1AOIA

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
molecule tags Dna binding protein/dna
source organism Xenopus laevis
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 1997-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiA00
4J8UC 4KUDA 2NQBD 5GSUD 5B31B 3LJAD 3AV2C 3KUYB 1B6WA 1Q9CA 5BS7A 2BYMA 3TU4A 3KXBB 5AV6B 4XUJB 3A6NC 3X1UC 3VH5W 4J8VB 3WTPD 3MNNC 3B0DC 5B1MA 5BS7C 3AV1C 3AZHC 4H9RA 4J8UB 3X1TD 5DNMA 5B0ZA 3LELA 3R45A 3AN2C 4J8UA 5B1LC 4KUDC 1KX3C 1R4VA 3W97A 3AYWC 3AZFD 3LELC 1P3AA 3R45B 3REKB 1HQ3B 5CP6A 3AZIA 3LZ0B 3LZ1B 3AZEC 4LD9D 1HQ3A 5B2JD 5B2IC 1P34A 4Z66A 3B6FC 1P3OC 3AZNA 3AYWD 3B0DB 2RVQD 5AVBD 3TU4C 3W99A 4J8WB 4Z66B 3AN2D 3X1VB 3REJD 4X23B 3REID 3WAAD 1P3FB 3AZFC 3MGPC 3W99C 5CPKD 3X1VA 1KX4B 4H9OA 5B2IB 5AVBB 5B40C 4NE3A 2NZDA 4WU8D 3AZEB 4R8PB 4H9OB 1P3FD 1N1JB 3A6ND 1AOIA 5B32G 3AZJA 3AZEA 4H9PB 3MNND 4YM6B 1P3OD 1KX3A 3AZLA 2F8NH 2CV5A 4WNNA 2LY8A 3AZHB 5B0ZC 4UUZA 4KHAA 3C1CC 3MGPA 4WNNB 3MGSC 5CPIB 3AZKC 4QLCC 2F8NB 2F8NG 3NQUA 1P3KC 4WU9A 3W98B 3WTPB 3AZMC 1TAFA 1P3PD 2F8NA 1KX5D 5AV9D 5B0ZD 3WKJD 5DNNA 3C1CB 3AZFA 5KDMA 3AV2A 5B32A 3MVDD 1BH9A 2PYOD 5B32B 3RELD 5B1LA 3B6FA 3C1BC 2FJ7B 4CSRB 1F66C 3WKJC 1ZLAB 5DNMC 3VH6W 3AV1A 2NQBB 3W99D 3MGQB 3KWQA 1TZYB 4KUDD 3REKD 1F66A 2BYKA 2HIOB 3X1TC 1F66B 4DRAA 4G91B 3RELC 4EO5B 5B32C 5GXQB 1P3IB 4NE6A 3B0CT 4KUDB 5GXQD 1P3ID 1M18C 5B2JC 5DNMD 2HIOC 4AWLB 5JA4A 3MNNA 3AZGC 4J8VD 3X1UA 1EQZD 2NQBC 5JA4B 2BYMB 4WU9C 3MNNB 2HUEC 5B32D 3RELB 4H9NB 4QLCA 3W98C 1M1AD 3LJAA 5AV5B 4JJNB 4KGCB 5GT0A 4R8PD 1BFMA 5B40D 5BNXA 3LJAB 3MGRC 5CPKC 4WU9D 3LZ0A 5AV5D 5B0YC 2PYOC 4LD9B 3X1VD 4WZSB 4J8XA 3O62C 3REKA 1P3LD 4KGCC 4JJNC 1KX5B 4LD9A 1JFIB 4YS3D 4J8XB 5GSUC 3LELD 5AY8C 1JFIA 3MGRD 5GT3A 3AZNB 5AVBA 4J8WA 3AZKD 1BH8A 1N1JA 4Z66C 3UTBC 5E5AC 5B0YB 4Z2MH 5B2IA 4YM6A 3WAAC 3REIC 3NQJA 3X1SB 3MGQD 1P3MD 4R8PA 1AOIB 1M19C 3AZJB 4H9QA 1ZLAD 3KXBD 4H9PA 5AV9A 5B31D 5CPJA 1P3FC 3KUYD 5BO0A 5AV9B 5C3IC 4Z5TA 3AZHA 3VH5A 5B1MC 2AROC 1EQZB 3UT9C 1P3PB 5B24A 3AZFB 4EO5C 1P3PA 3VH5T 3MGSD 3WTPA 5AV6C 3LZ0D 5C3IB 3KXBC 5F99C 5AY8D 3X1TB 3O62D 5B1LB 3UTAA 3O62B 1P3BC 3AZGD 3WA9C 5KDMB 5AV8B 3AFAD 3REHC 5CPIC 2CWEA 4WV4B 3MGSB 1ID3C 4ZUXB 3REJA 2HIOD 4H9SC 3LZ1C 5AY8B 5B1LD 5AV6D 4G92C 2FJ7A 1ZLAA 1P3LB 3UTBD 1S32A 1A7WA 5E5AA 4WU8B 2IO5B 4XZQB 5JRGA 4XZQD 3W96B 4QLCD 5B31C 3V9RB 3AFAC 3REHD 1ID3D 5AV8C 3REHB 1ID3B 5BNVA 4DRBA 2RVQC 5AVBC 4XUJA 3AZLD 3X1UB 4J8VA 5GXQA 1P3IA 3KWQD 5B0YD 1P3LC 4KGCD 4H9RB 5AVCA 1S32C 2HUEB 4JJNA 5AV8D 3AFAB 4XZQC 2AROD 2AROB 3WA9B 3AFAA 4WU8C 4YS3A 3AZHD 1P3AB 3W97B 3UT9D 1P3GC 5JRGC 5AV5A 4Z2MG 5CP6B 3AZIB 5DNND 5F99B 5DNMB 5GT3D 4YS3B 3LELB 1H3OA 4G92B 5CPID 1P34B 3WA9D 3MVDA 1S32D 3B6FD 1M1AA 1P3MC 4H9SA 3LZ1A 5AVCC 4J8XD 3X1SC 4X23A 5B2ID 4YM6D 3AZGA 3B0CW 4ZBJB 1KX5A 5GXQC 1P3IC 3AZMD 1KX4A 3UTAC 5B31G 4XUJC 3A6NB 1M18A 2NZDB 1P3PC 1P3MB 5CPJC 1U35A 5B1MD 1P3MA 3W98D 3REIB 3WAAB 3X1SD 4H9QB 3KWQC 1U35B 3UTBB 1KX3B 5B33B 3WKJB 4YM6C 4Z5TC 1P3GB 3VH6A 1M19B 5CPIA 1M19D 5CPJD 1P3GD 5CPJB 2YFVA 5B24B 5BO0B 1TAFB 4KHAB 5DNNC 1KX5C 4Z5TB 3MGPB 1WWSA 4X23C 3KUYC 4WU9B 5FUGA 2FJ7D 3X1UD 5G49A 1EQZA 3O62A 3W96C 1HTAA 2JSSA 3MVDC 5B40B 3B6GA 3MGSA 5G49B 5GSUB 1KX4C 3REJB 5AY8A 3LZ0C 5GT0D 3WTPE 3MGRA 5GSUA 3AZLC 3VH6T 4LD9C 3AYWB 4ZBJC 1BH9B 1TZYA 4X23D 3B6FB 2YFWA 4J8WD 3AN2B 4R8PC 2BYKB 5E5AD 1TZYC 3AZJC 5JRGD 3KSYA 1P3BB 3AV1B 3V9RA 1P3LA 2NQBA 3REHA 1ID3A 5BNVB 1S32B 3MGPD 1P3BA 4G91C 4YS3C 4WU8A 5GT0C 2HIOA 4J8WC 3B6GC 3TU4B 4XZQA 5JRGB 3TU4D 3KXBA 5AV6A 3W96A 1P3OB 4ZUXD 5B31A 1EQZC 5AVCB 3KUYA 3AZNC 5B1MB 1P3AD 1P3OA 4AWLC 3W97D 1KX3D 4E45A 2AROA 4KGCA 5GT0B 5B33D 5BNXB 3C1BB 2FJ7C 4M6BA 2PYOA 1KU5A 3RELA 4Z66D 3W97C 4H9NA 4QLCB 3C1BA 2PYOB 3WA9A 3MVDB 5B0ZB 1M1AB 1B67A 5CHLB 4JJND 2IO5C 5F99A 3C1CD 1ZLAC 4Z5TD 3LZ1D 3WTPC 1H3OB 3AZMB 2F8NK 1P3KB 1U35C 1HQ3D 3AZMA 3UT9A 3A6NA 2L5AA 1AOID 5B24D 1P3KA 1M18D 4NFTA 3UT9B 3AZGB 1TZYD 5CP6D 3W99B 5GT3B 3UTAD 1M18B 1P3FA 2CV5C 3NQJB 3X1SA 5B24C 5B33A 1BH8B 5BT1C 1M1AC 3B0BA 4XUJD 1U35D 5CPKB 1KX4D 5B0YA 4ZUXC 3REIA 3WAAA 4NE5A 3AZED 1AOIC 3MGQC 3UTBA 1ULYA 3W96D 4HGAC 5CPKA 3WKJA 5AV5C 1F1EA 1P3GA 2NZDD 5AV9C 3X1VC 3AZLB 2CV5D 1M19A 2CV5B 3W98A 3AZJD 5BT1D 4UUZB 5GT3C 2F8ND 2YFVB 5B2JB 5B40A 2NZDC 3NQUB 3AZID 3C1BD 3B6GB 4J8VC 3UTAB 1HQ3C 5AVCD 4J8XC 5B2JA 1P34D 5AV8A 3AZKA 5FUGB 1WWIA 1F66D 4CSRA 4HGAB 5F99D 5DNNB 3C1CA 3AYWA 3AZND 3AV2D 1P3AC 3AV2B 3B6GD 3X1TA 3AZKB 2YFWB 3AN2A 1P3BD 4J8UD 3MGQA 1P34C 3LJAC 3MGRB 3REKC 4ZUXA 1P3KD 5E5AB 4CAYA 3AZIC 5CP6C 4E44A 3AV1D 3REJC 5B33C 4CAYB 3KWQB
