1AOIA

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 1997-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiA00
4X23C 5B2JB 4Z5TD 1ZLAA 4NFTA 5B1MB 1AOIC 2BYMB 3W97A 5DNMA 3MGRB 1HQ3B 4JJNA 5AVBC 1B67A 3O62B 2PYOC 1S32C 4LD9B 1TZYD 2F8NB 3KWQB 3KXBA 3AZMC 3AZEA 5AV8A 5GT0A 4WNNA 5CPJC 5E5AB 1M19A 5DNNB 3W98A 3VH6W 3B0CT 1BH8B 3LJAD 1P3GC 5B0YD 4J8VA 3AZNA 5GXQD 4R8PD 3A6NA 3REID 1P3KC 3B6FC 4NE6A 1P3BC 1EQZB 4CSRB 1F66A 3WTPA 1P3AC 4J8UD 3X1VD 3MNNB 3WA9B 4XUJD 4KGCC 3VH5A 5F99B 1M1AA 3AZIB 3UT9C 5B1LB 3UTBB 5CPIA 4G92C 2AROB 3MGPD 1KX3B 4J8XD 1KU5A 5AV5B 5B24D 2HIOA 3X1TC 4ZUXA 1KX4B 4X23D 2NQBA 4YS3C 4NE3A 5FUGA 4Z5TB 4Z66A 4WU8D 1AOID 3AZJD 2FJ7B 1P3MA 5AVBD 3KUYA 5CP6A 2PYOD 5CPKA 5JRGC 1TAFA 3TU4A 1TZYB 5B32D 4KHAB 3C1BA 5B31A 3W96A 4J8WC 1P3LA 5CPJD 5AY8A 5GT3A 3NQUB 4XZQC 5BNXA 4CAYA 5B2IA 3X1UC 1P3GD 3LJAB 3R45B 5B0YB 5GXQB 4R8PB 3MGSA 3REIB 3AZGB 5BO0B 1P3KD 3B6FD 1P3BD 1ZLAC 3NQJB 1P3AD 3W97C 5DNMC 1A7WA 4J8UB 3B6GA 1BH9B 4XUJB 1P34B 4YM6D 3REKD 1H3OB 3UT9D 3MVDD 5C3IB 2BYKA 5BS7C 5B31G 4H9QB 5AV8C 3AZEC 5GT0C 4ZBJB 3C1CA 3MGPB 5AV6D 4WU9D 4J8XB 4EO5B 5B24B 2IO5C 3W98C 3AZFB 5B2JA 4X23B 4YS3D 5B1MA 5AV9C 3A6NC 2BYMA 3B0DB 4WU8B 5B40C 1HQ3A 1AOIB 3X1SD 2HUEC 4HGAC 3AFAB 3AZJB 1P3OC 3O62A 1F66C 5AVBB 3AZKD 3WTPC 4LD9A 1KX5D 3AYWD 2F8NA 2PYOB 3KWQA 4KUDB 5B32B 4G91B 4H9SA 3V9RB 4J8WD 1U35B 1P3IA 1M1AC 4NE5A 5E5AA 5CPJB 4XZQD 4UUZB 1R4VA 5B33D 3LZ0D 1BH8A 3X1UD 3AZHC 5CPIC 1P3GB 3VH5W 2HIOC 4ZUXC 2NQBC 3LZ1D 2RVQD 1EQZA 3B6FB 1P3BB 3WAAD 4Z66C 3AN2D 1P3AB 3W97D 3MNNA 3WA9A 4E45A 3KUYC 5F99A 5CP6C 3AZLA 5CPKC 4YM6B 2F8NG 3AZIA 5B1LA 3REKB 3UT9B 3UTBA 3MVDB 3UTAA 3AZED 2AROA 1P3LC 1KX3A 5B0ZB 4QLCC 5AV5A 5GT3C 1KX4A 2NZDB 5AV6B 4WU9B 5AVCA 4YS3B 4E44A 5B40D 5AV9D 1P3PD 1ID3D 2FJ7A 5JA4B 1P3OD 3X1SB 3WKJB 3LELC 3REHB 3WTPD 3RELD 3AZKB 1KX5B 3AYWB 3VH6T 4DRBA 3REJC 3B6GC 4KHAA 4J8WB 2CV5A 1M1AD 3NQUA 4XZQB 4WV4B 3AZHD 5B33B 3LZ0B 5CPID 2F8NK 3X1UB 3R45A 5B0YA 1M18C 5GXQA 4ZUXD 4R8PA 3REIA 3AZGA 5BO0A 2NQBD 5B2JC 3LZ1B 5B1MC 4Z66D 3NQJA 3AV1C 3WAAB 3AN2B 1JFIB 5GSUC 3W97B 4H9NB 3AV2A 1BH9A 3KUYD 3MGQA 1P34A 5CHLB 5CPKD 4LD9C 1S32D 1H3OA 1P3FC 3AZMD 4H9SC 4H9QA 1P3IC 1N1JB 1P3LD 3AZEB 4QLCD 3MGPA 5GT3D 4J8XA 1HTAA 5B24A 3W99C 3AZFA 4X23A 4WU8A 1AOIA 3MGQC 1P3PB 5B40B 5AV9B 3AZJA 1ID3B 3AFAA 1EQZC 4HGAB 5AVBA 1P3OB 3LELD 4H9OB 2PYOA 3RELB 3WTPB 3WA9C 3MNNC 3REJD 4KUDA 3B6GD 5B32A 3X1VB 4JJNC 3AZLC 4Z2MG 4KGCD 3V9RA 1U35A 5CPJA 3KXBC 4UUZA 2LY8A 5BT1C 3UTAC 2AROC 3AZHB 1P3GA 1KX3C 1M18D 5AV5C 5BNVB 3X1TD 5G49B 4ZUXB 1M19C 2JSSA 5AVCC 4J8VC 3AZNC 3AV1D 1P3AA 2FJ7C 5GSUD 3MGRA 3KUYB 2F8ND 5CPKB 4YM6A 5JRGD 1S32B 1P3FD 3REKA 3MVDA 5B32G 3AZMB 1P3ID 3WTPE 5B0ZA 2CV5C 1P3LB 4QLCB 2NZDA 5AV6A 4WU9A 3W99D 5DNNA 4CAYB 4M6BA 4YS3A 3MGQD 4R8PC 3AZGC 5JA4A 3X1SA 3WKJA 4CSRA 3REHA 1P3KB 1ZLAD 3AZKA 3LELB 2YFVB 3MNND 3AYWA 1KX5A 5DNMD 1P3MC 3REJB 4JJND 3AV2C 3B6GB 3VH5T 3AZLD 1P34C 4H9RB 4KGCB 4J8WA 5KDMB 3TU4C 3KXBD 5C3IC 4DRAA 4AWLC 4XZQA 5BT1D 3C1BC 2BYKB 5B31C 5B33A 3LZ0A 3W96C 3UTAD 3X1UA 5AV8D 5GT0D 1KX4D 5AV5D 4G92B 1M18B 5AY8C 4EO5C 1Q9CA 3AZFC 1M19D 3W98D 3X1TB 5B2IC 3LZ1A 5AVCD 4J8VD 4Z5TA 3AZND 3WAAA 3AN2A 1JFIA 3B0DC 4WU8C 3A6ND 3AV1B 2FJ7D 3AZJC 3MGSC 3AFAC 4H9NA 5GSUB 4H9PB 1F66D 3B0CW 1TZYA 4KUDC 5JRGB 5B32C 1P3FB 2YFWB 4G91C 1U35C 1N1JA 5BS7A 1P3IB 2CV5D 2F8NH 3W99B 3LJAA 3C1CC 1P3PA 2HIOD 5B40A 5AV9A 3AZGD 3MGQB 1ID3A 1P3OA 4H9OA 3RELA 1ZLAB 3MGRC 1HQ3C 4J8UA 3X1VA 5DNMB 1P3MD 3AV2D 3O62C 4JJNB 5CP6D 4XUJA 3AZLB 1P34D 4YM6C 3KWQC 3TU4D 3REKC 3KXBB 3MVDC 3C1BD 5B31D 3W96D 3AZHA 3UTAB 5B0ZC 5AV8B 5GT0B 5AY8D 4WNNB 5E5AC 5BNVA 5AV6C 4WU9C 2NZDC 5G49A 5DNNC 3AZFD 5B2ID 1M19B 2IO5B 3W98B 5AVCB 3KSYA 4J8VB 3AZNB 3A6NB 3AFAD 3MGSD 3X1SC 3WKJC 3REHC 2HUEB 3AZKC 1F66B 1KX5C 3AYWC 1S32A 4KUDD 1F1EA 3B0BA 3VH6A 3AZMA 5F99C 1U35D 4QLCA 3AZIC 2CV5B 1M1AB 5B1LC 3UTBC 5B33C 3LZ0C 1WWSA 5CPIB 3C1CD 1KX4C 2HIOB 3LZ1C 2RVQC 5B2JD 2NQBB 1P3KA 3B6FA 5B1MD 1P3BA 4Z5TC 3WAAC 3LELA 3AN2C 2YFVA 5FUGB 4Z66B 3MGRD 1HQ3D 3REJA 1B6WA 3O62D 4WZSB 1P3MB 3AV2B 4H9RA 4KGCA 1ULYA 5CP6B 4LD9D 5KDMA 3KWQD 1TZYC 1TAFB 3TU4B 3UT9A 2CWEA 4AWLB 4Z2MH 3C1BB 5B31B 5B0ZD 3W96B 1M18A 5E5AD 2NZDD 5AY8B 5GT3B 5DNND 3X1TA 5BNXB 1WWIA 3LJAC 5B2IB 5B0YC 3AV1A 5GXQC 1P3PC 3REIC 1ID3C 5GSUA 1EQZD 3MGSB 3WKJD 3REHD 1BFMA 4H9PA 3RELC 3WA9D 5JRGA 4J8UC 3X1VC 1P3FA 2YFWA 2L5AA 5F99D 4XUJC 3AZID 5B1LD 3UTBD 3W99A 2AROD 1KX3D 4ZBJC 3MGPC 4J8XC 3C1CB 5B24C
