1ANXA

The crystal structure of a new high-calcium form of annexin v
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
316
structure length
316
Chain Sequence
QVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title The crystal structure of a new high-calcium form of annexin V.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid-binding protein
total genus 128
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anxA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anxA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anxA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1anxA03
4EVHA 1SAVA 1ALAA 2ZHJA 1BCYA 2IE7A 1MCXA 1A8BA 2IICA 1G5NA 2XO3A 1BCWA 1AXNA 1I4AA 1HVFA 2H0KA 4MDUA 1AVRA 1YIIA 2IE6A 1HVDA 2Q4CA 1ANXA 1AVCA 1BCZA 2RANA 1N42A 2ZHIA 1BC3A 2HYUA 1AEIA 1YJ0A 1A8AA 1M9IA 1BO9A 1DM5A 1BC1A 1ANNA 1HVGA 1N41A 1XJLA 1YCNA 1BC0A 2H0MA 4HREA 1HVEA 4EVFA 2XO2A 1HM6A 1N00A 2HYVA 2ZOCA 1W3WA 1N44A 1HAKA 1DK5A 2II2A 1ANWA 1W7BA 1W45A 3BRXA 1AIIA 4X9PA 1AOWA 2H0LA 1AVHA 4MDVA 2HYWA
chains in the Genus database with same CATH superfamily
1BCYA 2IE7A 1R8QE 4X9PA 1A8BA 1BCWA 3ABOA 1HVDA 2Q4CA 1UPTB 1AVCA 2RANA 1N42A 4D7QA 1BC3A 1RE0B 3HJLA 1A8AA 1M9IA 3ABQA 1XJLA 3LTLA 4EVFA 4KN4X 2QEZA 1YGMA 4JWLA 1DK5A 1QC7A 1W7BA 1S9DE 3ABSA 3BRXA 4Q2SA 1PBVA 4MDUA 4JMIA 1AOWA 2H0LA 1AVHA 3ANYA 4EVHA 1SAVA 1R8ME 4C7PA 1ALAA 4FHRB 2IICA 1I4AA 1HVFA 1LKVX 4JXHA 1BCZA 2ZHIA 3L8NA 1YJ0A 1XSZA 3AO0A 3USWA 1ANNA 1N41A 2XO2A 1HM6A 2HYVA 1R4AE 1ANWA 3USYA 1AIIA 3SWVA 4KN7X 4JMOA 1MCXA 2XO3A 3SOHB 1AVRA 2IE6A 1ANXA 4D7RA 2HSNA 2HYUA 4KMUX 1BO9A 1BC1A 2H0MA 1BC0A 1HVEA 1N00A 2ZOCA 4JK1X 1W3WA 2VXGA 2II2A 2R0DA 3AJCA 1W45A 2OY9A 1KU1A 4Z21A 2K6XA 3ABRA 4MDVA 2HYWA 4C0AA 2R09A 2ZHJA 1G5NA 1AXNA 2H0KA 1YIIA 4A4PA 4OIYA 1R8SE 1Q8DA 3TW5A 1AEIA 1DM5A 1HVGA 1C1KA 1YCNA 4HREA 4L5MA 4FQ0C 1N44A 1XT0B 1BC9A 1HAKA
chains in the Genus database with same CATH topology
4EVHA 1SAVA 1ALAA 2ZHJA 1BCYA 2IE7A 1MCXA 1A8BA 2IICA 1G5NA 2XO3A 1BCWA 1AXNA 1I4AA 1HVFA 2H0KA 4MDUA 1AVRA 1YIIA 2IE6A 1HVDA 2Q4CA 1ANXA 1AVCA 1BCZA 2RANA 1N42A 2ZHIA 1BC3A 2HYUA 1AEIA 1YJ0A 1A8AA 1M9IA 1BO9A 1DM5A 1BC1A 1ANNA 1HVGA 1N41A 1XJLA 1YCNA 1BC0A 2H0MA 4HREA 1HVEA 4EVFA 2XO2A 1HM6A 1N00A 2HYVA 2ZOCA 1W3WA 1N44A 1HAKA 1DK5A 2II2A 1ANWA 1W7BA 1W45A 3BRXA 1AIIA 4X9PA 1AOWA 2H0LA 1AVHA 4MDVA 2HYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVH A;  1SAV A;  1ALA A;  2ZHJ A;  1BCY A;  2IE7 A;  1MCX A;  1A8B A;  2IIC A;  1G5N A;  