chains in the Genus database with same CATH superfamily
4J8UC 4KUDA 2NQBD 5GSUD 5B31B 3LJAD 3AV2C 3KUYB 1B6WA 1Q9CA 5BS7A 1W2EA 2BYMA 3TU4A 3KXBB 5AV6B 4XUJB 3A6NC 3X1UC 3VH5W 4J8VB 3WTPD 3MNNC 3B0DC 2ZY5A 5B1MA 5BS7C 3AV1C 3AZHC 1PZRA 4H9RA 4J8UB 2G5IC 3X1TD 5DNMA 2UWXA 5B0ZA 3LELA 3R45A 3AN2C 4J8UA 5B1LC 4KUDC 1KX3C 1R4VA 3W97A 3AYWC 3AZFD 3LELC 1P3AA 3R45B 3REKB 1HQ3B 5CP6A 3AZIA 3LZ0B 3LZ1B 2XD5A 3AZEC 4LD9D 1HQ3A 5B2JD 5B2IC 1P34A 4Z66A 3B6FC 1P3OC 3AZNA 3AYWD 3B0DB 2RVQD 5AVBD 2Y2MA 3H0RC 3TU4C 3W99A 4J8WB 4Z66B 3AN2D 3X1VB 3REJD 4X23B 3REID 3WAAD 1P3FB 3AZFC 3MGPC 3W99C 5CPKD 3X1VA 1KX4B 4H9OA 5B2IB 5AVBB 5B40C 4NE3A 2NZDA 4WU8D 3AZEB 4DQYB 4R8PB 4H9OB 1P3FD 1Z2CB 1N1JB 3A6ND 1AOIA 5B32G 3AZJA 3AZEA 4H9PB 3MNND 2XD1A 2DF4C 4YM6B 1P3OD 1KX3A 3AZLA 2F8NH 3EPLA 2CV5A 2Y2IA 4WNNA 2LY8A 3AZHB 5B0ZC 4UUZA 4KHAA 3C1CC 3MGPA 4WNNB 3MGSC 5CPIB 3AZKC 4QLCC 3P5JB 2F8NB 2F8NG 2FFFB 3NQUA 1P3KC 4WU9A 3W98B 3WTPB 3AZMC 1TAFA 1P3PD 2F8NA 1KX5D 5AV9D 5B0ZD 2RIQA 3WKJD 3EG5B 5DNNA 3C1CB 3AZFA 5KDMA 3AV2A 5B32A 3MVDD 1BH9A 2PYOD 5B32B 3RELD 5B1LA 3B6FA 3C1BC 2FJ7B 4CSRB 1F66C 3WKJC 1ZLAB 5DNMC 3VH6W 3AV1A 2NQBB 3W99D 3MGQB 3KWQA 1TZYB 4KUDD 3REKD 1F66A 2BYKA 2HIOB 3X1TC 3A1IA 1F66B 4DRAA 4G91B 3RELC 4EO5B 5B32C 5GXQB 1P3IB 4NE6A 3B0CT 4KUDB 5GXQD 1P3ID 1M18C 5B2JC 5DNMD 2HIOC 4AWLB 4UPKA 5JA4A 3MNNA 3AZGC 4J8VD 3X1UA 1EQZD 2NQBC 5JA4B 2BYMB 4WU9C 3MNNB 2HUEC 3EPHA 5B32D 3RELB 4H9NB 4QLCA 3FDDA 3W98C 1M1AD 3LJAA 5AV5B 4JJNB 4KGCB 5GT0A 4R8PD 1BFMA 5B40D 5BNXA 3LJAB 3MGRC 5CPKC 4WU9D 3LZ0A 2Y2GA 2ZY3A 5AV5D 5B0YC 2PYOC 4LD9B 3X1VD 4WZSB 4J8XA 3O62C 3REKA 1P3LD 4KGCC 4JJNC 1KX5B 4LD9A 1JFIB 4YS3D 4J8XB 5GSUC 3LELD 5AY8C 1JFIA 3MGRD 5GT3A 3AZNB 5AVBA 4J8WA 3AZKD 3AL0C 1BH8A 1N1JA 4Z66C 3EPKA 3UTBC 5E5AC 5B0YB 4Z2MH 5B2IA 4YM6A 3WAAC 3REIC 3NQJA 3X1SB 3MGQD 1P3MD 4R8PA 1AOIB 1M19C 3AZJB 4H9QA 1ZLAD 3KXBD 4H9PA 5AV9A 5B31D 5CPJA 1P3FC 3KUYD 5BO0A 5AV9B 5C3IC 4Z5TA 3AZHA 3VH5A 5B1MC 2AROC 1EQZB 3UT9C 1P3PB 5B24A 2Y2PA 3AZFB 4EO5C 1P3PA 3VH5T 3MGSD 3WTPA 5AV6C 5C3IB 3KXBC 3LZ0D 5F99C 5AY8D 3X1TB 3O62D 5B1LB 3UTAA 3O62B 1P3BC 3AZGD 3WA9C 5KDMB 5AV8B 3AFAD 3REHC 5CPIC 2CWEA 4WV4B 3MGSB 1ID3C 4ZUXB 3REJA 2HIOD 4H9SC 3LZ1C 5AY8B 5B1LD 5AV6D 4G92C 2FJ7A 1ZLAA 1P3LB 3UTBD 1S32A 1A7WA 5E5AA 4WU8B 2IO5B 4XZQB 5JRGA 4XZQD 3W96B 3EPJA 4QLCD 5B31C 3V9RB 3AFAC 3REHD 1ID3D 5AV8C 3REHB 1ID3B 5BNVA 4DRBA 2RVQC 5AVBC 4XUJA 3AZLD 3X1UB 4J8VA 5GXQA 1P3IA 3KWQD 5B0YD 1P3LC 4KGCD 2JE5A 4H9RB 5AVCA 1S32C 2HUEB 4JJNA 5AV8D 3AFAB 4XZQC 2AROD 2AROB 3WA9B 3AFAA 4WU8C 4YS3A 3AZHD 2F2AC 1P3AB 3W97B 3UT9D 1P3GC 5JRGC 5AV5A 4Z2MG 5CP6B 3AZIB 5DNND 5F99B 5DNMB 5GT3D 4YS3B 3LELB 1H3OA 4G92B 5CPID 1P34B 3WA9D 3MVDA 1S32D 3B6FD 1M1AA 1P3MC 4H9SA 3LZ1A 5AVCC 2ZM5A 4J8XD 3X1SC 4X23A 2JCHA 5B2ID 4YM6D 3AZGA 3B0CW 4ZBJB 1KX5A 5GXQC 1P3IC 3AZMD 1KX4A 3UTAC 5B31G 4XUJC 3A6NB 1M18A 2NZDB 2ZY4A 1P3PC 1P3MB 5CPJC 1U35A 5B1MD 1P3MA 3W98D 3REIB 3WAAB 3X1SD 4H9QB 3KWQC 1U35B 3UTBB 1KX3B 5B33B 3WKJB 4YM6C 4Z5TC 1P3GB 3VH6A 1M19B 5CPIA 1M19D 5CPJD 1P3GD 5CPJB 2Y2KA 2YFVA 5B24B 5BO0B 1TAFB 4KHAB 5DNNC 3A1KA 1KX5C 4Z5TB 3MGPB 1WWSA 2VQRA 4X23C 3KUYC 4WU9B 5FUGA 2FJ7D 3X1UD 5G49A 1EQZA 3O62A 3W96C 1HTAA 2JSSA 3MVDC 5B40B 3B6GA 3MGSA 2Y2QA 5G49B 5GSUB 1KX4C 3REJB 5AY8A 3LZ0C 2Y2NA 5GT0D 3WTPE 3MGRA 5GSUA 2G5HC 3AZLC 3VH6T 4LD9C 3AYWB 4ZBJC 1BH9B 1TZYA 4X23D 3H0MC 2YFWA 4J8WD 3AN2B 3B6FB 4R8PC 2BYKB 2Y2OA 5E5AD 1TZYC 3AZJC 5JRGD 3KSYA 1P3BB 3AV1B 3V9RA 1P3LA 2NQBA 3REHA 1ID3A 5BNVB 1S32B 3MGPD 1P3BA 4G91C 4YS3C 4WU8A 5GT0C 2HIOA 4J8WC 3B6GC 3TU4B 4XZQA 5JRGB 3TU4D 3KXBA 5AV6A 3W96A 1P3OB 4ZUXD 5B31A 1EQZC 2Y2HA 5AVCB 3KUYA 3AZNC 5B1MB 1P3AD 1P3OA 4AWLC 3W97D 1KX3D 3H0LC 4E45A 2AROA 4KGCA 5GT0B 5B33D 5BNXB 3C1BB 2FJ7C 4M6BA 2PYOA 1KU5A 3RELA 4Z66D 3W97C 4H9NA 4QLCB 3C1BA 2PYOB 3WA9A 3MVDB 5B0ZB 1M1AB 1B67A 5CHLB 4JJND 2IO5C 5F99A 3C1CD 1ZLAC 4Z5TD 3LZ1D 3WTPC 1H3OB 3AZMB 2F8NK 1P3KB 1U35C 1HQ3D 3AZMA 3UT9A 3A6NA 2L5AA 1AOID 5B24D 1P3KA 1M18D 4NFTA 3UT9B 3AZGB 1TZYD 4WJ3C 5CP6D 3W99B 5GT3B 2BG1A 3UTAD 1M18B 1P3FA 2CV5C 3NQJB 3X1SA 5B24C 5B33A 1BH8B 5BT1C 1M1AC 3B0BA 2DQNC 4XUJD 1U35D 5CPKB 1KX4D 5B0YA 4ZUXC 3REIA 3WAAA 4NE5A 2J8PA 3AZED 1AOIC 3MGQC 3UTBA 1ULYA 3W96D 4HGAC 5CPKA 3WKJA 5AV5C 1F1EA 1P3GA 2NZDD 5AV9C 3X1VC 1T3UA 3AZLB 2CV5D 2Y2LA 1M19A 2CV5B 3W98A 3AZJD 5BT1D 5GT3C 4UUZB 2F8ND 2YFVB 2W8SA 5B2JB 5B40A 2NZDC 3NQUB 3AZID 3C1BD 3B6GB 2ZY2A 4J8VC 3UTAB 1HQ3C 2Y2JA 5AVCD 4J8XC 5B2JA 1P34D 5AV8A 3AZKA 5FUGB 1WWIA 1F66D 4CSRA 4HGAB 5F99D 5DNNB 3C1CA 3AYWA 3AZND 3AV2D 1P3AC 3AV2B 3B6GD 3X1TA 3AZKB 2YFWB 3AN2A 1P3BD 4J8UD 3MGQA 1P34C 3IP4C 3LJAC 3MGRB 3REKC 4ZUXA 1P3KD 5E5AB 4CAYA 3AZIC 5CP6C 4E44A 3F6TA 3AV1D 3KFUG 3REJC 5B33C 4CAYB 3KWQB