chains in the Genus database with same CATH superfamily
4X23C 5B2JB 4Z5TD 1ZLAA 4NFTA 5B1MB 1AOIC 2BYMB 3W97A 5DNMA 3A1IA 1HQ3B 3MGRB 4JJNA 5AVBC 1B67A 3O62B 2PYOC 1S32C 4LD9B 1TZYD 2F8NB 3KWQB 3KXBA 3AZMC 3AZEA 5AV8A 5GT0A 4WNNA 5CPJC 4UPKA 5E5AB 1M19A 5DNNB 3W98A 2FFFB 3B0CT 1BH8B 3VH6W 3LJAD 1P3GC 5B0YD 4J8VA 2XD1A 3AZNA 5GXQD 4R8PD 3P5JB 3A6NA 3REID 1W2EA 1P3KC 3B6FC 4NE6A 1P3BC 1EQZB 4CSRB 1F66A 2Y2LA 3WTPA 1P3AC 4J8UD 3X1VD 3MNNB 3WA9B 4XUJD 4KGCC 3VH5A 5F99B 1M1AA 3AZIB 3UT9C 5B1LB 3UTBB 5CPIA 4G92C 2AROB 3MGPD 1KX3B 4J8XD 1KU5A 5AV5B 5B24D 2HIOA 3X1TC 4ZUXA 1KX4B 4X23D 2NQBA 4YS3C 4NE3A 5FUGA 4Z5TB 4Z66A 4WU8D 1AOID 3AZJD 2FJ7B 1P3MA 5AVBD 3KUYA 5CP6A 2PYOD 1PZRA 5CPKA 1Z2CB 5JRGC 1TAFA 3TU4A 1TZYB 3AL0C 5B32D 2Y2IA 4KHAB 3C1BA 5B31A 3W96A 4J8WC 1P3LA 5CPJD 5AY8A 5GT3A 3NQUB 4XZQC 5BNXA 4CAYA 5B2IA 3X1UC 1P3GD 3LJAB 3R45B 5B0YB 5GXQB 4R8PB 3MGSA 3REIB 3AZGB 5BO0B 1P3KD 3B6FD 1P3BD 1ZLAC 3EG5B 3NQJB 1P3AD 3W97C 5DNMC 1A7WA 4J8UB 3B6GA 1BH9B 4XUJB 1P34B 3H0MC 4YM6D 3REKD 1H3OB 3UT9D 3MVDD 5C3IB 2BYKA 5BS7C 5B31G 4H9QB 5AV8C 3AZEC 5GT0C 4ZBJB 3C1CA 3MGPB 5AV6D 4WU9D 4J8XB 4EO5B 5B24B 2IO5C 3W98C 3AZFB 5B2JA 4X23B 4YS3D 2RIQA 5B1MA 2ZY4A 5AV9C 3A6NC 2BYMA 2Y2MA 3B0DB 4WU8B 1HQ3A 5B40C 1AOIB 3X1SD 2HUEC 4HGAC 3AFAB 3AZJB 1P3OC 3O62A 1F66C 5AVBB 3AZKD 3WTPC 4LD9A 1KX5D 3AYWD 2F8NA 2PYOB 3KWQA 4KUDB 5B32B 4G91B 4H9SA 3V9RB 4J8WD 1U35B 1P3IA 1M1AC 4NE5A 5E5AA 5CPJB 4XZQD 4UUZB 1R4VA 5B33D 3LZ0D 1BH8A 3X1UD 3AZHC 5CPIC 1P3GB 3VH5W 2HIOC 4DQYB 4ZUXC 2NQBC 3LZ1D 2RVQD 1EQZA 3B6FB 1P3BB 3WAAD 4Z66C 3AN2D 1P3AB 3W97D 3MNNA 3WA9A 4E45A 2UWXA 3KUYC 5F99A 5CP6C 3AZLA 5CPKC 4YM6B 2F8NG 3AZIA 5B1LA 3REKB 3UT9B 3UTBA 3MVDB 3UTAA 2J8PA 3AZED 2AROA 1P3LC 1KX3A 5B0ZB 4QLCC 5AV5A 5GT3C 1KX4A 2NZDB 5AV6B 4WU9B 5AVCA 4YS3B 2ZM5A 4E44A 5B40D 5AV9D 1P3PD 1ID3D 2FJ7A 5JA4B 1P3OD 3X1SB 3WKJB 3LELC 3REHB 3WTPD 3RELD 3AZKB 1KX5B 3AYWB 3VH6T 4DRBA 3REJC 3B6GC 4KHAA 4J8WB 2CV5A 1M1AD 3NQUA 4XZQB 4WV4B 2Y2HA 3AZHD 5B33B 3LZ0B 5CPID 2F8NK 3X1UB 3R45A 5B0YA 1M18C 5GXQA 4ZUXD 4R8PA 3REIA 3AZGA 5BO0A 2NQBD 2DQNC 5B2JC 3LZ1B 5B1MC 4Z66D 2DF4C 3NQJA 3AV1C 3WAAB 3AN2B 1JFIB 3KFUG 5GSUC 3W97B 2ZY5A 4H9NB 3AV2A 1BH9A 3KUYD 3MGQA 1P34A 5CHLB 5CPKD 4LD9C 1S32D 1H3OA 1P3FC 3AZMD 4H9SC 4WJ3C 4H9QA 1P3IC 1N1JB 1P3LD 3AZEB 4QLCD 3MGPA 5GT3D 4J8XA 1HTAA 5B24A 3W99C 3AZFA 4X23A 4WU8A 1AOIA 3MGQC 1P3PB 5B40B 5AV9B 3AZJA 1ID3B 3AFAA 1EQZC 4HGAB 5AVBA 1P3OB 3LELD 4H9OB 2PYOA 3RELB 3WTPB 3WA9C 3MNNC 3REJD 4KUDA 3B6GD 5B32A 3X1VB 4JJNC 3AZLC 4Z2MG 4KGCD 3V9RA 1U35A 5CPJA 3KXBC 4UUZA 2LY8A 5BT1C 3F6TA 3UTAC 2AROC 3AZHB 1P3GA 1KX3C 1M18D 5AV5C 5BNVB 3X1TD 5G49B 4ZUXB 1M19C 2JSSA 5AVCC 2XD5A 4J8VC 3AZNC 3AV1D 1P3AA 2ZY2A 2FJ7C 5GSUD 3MGRA 3KUYB 2F8ND 5CPKB 4YM6A 5JRGD 1S32B 1P3FD 3REKA 3MVDA 5B32G 3AZMB 1P3ID 3WTPE 5B0ZA 2CV5C 1P3LB 4QLCB 2NZDA 5AV6A 4WU9A 3W99D 5DNNA 4CAYB 4M6BA 4YS3A 3MGQD 4R8PC 3AZGC 5JA4A 3EPJA 3X1SA 3WKJA 4CSRA 3REHA 1P3KB 1ZLAD 3AZKA 3LELB 2YFVB 3MNND 3AYWA 1KX5A 5DNMD 1P3MC 3REJB 4JJND 3AV2C 3B6GB 3VH5T 3A1KA 3AZLD 1P34C 4H9RB 4KGCB 4J8WA 5KDMB 3TU4C 3KXBD 5C3IC 4DRAA 4AWLC 4XZQA 5BT1D 3C1BC 2BYKB 5B31C 5B33A 3LZ0A 3W96C 3UTAD 3X1UA 5AV8D 5GT0D 1KX4D 5AV5D 4G92B 1M18B 5AY8C 4EO5C 2G5IC 1Q9CA 3AZFC 1M19D 3X1TB 5B2IC 3LZ1A 3W98D 5AVCD 2F2AC 4J8VD 4Z5TA 3AZND 3WAAA 2VQRA 3AN2A 1JFIA 3B0DC 4WU8C 3A6ND 3AV1B 2FJ7D 3AZJC 3MGSC 3AFAC 4H9NA 5GSUB 4H9PB 1F66D 2Y2JA 2Y2GA 3B0CW 1TZYA 4KUDC 5JRGB 5B32C 1P3FB 3H0RC 2YFWB 4G91C 1U35C 2JE5A 1N1JA 5BS7A 1P3IB 2CV5D 2F8NH 2JCHA 2Y2PA 3W99B 3H0LC 3LJAA 3EPHA 3C1CC 1P3PA 2HIOD 5B40A 5AV9A 3AZGD 3MGQB 1ID3A 1P3OA 4H9OA 3RELA 1ZLAB 3MGRC 1HQ3C 4J8UA 3X1VA 5DNMB 1P3MD 3AV2D 3O62C 4JJNB 5CP6D 4XUJA 3AZLB 1P34D 4YM6C 3KWQC 3TU4D 3REKC 1T3UA 3KXBB 3MVDC 3C1BD 5B31D 3W96D 3AZHA 3UTAB 5B0ZC 5AV8B 5GT0B 5AY8D 4WNNB 5E5AC 5BNVA 5AV6C 4WU9C 2NZDC 5G49A 5DNNC 3AZFD 5B2ID 2Y2OA 1M19B 2IO5B 3EPLA 3W98B 5AVCB 3KSYA 4J8VB 3AZNB 2BG1A 3A6NB 3AFAD 3MGSD 3X1SC 3WKJC 2ZY3A 2HUEB 3REHC 3AZKC 1F66B 1KX5C 3AYWC 1S32A 4KUDD 1F1EA 3FDDA 3B0BA 3VH6A 3AZMA 5F99C 1U35D 4QLCA 3AZIC 2CV5B 1M1AB 5B1LC 3UTBC 5B33C 3LZ0C 1WWSA 5CPIB 3C1CD 1KX4C 2HIOB 3LZ1C 2RVQC 5B2JD 2NQBB 1P3KA 3B6FA 5B1MD 1P3BA 4Z5TC 3WAAC 3LELA 3AN2C 2YFVA 5FUGB 4Z66B 3MGRD 1HQ3D 3REJA 1B6WA 3IP4C 4WZSB 3O62D 1P3MB 3AV2B 4H9RA 4KGCA 1ULYA 5CP6B 4LD9D 5KDMA 3KWQD 1TZYC 1TAFB 3TU4B 3UT9A 2CWEA 4AWLB 4Z2MH 3C1BB 5B31B 5B0ZD 3W96B 1M18A 2Y2KA 5E5AD 2NZDD 5AY8B 5GT3B 5DNND 3X1TA 5BNXB 1WWIA 3LJAC 5B2IB 5B0YC 2Y2NA 2Y2QA 3AV1A 5GXQC 1P3PC 3REIC 1ID3C 5GSUA 1EQZD 3MGSB 3WKJD 3REHD 1BFMA 4H9PA 3RELC 3WA9D 5JRGA 4J8UC 3X1VC 1P3FA 2YFWA 2L5AA 5F99D 4XUJC 2G5HC 3AZID 3EPKA 5B1LD 3UTBD 3W99A 2W8SA 2AROD 1KX3D 4ZBJC 3MGPC 4J8XC 3C1CB 5B24C
