1AOIA

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 1997-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiA00
5B2JD 3LZ0B 3REJD 1P3ID 3AZIB 3AYWB 3X1VA 5BT1C 5B0YB 4J8XC 3X1SC 1P34B 5B31C 2HUEC 5BNVB 5E5AC 4XZQB 2F8ND 3AN2A 3A6ND 4J8WA 3UTBA 5GXQC 3AZID 5GT3C 4CAYB 5F99B 5GSUC 1P34D 3MGQB 4XZQD 3AZNA 1S32C 4YS3B 3MGPA 3AZGA 3MNND 5DNMD 3KWQA 5CPKA 5AVCC 3UT9A 1P3OA 4QLCD 5CP6B 3AZJC 5B2JC 5F99D 3REHC 3REJC 3NQUA 3O62A 5BNXA 3B0DB 4G91C 1TAFA 4WZSB 4HGAB 5BO0A 3AFAB 2AROC 3W98A 1P3PC 3MGSA 5B1MA 1M1AB 3B6FD 5AV5D 3AV1B 4Z5TA 2YFWA 4H9RB 3AFAD 3W96B 2HIOC 3W97B 4Z2MH 4WU9D 4H9PA 3MNNC 3UTAD 5DNMC 2CV5B 1M1AD 1F66C 4LD9B 1P3BB 3AV1D 4Z2MG 4WNNB 4QLCC 2PYOC 4ZBJB 3VH6A 4J8UB 5CHLB 1ID3B 4ZUXA 4EO5C 3W97D 5B40D 1P3GD 4H9SA 3REIB 4E44A 4R8PC 3LJAA 3MVDB 3X1VD 1P3MC 1BH9A 5AV6C 3AZEC 4J8UD 1JFIB 4WU8C 1P3IA 3W99C 5B24B 5B32B 5BS7A 4J8WD 2BYMB 1WWSA 3KUYB 4WU9C 3UTAC 3LZ0A 3B0BA 3AYWA 3AZIA 4JJNB 1N1JB 5B0YA 1P34A 5BNVA 3WAAC 4XZQA 5CPIB 5CPKD 1P3AB 1P3OD 5CPJB 1ZLAB 5G49B 3LELC 5B40C 4XUJB 3REKD 3O62D 5AY8C 4JJND 4CAYA 5F99A 1AOIB 3MGQA 1P3AD 3MGSD 5CPID 5CPJD 5B1MD 4YS3A 4Z66B 3WTPB 3AN2C 5AVBB 4J8WC 1ZLAD 4J8VD 3UTBC 4UUZB 4Z5TD 4XUJD 1M18B 5CP6A 3B6FA 1F1EA 4KGCB 3AFAA 3AZNC 1ULYA 3MGPC 3AZGC 3KWQC 3UT9C 4H9OB 1P3OC 4KUDD 1M1AA 3B6GB 1KU5A 3AV1A 4ZUXD 4H9RA 3W96A 3O62C 5B1LB 1KX5B 3W98C 3LJAD 3W97A 1P3GA 5B33B 2CV5A 3B6GD 4LD9A 1P3BA 4Z5TC 4NE6A 4WNNA 1M19C 4J8UA 3TU4B 2IO5B 1KX5D 1ID3A 5JRGD 3REHB 1B6WA 5B31G 3MGRB 3LZ0D 2AROB 4CSRB 1P3PB 3MVDA 3AYWD 5B0YD 1JFIA 2RVQD 3AZMC 1P3KB 5B32A 4ZUXC 1P3LB 5B0ZB 2NZDB 3AZHB 1EQZB 2BYMA 4H9SC 3LJAC 4DRBA 3KUYA 5DNNB 3MGQD 1P3IC 3C1CB 4JJNA 