;  1I4A A;  1N44 A;  1G5N A;  2ZHJ A;  1HAK A;  2IIC A;  2H0M A;  1N00 A;  1XJL A;  1BCW A;  4X9P A;  2HYU A;  1DK5 A;  1ANW A;  1W7B A;  1AVC A;  1HVD A;  1BCY A;  1AOW A;  1A8A A;  2IE7 A;  4EVH A;  1HVE A;  2XO2 A;  1YII A;  1A8B A;  1MCX A;  1AEI A;  1DM5 A;  2Q4C A;  2H0L A;  1HM6 A;  4MDV A;  2ZOC A;  1BCZ A;  3BRX A;  2RAN A;  2ZHI A;  1W3W A;  1BO9 A;  2IE6 A;  1N41 A;  1ALA A;  2II2 A;  2XO3 A;  1AVR A;  1YCN A;  1HVG A;  1ANN A;  2H0K A;  4MDU A;  1HVF A;  4EVF A;  1ANX A;  1AVH A;  1M9I A;  1N42 A;  4HRE A;  1BC0 A;  1BC1 A;  1AII A; 
#chains in the Genus database with same CATH topology
 2HYV A;  1Q8D A;  1AXN A;  3AJC A;  4HRE A;  2IIC A;  1N00 A;  1R8Q E;  3SWV A;  1BCW A;  1R8M E;  4X9P A;  1ANW A;  1HVD A;  1KU1 A;  1AOW A;  4EVH A;  1HVE A;  2HSN A;  3HJL A;  4Q2S A;  1YII A;  4KN4 X;  2R0D A;  3ABQ A;  2OY9 A;  2II2 A;  1N41 A;  2XO3 A;  3USW A;  1AVR A;  3USY A;  1ANX A;  3TW5 A;  1R4A E;  3ABR A;  4OIY A;  1AII A;  4JXH A;  2HYW A;  1W45 A;  2ZHJ A;  1S9D E;  3ABS A;  1XJL A;  1BC9 A;  1YGM A;  2VXG A;  2IE7 A;  4JWL A;  1A8B A;  2H0L A;  1HM6 A;  2ZOC A;  1BCZ A;  3BRX A;  2RAN A;  1BO9 A;  1XT0 B;  4Z21 A;  1XSZ A;  2H0K A;  1RE0 B;  1HVF A;  1AVH A;  3LTL A;  1M9I A;  4FHR B;  1BC0 A;  3L8N A;  2ZHI A;  1YJ0 A;  1I4A A;  1N44 A;  2H0M A;  2HYU A;  4L5M A;  2R09 A;  2XO2 A;  1C1K A;  2Q4C A;  1PBV A;  4JMO A;  4D7Q A;  1W3W A;  4KN7 X;  3SOH B;  1ANN A;  4MDU A;  4EVF A;  1BC1 A;  1BC3 A;  4D7R A;  1SAV A;  4JMI A;  1G5N A;  1HAK A;  3ANY A;  3ABO A;  4C0A A;  1DK5 A;  1W7B A;  1AVC A;  4KMU X;  4A4P A;  1BCY A;  4JK1 X;  1A8A A;  2K6X A;  2QEZ A;  4C7P A;  1MCX A;  1AEI A;  1DM5 A;  1LKV X;  3AO0 A;  4MDV A;  4FQ0 C;  1R8S E;  2IE6 A;  1ALA A;  1YCN A;  1HVG A;  1UPT B;  1N42 A;  1QC7 A; 
#chains in the Genus database with same CATH homology
 1BC3 A;  2HYV A;  1SAV A;  1AXN A;  1YJ0 A;  2HYW A;  1W45 A;  1I4A A;  1N44 A;  1G5N A;  2ZHJ A;  1HAK A;  2IIC A;  2H0M A;  1N00 A;  1XJL A;  1BCW A;  4X9P A;  2HYU A;  1DK5 A;  1ANW A;  1W7B A;  1AVC A;  1HVD A;  1BCY A;  1AOW A;  1A8A A;  2IE7 A;  4EVH A;  1HVE A;  2XO2 A;  1YII A;  1A8B A;  1MCX A;  1AEI A;  1DM5 A;  2Q4C A;  2H0L A;  1HM6 A;  4MDV A;  2ZOC A;  1BCZ A;  3BRX A;  2RAN A;  2ZHI A;  1W3W A;  1BO9 A;  2IE6 A;  1N41 A;  1ALA A;  2II2 A;  2XO3 A;  1AVR A;  1YCN A;  1HVG A;  1ANN A;  2H0K A;  4MDU A;  1HVF A;  4EVF A;  1ANX A;  1AVH A;  1M9I A;  1N42 A;  4HRE A;  1BC0 A;  1BC1 A;  1AII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...