chains in the Genus database with same CATH topology
4X23C 5B2JB 4Z5TD 1ZLAA 4NFTA 5B1MB 1AOIC 2BYMB 3W97A 5DNMA 3A1IA 1HQ3B 3MGRB 4JJNA 5AVBC 1B67A 3O62B 2PYOC 1S32C 4LD9B 1TZYD 2F8NB 3KWQB 3KXBA 3AZMC 3AZEA 5AV8A 5GT0A 4WNNA 5CPJC 4UPKA 5E5AB 1M19A 5DNNB 3W98A 2FFFB 3B0CT 1BH8B 3VH6W 3LJAD 1P3GC 5B0YD 4J8VA 2XD1A 3AZNA 5GXQD 4R8PD 3P5JB 3A6NA 3REID 1W2EA 1P3KC 3B6FC 4NE6A 1P3BC 1EQZB 4CSRB 1F66A 2Y2LA 3WTPA 1P3AC 4J8UD 3X1VD 3MNNB 3WA9B 4XUJD 4KGCC 3VH5A 5F99B 1M1AA 3AZIB 3UT9C 5B1LB 3UTBB 5CPIA 4G92C 2AROB 3MGPD 1KX3B 4J8XD 1KU5A 5AV5B 5B24D 2HIOA 3X1TC 4ZUXA 1KX4B 4X23D 2NQBA 4YS3C 4NE3A 5FUGA 4Z5TB 4Z66A 4WU8D 1AOID 3AZJD 2FJ7B 1P3MA 5AVBD 3KUYA 5CP6A 2PYOD 1PZRA 5CPKA 1Z2CB 5JRGC 1TAFA 3TU4A 1TZYB 3AL0C 5B32D 2Y2IA 4KHAB 3C1BA 5B31A 3W96A 4J8WC 1P3LA 5CPJD 5AY8A 5GT3A 3NQUB 4XZQC 5BNXA 4CAYA 5B2IA 3X1UC 1P3GD 3LJAB 3R45B 5B0YB 5GXQB 4R8PB 3MGSA 3REIB 3AZGB 5BO0B 1P3KD 3B6FD 1P3BD 1ZLAC 3EG5B 3NQJB 1P3AD 3W97C 5DNMC 1A7WA 4J8UB 3B6GA 1BH9B 4XUJB 1P34B 3H0MC 4YM6D 3REKD 1H3OB 3UT9D 3MVDD 5C3IB 2BYKA 5BS7C 5B31G 4H9QB 5AV8C 3AZEC 5GT0C 4ZBJB 3C1CA 3MGPB 5AV6D 4WU9D 4J8XB 4EO5B 5B24B 2IO5C 3W98C 3AZFB 5B2JA 4X23B 4YS3D 2RIQA 5B1MA 2ZY4A 5AV9C 3A6NC 2BYMA 2Y2MA 3B0DB 4WU8B 1HQ3A 5B40C 1AOIB 3X1SD 2HUEC 4HGAC 3AFAB 3AZJB 1P3OC 3O62A 1F66C 5AVBB 3AZKD 3WTPC 4LD9A 1KX5D 3AYWD 2F8NA 2PYOB 3KWQA 4KUDB 5B32B 4G91B 4H9SA 3V9RB 4J8WD 1U35B 1P3IA 1M1AC 4NE5A 5E5AA 5CPJB 4XZQD 4UUZB 1R4VA 5B33D 3LZ0D 1BH8A 3X1UD 3AZHC 5CPIC 1P3GB 3VH5W 2HIOC 4DQYB 4ZUXC 2NQBC 3LZ1D 2RVQD 1EQZA 3B6FB 1P3BB 3WAAD 4Z66C 3AN2D 1P3AB 3W97D 3MNNA 3WA9A 4E45A 2UWXA 3KUYC 5F99A 5CP6C 3AZLA 5CPKC 4YM6B 2F8NG 3AZIA 5B1LA 3REKB 3UT9B 3UTBA 3MVDB 3UTAA 2J8PA 3AZED 2AROA 1P3LC 1KX3A 5B0ZB 4QLCC 5AV5A 5GT3C 1KX4A 2NZDB 5AV6B 4WU9B 5AVCA 4YS3B 2ZM5A 4E44A 5B40D 5AV9D 1P3PD 1ID3D 2FJ7A 5JA4B 1P3OD 3X1SB 3WKJB 3LELC 3REHB 3WTPD 3RELD 3AZKB 1KX5B 3AYWB 3VH6T 4DRBA 3REJC 3B6GC 4KHAA 4J8WB 2CV5A 1M1AD 3NQUA 4XZQB 4WV4B 2Y2HA 3AZHD 5B33B 3LZ0B 5CPID 2F8NK 3X1UB 3R45A 5B0YA 1M18C 5GXQA 4ZUXD 4R8PA 3REIA 3AZGA 5BO0A 2NQBD 2DQNC 5B2JC 3LZ1B 5B1MC 4Z66D 2DF4C 3NQJA 3AV1C 3WAAB 3AN2B 1JFIB 3KFUG 5GSUC 3W97B 2ZY5A 4H9NB 3AV2A 1BH9A 3KUYD 3MGQA 1P34A 5CHLB 5CPKD 4LD9C 1S32D 1H3OA 1P3FC 3AZMD 4H9SC 4WJ3C 4H9QA 1P3IC 1N1JB 1P3LD 3AZEB 4QLCD 3MGPA 5GT3D 4J8XA 1HTAA 5B24A 3W99C 3AZFA 4X23A 4WU8A 1AOIA 3MGQC 1P3PB 5B40B 5AV9B 3AZJA 1ID3B 3AFAA 1EQZC 4HGAB 5AVBA 1P3OB 3LELD 4H9OB 2PYOA 3RELB 3WTPB 3WA9C 3MNNC 3REJD 4KUDA 3B6GD 5B32A 3X1VB 4JJNC 3AZLC 4Z2MG 4KGCD 3V9RA 1U35A 5CPJA 3KXBC 4UUZA 2LY8A 5BT1C 3F6TA 3UTAC 2AROC 3AZHB 1P3GA 1KX3C 1M18D 5AV5C 5BNVB 3X1TD 5G49B 4ZUXB 1M19C 2JSSA 5AVCC 2XD5A 4J8VC 3AZNC 3AV1D 1P3AA 2ZY2A 2FJ7C 5GSUD 3MGRA 3KUYB 2F8ND 5CPKB 4YM6A 5JRGD 1S32B 1P3FD 3REKA 3MVDA 5B32G 3AZMB 1P3ID 3WTPE 5B0ZA 2CV5C 1P3LB 4QLCB 2NZDA 5AV6A 4WU9A 3W99D 5DNNA 4CAYB 4M6BA 4YS3A 3MGQD 4R8PC 3AZGC 5JA4A 3EPJA 3X1SA 3WKJA 4CSRA 3REHA 1P3KB 1ZLAD 3AZKA 3LELB 2YFVB 3MNND 3AYWA 1KX5A 5DNMD 1P3MC 3REJB 4JJND 3AV2C 3B6GB 3VH5T 3A1KA 3AZLD 1P34C 4H9RB 4KGCB 4J8WA 5KDMB 3TU4C 3KXBD 5C3IC 4DRAA 4AWLC 4XZQA 5BT1D 3C1BC 2BYKB 5B31C 5B33A 3LZ0A 3W96C 3UTAD 3X1UA 5AV8D 5GT0D 1KX4D 5AV5D 4G92B 1M18B 5AY8C 4EO5C 2G5IC 1Q9CA 3AZFC 1M19D 3X1TB 5B2IC 3LZ1A 3W98D 5AVCD 2F2AC 4J8VD 4Z5TA 3AZND 3WAAA 2VQRA 3AN2A 1JFIA 3B0DC 4WU8C 3A6ND 3AV1B 2FJ7D 3AZJC 3MGSC 3AFAC 4H9NA 5GSUB 4H9PB 1F66D 2Y2JA 2Y2GA 3B0CW 1TZYA 4KUDC 5JRGB 5B32C 1P3FB 3H0RC 2YFWB 4G91C 1U35C 2JE5A 1N1JA 5BS7A 1P3IB 2CV5D 2F8NH 2JCHA 2Y2PA 3W99B 3H0LC 3LJAA 3EPHA 3C1CC 1P3PA 2HIOD 5B40A 5AV9A 3AZGD 3MGQB 1ID3A 1P3OA 4H9OA 3RELA 1ZLAB 3MGRC 1HQ3C 4J8UA 3X1VA 5DNMB 1P3MD 3AV2D 3O62C 4JJNB 5CP6D 4XUJA 3AZLB 1P34D 4YM6C 3KWQC 3TU4D 3REKC 1T3UA 3KXBB 3MVDC 3C1BD 5B31D 3W96D 3AZHA 3UTAB 5B0ZC 5AV8B 