chains in the Genus database with same CATH topology
4J8UC 4KUDA 2NQBD 5GSUD 5B31B 3LJAD 3AV2C 3KUYB 1B6WA 1Q9CA 5BS7A 1W2EA 2BYMA 3TU4A 3KXBB 5AV6B 4XUJB 3A6NC 3X1UC 3VH5W 4J8VB 3WTPD 3MNNC 3B0DC 2ZY5A 5B1MA 5BS7C 3AV1C 3AZHC 1PZRA 4H9RA 4J8UB 2G5IC 3X1TD 5DNMA 2UWXA 5B0ZA 3LELA 3R45A 3AN2C 4J8UA 5B1LC 4KUDC 1KX3C 1R4VA 3W97A 3AYWC 3AZFD 3LELC 1P3AA 3R45B 3REKB 1HQ3B 5CP6A 3AZIA 3LZ0B 3LZ1B 2XD5A 3AZEC 4LD9D 1HQ3A 5B2JD 5B2IC 1P34A 4Z66A 3B6FC 1P3OC 3AZNA 3AYWD 3B0DB 2RVQD 5AVBD 2Y2MA 3H0RC 3TU4C 3W99A 4J8WB 4Z66B 3AN2D 3X1VB 3REJD 4X23B 3REID 3WAAD 1P3FB 3AZFC 3MGPC 3W99C 5CPKD 3X1VA 1KX4B 4H9OA 5B2IB 5AVBB 5B40C 4NE3A 2NZDA 4WU8D 3AZEB 4DQYB 4R8PB 4H9OB 1P3FD 1Z2CB 1N1JB 3A6ND 1AOIA 5B32G 3AZJA 3AZEA 4H9PB 3MNND 2XD1A 2DF4C 4YM6B 1P3OD 1KX3A 3AZLA 2F8NH 3EPLA 2CV5A 2Y2IA 4WNNA 2LY8A 3AZHB 5B0ZC 4UUZA 4KHAA 3C1CC 3MGPA 4WNNB 3MGSC 5CPIB 3AZKC 4QLCC 3P5JB 2F8NB 2F8NG 2FFFB 3NQUA 1P3KC 4WU9A 3W98B 3WTPB 3AZMC 1TAFA 1P3PD 2F8NA 1KX5D 5AV9D 5B0ZD 2RIQA 3WKJD 3EG5B 5DNNA 3C1CB 3AZFA 5KDMA 3AV2A 5B32A 3MVDD 1BH9A 2PYOD 5B32B 3RELD 5B1LA 3B6FA 3C1BC 2FJ7B 4CSRB 1F66C 3WKJC 1ZLAB 5DNMC 3VH6W 3AV1A 2NQBB 3W99D 3MGQB 3KWQA 1TZYB 4KUDD 3REKD 1F66A 2BYKA 2HIOB 3X1TC 3A1IA 1F66B 4DRAA 4G91B 3RELC 4EO5B 5B32C 5GXQB 1P3IB 4NE6A 3B0CT 4KUDB 5GXQD 1P3ID 1M18C 5B2JC 5DNMD 2HIOC 4AWLB 4UPKA 5JA4A 3MNNA 3AZGC 4J8VD 3X1UA 1EQZD 2NQBC 5JA4B 2BYMB 4WU9C 3MNNB 2HUEC 3EPHA 5B32D 3RELB 4H9NB 4QLCA 3FDDA 3W98C 1M1AD 3LJAA 5AV5B 4JJNB 4KGCB 5GT0A 4R8PD 1BFMA 5B40D 5BNXA 3LJAB 3MGRC 5CPKC 4WU9D 3LZ0A 2Y2GA 2ZY3A 5AV5D 5B0YC 2PYOC 4LD9B 3X1VD 4WZSB 4J8XA 3O62C 3REKA 1P3LD 4KGCC 4JJNC 1KX5B 4LD9A 1JFIB 4YS3D 4J8XB 5GSUC 3LELD 5AY8C 1JFIA 3MGRD 5GT3A 3AZNB 5AVBA 4J8WA 3AZKD 3AL0C 1BH8A 1N1JA 4Z66C 3EPKA 3UTBC 5E5AC 5B0YB 4Z2MH 5B2IA 4YM6A 3WAAC 3REIC 3NQJA 3X1SB 3MGQD 1P3MD 4R8PA 1AOIB 1M19C 3AZJB 4H9QA 1ZLAD 3KXBD 4H9PA 5AV9A 5B31D 5CPJA 1P3FC 3KUYD 5BO0A 5AV9B 5C3IC 4Z5TA 3AZHA 3VH5A 5B1MC 2AROC 1EQZB 3UT9C 1P3PB 5B24A 2Y2PA 3AZFB 4EO5C 1P3PA 3VH5T 3MGSD 3WTPA 5AV6C 5C3IB 3KXBC 3LZ0D 5F99C 5AY8D 3X1TB 3O62D 5B1LB 3UTAA 3O62B 1P3BC 3AZGD 3WA9C 5KDMB 5AV8B 3AFAD 3REHC 5CPIC 2CWEA 4WV4B 3MGSB 1ID3C 4ZUXB 3REJA 2HIOD 4H9SC 3LZ1C 5AY8B 5B1LD 5AV6D 4G92C 2FJ7A 1ZLAA 1P3LB 3UTBD 1S32A 1A7WA 5E5AA 4WU8B 2IO5B 4XZQB 5JRGA 4XZQD 3W96B 3EPJA 4QLCD 5B31C 3V9RB 3AFAC 3REHD 1ID3D 5AV8C 3REHB 1ID3B 5BNVA 4DRBA 2RVQC 5AVBC 4XUJA 3AZLD 3X1UB 4J8VA 5GXQA 1P3IA 3KWQD 5B0YD 1P3LC 4KGCD 2JE5A 4H9RB 5AVCA 1S32C 2HUEB 4JJNA 5AV8D 3AFAB 4XZQC 2AROD 2AROB 3WA9B 3AFAA 4WU8C 4YS3A 3AZHD 2F2AC 1P3AB 3W97B 3UT9D 1P3GC 5JRGC 5AV5A 4Z2MG 5CP6B 3AZIB 5DNND 5F99B 5DNMB 5GT3D 4YS3B 3LELB 1H3OA 4G92B 5CPID 1P34B 3WA9D 3MVDA 1S32D 3B6FD 1M1AA 1P3MC 4H9SA 3LZ1A 5AVCC 2ZM5A 4J8XD 3X1SC 4X23A 2JCHA 5B2ID 4YM6D 3AZGA 3B0CW 4ZBJB 1KX5A 5GXQC 1P3IC 3AZMD 1KX4A 3UTAC 5B31G 4XUJC 3A6NB 1M18A 2NZDB 2ZY4A 1P3PC 1P3MB 5CPJC 1U35A 5B1MD 1P3MA 3W98D 3REIB 3WAAB 3X1SD 4H9QB 3KWQC 1U35B 3UTBB 1KX3B 5B33B 3WKJB 4YM6C 4Z5TC 1P3GB 3VH6A 1M19B 5CPIA 1M19D 5CPJD 1P3GD 5CPJB 2Y2KA 2YFVA 5B24B 5BO0B 1TAFB 4KHAB 5DNNC 3A1KA 1KX5C 4Z5TB 3MGPB 1WWSA 2VQRA 4X23C 3KUYC 4WU9B 5FUGA 2FJ7D 3X1UD 5G49A 1EQZA 3O62A 3W96C 1HTAA 2JSSA 3MVDC 5B40B 3B6GA 3MGSA 2Y2QA 5G49B 5GSUB 1KX4C 3REJB 5AY8A 3LZ0C 2Y2NA 5GT0D 3WTPE 3MGRA 5GSUA 2G5HC 3AZLC 3VH6T 4LD9C 3AYWB 4ZBJC 1BH9B 1TZYA 4X23D 3H0MC 2YFWA 4J8WD 3AN2B 3B6FB 4R8PC 2BYKB 2Y2OA 5E5AD 1TZYC 3AZJC 5JRGD 3KSYA 1P3BB 3AV1B 3V9RA 1P3LA 2NQBA 3REHA 1ID3A 5BNVB 1S32B 3MGPD 1P3BA 4G91C 4YS3C 4WU8A 5GT0C 2HIOA 4J8WC 3B6GC 3TU4B 4XZQA 5JRGB 3TU4D 3KXBA 5AV6A 3W96A 1P3OB 4ZUXD 5B31A 1EQZC 2Y2HA 5AVCB 3KUYA 3AZNC 5B1MB 1P3AD 1P3OA 4AWLC 3W97D 1KX3D 3H0LC 4E45A 2AROA 4KGCA 5GT0B 