2XO3 A;  1BCW A;  1AXN A;  1I4A A;  1HVF A;  2H0K A;  4MDU A;  1AVR A;  1YII A;  2IE6 A;  1HVD A;  2Q4C A;  1ANX A;  1AVC A;  1BCZ A;  2RAN A;  1N42 A;  2ZHI A;  1BC3 A;  2HYU A;  1AEI A;  1YJ0 A;  1A8A A;  1M9I A;  1BO9 A;  1DM5 A;  1BC1 A;  1ANN A;  1HVG A;  1N41 A;  1XJL A;  1YCN A;  1BC0 A;  2H0M A;  4HRE A;  1HVE A;  4EVF A;  2XO2 A;  1HM6 A;  1N00 A;  2HYV A;  2ZOC A;  1W3W A;  1N44 A;  1HAK A;  1DK5 A;  2II2 A;  1ANW A;  1W7B A;  1W45 A;  3BRX A;  1AII A;  4X9P A;  1AOW A;  2H0L A;  1AVH A;  4MDV A;  2HYW A; 
#chains in the Genus database with same CATH topology
 1BCY A;  2IE7 A;  1R8Q E;  4X9P A;  1A8B A;  1BCW A;  3ABO A;  1HVD A;  2Q4C A;  1UPT B;  1AVC A;  2RAN A;  1N42 A;  4D7Q A;  1BC3 A;  1RE0 B;  3HJL A;  1A8A A;  1M9I A;  3ABQ A;  1XJL A;  3LTL A;  4EVF A;  4KN4 X;  2QEZ A;  1YGM A;  4JWL A;  1DK5 A;  1QC7 A;  1W7B A;  1S9D E;  3ABS A;  3BRX A;  4Q2S A;  1PBV A;  4MDU A;  4JMI A;  1AOW A;  2H0L A;  1AVH A;  3ANY A;  4EVH A;  1SAV A;  1R8M E;  4C7P A;  1ALA A;  4FHR B;  2IIC A;  1I4A A;  1HVF A;  1LKV X;  4JXH A;  1BCZ A;  2ZHI A;  3L8N A;  1YJ0 A;  1XSZ A;  3AO0 A;  3USW A;  1ANN A;  1N41 A;  2XO2 A;  1HM6 A;  2HYV A;  1R4A E;  1ANW A;  3USY A;  1AII A;  3SWV A;  4KN7 X;  4JMO A;  1MCX A;  2XO3 A;  3SOH B;  1AVR A;  2IE6 A;  1ANX A;  4D7R A;  2HSN A;  2HYU A;  4KMU X;  1BO9 A;  1BC1 A;  2H0M A;  1BC0 A;  1HVE A;  1N00 A;  2ZOC A;  4JK1 X;  1W3W A;  2VXG A;  2II2 A;  2R0D A;  3AJC A;  1W45 A;  2OY9 A;  1KU1 A;  4Z21 A;  2K6X A;  3ABR A;  4MDV A;  2HYW A;  4C0A A;  2R09 A;  2ZHJ A;  1G5N A;  1AXN A;  2H0K A;  1YII A;  4A4P A;  4OIY A;  1R8S E;  1Q8D A;  3TW5 A;  1AEI A;  1DM5 A;  1HVG A;  1C1K A;  1YCN A;  4HRE A;  4L5M A;  4FQ0 C;  1N44 A;  1XT0 B;  1BC9 A;  1HAK A; 
#chains in the Genus database with same CATH homology
 4EVH A;  1SAV A;  1ALA A;  2ZHJ A;  1BCY A;  2IE7 A;  1MCX A;  1A8B A;  2IIC A;  1G5N A;  2XO3 A;  1BCW A;  1AXN A;  1I4A A;  1HVF A;  2H0K A;  4MDU A;  1AVR A;  1YII A;  2IE6 A;  1HVD A;  2Q4C A;  1ANX A;  1AVC A;  1BCZ A;  2RAN A;  1N42 A;  2ZHI A;  1BC3 A;  2HYU A;  1AEI A;  1YJ0 A;  1A8A A;  1M9I A;  1BO9 A;  1DM5 A;  1BC1 A;  1ANN A;  1HVG A;  1N41 A;  1XJL A;  1YCN A;  1BC0 A;  2H0M A;  4HRE A;  1HVE A;  4EVF A;  2XO2 A;  1HM6 A;  1N00 A;  2HYV A;  2ZOC A;  1W3W A;  1N44 A;  1HAK A;  1DK5 A;  2II2 A;  1ANW A;  1W7B A;  1W45 A;  3BRX A;  1AII A;  4X9P A;  1AOW A;  2H0L A;  1AVH A;  4MDV A;  2HYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...