5GT0B 5AY8D 4WNNB 5E5AC 5BNVA 5AV6C 4WU9C 2NZDC 5G49A 5DNNC 3AZFD 5B2ID 2Y2OA 1M19B 2IO5B 3EPLA 3W98B 5AVCB 3KSYA 4J8VB 3AZNB 2BG1A 3A6NB 3AFAD 3MGSD 3X1SC 3WKJC 2ZY3A 2HUEB 3REHC 3AZKC 1F66B 1KX5C 3AYWC 1S32A 4KUDD 1F1EA 3FDDA 3B0BA 3VH6A 3AZMA 5F99C 1U35D 4QLCA 3AZIC 2CV5B 1M1AB 5B1LC 3UTBC 5B33C 3LZ0C 1WWSA 5CPIB 3C1CD 1KX4C 2HIOB 3LZ1C 2RVQC 5B2JD 2NQBB 1P3KA 3B6FA 5B1MD 1P3BA 4Z5TC 3WAAC 3LELA 3AN2C 2YFVA 5FUGB 4Z66B 3MGRD 1HQ3D 3REJA 1B6WA 3IP4C 4WZSB 3O62D 1P3MB 3AV2B 4H9RA 4KGCA 1ULYA 5CP6B 4LD9D 5KDMA 3KWQD 1TZYC 1TAFB 3TU4B 3UT9A 2CWEA 4AWLB 4Z2MH 3C1BB 5B31B 5B0ZD 3W96B 1M18A 2Y2KA 5E5AD 2NZDD 5AY8B 5GT3B 5DNND 3X1TA 5BNXB 1WWIA 3LJAC 5B2IB 5B0YC 2Y2NA 2Y2QA 3AV1A 5GXQC 1P3PC 3REIC 1ID3C 5GSUA 1EQZD 3MGSB 3WKJD 3REHD 1BFMA 4H9PA 3RELC 3WA9D 5JRGA 4J8UC 3X1VC 1P3FA 2YFWA 2L5AA 5F99D 4XUJC 2G5HC 3AZID 3EPKA 5B1LD 3UTBD 3W99A 2W8SA 2AROD 1KX3D 4ZBJC 3MGPC 4J8XC 3C1CB 5B24C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  5B2J B;  4Z5T D;  1ZLA A;  4NFT A;  5B1M B;  1AOI C;  2BYM B;  3W97 A;  5DNM A;  3MGR B;  1HQ3 B;  4JJN A;  5AVB C;  1B67 A;  3O62 B;  2PYO C;  1S32 C;  4LD9 B;  1TZY D;  2F8N B;  3KWQ B;  3KXB A;  3AZM C;  3AZE A;  5AV8 A;  5GT0 A;  4WNN A;  5CPJ C;  5E5A B;  1M19 A;  5DNN B;  3W98 A;  3VH6 W;  3B0C T;  1BH8 B;  3LJA D;  1P3G C;  5B0Y D;  4J8V A;  3AZN A;  5GXQ D;  4R8P D;  3A6N A;  3REI D;  1P3K C;  3B6F C;  4NE6 A;  1P3B C;  1EQZ B;  4CSR B;  1F66 A;  3WTP A;  1P3A C;  4J8U D;  3X1V D;  3MNN B;  3WA9 B;  4XUJ D;  4KGC C;  3VH5 A;  5F99 B;  1M1A A;  3AZI B;  3UT9 C;  5B1L B;  3UTB B;  5CPI A;  4G92 C;  2ARO B;  3MGP D;  1KX3 B;  4J8X D;  1KU5 A;  5AV5 B;  5B24 D;  2HIO A;  3X1T C;  4ZUX A;  1KX4 B;  4X23 D;  2NQB A;  4YS3 C;  4NE3 A;  5FUG A;  4Z5T B;  4Z66 A;  4WU8 D;  1AOI D;  3AZJ D;  2FJ7 B;  1P3M A;  5AVB D;  3KUY A;  5CP6 A;  2PYO D;  5CPK A;  5JRG C;  1TAF A;  3TU4 A;  1TZY B;  5B32 D;  4KHA B;  3C1B A;  5B31 A;  3W96 A;  4J8W C;  1P3L A;  5CPJ D;  5AY8 A;  5GT3 A;  3NQU B;  4XZQ C;  5BNX A;  4CAY A;  5B2I A;  3X1U C;  1P3G D;  3LJA B;  3R45 B;  5B0Y B;  5GXQ B;  4R8P B;  3MGS A;  3REI B;  3AZG B;  5BO0 B;  1P3K D;  3B6F D;  1P3B D;  1ZLA C;  3NQJ B;  1P3A D;  3W97 C;  5DNM C;  1A7W A;  4J8U B;  3B6G A;  1BH9 B;  4XUJ B;  1P34 B;  4YM6 D;  3REK D;  1H3O B;  3UT9 D;  3MVD D;  5C3I B;  2BYK A;  5BS7 C;  5B31 G;  4H9Q B;  5AV8 C;  3AZE C;  5GT0 C;  4ZBJ B;  3C1C A;  3MGP B;  5AV6 D;  4WU9 D;  4J8X B;  4EO5 B;  5B24 B;  2IO5 C;  3W98 C;  3AZF B;  5B2J A;  4X23 B;  4YS3 D;  5B1M A;  5AV9 C;  3A6N C;  2BYM A;  3B0D B;  4WU8 B;  5B40 C;  1HQ3 A;  1AOI B;  3X1S D;  2HUE C;  4HGA C;  3AFA B;  3AZJ B;  1P3O C;  3O62 A;  1F66 C;  5AVB B;  3AZK D;  3WTP C;  4LD9 A;  1KX5 D;  3AYW D;  2F8N A;  2PYO B;  3KWQ A;  4KUD B;  5B32 B;  4G91 B;  4H9S A;  3V9R B;  4J8W D;  1U35 B;  1P3I A;  1M1A C;  4NE5 A;  5E5A A;  5CPJ B;  4XZQ D;  4UUZ B;  1R4V A;  5B33 D;  3LZ0 D;  1BH8 A;  3X1U D;  3AZH C;  5CPI C;  1P3G B;  3VH5 W;  2HIO C;  4ZUX C;  2NQB C;  3LZ1 D;  2RVQ D;  1EQZ A;  3B6F B;  1P3B B;  3WAA D;  4Z66 C;  3AN2 D;  1P3A B;  3W97 D;  3MNN A;  3WA9 A;  4E45 A;  3KUY C;  5F99 A;  5CP6 C;  3AZL A;  5CPK C;  4YM6 B;  2F8N G;  3AZI A;  5B1L A;  3REK B;  3UT9 B;  3UTB A;  3MVD B;  3UTA A;  3AZE D;  2ARO A;  1P3L C;  1KX3 A;  5B0Z B;  4QLC C;  5AV5 A;  5GT3 C;  1KX4 A;  2NZD B;  5AV6 B;  4WU9 B;  5AVC A;  4YS3 B;  4E44 A;  5B40 D;  5AV9 D;  1P3P D;  1ID3 D;  2FJ7 A;  5JA4 B;  1P3O D;  3X1S B;  3WKJ B;  3LEL C;  3REH B;  3WTP D;  3REL D;  3AZK B;  1KX5 B;  3AYW B;  3VH6 T;  4DRB A;  3REJ C;  3B6G C;  4KHA A;  4J8W B;  2CV5 A;  1M1A D;  3NQU A;  4XZQ B;  4WV4 B;  3AZH D;  5B33 B;  3LZ0 B;  5CPI D;  2F8N K;  3X1U B;  3R45 A;  5B0Y A;  1M18 C;  5GXQ A;  4ZUX D;  4R8P A;  3REI A;  3AZG A;  5BO0 A;  2NQB D;  5B2J C;  3LZ1 B;  5B1M C;  4Z66 D;  3NQJ A;  3AV1 C;  3WAA B;  3AN2 B;  1JFI B;  5GSU C;  3W97 B;  4H9N B;  3AV2 A;  1BH9 A;  3KUY D;  3MGQ A;  1P34 A;  5CHL B;  5CPK D;  4LD9 C;  1S32 D;  1H3O A;  1P3F C;  3AZM D;  4H9S C;  4H9Q A;  1P3I C;  1N1J B;  1P3L D;  3AZE B;  4QLC D;  3MGP A;  5GT3 D;  4J8X A;  1HTA A;  5B24 A;  3W99 C;  3AZF A;  4X23 A;  4WU8 A;  1AOI A;  3MGQ C;  1P3P B;  5B40 B;  5AV9 B;  3AZJ A;  1ID3 B;  3AFA A;  1EQZ C;  4HGA B;  5AVB A;  1P3O B;  3LEL D;  4H9O B;  2PYO