5B33D 5BNXB 3C1BB 2FJ7C 4M6BA 2PYOA 1KU5A 3RELA 4Z66D 3W97C 4H9NA 4QLCB 3C1BA 2PYOB 3WA9A 3MVDB 5B0ZB 1M1AB 1B67A 5CHLB 4JJND 2IO5C 5F99A 3C1CD 1ZLAC 4Z5TD 3LZ1D 3WTPC 1H3OB 3AZMB 2F8NK 1P3KB 1U35C 1HQ3D 3AZMA 3UT9A 3A6NA 2L5AA 1AOID 5B24D 1P3KA 1M18D 4NFTA 3UT9B 3AZGB 1TZYD 4WJ3C 5CP6D 3W99B 5GT3B 2BG1A 3UTAD 1M18B 1P3FA 2CV5C 3NQJB 3X1SA 5B24C 5B33A 1BH8B 5BT1C 1M1AC 3B0BA 2DQNC 4XUJD 1U35D 5CPKB 1KX4D 5B0YA 4ZUXC 3REIA 3WAAA 4NE5A 2J8PA 3AZED 1AOIC 3MGQC 3UTBA 1ULYA 3W96D 4HGAC 5CPKA 3WKJA 5AV5C 1F1EA 1P3GA 2NZDD 5AV9C 3X1VC 1T3UA 3AZLB 2CV5D 2Y2LA 1M19A 2CV5B 3W98A 3AZJD 5BT1D 5GT3C 4UUZB 2F8ND 2YFVB 2W8SA 5B2JB 5B40A 2NZDC 3NQUB 3AZID 3C1BD 3B6GB 2ZY2A 4J8VC 3UTAB 1HQ3C 2Y2JA 5AVCD 4J8XC 5B2JA 1P34D 5AV8A 3AZKA 5FUGB 1WWIA 1F66D 4CSRA 4HGAB 5F99D 5DNNB 3C1CA 3AYWA 3AZND 3AV2D 1P3AC 3AV2B 3B6GD 3X1TA 3AZKB 2YFWB 3AN2A 1P3BD 4J8UD 3MGQA 1P34C 3IP4C 3LJAC 3MGRB 3REKC 4ZUXA 1P3KD 5E5AB 4CAYA 3AZIC 5CP6C 4E44A 3F6TA 3AV1D 3KFUG 3REJC 5B33C 4CAYB 3KWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U C;  4KUD A;  2NQB D;  5GSU D;  5B31 B;  3LJA D;  3AV2 C;  3KUY B;  1B6W A;  1Q9C A;  5BS7 A;  2BYM A;  3TU4 A;  3KXB B;  5AV6 B;  4XUJ B;  3A6N C;  3X1U C;  3VH5 W;  4J8V B;  3WTP D;  3MNN C;  3B0D C;  5B1M A;  5BS7 C;  3AV1 C;  3AZH C;  4H9R A;  4J8U B;  3X1T D;  5DNM A;  5B0Z A;  3LEL A;  3R45 A;  3AN2 C;  4J8U A;  5B1L C;  4KUD C;  1KX3 C;  1R4V A;  3W97 A;  3AYW C;  3AZF D;  3LEL C;  1P3A A;  3R45 B;  3REK B;  1HQ3 B;  5CP6 A;  3AZI A;  3LZ0 B;  3LZ1 B;  3AZE C;  4LD9 D;  1HQ3 A;  5B2J D;  5B2I C;  1P34 A;  4Z66 A;  3B6F C;  1P3O C;  3AZN A;  3AYW D;  3B0D B;  2RVQ D;  5AVB D;  3TU4 C;  3W99 A;  4J8W B;  4Z66 B;  3AN2 D;  3X1V B;  3REJ D;  4X23 B;  3REI D;  3WAA D;  1P3F B;  3AZF C;  3MGP C;  3W99 C;  5CPK D;  3X1V A;  1KX4 B;  4H9O A;  5B2I B;  5AVB B;  5B40 C;  4NE3 A;  2NZD A;  4WU8 D;  3AZE B;  4R8P B;  4H9O B;  1P3F D;  1N1J B;  3A6N D;  1AOI A;  5B32 G;  3AZJ A;  3AZE A;  4H9P B;  3MNN D;  4YM6 B;  1P3O D;  1KX3 A;  3AZL A;  2F8N H;  2CV5 A;  4WNN A;  2LY8 A;  3AZH B;  5B0Z C;  4UUZ A;  4KHA A;  3C1C C;  3MGP A;  4WNN B;  3MGS C;  5CPI B;  3AZK C;  4QLC C;  2F8N B;  2F8N G;  3NQU A;  1P3K C;  4WU9 A;  3W98 B;  3WTP B;  3AZM C;  1TAF A;  1P3P D;  2F8N A;  1KX5 D;  5AV9 D;  5B0Z D;  3WKJ D;  5DNN A;  3C1C B;  3AZF A;  5KDM A;  3AV2 A;  5B32 A;  3MVD D;  1BH9 A;  2PYO D;  5B32 B;  3REL D;  5B1L A;  3B6F A;  3C1B C;  2FJ7 B;  4CSR B;  1F66 C;  3WKJ C;  1ZLA B;  5DNM C;  3VH6 W;  3AV1 A;  2NQB B;  3W99 D;  3MGQ B;  3KWQ A;  1TZY B;  4KUD D;  3REK D;  1F66 A;  2BYK A;  2HIO B;  3X1T C;  1F66 B;  4DRA A;  4G91 B;  3REL C;  4EO5 B;  5B32 C;  5GXQ B;  1P3I B;  4NE6 A;  3B0C T;  4KUD B;  5GXQ D;  1P3I D;  1M18 C;  5B2J C;  5DNM D;  2HIO C;  4AWL B;  5JA4 A;  3MNN A;  3AZG C;  4J8V D;  3X1U A;  1EQZ D;  2NQB C;  5JA4 B;  2BYM B;  4WU9 C;  3MNN B;  2HUE C;  5B32 D;  3REL B;  4H9N B;  4QLC A;  3W98 C;  1M1A D;  3LJA A;  5AV5 B;  4JJN B;  4KGC B;  5GT0 A;  4R8P D;  1BFM A;  5B40 D;  5BNX A;  3LJA B;  3MGR C;  5CPK C;  4WU9 D;  3LZ0 A;  5AV5 D;  5B0Y C;  2PYO C;  4LD9 B;  3X1V D;  4WZS B;  4J8X A;  3O62 C;  3REK A;  1P3L D;  4KGC C;  4JJN C;  1KX5 B;  4LD9 A;  1JFI B;  4YS3 D;  4J8X B;  5GSU C;  3LEL D;  5AY8 C;  1JFI A;  3MGR D;  5GT3 A;  3AZN B;  5AVB A;  4J8W A;  3AZK D;  1BH8 A;  1N1J A;  4Z66 C;  3UTB C;  5E5A C;  5B0Y B;  4Z2M H;  5B2I A;  4YM6 A;  3WAA C;  3REI C;  3NQJ A;  3X1S B;  3MGQ D;  1P3M D;  4R8P A;  1AOI B;  1M19 C;  3AZJ B;  4H9Q A;  1ZLA D;  3KXB D;  4H9P A;  5AV9 A;  5B31 D;  5CPJ A;  1P3F C;  3KUY D;  5BO0 A;  5AV9 B;  5C3I C;  4Z5T A;  3AZH A;  3VH5 A;  5B1M C;  2ARO C;  1EQZ B;  3UT9 C;  1P3P B;  5B24 A;  3AZF B;  4EO5 C;  1P3P A;  3VH5 T;  3MGS D;  3WTP A;  5AV6 C;  3LZ0 D;  5C3I B;  3KXB C;  5F99 C;  5AY8 D;  3X1T B;  3O62 D;  5B1L B;  3UTA A;  3O62 B;  1P3B C;  3AZG D;  3WA9 C;  5KDM B;  5AV8 B;  3AFA D;  3REH C;  5CPI C;  2CWE A;  4WV4 B;  3MGS B;  1ID3 C;  4ZUX B;  3REJ A;  2HIO D;  4H9S C;  3LZ1 C;  5AY8 B;  5B1L D;  5AV6 D;  4G92 C;  2FJ7 A;  1ZLA A;  1P3L B;  3UTB D;  1S32 A;  1A7W A;  5E5A A;  4WU8 B;  2IO5 B;  4XZQ B;  5JRG A;  4XZQ D;  3W96 B;  4QLC D;  5B31 C;  3V9R B;  3AFA C;  3REH D;  1ID3 D;  5AV8 C;  3REH B;  1ID3 B;  5BNV A;  4DRB A;  2RVQ C;  5AVB C;  4XUJ A;  3AZL D;  3X1U