1N1JA 1B67A 4YS3D 4KGCC 5BS7C 5AV9B 5B0ZD 2NZDD 1P3AA 5CPIA 2F8NH 2FJ7B 5CPJA 3A6NC 1ZLAA 5G49A 5CP6D 4J8VA 2F8NG 5DNND 4WV4B 3LZ0C 4XUJA 2NQBB 3C1CD 3AZIC 1KX3B 3RELB 3AV2B 1AOIA 5B0YC 1H3OB 3AZEB 1P34C 1P3MB 4XZQC 4WU8B 4Z66A 3WTPA 5AVBA 3X1UB 4G92B 4UUZA 4AWLC 4KUDA 3W96D 1M18A 1KX3D 3RELD 3AV2D 3X1TB 4KGCA 5F99C 3MGQC 4X23B 3WA9B 4YS3C 2CV5D 4LD9D 4H9OA 1P3BD 4M6BA 3KXBB 3B6GA 5CP6C 3B6FC 5AV5C 3X1TD 1KX4B 5B2IB 1ID3D 3AFAC 3B0DC 5B1LA 3WKJB 3C1BB 4HGAC 4X23D 3WA9D 5AY8B 1KX5A 3REID 5JRGA 1U35B 3MVDD 5B33A 5FUGB 1M1AC 4NFTA 1KX4D 3AV1C 5B24D 5B32D 3UTBB 3W96C 5GT0B 3TU4A 3WKJD 3REHA 3W97C 3AZLB 1P3GC 1TZYB 3KUYD 3MGRA 2CV5C 3AZKB 2AROA 3MGPB 4CSRA 4DRAA 1P3BC 1P3PA 4YM6B 3X1VC 4KHAB 5C3IC 5GT0D 4ZBJC 4J8UC 1P3FB 1P3KA 1ID3C 1P3LA 3LZ1B 5B0ZA 2NZDA 3AZLD 3AZHA 1HQ3B 1EQZA 3V9RB 5BO0B 3AZFB 5AV8B 3B0CW 3MVDC 4YM6D 5DNNA 1AOID 3C1CA 5B32C 4Z66D 3WTPD 5AVBD 5AV9A 3LZ1D 1M19B 5CPKC 4J8XB 2FJ7A 3X1SB 5B31B 2HUEB 5E5AB 1M18D 3KUYC 4KGCD 4H9QB 2NQBA 3REKC 1KX3A 3RELA 4JJNC 3AV2A 5GXQB 5GT3B 1H3OA 1P3MA 5BT1D 1P3AC 5CPIC 5GSUB 3MGSC 3X1SD 5CPJC 5B1MC 3AZMB 3X1UA 1ZLAC 1S32B 4H9NB 4J8VC 5AVCB 4XUJC 3REKA 5B1LD 4NE5A 3X1TA 5GXQD 1AOIC 5GT3D 5KDMB 5B2JB 3AZJB 5JA4B 3REJB 4X23A 3WA9A 2JSSA 5B33D 2CWEA 4Z66C 3WTPC 4G91B 3REIA 1WWIA 1S32D 2F8NB 4KUDC 3KXBA 1M18C 3TU4D 3A6NB 1KX4A 5B2IA 5B24A 3AZJD 3REHD 3WKJA 3C1BA 5AY8A 3MGRD 2AROD 1U35A 1P3PD 2HIOB 5FUGA 3KSYA 3B6GC 3MNNB 1BH8B 5DNMB 1F66B 1P3KD 1BFMA 1P3LD 5GT0A 4AWLB 5B1LC 4QLCB 3AZHD 1EQZD 2PYOB 3R45B 1KX5C 5JRGC 3AZLA 1TZYA 2HIOD 4EO5B 3VH5A 5B33C 3AZKA 4E45A 2L5AA 3AYWC 4YM6A 4R8PB 3NQJB 1F66D 4KHAA 1P3FA 3TU4C 5AV9D 5AV6B 2IO5C 2PYOD 2RVQC 2FJ7D 