A;  3REL B;  3WTP B;  3WA9 C;  3MNN C;  3REJ D;  4KUD A;  3B6G D;  5B32 A;  3X1V B;  4JJN C;  3AZL C;  4Z2M G;  4KGC D;  3V9R A;  1U35 A;  5CPJ A;  3KXB C;  4UUZ A;  2LY8 A;  5BT1 C;  3UTA C;  2ARO C;  3AZH B;  1P3G A;  1KX3 C;  1M18 D;  5AV5 C;  5BNV B;  3X1T D;  5G49 B;  4ZUX B;  1M19 C;  2JSS A;  5AVC C;  4J8V C;  3AZN C;  3AV1 D;  1P3A A;  2FJ7 C;  5GSU D;  3MGR A;  3KUY B;  2F8N D;  5CPK B;  4YM6 A;  5JRG D;  1S32 B;  1P3F D;  3REK A;  3MVD A;  5B32 G;  3AZM B;  1P3I D;  3WTP E;  5B0Z A;  2CV5 C;  1P3L B;  4QLC B;  2NZD A;  5AV6 A;  4WU9 A;  3W99 D;  5DNN A;  4CAY B;  4M6B A;  4YS3 A;  3MGQ D;  4R8P C;  3AZG C;  5JA4 A;  3X1S A;  3WKJ A;  4CSR A;  3REH A;  1P3K B;  1ZLA D;  3AZK A;  3LEL B;  2YFV B;  3MNN D;  3AYW A;  1KX5 A;  5DNM D;  1P3M C;  3REJ B;  4JJN D;  3AV2 C;  3B6G B;  3VH5 T;  3AZL D;  1P34 C;  4H9R B;  4KGC B;  4J8W A;  5KDM B;  3TU4 C;  3KXB D;  5C3I C;  4DRA A;  4AWL C;  4XZQ A;  5BT1 D;  3C1B C;  2BYK B;  5B31 C;  5B33 A;  3LZ0 A;  3W96 C;  3UTA D;  3X1U A;  5AV8 D;  5GT0 D;  1KX4 D;  5AV5 D;  4G92 B;  1M18 B;  5AY8 C;  4EO5 C;  1Q9C A;  3AZF C;  1M19 D;  3W98 D;  3X1T B;  5B2I C;  3LZ1 A;  5AVC D;  4J8V D;  4Z5T A;  3AZN D;  3WAA A;  3AN2 A;  1JFI A;  3B0D C;  4WU8 C;  3A6N D;  3AV1 B;  2FJ7 D;  3AZJ C;  3MGS C;  3AFA C;  4H9N A;  5GSU B;  4H9P B;  1F66 D;  3B0C W;  1TZY A;  4KUD C;  5JRG B;  5B32 C;  1P3F B;  2YFW B;  4G91 C;  1U35 C;  1N1J A;  5BS7 A;  1P3I B;  2CV5 D;  2F8N H;  3W99 B;  3LJA A;  3C1C C;  1P3P A;  2HIO D;  5B40 A;  5AV9 A;  3AZG D;  3MGQ B;  1ID3 A;  1P3O A;  4H9O A;  3REL A;  1ZLA B;  3MGR C;  1HQ3 C;  4J8U A;  3X1V A;  5DNM B;  1P3M D;  3AV2 D;  3O62 C;  4JJN B;  5CP6 D;  4XUJ A;  3AZL B;  1P34 D;  4YM6 C;  3KWQ C;  3TU4 D;  3REK C;  3KXB B;  3MVD C;  3C1B D;  5B31 D;  3W96 D;  3AZH A;  3UTA B;  5B0Z C;  5AV8 B;  5GT0 B;  5AY8 D;  4WNN B;  5E5A C;  5BNV A;  5AV6 C;  4WU9 C;  2NZD C;  5G49 A;  5DNN C;  3AZF D;  5B2I D;  1M19 B;  2IO5 B;  3W98 B;  5AVC B;  3KSY A;  4J8V B;  3AZN B;  3A6N B;  3AFA D;  3MGS D;  3X1S C;  3WKJ C;  3REH C;  2HUE B;  3AZK C;  1F66 B;  1KX5 C;  3AYW C;  1S32 A;  4KUD D;  1F1E A;  3B0B A;  3VH6 A;  3AZM A;  5F99 C;  1U35 D;  4QLC A;  3AZI C;  2CV5 B;  1M1A B;  5B1L C;  3UTB C;  5B33 C;  3LZ0 C;  1WWS A;  5CPI B;  3C1C D;  1KX4 C;  2HIO B;  3LZ1 C;  2RVQ C;  5B2J D;  2NQB B;  1P3K A;  3B6F A;  5B1M D;  1P3B A;  4Z5T C;  3WAA C;  3LEL A;  3AN2 C;  2YFV A;  5FUG B;  4Z66 B;  3MGR D;  1HQ3 D;  3REJ A;  1B6W A;  3O62 D;  4WZS B;  1P3M B;  3AV2 B;  4H9R A;  4KGC A;  1ULY A;  5CP6 B;  4LD9 D;  5KDM A;  3KWQ D;  1TZY C;  1TAF B;  3TU4 B;  3UT9 A;  2CWE A;  4AWL B;  4Z2M H;  3C1B B;  5B31 B;  5B0Z D;  3W96 B;  1M18 A;  5E5A D;  2NZD D;  5AY8 B;  5GT3 B;  5DNN D;  3X1T A;  5BNX B;  1WWI A;  3LJA C;  5B2I B;  5B0Y C;  3AV1 A;  5GXQ C;  1P3P C;  3REI C;  1ID3 C;  5GSU A;  1EQZ D;  3MGS B;  3WKJ D;  3REH D;  1BFM A;  4H9P A;  3REL C;  3WA9 D;  5JRG A;  4J8U C;  3X1V C;  1P3F A;  2YFW A;  2L5A A;  5F99 D;  4XUJ C;  3AZI D;  5B1L D;  3UTB D;  3W99 A;  2ARO D;  1KX3 D;  4ZBJ C;  3MGP C;  4J8X C;  3C1C B;  5B24 C; 
#chains in the Genus database with same CATH topology
 4X23 C;  5B2J B;  4Z5T D;  1ZLA A;  4NFT A;  5B1M B;  1AOI C;  2BYM B;  3W97 A;  5DNM A;  3A1I A;  1HQ3 B;  3MGR B;  4JJN A;  5AVB C;  1B67 A;  3O62 B;  2PYO C;  1S32 C;  4LD9 B;  1TZY D;  2F8N B;  3KWQ B;  3KXB A;  3AZM C;  3AZE A;  5AV8 A;  5GT0 A;  4WNN A;  5CPJ C;  4UPK A;  5E5A B;  1M19 A;  5DNN B;  3W98 A;  2FFF B;  3B0C T;  1BH8 B;  3VH6 W;  3LJA D;  1P3G C;  5B0Y D;  4J8V A;  2XD1 A;  3AZN A;  5GXQ D;  4R8P D;  3P5J B;  3A6N A;  3REI D;  1W2E A;  1P3K C;  3B6F C;  4NE6 A;  1P3B C;  1EQZ B;  4CSR B;  1F66 A;  2Y2L A;  3WTP A;  1P3A C;  4J8U D;  3X1V D;  3MNN B;  3WA9 B;  4XUJ D;  4KGC C;  3VH5 A;  5F99 B;  1M1A A;  3AZI B;  3UT9 C;  5B1L B;  3UTB B;  5CPI A;  4G92 C;  2ARO B;  3MGP D;  1KX3 B;  4J8X D;  1KU5 A;  5AV5 B;  5B24 D;  2HIO A;  3X1T C;  4ZUX A;  1KX4 B;  4X23 D;  2NQB A;  4YS3 C;  4NE3 A;  5FUG A;  4Z5T B;  4Z66 A;  4WU8 D;  1AOI D;  3AZJ D;  2FJ7 B;  1P3M A;  5AVB D;  3KUY A;  5CP6 A;  2PYO D;  1PZR A;  5CPK A;  1Z2C B;  5JRG C;  1TAF A;  3TU4 A;  1TZY B;  3AL0 C;  5B32 D;  2Y2I A;  4KHA B;  3C1B A;  5B31 A;  3W96 A;  4J8W C;  1P3L A;  5CPJ D;  5AY8 A;  5GT3 