B;  4J8V A;  5GXQ A;  1P3I A;  3KWQ D;  5B0Y D;  1P3L C;  4KGC D;  4H9R B;  5AVC A;  1S32 C;  2HUE B;  4JJN A;  5AV8 D;  3AFA B;  4XZQ C;  2ARO D;  2ARO B;  3WA9 B;  3AFA A;  4WU8 C;  4YS3 A;  3AZH D;  1P3A B;  3W97 B;  3UT9 D;  1P3G C;  5JRG C;  5AV5 A;  4Z2M G;  5CP6 B;  3AZI B;  5DNN D;  5F99 B;  5DNM B;  5GT3 D;  4YS3 B;  3LEL B;  1H3O A;  4G92 B;  5CPI D;  1P34 B;  3WA9 D;  3MVD A;  1S32 D;  3B6F D;  1M1A A;  1P3M C;  4H9S A;  3LZ1 A;  5AVC C;  4J8X D;  3X1S C;  4X23 A;  5B2I D;  4YM6 D;  3AZG A;  3B0C W;  4ZBJ B;  1KX5 A;  5GXQ C;  1P3I C;  3AZM D;  1KX4 A;  3UTA C;  5B31 G;  4XUJ C;  3A6N B;  1M18 A;  2NZD B;  1P3P C;  1P3M B;  5CPJ C;  1U35 A;  5B1M D;  1P3M A;  3W98 D;  3REI B;  3WAA B;  3X1S D;  4H9Q B;  3KWQ C;  1U35 B;  3UTB B;  1KX3 B;  5B33 B;  3WKJ B;  4YM6 C;  4Z5T C;  1P3G B;  3VH6 A;  1M19 B;  5CPI A;  1M19 D;  5CPJ D;  1P3G D;  5CPJ B;  2YFV A;  5B24 B;  5BO0 B;  1TAF B;  4KHA B;  5DNN C;  1KX5 C;  4Z5T B;  3MGP B;  1WWS A;  4X23 C;  3KUY C;  4WU9 B;  5FUG A;  2FJ7 D;  3X1U D;  5G49 A;  1EQZ A;  3O62 A;  3W96 C;  1HTA A;  2JSS A;  3MVD C;  5B40 B;  3B6G A;  3MGS A;  5G49 B;  5GSU B;  1KX4 C;  3REJ B;  5AY8 A;  3LZ0 C;  5GT0 D;  3WTP E;  3MGR A;  5GSU A;  3AZL C;  3VH6 T;  4LD9 C;  3AYW B;  4ZBJ C;  1BH9 B;  1TZY A;  4X23 D;  3B6F B;  2YFW A;  4J8W D;  3AN2 B;  4R8P C;  2BYK B;  5E5A D;  1TZY C;  3AZJ C;  5JRG D;  3KSY A;  1P3B B;  3AV1 B;  3V9R A;  1P3L A;  2NQB A;  3REH A;  1ID3 A;  5BNV B;  1S32 B;  3MGP D;  1P3B A;  4G91 C;  4YS3 C;  4WU8 A;  5GT0 C;  2HIO A;  4J8W C;  3B6G C;  3TU4 B;  4XZQ A;  5JRG B;  3TU4 D;  3KXB A;  5AV6 A;  3W96 A;  1P3O B;  4ZUX D;  5B31 A;  1EQZ C;  5AVC B;  3KUY A;  3AZN C;  5B1M B;  1P3A D;  1P3O A;  4AWL C;  3W97 D;  1KX3 D;  4E45 A;  2ARO A;  4KGC A;  5GT0 B;  5B33 D;  5BNX B;  3C1B B;  2FJ7 C;  4M6B A;  2PYO A;  1KU5 A;  3REL A;  4Z66 D;  3W97 C;  4H9N A;  4QLC B;  3C1B A;  2PYO B;  3WA9 A;  3MVD B;  5B0Z B;  1M1A B;  1B67 A;  5CHL B;  4JJN D;  2IO5 C;  5F99 A;  3C1C D;  1ZLA C;  4Z5T D;  3LZ1 D;  3WTP C;  1H3O B;  3AZM B;  2F8N K;  1P3K B;  1U35 C;  1HQ3 D;  3AZM A;  3UT9 A;  3A6N A;  2L5A A;  1AOI D;  5B24 D;  1P3K A;  1M18 D;  4NFT A;  3UT9 B;  3AZG B;  1TZY D;  5CP6 D;  3W99 B;  5GT3 B;  3UTA D;  1M18 B;  1P3F A;  2CV5 C;  3NQJ B;  3X1S A;  5B24 C;  5B33 A;  1BH8 B;  5BT1 C;  1M1A C;  3B0B A;  4XUJ D;  1U35 D;  5CPK B;  1KX4 D;  5B0Y A;  4ZUX C;  3REI A;  3WAA A;  4NE5 A;  3AZE D;  1AOI C;  3MGQ C;  3UTB A;  1ULY A;  3W96 D;  4HGA C;  5CPK A;  3WKJ A;  5AV5 C;  1F1E A;  1P3G A;  2NZD D;  5AV9 C;  3X1V C;  3AZL B;  2CV5 D;  1M19 A;  2CV5 B;  3W98 A;  3AZJ D;  5BT1 D;  4UUZ B;  5GT3 C;  2F8N D;  2YFV B;  5B2J B;  5B40 A;  2NZD C;  3NQU B;  3AZI D;  3C1B D;  3B6G B;  4J8V C;  3UTA B;  1HQ3 C;  5AVC D;  4J8X C;  5B2J A;  1P34 D;  5AV8 A;  3AZK A;  5FUG B;  1WWI A;  1F66 D;  4CSR A;  4HGA B;  5F99 D;  5DNN B;  3C1C A;  3AYW A;  3AZN D;  3AV2 D;  1P3A C;  3AV2 B;  3B6G D;  3X1T A;  3AZK B;  2YFW B;  3AN2 A;  1P3B D;  4J8U D;  3MGQ A;  1P34 C;  3LJA C;  3MGR B;  3REK C;  4ZUX A;  1P3K D;  5E5A B;  4CAY A;  3AZI C;  5CP6 C;  4E44 A;  3AV1 D;  3REJ C;  5B33 C;  4CAY B;  3KWQ B; 
#chains in the Genus database with same CATH topology
 4J8U C;  4KUD A;  2NQB D;  5GSU D;  5B31 B;  3LJA D;  3AV2 C;  3KUY B;  1B6W A;  1Q9C A;  5BS7 A;  1W2E A;  2BYM A;  3TU4 A;  3KXB B;  5AV6 B;  4XUJ B;  3A6N C;  3X1U C;  3VH5 W;  4J8V B;  3WTP D;  3MNN C;  3B0D C;  2ZY5 A;  5B1M A;  5BS7 C;  3AV1 C;  3AZH C;  1PZR A;  4H9R A;  4J8U B;  2G5I C;  3X1T D;  5DNM A;  2UWX A;  5B0Z A;  3LEL A;  3R45 A;  3AN2 C;  4J8U A;  5B1L C;  4KUD C;  1KX3 C;  1R4V A;  3W97 A;  3AYW C;  3AZF D;  3LEL C;  1P3A A;  3R45 B;  3REK B;  1HQ3 B;  5CP6 A;  3AZI A;  3LZ0 B;  3LZ1 B;  2XD5 A;  3AZE C;  4LD9 D;  1HQ3 A;  5B2J D;  5B2I C;  1P34 A;  4Z66 A;  3B6F C;  1P3O C;  3AZN A;  3AYW D;  3B0D B;  2RVQ D;  5AVB D;  2Y2M A;  3H0R C;  3TU4 C;  3W99 A;  4J8W B;  4Z66 B;  3AN2 D;  3X1V B;  3REJ D;  4X23 B;  3REI D;  3WAA D;  1P3F B;  3AZF C;  3MGP C;  3W99 C;  5CPK D;  3X1V A;  1KX4 B;  4H9O A;  5B2I B;  5AVB B;  5B40 C;  4NE3 A;  2NZD A;  4WU8 D;  3AZE B;  4DQY B;  4R8P B;  4H9O B;  1P3F D;  1Z2C B;  1N1J B;  3A6N D;  1AOI A;  5B32 G;  3AZJ A;  3AZE A;  4H9P B;  3MNN D;  2XD1 A;  2DF4 C;  4YM6 B;  1P3O D;  1KX3 