3B6FB 5AV5B 3W99B 3LZ1A 1HQ3A 2YFVB 3V9RA 3MGRC 1A7WA 2BYKB 3AZFA 2NQBD 5AV8A 4R8PD 1P3MD 5AV6D 3AZED 4WU9B 3UTAB 1P3KC 4WU8D 3W99D 1P3LC 1R4VA 3X1UD 5B0ZC 2NZDC 1M19A 3AZHC 4J8XA 1EQZC 3X1SA 5B31A 5E5AA 3WAAB 3LELB 5DNNC 4H9QA 5B40B 1P3GB 4NE3A 3C1CC 2LY8A 5GXQA 5GT3A 3X1VB 5AV9C 5GSUA 5C3IB 2FJ7C 3WAAD 3VH5T 3AZMA 3KXBD 1S32A 1Q9CA 4H9NA 3AN2B 4J8WB 3LELD 5B2ID 5AVCA 2NQBC 1KX3C 3RELC 3C1BD 3VH5W 3AV2C 5AY8D 5KDMA 5B2JA 3AZJA 5JA4A 1U35D 3REJA 3WTPE 3X1UC 3AZNB 4LD9C 4G92C 3AN2D 3AZGB 2F8NA 3KWQB 5CPKB 3UT9B 3UTBD 1P3OB 3A6NA 3X1TC 3B0CT 4X23C 3WA9C 3NQUB 1TZYD 5BNXB 3O62B 3REKB 1TAFB 3REIC 3AZND 3AZKD 3MGPD 3AZGD 3W98B 3KWQD 2HIOA 3MGSB 3UT9D 3KXBC 1P3FD 5B1MB 1KX4C 3MNNA 1BH8A 5DNMA 1F66A 5B2IC 5B24C 4J8VB 4Z5TB 2YFWB 3WKJC 3C1BC 4QLCA 1HQ3D 2PYOA 3VH6T 3R45A 3AZFD 5B32G 2F8NK 1U35C 3W98D 5AV8D 3VH6W 4H9PB 4R8PA 3NQJA 5GT0C 4KUDB 5AV6A 3AZEA 1M19D 4J8XD 4WU8A 5AV5A 5B31D 5E5AD 3W99A 4ZUXB 3AZLC 1TZYC 2YFVA 2BYKA 3AZKC 4YM6C 3LJAB 1P3FC 1BH9B 4WU9A 3UTAA 5GSUD 1P3IB 3AZMD 5AVBC 3LZ1C 1HQ3C 3WAAA 5AVCD 3AZFC 5AV8C 5JRGB 1HTAA 3LELA 5B40A
chains in the Genus database with same CATH superfamily
5B2JD 3LZ0B 3REJD 1P3ID 3AZIB 3AYWB 3X1VA 5BT1C 5B0YB 4J8XC 3X1SC 1P34B 5B31C 2HUEC 5BNVB 5E5AC 4XZQB 2F8ND 3AN2A 3A6ND 4J8WA 2Y2KA 3UTBA 2G5HC 5GXQC 3AZID 5GT3C 4CAYB 5F99B 5GSUC 1P34D 3MGQB 4XZQD 3AZNA 1S32C 4YS3B 3MGPA 3AZGA 3MNND 5DNMD 3KWQA 5CPKA 5AVCC 3UT9A 1P3OA 3H0RC 4QLCD 3H0LC 5CP6B 3AZJC 5B2JC 5F99D 3REHC 3REJC 3NQUA 3O62A 5BNXA 3B0DB 4G91C 1TAFA 4WZSB 4HGAB 5BO0A 3AFAB 2AROC 3W98A 1P3PC 2Y2IA 3MGSA 5B1MA 1M1AB 3B6FD 5AV5D 3AV1B 4Z5TA 2YFWA 4H9RB 3AFAD 3W96B 2Y2GA 2Y2OA 2DQNC 2Y2HA 2HIOC 3W97B 