A;  3NQU B;  4XZQ C;  5BNX A;  4CAY A;  5B2I A;  3X1U C;  1P3G D;  3LJA B;  3R45 B;  5B0Y B;  5GXQ B;  4R8P B;  3MGS A;  3REI B;  3AZG B;  5BO0 B;  1P3K D;  3B6F D;  1P3B D;  1ZLA C;  3EG5 B;  3NQJ B;  1P3A D;  3W97 C;  5DNM C;  1A7W A;  4J8U B;  3B6G A;  1BH9 B;  4XUJ B;  1P34 B;  3H0M C;  4YM6 D;  3REK D;  1H3O B;  3UT9 D;  3MVD D;  5C3I B;  2BYK A;  5BS7 C;  5B31 G;  4H9Q B;  5AV8 C;  3AZE C;  5GT0 C;  4ZBJ B;  3C1C A;  3MGP B;  5AV6 D;  4WU9 D;  4J8X B;  4EO5 B;  5B24 B;  2IO5 C;  3W98 C;  3AZF B;  5B2J A;  4X23 B;  4YS3 D;  2RIQ A;  5B1M A;  2ZY4 A;  5AV9 C;  3A6N C;  2BYM A;  2Y2M A;  3B0D B;  4WU8 B;  1HQ3 A;  5B40 C;  1AOI B;  3X1S D;  2HUE C;  4HGA C;  3AFA B;  3AZJ B;  1P3O C;  3O62 A;  1F66 C;  5AVB B;  3AZK D;  3WTP C;  4LD9 A;  1KX5 D;  3AYW D;  2F8N A;  2PYO B;  3KWQ A;  4KUD B;  5B32 B;  4G91 B;  4H9S A;  3V9R B;  4J8W D;  1U35 B;  1P3I A;  1M1A C;  4NE5 A;  5E5A A;  5CPJ B;  4XZQ D;  4UUZ B;  1R4V A;  5B33 D;  3LZ0 D;  1BH8 A;  3X1U D;  3AZH C;  5CPI C;  1P3G B;  3VH5 W;  2HIO C;  4DQY B;  4ZUX C;  2NQB C;  3LZ1 D;  2RVQ D;  1EQZ A;  3B6F B;  1P3B B;  3WAA D;  4Z66 C;  3AN2 D;  1P3A B;  3W97 D;  3MNN A;  3WA9 A;  4E45 A;  2UWX A;  3KUY C;  5F99 A;  5CP6 C;  3AZL A;  5CPK C;  4YM6 B;  2F8N G;  3AZI A;  5B1L A;  3REK B;  3UT9 B;  3UTB A;  3MVD B;  3UTA A;  2J8P A;  3AZE D;  2ARO A;  1P3L C;  1KX3 A;  5B0Z B;  4QLC C;  5AV5 A;  5GT3 C;  1KX4 A;  2NZD B;  5AV6 B;  4WU9 B;  5AVC A;  4YS3 B;  2ZM5 A;  4E44 A;  5B40 D;  5AV9 D;  1P3P D;  1ID3 D;  2FJ7 A;  5JA4 B;  1P3O D;  3X1S B;  3WKJ B;  3LEL C;  3REH B;  3WTP D;  3REL D;  3AZK B;  1KX5 B;  3AYW B;  3VH6 T;  4DRB A;  3REJ C;  3B6G C;  4KHA A;  4J8W B;  2CV5 A;  1M1A D;  3NQU A;  4XZQ B;  4WV4 B;  2Y2H A;  3AZH D;  5B33 B;  3LZ0 B;  5CPI D;  2F8N K;  3X1U B;  3R45 A;  5B0Y A;  1M18 C;  5GXQ A;  4ZUX D;  4R8P A;  3REI A;  3AZG A;  5BO0 A;  2NQB D;  2DQN C;  5B2J C;  3LZ1 B;  5B1M C;  4Z66 D;  2DF4 C;  3NQJ A;  3AV1 C;  3WAA B;  3AN2 B;  1JFI B;  3KFU G;  5GSU C;  3W97 B;  2ZY5 A;  4H9N B;  3AV2 A;  1BH9 A;  3KUY D;  3MGQ A;  1P34 A;  5CHL B;  5CPK D;  4LD9 C;  1S32 D;  1H3O A;  1P3F C;  3AZM D;  4H9S C;  4WJ3 C;  4H9Q A;  1P3I C;  1N1J B;  1P3L D;  3AZE B;  4QLC D;  3MGP A;  5GT3 D;  4J8X A;  1HTA A;  5B24 A;  3W99 C;  3AZF A;  4X23 A;  4WU8 A;  1AOI A;  3MGQ C;  1P3P B;  5B40 B;  5AV9 B;  3AZJ A;  1ID3 B;  3AFA A;  1EQZ C;  4HGA B;  5AVB A;  1P3O B;  3LEL D;  4H9O B;  2PYO A;  3REL B;  3WTP B;  3WA9 C;  3MNN C;  3REJ D;  4KUD A;  3B6G D;  5B32 A;  3X1V B;  4JJN C;  3AZL C;  4Z2M G;  4KGC D;  3V9R A;  1U35 A;  5CPJ A;  3KXB C;  4UUZ A;  2LY8 A;  5BT1 C;  3F6T A;  3UTA C;  2ARO C;  3AZH B;  1P3G A;  1KX3 C;  1M18 D;  5AV5 C;  5BNV B;  3X1T D;  5G49 B;  4ZUX B;  1M19 C;  2JSS A;  5AVC C;  2XD5 A;  4J8V C;  3AZN C;  3AV1 D;  1P3A A;  2ZY2 A;  2FJ7 C;  5GSU D;  3MGR A;  3KUY B;  2F8N D;  5CPK B;  4YM6 A;  5JRG D;  1S32 B;  1P3F D;  3REK A;  3MVD A;  5B32 G;  3AZM B;  1P3I D;  3WTP E;  5B0Z A;  2CV5 C;  1P3L B;  4QLC B;  2NZD A;  5AV6 A;  4WU9 A;  3W99 D;  5DNN A;  4CAY B;  4M6B A;  4YS3 A;  3MGQ D;  4R8P C;  3AZG C;  5JA4 A;  3EPJ A;  3X1S A;  3WKJ A;  4CSR A;  3REH A;  1P3K B;  1ZLA D;  3AZK A;  3LEL B;  2YFV B;  3MNN D;  3AYW A;  1KX5 A;  5DNM D;  1P3M C;  3REJ B;  4JJN D;  3AV2 C;  3B6G B;  3VH5 T;  3A1K A;  3AZL D;  1P34 C;  4H9R B;  4KGC B;  4J8W A;  5KDM B;  3TU4 C;  3KXB D;  5C3I C;  4DRA A;  4AWL C;  4XZQ A;  5BT1 D;  3C1B C;  2BYK B;  5B31 C;  5B33 A;  3LZ0 A;  3W96 C;  3UTA D;  3X1U A;  5AV8 D;  5GT0 D;  1KX4 D;  5AV5 D;  4G92 B;  1M18 B;  5AY8 C;  4EO5 C;  2G5I C;  1Q9C A;  3AZF C;  1M19 D;  3X1T B;  5B2I C;  3LZ1 A;  3W98 D;  5AVC D;  2F2A C;  4J8V D;  4Z5T A;  3AZN D;  3WAA A;  2VQR A;  3AN2 A;  1JFI A;  3B0D C;  4WU8 C;  3A6N D;  3AV1 B;  2FJ7 D;  3AZJ C;  3MGS C;  3AFA C;  4H9N A;  5GSU B;  4H9P B;  1F66 D;  2Y2J A;  2Y2G A;  3B0C W;  1TZY A;  4KUD C;  5JRG B;  5B32 C;  1P3F B;  3H0R C;  2YFW B;  4G91 C;  1U35 C;  2JE5 A;  1N1J A;  5BS7 A;  1P3I B;  2CV5 D;  2F8N H;  2JCH A;  2Y2P A;  3W99 B;  3H0L C;  3LJA A;  3EPH A;  3C1C C;  1P3P A;  2HIO D;  5B40 A;  5AV9 A;  3AZG D;  3MGQ B;  1ID3 A;  1P3O A;  4H9O A;  3REL A;  1ZLA B;  3MGR C;  1HQ3 C;  4J8U A;  3X1V A;  5DNM B;  1P3M D;  3AV2 D;  3O62 C;  4JJN B;  5CP6 D;  4XUJ A;  