A;  3AZL A;  2F8N H;  3EPL A;  2CV5 A;  2Y2I A;  4WNN A;  2LY8 A;  3AZH B;  5B0Z C;  4UUZ A;  4KHA A;  3C1C C;  3MGP A;  4WNN B;  3MGS C;  5CPI B;  3AZK C;  4QLC C;  3P5J B;  2F8N B;  2F8N G;  2FFF B;  3NQU A;  1P3K C;  4WU9 A;  3W98 B;  3WTP B;  3AZM C;  1TAF A;  1P3P D;  2F8N A;  1KX5 D;  5AV9 D;  5B0Z D;  2RIQ A;  3WKJ D;  3EG5 B;  5DNN A;  3C1C B;  3AZF A;  5KDM A;  3AV2 A;  5B32 A;  3MVD D;  1BH9 A;  2PYO D;  5B32 B;  3REL D;  5B1L A;  3B6F A;  3C1B C;  2FJ7 B;  4CSR B;  1F66 C;  3WKJ C;  1ZLA B;  5DNM C;  3VH6 W;  3AV1 A;  2NQB B;  3W99 D;  3MGQ B;  3KWQ A;  1TZY B;  4KUD D;  3REK D;  1F66 A;  2BYK A;  2HIO B;  3X1T C;  3A1I A;  1F66 B;  4DRA A;  4G91 B;  3REL C;  4EO5 B;  5B32 C;  5GXQ B;  1P3I B;  4NE6 A;  3B0C T;  4KUD B;  5GXQ D;  1P3I D;  1M18 C;  5B2J C;  5DNM D;  2HIO C;  4AWL B;  4UPK A;  5JA4 A;  3MNN A;  3AZG C;  4J8V D;  3X1U A;  1EQZ D;  2NQB C;  5JA4 B;  2BYM B;  4WU9 C;  3MNN B;  2HUE C;  3EPH A;  5B32 D;  3REL B;  4H9N B;  4QLC A;  3FDD A;  3W98 C;  1M1A D;  3LJA A;  5AV5 B;  4JJN B;  4KGC B;  5GT0 A;  4R8P D;  1BFM A;  5B40 D;  5BNX A;  3LJA B;  3MGR C;  5CPK C;  4WU9 D;  3LZ0 A;  2Y2G A;  2ZY3 A;  5AV5 D;  5B0Y C;  2PYO C;  4LD9 B;  3X1V D;  4WZS B;  4J8X A;  3O62 C;  3REK A;  1P3L D;  4KGC C;  4JJN C;  1KX5 B;  4LD9 A;  1JFI B;  4YS3 D;  4J8X B;  5GSU C;  3LEL D;  5AY8 C;  1JFI A;  3MGR D;  5GT3 A;  3AZN B;  5AVB A;  4J8W A;  3AZK D;  3AL0 C;  1BH8 A;  1N1J A;  4Z66 C;  3EPK A;  3UTB C;  5E5A C;  5B0Y B;  4Z2M H;  5B2I A;  4YM6 A;  3WAA C;  3REI C;  3NQJ A;  3X1S B;  3MGQ D;  1P3M D;  4R8P A;  1AOI B;  1M19 C;  3AZJ B;  4H9Q A;  1ZLA D;  3KXB D;  4H9P A;  5AV9 A;  5B31 D;  5CPJ A;  1P3F C;  3KUY D;  5BO0 A;  5AV9 B;  5C3I C;  4Z5T A;  3AZH A;  3VH5 A;  5B1M C;  2ARO C;  1EQZ B;  3UT9 C;  1P3P B;  5B24 A;  2Y2P A;  3AZF B;  4EO5 C;  1P3P A;  3VH5 T;  3MGS D;  3WTP A;  5AV6 C;  5C3I B;  3KXB C;  3LZ0 D;  5F99 C;  5AY8 D;  3X1T B;  3O62 D;  5B1L B;  3UTA A;  3O62 B;  1P3B C;  3AZG D;  3WA9 C;  5KDM B;  5AV8 B;  3AFA D;  3REH C;  5CPI C;  2CWE A;  4WV4 B;  3MGS B;  1ID3 C;  4ZUX B;  3REJ A;  2HIO D;  4H9S C;  3LZ1 C;  5AY8 B;  5B1L D;  5AV6 D;  4G92 C;  2FJ7 A;  1ZLA A;  1P3L B;  3UTB D;  1S32 A;  1A7W A;  5E5A A;  4WU8 B;  2IO5 B;  4XZQ B;  5JRG A;  4XZQ D;  3W96 B;  3EPJ A;  4QLC D;  5B31 C;  3V9R B;  3AFA C;  3REH D;  1ID3 D;  5AV8 C;  3REH B;  1ID3 B;  5BNV A;  4DRB A;  2RVQ C;  5AVB C;  4XUJ A;  3AZL D;  3X1U B;  4J8V A;  5GXQ A;  1P3I A;  3KWQ D;  5B0Y D;  1P3L C;  4KGC D;  2JE5 A;  4H9R B;  5AVC A;  1S32 C;  2HUE B;  4JJN A;  5AV8 D;  3AFA B;  4XZQ C;  2ARO D;  2ARO B;  3WA9 B;  3AFA A;  4WU8 C;  4YS3 A;  3AZH D;  2F2A C;  1P3A B;  3W97 B;  3UT9 D;  1P3G C;  5JRG C;  5AV5 A;  4Z2M G;  5CP6 B;  3AZI B;  5DNN D;  5F99 B;  5DNM B;  5GT3 D;  4YS3 B;  3LEL B;  1H3O A;  4G92 B;  5CPI D;  1P34 B;  3WA9 D;  3MVD A;  1S32 D;  3B6F D;  1M1A A;  1P3M C;  4H9S A;  3LZ1 A;  5AVC C;  2ZM5 A;  4J8X D;  3X1S C;  4X23 A;  2JCH A;  5B2I D;  4YM6 D;  3AZG A;  3B0C W;  4ZBJ B;  1KX5 A;  5GXQ C;  1P3I C;  3AZM D;  1KX4 A;  3UTA C;  5B31 G;  4XUJ C;  3A6N B;  1M18 A;  2NZD B;  2ZY4 A;  1P3P C;  1P3M B;  5CPJ C;  1U35 A;  5B1M D;  1P3M A;  3W98 D;  3REI B;  3WAA B;  3X1S D;  4H9Q B;  3KWQ C;  1U35 B;  3UTB B;  1KX3 B;  5B33 B;  3WKJ B;  4YM6 C;  4Z5T C;  1P3G B;  3VH6 A;  1M19 B;  5CPI A;  1M19 D;  5CPJ D;  1P3G D;  5CPJ B;  2Y2K A;  2YFV A;  5B24 B;  5BO0 B;  1TAF B;  4KHA B;  5DNN C;  3A1K A;  1KX5 C;  4Z5T B;  3MGP B;  1WWS A;  2VQR A;  4X23 C;  3KUY C;  4WU9 B;  5FUG A;  2FJ7 D;  3X1U D;  5G49 A;  1EQZ A;  3O62 A;  3W96 C;  1HTA A;  2JSS A;  3MVD C;  5B40 B;  3B6G A;  3MGS A;  2Y2Q A;  5G49 B;  5GSU B;  1KX4 C;  3REJ B;  5AY8 A;  3LZ0 C;  2Y2N A;  5GT0 D;  3WTP E;  3MGR A;  5GSU A;  2G5H C;  3AZL C;  3VH6 T;  4LD9 C;  3AYW B;  4ZBJ C;  1BH9 B;  1TZY A;  4X23 D;  3H0M C;  2YFW A;  4J8W D;  3AN2 B;  3B6F B;  4R8P C;  2BYK B;  2Y2O A;  5E5A D;  1TZY C;  3AZJ C;  5JRG D;  3KSY A;  1P3B B;  3AV1 B;  3V9R A;  1P3L A;  2NQB A;  3REH A;  1ID3 A;  5BNV B;  1S32 B;  3MGP D;  1P3B A;  4G91 C;  4YS3 C;  4WU8 A;  5GT0 C;  2HIO A;  4J8W C;  3B6G C;  3TU4 B;  4XZQ A;  5JRG B;  3TU4 D;  3KXB A;  5AV6 A;  3W96 A;  1P3O B;  4ZUX D;  5B31 A;  1EQZ C;  2Y2H A;  5AVC B;  3KUY A;  3AZN C;  5B1M B;  1P3A D;  1P3O A;  4AWL