4Z2MH 4WU9D 4H9PA 3MNNC 3UTAD 2JE5A 5DNMC 2CV5B 3P5JB 1M1AD 1F66C 4LD9B 1P3BB 3AV1D 4Z2MG 4WNNB 4QLCC 2PYOC 4ZBJB 3VH6A 4J8UB 5CHLB 1ID3B 4ZUXA 4EO5C 3W97D 5B40D 2RIQA 1P3GD 4H9SA 3REIB 4E44A 4R8PC 3LJAA 2UWXA 3MVDB 3X1VD 1P3MC 1BH9A 5AV6C 3AZEC 4J8UD 1JFIB 4WU8C 2ZY5A 1P3IA 3W99C 5B24B 5B32B 5BS7A 4J8WD 2BYMB 1WWSA 3KUYB 4WU9C 3UTAC 3LZ0A 3B0BA 3AYWA 3AZIA 4JJNB 3EPHA 1N1JB 2G5IC 5B0YA 1P34A 5BNVA 3WAAC 4XZQA 5CPIB 5CPKD 1P3AB 1P3OD 5CPJB 1ZLAB 5G49B 3LELC 5B40C 4XUJB 3REKD 3O62D 5AY8C 4JJND 4CAYA 5F99A 1AOIB 3MGQA 1P3AD 4UPKA 3MGSD 5CPID 5CPJD 5B1MD 4YS3A 4Z66B 3WTPB 3AN2C 5AVBB 4J8WC 1ZLAD 4J8VD 3UTBC 4UUZB 4Z5TD 4XUJD 1M18B 5CP6A 3B6FA 1F1EA 4KGCB 3AFAA 3AZNC 1ULYA 3IP4C 3MGPC 3AZGC 2Y2MA 3KWQC 3UT9C 4H9OB 1P3OC 4KUDD 1M1AA 3B6GB 2Y2NA 1KU5A 3AV1A 4ZUXD 4H9RA 3W96A 3O62C 5B1LB 1KX5B 3W98C 3LJAD 3W97A 1P3GA 5B33B 2CV5A 3B6GD 4LD9A 1P3BA 4Z5TC 4NE6A 4WNNA 1M19C 4J8UA 3TU4B 2IO5B 1KX5D 1ID3A 5JRGD 3REHB 1B6WA 5B31G 3MGRB 3LZ0D 2AROB 4CSRB 1P3PB 3MVDA 3AYWD 5B0YD 1JFIA 2RVQD 3AZMC 1P3KB 5B32A 2ZM5A 1PZRA 4ZUXC 1P3LB 5B0ZB 2NZDB 3AZHB 1EQZB 4WJ3C 2BYMA 4H9SC 3LJAC 4DRBA 3KUYA 5DNNB 3MGQD 1P3IC 3C1CB 4JJNA 1N1JA 1B67A 4YS3D 4KGCC 5BS7C 5AV9B 5B0ZD 2NZDD 2XD5A 5CPIA 1P3AA 2F8NH 2FJ7B 5CPJA 3A6NC 1ZLAA 5G49A 5CP6D 4J8VA 2F8NG 5DNND 4WV4B 3LZ0C 4XUJA 2NQBB 3C1CD 3AZIC 1KX3B 3RELB 3AV2B 1AOIA 5B0YC 1H3OB 3AZEB 1P34C 1P3MB 4XZQC 4WU8B 4Z66A 3WTPA 5AVBA 3X1UB 4G92B 4UUZA 4AWLC 4KUDA 3W96D 1M18A 2DF4C 1KX3D 3RELD 3AV2D 3X1TB 4KGCA 5F99C 3MGQC 1W2EA 4X23B 3WA9B 4YS3C 2CV5D 4LD9D 4H9OA 2FFFB 1P3BD 4M6BA 3KXBB 3B6GA 5CP6C 3B6FC 5AV5C 3X1TD 1KX4B 5B2IB 1ID3D 3AFAC 3B0DC 5B1LA 3WKJB 3C1BB 4HGAC 4X23D 3WA9D 