3AZL B;  1P34 D;  4YM6 C;  3KWQ C;  3TU4 D;  3REK C;  1T3U A;  3KXB B;  3MVD C;  3C1B D;  5B31 D;  3W96 D;  3AZH A;  3UTA B;  5B0Z C;  5AV8 B;  5GT0 B;  5AY8 D;  4WNN B;  5E5A C;  5BNV A;  5AV6 C;  4WU9 C;  2NZD C;  5G49 A;  5DNN C;  3AZF D;  5B2I D;  2Y2O A;  1M19 B;  2IO5 B;  3EPL A;  3W98 B;  5AVC B;  3KSY A;  4J8V B;  3AZN B;  2BG1 A;  3A6N B;  3AFA D;  3MGS D;  3X1S C;  3WKJ C;  2ZY3 A;  2HUE B;  3REH C;  3AZK C;  1F66 B;  1KX5 C;  3AYW C;  1S32 A;  4KUD D;  1F1E A;  3FDD A;  3B0B A;  3VH6 A;  3AZM A;  5F99 C;  1U35 D;  4QLC A;  3AZI C;  2CV5 B;  1M1A B;  5B1L C;  3UTB C;  5B33 C;  3LZ0 C;  1WWS A;  5CPI B;  3C1C D;  1KX4 C;  2HIO B;  3LZ1 C;  2RVQ C;  5B2J D;  2NQB B;  1P3K A;  3B6F A;  5B1M D;  1P3B A;  4Z5T C;  3WAA C;  3LEL A;  3AN2 C;  2YFV A;  5FUG B;  4Z66 B;  3MGR D;  1HQ3 D;  3REJ A;  1B6W A;  3IP4 C;  4WZS B;  3O62 D;  1P3M B;  3AV2 B;  4H9R A;  4KGC A;  1ULY A;  5CP6 B;  4LD9 D;  5KDM A;  3KWQ D;  1TZY C;  1TAF B;  3TU4 B;  3UT9 A;  2CWE A;  4AWL B;  4Z2M H;  3C1B B;  5B31 B;  5B0Z D;  3W96 B;  1M18 A;  2Y2K A;  5E5A D;  2NZD D;  5AY8 B;  5GT3 B;  5DNN D;  3X1T A;  5BNX B;  1WWI A;  3LJA C;  5B2I B;  5B0Y C;  2Y2N A;  2Y2Q A;  3AV1 A;  5GXQ C;  1P3P C;  3REI C;  1ID3 C;  5GSU A;  1EQZ D;  3MGS B;  3WKJ D;  3REH D;  1BFM A;  4H9P A;  3REL C;  3WA9 D;  5JRG A;  4J8U C;  3X1V C;  1P3F A;  2YFW A;  2L5A A;  5F99 D;  4XUJ C;  2G5H C;  3AZI D;  3EPK A;  5B1L D;  3UTB D;  3W99 A;  2W8S A;  2ARO D;  1KX3 D;  4ZBJ C;  3MGP C;  4J8X C;  3C1C B;  5B24 C; 
#chains in the Genus database with same CATH homology
 4X23 C;  5B2J B;  4Z5T D;  1ZLA A;  4NFT A;  5B1M B;  1AOI C;  2BYM B;  3W97 A;  5DNM A;  3A1I A;  1HQ3 B;  3MGR B;  4JJN A;  5AVB C;  1B67 A;  3O62 B;  2PYO C;  1S32 C;  4LD9 B;  1TZY D;  2F8N B;  3KWQ B;  3KXB A;  3AZM C;  3AZE A;  5AV8 A;  5GT0 A;  4WNN A;  5CPJ C;  4UPK A;  5E5A B;  1M19 A;  5DNN B;  3W98 A;  2FFF B;  3B0C T;  1BH8 B;  3VH6 W;  3LJA D;  1P3G C;  5B0Y D;  4J8V A;  2XD1 A;  3AZN A;  5GXQ D;  4R8P D;  3P5J B;  3A6N A;  3REI D;  1W2E A;  1P3K C;  3B6F C;  4NE6 A;  1P3B C;  1EQZ B;  4CSR B;  1F66 A;  2Y2L A;  3WTP A;  1P3A C;  4J8U D;  3X1V D;  3MNN B;  3WA9 B;  4XUJ D;  4KGC C;  3VH5 A;  5F99 B;  1M1A A;  3AZI B;  3UT9 C;  5B1L B;  3UTB B;  5CPI A;  4G92 C;  2ARO B;  3MGP D;  1KX3 B;  4J8X D;  1KU5 A;  5AV5 B;  5B24 D;  2HIO A;  3X1T C;  4ZUX A;  1KX4 B;  4X23 D;  2NQB A;  4YS3 C;  4NE3 A;  5FUG A;  4Z5T B;  4Z66 A;  4WU8 D;  1AOI D;  3AZJ D;  2FJ7 B;  1P3M A;  5AVB D;  3KUY A;  5CP6 A;  2PYO D;  1PZR A;  5CPK A;  1Z2C B;  5JRG C;  1TAF A;  3TU4 A;  1TZY B;  3AL0 C;  5B32 D;  2Y2I A;  4KHA B;  3C1B A;  5B31 A;  3W96 A;  4J8W C;  1P3L A;  5CPJ D;  5AY8 A;  5GT3 A;  3NQU B;  4XZQ C;  5BNX A;  4CAY A;  5B2I A;  3X1U C;  1P3G D;  3LJA B;  3R45 B;  5B0Y B;  5GXQ B;  4R8P B;  3MGS A;  3REI B;  3AZG B;  5BO0 B;  1P3K D;  3B6F D;  1P3B D;  1ZLA C;  3EG5 B;  3NQJ B;  1P3A D;  3W97 C;  5DNM C;  1A7W A;  4J8U B;  3B6G A;  1BH9 B;  4XUJ B;  1P34 B;  3H0M C;  4YM6 D;  3REK D;  1H3O B;  3UT9 D;  3MVD D;  5C3I B;  2BYK A;  5BS7 C;  5B31 G;  4H9Q B;  5AV8 C;  3AZE C;  5GT0 C;  4ZBJ B;  3C1C A;  3MGP B;  5AV6 D;  4WU9 D;  4J8X B;  4EO5 B;  5B24 B;  2IO5 C;  3W98 C;  3AZF B;  5B2J A;  4X23 B;  4YS3 D;  2RIQ A;  5B1M A;  2ZY4 A;  5AV9 C;  3A6N C;  2BYM A;  2Y2M A;  3B0D B;  4WU8 B;  1HQ3 A;  5B40 C;  1AOI B;  3X1S D;  2HUE C;  4HGA C;  3AFA B;  3AZJ B;  1P3O C;  3O62 A;  1F66 C;  5AVB B;  3AZK D;  3WTP C;  4LD9 A;  1KX5 D;  3AYW D;  2F8N A;  2PYO B;  3KWQ A;  4KUD B;  5B32 B;  4G91 B;  4H9S A;  3V9R B;  4J8W D;  1U35 B;  1P3I A;  1M1A C;  4NE5 A;  5E5A A;  5CPJ B;  4XZQ D;  4UUZ B;  1R4V A;  5B33 D;  3LZ0 D;  1BH8 A;  3X1U D;  3AZH C;  5CPI C;  1P3G B;  3VH5 W;  2HIO C;  4DQY B;  4ZUX C;  2NQB C;  3LZ1 D;  2RVQ D;  1EQZ A;  3B6F B;  1P3B B;  3WAA D;  4Z66 C;  3AN2 D;  1P3A B;  3W97 D;  3MNN A;  3WA9 A;  4E45 A;  2UWX A;  3KUY C;  5F99 A;  5CP6 C;  3AZL A;  5CPK C;  4YM6 B;  2F8N G;  3AZI A;  5B1L A;  3REK B;  3UT9 B;  3UTB A;  3MVD B;  3UTA A;  2J8P A;  3AZE D;  2ARO A;  1P3L C;  1KX3 A;  5B0Z B;  4QLC C;  5AV5 A;  5GT3 C;  1KX4 A;  2NZD B;  5AV6 B;  4WU9 B;  5AVC A;  4YS3 B;  2ZM5 A;  4E44 A;  5B40 D;  5AV9 D;  1P3P D;  1ID3 D;  2FJ7 A;  5JA4 B;  1P3O D;  3X1S B;  3WKJ B;  3LEL C;  3REH