C;  3W97 D;  1KX3 D;  3H0L C;  4E45 A;  2ARO A;  4KGC A;  5GT0 B;  5B33 D;  5BNX B;  3C1B B;  2FJ7 C;  4M6B A;  2PYO A;  1KU5 A;  3REL A;  4Z66 D;  3W97 C;  4H9N A;  4QLC B;  3C1B A;  2PYO B;  3WA9 A;  3MVD B;  5B0Z B;  1M1A B;  1B67 A;  5CHL B;  4JJN D;  2IO5 C;  5F99 A;  3C1C D;  1ZLA C;  4Z5T D;  3LZ1 D;  3WTP C;  1H3O B;  3AZM B;  2F8N K;  1P3K B;  1U35 C;  1HQ3 D;  3AZM A;  3UT9 A;  3A6N A;  2L5A A;  1AOI D;  5B24 D;  1P3K A;  1M18 D;  4NFT A;  3UT9 B;  3AZG B;  1TZY D;  4WJ3 C;  5CP6 D;  3W99 B;  5GT3 B;  2BG1 A;  3UTA D;  1M18 B;  1P3F A;  2CV5 C;  3NQJ B;  3X1S A;  5B24 C;  5B33 A;  1BH8 B;  5BT1 C;  1M1A C;  3B0B A;  2DQN C;  4XUJ D;  1U35 D;  5CPK B;  1KX4 D;  5B0Y A;  4ZUX C;  3REI A;  3WAA A;  4NE5 A;  2J8P A;  3AZE D;  1AOI C;  3MGQ C;  3UTB A;  1ULY A;  3W96 D;  4HGA C;  5CPK A;  3WKJ A;  5AV5 C;  1F1E A;  1P3G A;  2NZD D;  5AV9 C;  3X1V C;  1T3U A;  3AZL B;  2CV5 D;  2Y2L A;  1M19 A;  2CV5 B;  3W98 A;  3AZJ D;  5BT1 D;  5GT3 C;  4UUZ B;  2F8N D;  2YFV B;  2W8S A;  5B2J B;  5B40 A;  2NZD C;  3NQU B;  3AZI D;  3C1B D;  3B6G B;  2ZY2 A;  4J8V C;  3UTA B;  1HQ3 C;  2Y2J A;  5AVC D;  4J8X C;  5B2J A;  1P34 D;  5AV8 A;  3AZK A;  5FUG B;  1WWI A;  1F66 D;  4CSR A;  4HGA B;  5F99 D;  5DNN B;  3C1C A;  3AYW A;  3AZN D;  3AV2 D;  1P3A C;  3AV2 B;  3B6G D;  3X1T A;  3AZK B;  2YFW B;  3AN2 A;  1P3B D;  4J8U D;  3MGQ A;  1P34 C;  3IP4 C;  3LJA C;  3MGR B;  3REK C;  4ZUX A;  1P3K D;  5E5A B;  4CAY A;  3AZI C;  5CP6 C;  4E44 A;  3F6T A;  3AV1 D;  3KFU G;  3REJ C;  5B33 C;  4CAY B;  3KWQ B; 
#chains in the Genus database with same CATH homology
 4J8U C;  4KUD A;  2NQB D;  5GSU D;  5B31 B;  3LJA D;  3AV2 C;  3KUY B;  1B6W A;  1Q9C A;  5BS7 A;  1W2E A;  2BYM A;  3TU4 A;  3KXB B;  5AV6 B;  4XUJ B;  3A6N C;  3X1U C;  3VH5 W;  4J8V B;  3WTP D;  3MNN C;  3B0D C;  2ZY5 A;  5B1M A;  5BS7 C;  3AV1 C;  3AZH C;  1PZR A;  4H9R A;  4J8U B;  2G5I C;  3X1T D;  5DNM A;  2UWX A;  5B0Z A;  3LEL A;  3R45 A;  3AN2 C;  4J8U A;  5B1L C;  4KUD C;  1KX3 C;  1R4V A;  3W97 A;  3AYW C;  3AZF D;  3LEL C;  1P3A A;  3R45 B;  3REK B;  1HQ3 B;  5CP6 A;  3AZI A;  3LZ0 B;  3LZ1 B;  2XD5 A;  3AZE C;  4LD9 D;  1HQ3 A;  5B2J D;  5B2I C;  1P34 A;  4Z66 A;  3B6F C;  1P3O C;  3AZN A;  3AYW D;  3B0D B;  2RVQ D;  5AVB D;  2Y2M A;  3H0R C;  3TU4 C;  3W99 A;  4J8W B;  4Z66 B;  3AN2 D;  3X1V B;  3REJ D;  4X23 B;  3REI D;  3WAA D;  1P3F B;  3AZF C;  3MGP C;  3W99 C;  5CPK D;  3X1V A;  1KX4 B;  4H9O A;  5B2I B;  5AVB B;  5B40 C;  4NE3 A;  2NZD A;  4WU8 D;  3AZE B;  4DQY B;  4R8P B;  4H9O B;  1P3F D;  1Z2C B;  1N1J B;  3A6N D;  1AOI A;  5B32 G;  3AZJ A;  3AZE A;  4H9P B;  3MNN D;  2XD1 A;  2DF4 C;  4YM6 B;  1P3O D;  1KX3 A;  3AZL A;  2F8N H;  3EPL A;  2CV5 A;  2Y2I A;  4WNN A;  2LY8 A;  3AZH B;  5B0Z C;  4UUZ A;  4KHA A;  3C1C C;  3MGP A;  4WNN B;  3MGS C;  5CPI B;  3AZK C;  4QLC C;  3P5J B;  2F8N B;  2F8N G;  2FFF B;  3NQU A;  1P3K C;  4WU9 A;  3W98 B;  3WTP B;  3AZM C;  1TAF A;  1P3P D;  2F8N A;  1KX5 D;  5AV9 D;  5B0Z D;  2RIQ A;  3WKJ D;  3EG5 B;  5DNN A;  3C1C B;  3AZF A;  5KDM A;  3AV2 A;  5B32 A;  3MVD D;  1BH9 A;  2PYO D;  5B32 B;  3REL D;  5B1L A;  3B6F A;  3C1B C;  2FJ7 B;  4CSR B;  1F66 C;  3WKJ C;  1ZLA B;  5DNM C;  3VH6 W;  3AV1 A;  2NQB B;  3W99 D;  3MGQ B;  3KWQ A;  1TZY B;  4KUD D;  3REK D;  1F66 A;  2BYK A;  2HIO B;  3X1T C;  3A1I A;  1F66 B;  4DRA A;  4G91 B;  3REL C;  4EO5 B;  5B32 C;  5GXQ B;  1P3I B;  4NE6 A;  3B0C T;  4KUD B;  5GXQ D;  1P3I D;  1M18 C;  5B2J C;  5DNM D;  2HIO C;  4AWL B;  4UPK A;  5JA4 A;  3MNN A;  3AZG C;  4J8V D;  3X1U A;  1EQZ D;  2NQB C;  5JA4 B;  2BYM B;  4WU9 C;  3MNN B;  2HUE C;  3EPH A;  5B32 D;  3REL B;  4H9N B;  4QLC A;  3FDD A;  3W98 C;  1M1A D;  3LJA A;  5AV5 B;  4JJN B;  4KGC B;  5GT0 A;  4R8P D;  1BFM A;  5B40 D;  5BNX A;  3LJA B;  3MGR C;  5CPK C;  4WU9 D;  3LZ0 A;  2Y2G A;  2ZY3 A;  5AV5 D;  5B0Y C;  2PYO C;  4LD9 B;  3X1V D;  4WZS B;  4J8X A;  3O62 C;  3REK A;  1P3L D;  4KGC C;  4JJN C;  1KX5 B;  4LD9 A;  1JFI B;  4YS3 D;  4J8X B;  5GSU C;  3LEL D;  5AY8 C;  1JFI A;  3MGR D;  5GT3 A;  3AZN B;  5AVB A;  4J8W A;  3AZK D;  3AL0 C;  1BH8 A;  1N1J A;  4Z66 C;  3EPK A;  3UTB C;  5E5A C;  5B0Y B;  4Z2M H;  5B2I A;  4YM6 A;  3WAA C;  3REI C;  3NQJ A;  3X1S B;  3MGQ D;  1P3M D;  4R8P A;  1AOI B;  1M19 C;  3AZJ B;  4H9Q A;  1ZLA D;  3KXB D;  4H9P A;  5AV9 A;  5B31 D;  5CPJ A;  1P3F C;  3KUY D;  5BO0 A;  5AV9 B;  5C3I C;  4Z5T A;  3AZH A;  3VH5 A;  5B1M C;  2ARO C;  1EQZ B;  3UT9 C;  1P3P B;  5B24 A;  2Y2P A;  3AZF B;  4EO5 C;  1P3P A;  3VH5 T;  3MGS D;  3WTP A;  5AV6 C;  5C3I B;  3KXB C;  3LZ0 D;  5F99 C;  5AY8 D;  3X1T B;  3O62 D;  5B1L B;  3UTA A;  3O62 B;  1P3B C;  3AZG D;  3WA9 C;  5KDM B;  5AV8 B;  3AFA D;  3REH C;  5CPI C;  2CWE A;  4WV4 B;  3MGS B;  1ID3 C;  4ZUX B;  3REJ A;  2HIO D;  4H9S C;  3LZ1 C;  5AY8 B;  5B1L D;  5AV6 D;  4G92 C;  2FJ7 A;  1ZLA A;  1P3L B;  3UTB D;  1S32 A;  1A7W A;  5E5A A;  4WU8 B;  2IO5 B;  4XZQ B;  5JRG A;  4XZQ D;  3W96 B;  3EPJ A;  4QLC D;  5B31 C;  3V9R B;  3AFA C;  3REH D;  1ID3 D;  5AV8 C;  3REH B;  1ID3 B;  5BNV A;  4DRB A;  2RVQ C;  5AVB C;  4XUJ A;  3AZL D;  3X1U B;  4J8V A;  5GXQ A;  1P3I A;  3KWQ D;  5B0Y D;  1P3L C;  4KGC D;  2JE5 A;  4H9R B;  5AVC A;  1S32 C;  2HUE B;  4JJN A;  5AV8 D;  3AFA B;  4XZQ C;  2ARO D;  2ARO B;  3WA9 B;  3AFA A;  4WU8 C;  4YS3 A;  3AZH D;  2F2A C;  1P3A B;  3W97 B;  3UT9 D;  1P3G C;  5JRG C;  5AV5 A;  4Z2M G;  5CP6 B;  3AZI B;  5DNN D;  5F99 B;  5DNM B;  5GT3 D;  4YS3 B;  3LEL B;  1H3O A;  4G92 B;  5CPI D;  1P34 B;  3WA9 D;  3MVD A;  1S32 D;  3B6F D;  1M1A A;  1P3M C;  4H9S A;  3LZ1 A;  5AVC C;  2ZM5 A;  4J8X D;  3X1S C;  4X23 A;  2JCH A;  5B2I D;  4YM6 D;  3AZG A;  3B0C W;  4ZBJ B;  1KX5 A;  5GXQ C;  1P3I C;  3AZM D;  1KX4 A;  3UTA C;  5B31 G;  4XUJ C;  3A6N B;  1M18 A;  2NZD B;  2ZY4 A;  1P3P C;  1P3M B;  5CPJ C;  1U35 A;  5B1M D;  1P3M A;  3W98 D;  3REI B;  3WAA B;  3X1S D;  4H9Q B;  3KWQ C;  1U35 B;  3UTB B;  1KX3 B;  5B33 B;  3WKJ B;  4YM6 C;  4Z5T C;  1P3G B;  3VH6 A;  1M19 B;  5CPI A;  1M19 D;  5CPJ D;  1P3G D;  5CPJ B;  2Y2K A;  2YFV A;  5B24 B;  5BO0 B;  1TAF B;  4KHA B;  5DNN C;  3A1K A;  1KX5 C;  4Z5T B;  3MGP B;  1WWS A;  2VQR A;  4X23 C;  3KUY C;  4WU9 B;  5FUG A;  2FJ7 D;  3X1U D;  5G49 A;  1EQZ A;  3O62 A;  3W96 C;  1HTA A;  2JSS A;  3MVD C;  5B40 B;  3B6G A;  3MGS A;  2Y2Q A;  5G49 B;  5GSU B;  1KX4 C;  3REJ B;  5AY8 A;  3LZ0 C;  2Y2N A;  5GT0 D;  3WTP E;  3MGR A;  5GSU A;  2G5H C;  3AZL C;  3VH6 T;  4LD9 C;  3AYW B;  4ZBJ C;  1BH9 B;  1TZY A;  4X23 D;  3H0M C;  2YFW A;  4J8W D;  3AN2 B;  3B6F B;  4R8P C;  2BYK B;  2Y2O A;  5E5A D;  1TZY C;  3AZJ C;  5JRG D;  3KSY A;  1P3B B;  3AV1 B;  3V9R A;  1P3L A;  2NQB A;  3REH A;  1ID3 A;  5BNV B;  1S32 B;  3MGP D;  1P3B A;  4G91 C;  4YS3 C;  4WU8 A;  5GT0 C;  2HIO A;  4J8W C;  3B6G C;  3TU4 B;  4XZQ A;  5JRG B;  3TU4 D;  3KXB A;  5AV6 A;  3W96 A;  1P3O B;  4ZUX D;  5B31 A;  1EQZ C;  2Y2H A;  5AVC B;  3KUY A;  3AZN C;  5B1M B;  1P3A D;  1P3O A;  4AWL C;  3W97 D;  1KX3 D;  3H0L C;  4E45 A;  2ARO A;  4KGC A;  5GT0 B;  5B33 D;  5BNX B;  3C1B B;  2FJ7 C;  4M6B A;  2PYO A;  1KU5 A;  3REL A;  4Z66 D;  3W97 C;  4H9N A;  4QLC B;  3C1B A;  2PYO B;  3WA9 A;  3MVD B;  5B0Z B;  1M1A B;  1B67 A;  5CHL B;  4JJN D;  2IO5 C;  5F99 A;  3C1C D;  1ZLA C;  4Z5T D;  3LZ1 D;  3WTP C;  1H3O B;  3AZM B;  2F8N K;  1P3K B;  1U35 C;  1HQ3 D;  3AZM A;  3UT9 A;  3A6N A;  2L5A A;  1AOI D;  5B24 D;  1P3K A;  1M18 D;  4NFT A;  3UT9 B;  3AZG B;  1TZY D;  4WJ3 C;  5CP6 D;  3W99 B;  5GT3 B;  2BG1 A;  3UTA D;  1M18 B;  1P3F A;  2CV5 C;  3NQJ B;  3X1S A;  5B24 C;  5B33 A;  1BH8 B;  5BT1 C;  1M1A C;  3B0B A;  2DQN C;  4XUJ D;  1U35 D;  5CPK B;  1KX4 D;  5B0Y A;  4ZUX C;  3REI A;  3WAA A;  4NE5 A;  2J8P A;  3AZE D;  1AOI C;  3MGQ C;  3UTB A;  1ULY A;  3W96 D;  4HGA C;  5CPK A;  3WKJ A;  5AV5 C;  1F1E A;  1P3G A;  2NZD D;  5AV9 C;  3X1V C;  1T3U A;  3AZL B;  2CV5 D;  2Y2L A;  1M19 A;  2CV5 B;  3W98 A;  3AZJ D;  5BT1 D;  5GT3 C;  4UUZ B;  2F8N D;  2YFV B;  2W8S A;  5B2J B;  5B40 A;  2NZD C;  3NQU B;  3AZI D;  3C1B D;  3B6G B;  2ZY2 A;  4J8V C;  3UTA B;  1HQ3 C;  2Y2J A;  5AVC D;  4J8X C;  5B2J A;  1P34 D;  5AV8 A;  3AZK A;  5FUG B;  1WWI A;  1F66 D;  4CSR A;  4HGA B;  5F99 D;  5DNN B;  3C1C A;  3AYW A;  3AZN D;  3AV2 D;  1P3A C;  3AV2 B;  3B6G D;  3X1T A;  3AZK B;  2YFW B;  3AN2 A;  1P3B D;  4J8U D;  3MGQ A;  1P34 C;  3IP4 C;  3LJA C;  3MGR B;  3REK C;  4ZUX A;  1P3K D;  5E5A B;  4CAY A;  3AZI C;  5CP6 C;  4E44 A;  3F6T A;  3AV1 D;  3KFU G;  3REJ C;  5B33 C;  4CAY B;  3KWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...