5AY8B 1KX5A 3REID 5JRGA 1U35B 3MVDD 5B33A 5FUGB 1M1AC 4NFTA 1KX4D 3AV1C 5B24D 5B32D 3UTBB 3W96C 5GT0B 3TU4A 3WKJD 1Z2CB 3KFUG 3REHA 3W97C 3AZLB 4DQYB 1P3GC 1TZYB 3KUYD 3EPLA 3MGRA 2CV5C 3AZKB 2AROA 3MGPB 4CSRA 4DRAA 1P3BC 2ZY3A 1T3UA 4YM6B 3X1VC 1P3PA 4KHAB 2VQRA 5C3IC 5GT0D 4ZBJC 4J8UC 1P3FB 1P3KA 1ID3C 1P3LA 3LZ1B 5B0ZA 2NZDA 3AZLD 3AZHA 1HQ3B 1EQZA 3V9RB 5BO0B 3AZFB 5AV8B 3B0CW 3MVDC 4YM6D 5DNNA 1AOID 3C1CA 5B32C 4Z66D 3WTPD 5AVBD 5AV9A 3LZ1D 1M19B 5CPKC 4J8XB 2FJ7A 3X1SB 5B31B 2HUEB 5E5AB 1M18D 3KUYC 4KGCD 4H9QB 2BG1A 2NQBA 3REKC 1KX3A 3RELA 4JJNC 3AV2A 5GXQB 5GT3B 1H3OA 1P3MA 5BT1D 1P3AC 5CPIC 5GSUB 3MGSC 2ZY2A 3X1SD 5CPJC 5B1MC 3AZMB 3X1UA 1ZLAC 1S32B 4H9NB 4J8VC 5AVCB 4XUJC 3REKA 5B1LD 4NE5A 3X1TA 5GXQD 1AOIC 5GT3D 5KDMB 5B2JB 3AZJB 5JA4B 3REJB 4X23A 3WA9A 2JSSA 5B33D 2CWEA 4G91B 4Z66C 3WTPC 3REIA 1WWIA 1S32D 2F8NB 4KUDC 3KXBA 1M18C 3TU4D 3A6NB 1KX4A 5B2IA 5B24A 3AZJD 3REHD 3WKJA 3C1BA 5AY8A 3MGRD 2AROD 1U35A 1P3PD 2ZY4A 2JCHA 2HIOB 5FUGA 3KSYA 3B6GC 3MNNB 1BH8B 5DNMB 1F66B 1P3KD 1BFMA 3A1IA 1P3LD 5GT0A 4AWLB 5B1LC 4QLCB 3AZHD 1EQZD 2PYOB 3R45B 1KX5C 5JRGC 3AZLA 1TZYA 2HIOD 4EO5B 3VH5A 5B33C 3AZKA 2XD1A 2L5AA 4E45A 3AYWC 4YM6A 4R8PB 3NQJB 1F66D 4KHAA 1P3FA 3TU4C 5AV9D 5AV6B 2IO5C 2PYOD 2RVQC 2FJ7D 3B6FB 5AV5B 3W99B 3LZ1A 1HQ3A 2YFVB 3V9RA 3MGRC 1A7WA 2BYKB 3AZFA 2NQBD 5AV8A 4R8PD 1P3MD 5AV6D 3AZED 4WU9B 3UTAB 1P3KC 4WU8D 3F6TA 3W99D 1P3LC 1R4VA 3X1UD 5B0ZC 2NZDC 1M19A 3AZHC 4J8XA 1EQZC 3EG5B 3X1SA 5B31A 5E5AA 3WAAB 3LELB 5DNNC 4H9QA 5B40B 1P3GB 4NE3A 3C1CC 2LY8A 5GXQA 5GT3A 3X1VB 5AV9C 2F2AC 5GSUA 5C3IB 2FJ7C 3WAAD 3VH5T 3AZMA 3KXBD 1S32A 1Q9CA 4H9NA 3AN2B 4J8WB 3LELD 5B2ID 5AVCA 2NQBC 