B;  3WTP D;  3REL D;  3AZK B;  1KX5 B;  3AYW B;  3VH6 T;  4DRB A;  3REJ C;  3B6G C;  4KHA A;  4J8W B;  2CV5 A;  1M1A D;  3NQU A;  4XZQ B;  4WV4 B;  2Y2H A;  3AZH D;  5B33 B;  3LZ0 B;  5CPI D;  2F8N K;  3X1U B;  3R45 A;  5B0Y A;  1M18 C;  5GXQ A;  4ZUX D;  4R8P A;  3REI A;  3AZG A;  5BO0 A;  2NQB D;  2DQN C;  5B2J C;  3LZ1 B;  5B1M C;  4Z66 D;  2DF4 C;  3NQJ A;  3AV1 C;  3WAA B;  3AN2 B;  1JFI B;  3KFU G;  5GSU C;  3W97 B;  2ZY5 A;  4H9N B;  3AV2 A;  1BH9 A;  3KUY D;  3MGQ A;  1P34 A;  5CHL B;  5CPK D;  4LD9 C;  1S32 D;  1H3O A;  1P3F C;  3AZM D;  4H9S C;  4WJ3 C;  4H9Q A;  1P3I C;  1N1J B;  1P3L D;  3AZE B;  4QLC D;  3MGP A;  5GT3 D;  4J8X A;  1HTA A;  5B24 A;  3W99 C;  3AZF A;  4X23 A;  4WU8 A;  1AOI A;  3MGQ C;  1P3P B;  5B40 B;  5AV9 B;  3AZJ A;  1ID3 B;  3AFA A;  1EQZ C;  4HGA B;  5AVB A;  1P3O B;  3LEL D;  4H9O B;  2PYO A;  3REL B;  3WTP B;  3WA9 C;  3MNN C;  3REJ D;  4KUD A;  3B6G D;  5B32 A;  3X1V B;  4JJN C;  3AZL C;  4Z2M G;  4KGC D;  3V9R A;  1U35 A;  5CPJ A;  3KXB C;  4UUZ A;  2LY8 A;  5BT1 C;  3F6T A;  3UTA C;  2ARO C;  3AZH B;  1P3G A;  1KX3 C;  1M18 D;  5AV5 C;  5BNV B;  3X1T D;  5G49 B;  4ZUX B;  1M19 C;  2JSS A;  5AVC C;  2XD5 A;  4J8V C;  3AZN C;  3AV1 D;  1P3A A;  2ZY2 A;  2FJ7 C;  5GSU D;  3MGR A;  3KUY B;  2F8N D;  5CPK B;  4YM6 A;  5JRG D;  1S32 B;  1P3F D;  3REK A;  3MVD A;  5B32 G;  3AZM B;  1P3I D;  3WTP E;  5B0Z A;  2CV5 C;  1P3L B;  4QLC B;  2NZD A;  5AV6 A;  4WU9 A;  3W99 D;  5DNN A;  4CAY B;  4M6B A;  4YS3 A;  3MGQ D;  4R8P C;  3AZG C;  5JA4 A;  3EPJ A;  3X1S A;  3WKJ A;  4CSR A;  3REH A;  1P3K B;  1ZLA D;  3AZK A;  3LEL B;  2YFV B;  3MNN D;  3AYW A;  1KX5 A;  5DNM D;  1P3M C;  3REJ B;  4JJN D;  3AV2 C;  3B6G B;  3VH5 T;  3A1K A;  3AZL D;  1P34 C;  4H9R B;  4KGC B;  4J8W A;  5KDM B;  3TU4 C;  3KXB D;  5C3I C;  4DRA A;  4AWL C;  4XZQ A;  5BT1 D;  3C1B C;  2BYK B;  5B31 C;  5B33 A;  3LZ0 A;  3W96 C;  3UTA D;  3X1U A;  5AV8 D;  5GT0 D;  1KX4 D;  5AV5 D;  4G92 B;  1M18 B;  5AY8 C;  4EO5 C;  2G5I C;  1Q9C A;  3AZF C;  1M19 D;  3X1T B;  5B2I C;  3LZ1 A;  3W98 D;  5AVC D;  2F2A C;  4J8V D;  4Z5T A;  3AZN D;  3WAA A;  2VQR A;  3AN2 A;  1JFI A;  3B0D C;  4WU8 C;  3A6N D;  3AV1 B;  2FJ7 D;  3AZJ C;  3MGS C;  3AFA C;  4H9N A;  5GSU B;  4H9P B;  1F66 D;  2Y2J A;  2Y2G A;  3B0C W;  1TZY A;  4KUD C;  5JRG B;  5B32 C;  1P3F B;  3H0R C;  2YFW B;  4G91 C;  1U35 C;  2JE5 A;  1N1J A;  5BS7 A;  1P3I B;  2CV5 D;  2F8N H;  2JCH A;  2Y2P A;  3W99 B;  3H0L C;  3LJA A;  3EPH A;  3C1C C;  1P3P A;  2HIO D;  5B40 A;  5AV9 A;  3AZG D;  3MGQ B;  1ID3 A;  1P3O A;  4H9O A;  3REL A;  1ZLA B;  3MGR C;  1HQ3 C;  4J8U A;  3X1V A;  5DNM B;  1P3M D;  3AV2 D;  3O62 C;  4JJN B;  5CP6 D;  4XUJ A;  3AZL B;  1P34 D;  4YM6 C;  3KWQ C;  3TU4 D;  3REK C;  1T3U A;  3KXB B;  3MVD C;  3C1B D;  5B31 D;  3W96 D;  3AZH A;  3UTA B;  5B0Z C;  5AV8 B;  5GT0 B;  5AY8 D;  4WNN B;  5E5A C;  5BNV A;  5AV6 C;  4WU9 C;  2NZD C;  5G49 A;  5DNN C;  3AZF D;  5B2I D;  2Y2O A;  1M19 B;  2IO5 B;  3EPL A;  3W98 B;  5AVC B;  3KSY A;  4J8V B;  3AZN B;  2BG1 A;  3A6N B;  3AFA D;  3MGS D;  3X1S C;  3WKJ C;  2ZY3 A;  2HUE B;  3REH C;  3AZK C;  1F66 B;  1KX5 C;  3AYW C;  1S32 A;  4KUD D;  1F1E A;  3FDD A;  3B0B A;  3VH6 A;  3AZM A;  5F99 C;  1U35 D;  4QLC A;  3AZI C;  2CV5 B;  1M1A B;  5B1L C;  3UTB C;  5B33 C;  3LZ0 C;  1WWS A;  5CPI B;  3C1C D;  1KX4 C;  2HIO B;  3LZ1 C;  2RVQ C;  5B2J D;  2NQB B;  1P3K A;  3B6F A;  5B1M D;  1P3B A;  4Z5T C;  3WAA C;  3LEL A;  3AN2 C;  2YFV A;  5FUG B;  4Z66 B;  3MGR D;  1HQ3 D;  3REJ A;  1B6W A;  3IP4 C;  4WZS B;  3O62 D;  1P3M B;  3AV2 B;  4H9R A;  4KGC A;  1ULY A;  5CP6 B;  4LD9 D;  5KDM A;  3KWQ D;  1TZY C;  1TAF B;  3TU4 B;  3UT9 A;  2CWE A;  4AWL B;  4Z2M H;  3C1B B;  5B31 B;  5B0Z D;  3W96 B;  1M18 A;  2Y2K A;  5E5A D;  2NZD D;  5AY8 B;  5GT3 B;  5DNN D;  3X1T A;  5BNX B;  1WWI A;  3LJA C;  5B2I B;  5B0Y C;  2Y2N A;  2Y2Q A;  3AV1 A;  5GXQ C;  1P3P C;  3REI C;  1ID3 C;  5GSU A;  1EQZ D;  3MGS B;  3WKJ D;  3REH D;  1BFM A;  4H9P A;  3REL C;  3WA9 D;  5JRG A;  4J8U C;  3X1V C;  1P3F A;  2YFW A;  2L5A A;  5F99 D;  4XUJ C;  2G5H C;  3AZI D;  3EPK A;  5B1L D;  3UTB D;  3W99 A;  2W8S A;  2ARO D;  1KX3 D;  4ZBJ C;  3MGP C;  4J8X C;  3C1C B;  5B24 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...