1KX3C 3RELC 3C1BD 3VH5W 3AV2C 5AY8D 5KDMA 5B2JA 2Y2PA 3AZJA 5JA4A 1U35D 3REJA 3H0MC 3WTPE 3X1UC 3AZNB 4LD9C 4G92C 3AN2D 3AZGB 2F8NA 3KWQB 5CPKB 3UT9B 3UTBD 1P3OB 3A6NA 3X1TC 3EPKA 3B0CT 4X23C 3WA9C 3NQUB 1TZYD 5BNXB 3O62B 3REKB 1TAFB 3REIC 3AZND 2W8SA 2J8PA 3AZKD 3MGPD 3AZGD 3W98B 3A1KA 3KWQD 2HIOA 3MGSB 3UT9D 3KXBC 1P3FD 5B1MB 1KX4C 3MNNA 1BH8A 5DNMA 1F66A 5B2IC 5B24C 4J8VB 4Z5TB 2YFWB 3WKJC 3C1BC 4QLCA 1HQ3D 2PYOA 3VH6T 3R45A 3AZFD 5B32G 2F8NK 1U35C 3W98D 5AV8D 2Y2JA 3VH6W 4H9PB 4R8PA 3NQJA 5GT0C 4KUDB 5AV6A 3AZEA 1M19D 4J8XD 4WU8A 5AV5A 5B31D 3AL0C 5E5AD 3W99A 4ZUXB 3AZLC 1TZYC 2YFVA 2BYKA 3AZKC 4YM6C 3LJAB 1P3FC 1BH9B 4WU9A 3FDDA 3UTAA 5GSUD 1P3IB 3EPJA 2Y2LA 3AZMD 5AVBC 3LZ1C 1HQ3C 3WAAA 5AVCD 3AZFC 2Y2QA 5AV8C 5JRGB 1HTAA 3LELA 5B40A
chains in the Genus database with same CATH topology
5B2JD 3LZ0B 3REJD 1P3ID 3AZIB 3AYWB 3X1VA 5BT1C 5B0YB 4J8XC 3X1SC 1P34B 5B31C 2HUEC 5BNVB 5E5AC 4XZQB 2F8ND 3AN2A 3A6ND 4J8WA 2Y2KA 3UTBA 2G5HC 5GXQC 3AZID 5GT3C 4CAYB 5F99B 5GSUC 1P34D 3MGQB 4XZQD 3AZNA 1S32C 4YS3B 3MGPA 3AZGA 3MNND 5DNMD 3KWQA 5CPKA 5AVCC 3UT9A 1P3OA 3H0RC 4QLCD 3H0LC 5CP6B 3AZJC 5B2JC 5F99D 3REHC 3REJC 3NQUA 3O62A 5BNXA 3B0DB 4G91C 1TAFA 4WZSB 4HGAB 5BO0A 3AFAB 2AROC 3W98A 1P3PC 2Y2IA 3MGSA 5B1MA 1M1AB 3B6FD 5AV5D 3AV1B 4Z5TA 2YFWA 4H9RB 3AFAD 3W96B 2Y2GA 2Y2OA 2DQNC 2Y2HA 2HIOC 3W97B 4Z2MH 4WU9D 4H9PA 3MNNC 3UTAD 2JE5A 5DNMC 2CV5B 3P5JB 1M1AD 1F66C 4LD9B 1P3BB 3AV1D 4Z2MG 4WNNB 4QLCC 2PYOC 4ZBJB 3VH6A 4J8UB 5CHLB 1ID3B 4ZUXA 4EO5C 3W97D 5B40D 2RIQA 1P3GD 4H9SA 3REIB 4E44A 4R8PC 3LJAA 2UWXA 3MVDB 3X1VD 1P3MC 1BH9A 5AV6C 3AZEC 4J8UD 1JFIB 4WU8C 2ZY5A 1P3IA 3W99C 5B24B 5B32B 5BS7A 4J8WD 2BYMB 1WWSA 3KUYB 4WU9C 3UTAC 3LZ0A 3B0BA 3AYWA 3AZIA 4JJNB 3EPHA 1N1JB 2G5IC 5B0YA 1P34A 5BNVA 3WAAC 4XZQA 5CPIB 5CPKD 1P3AB 1P3OD 5CPJB 1ZLAB 5G49B 3LELC 5B40C 4XUJB 3REKD 3O62D 5AY8C 4JJND 4CAYA 5F99A 1AOIB 3MGQA 1P3AD 4UPKA 3MGSD 5CPID 5CPJD 5B1MD 4YS3A 4Z66B 3WTPB 3AN2C 5AVBB 4J8WC 1ZLAD 4J8VD 3UTBC 4UUZB 4Z5TD 4XUJD 1M18B 5CP6A 3B6FA 1F1EA 4KGCB 3AFAA 3AZNC 1ULYA 3IP4C 3MGPC 3AZGC 2Y2MA 3KWQC 3UT9C 4H9OB 1P3OC 4KUDD 1M1AA 3B6GB 2Y2NA 1KU5A 3AV1A 4ZUXD 4H9RA 3W96A 3O62C 5B1LB 1KX5B 3W98C 3LJAD 3W97A 1P3GA 5B33B 2CV5A 3B6GD 4LD9A 1P3BA 4Z5TC 4NE6A 4WNNA 1M19C 4J8UA 3TU4B 2IO5B 1KX5D 1ID3A 5JRGD 3REHB 1B6WA 5B31G 3MGRB 3LZ0D 2AROB 4CSRB 1P3PB 3MVDA 3AYWD 5B0YD 1JFIA 2RVQD 3AZMC 1P3KB 5B32A 2ZM5A 1PZRA 4ZUXC 1P3LB 5B0ZB 2NZDB 3AZHB 1EQZB 4WJ3C 2BYMA 4H9SC 3LJAC 4DRBA 3KUYA 5DNNB 3MGQD 1P3IC 3C1CB 4JJNA 1N1JA 1B67A 4YS3D 4KGCC 5BS7C 5AV9B 5B0ZD 2NZDD 2XD5A 5CPIA 1P3AA 2F8NH 2FJ7B 5CPJA 3A6NC 1ZLAA 5G49A 5CP6D 4J8VA 2F8NG 5DNND 4WV4B 3LZ0C 4XUJA 2NQBB 3C1CD 3AZIC 1KX3B 3RELB 3AV2B 1AOIA 5B0YC 1H3OB 3AZEB 1P34C 1P3MB 4XZQC 4WU8B 4Z66A 3WTPA 5AVBA 3X1UB 4G92B 4UUZA 4AWLC 4KUDA 3W96D 1M18A 2DF4C 1KX3D 3RELD 3AV2D 3X1TB 4KGCA 5F99C 3MGQC 1W2EA 4X23B 3WA9B 4YS3C 2CV5D 4LD9D 4H9OA 2FFFB 1P3BD 4M6BA 3KXBB 3B6GA 5CP6C 3B6FC 5AV5C 3X1TD 1KX4B 5B2IB 1ID3D 3AFAC 3B0DC 5B1LA 3WKJB 3C1BB 4HGAC 4X23D 3WA9D 5AY8B 1KX5A 3REID 5JRGA 1U35B 3MVDD 5B33A 5FUGB 1M1AC 4NFTA 1KX4D 3AV1C 5B24D 5B32D 3UTBB 3W96C 5GT0B 3TU4A 3WKJD 1Z2CB 3KFUG 3REHA 3W97C 3AZLB 4DQYB 1P3GC 1TZYB 3KUYD 3EPLA 3MGRA 2CV5C 3AZKB 2AROA 3MGPB 4CSRA 4DRAA 1P3BC 2ZY3A 1T3UA 4YM6B 3X1VC 1P3PA 4KHAB 2VQRA 5C3IC 5GT0D 4ZBJC 4J8UC 1P3FB 1P3KA 1ID3C 1P3LA 3LZ1B 5B0ZA 2NZDA 3AZLD 3AZHA 1HQ3B 1EQZA 3V9RB 5BO0B 3AZFB 5AV8B 3B0CW 3MVDC 4YM6D 5DNNA 1AOID 3C1CA 5B32C 4Z66D 3WTPD 5AVBD 5AV9A 3LZ1D 1M19B 5CPKC 4J8XB 2FJ7A 3X1SB 5B31B 2HUEB 5E5AB 1M18D 3KUYC 4KGCD 4H9QB 2BG1A 2NQBA 3REKC 1KX3A 3RELA 4JJNC 3AV2A 5GXQB 5GT3B 1H3OA 1P3MA 5BT1D 1P3AC 5CPIC 5GSUB 3MGSC 2ZY2A 3X1SD 5CPJC 5B1MC 3AZMB 3X1UA 1ZLAC 1S32B 4H9NB 4J8VC 5AVCB 4XUJC 3REKA 5B1LD 4NE5A 3X1TA 5GXQD 1AOIC 5GT3D 5KDMB 5B2JB 3AZJB 5JA4B 3REJB 4X23A 3WA9A 2JSSA 5B33D 2CWEA 4G91B 4Z66C 3WTPC 3REIA 1WWIA 1S32D 2F8NB 4KUDC 3KXBA 1M18C 3TU4D 3A6NB 1KX4A 5B2IA 5B24A 3AZJD 3REHD 3WKJA 3C1BA 5AY8A 3MGRD 2AROD 1U35A 1P3PD 2ZY4A 2JCHA 2HIOB 5FUGA 3KSYA 3B6GC 3MNNB 1BH8B 5DNMB 1F66B 1P3KD 1BFMA 3A1IA 1P3LD 5GT0A 4AWLB 5B1LC 4QLCB 3AZHD 1EQZD 2PYOB 3R45B 1KX5C 5JRGC 3AZLA 1TZYA 2HIOD 4EO5B 3VH5A 5B33C 3AZKA 2XD1A 2L5AA 4E45A 3AYWC 4YM6A 4R8PB 3NQJB 1F66D 4KHAA 1P3FA 3TU4C 5AV9D 5AV6B 2IO5C 2PYOD 2RVQC 2FJ7D 3B6FB 5AV5B 3W99B 3LZ1A 1HQ3A 2YFVB 3V9RA 3MGRC 1A7WA 2BYKB 3AZFA 2NQBD 5AV8A 4R8PD 1P3MD 5AV6D 3AZED 4WU9B 3UTAB 1P3KC 4WU8D 3F6TA 3W99D 1P3LC 1R4VA 3X1UD 5B0ZC 2NZDC 1M19A 3AZHC 4J8XA 1EQZC 3EG5B 3X1SA 5B31A 5E5AA 3WAAB 3LELB 5DNNC 4H9QA 5B40B 1P3GB 4NE3A 3C1CC 2LY8A 5GXQA 5GT3A 3X1VB 5AV9C 2F2AC 5GSUA 5C3IB 2FJ7C 3WAAD 3VH5T 3AZMA 3KXBD 1S32A 1Q9CA 4H9NA 3AN2B 4J8WB 3LELD 5B2ID 5AVCA 2NQBC 1KX3C 3RELC 3C1BD 3VH5W 3AV2C 5AY8D 5KDMA 5B2JA 2Y2PA 3AZJA 5JA4A 1U35D 3REJA 3H0MC 3WTPE 3X1UC 3AZNB 4LD9C 4G92C 3AN2D 3AZGB 2F8NA 3KWQB 5CPKB 3UT9B 3UTBD 1P3OB 3A6NA 3X1TC 3EPKA 3B0CT 4X23C 3WA9C 3NQUB 1TZYD 5BNXB 3O62B 3REKB 1TAFB 3REIC 3AZND 2W8SA 2J8PA 3AZKD 3MGPD 3AZGD 3W98B 3A1KA 3KWQD 2HIOA 3MGSB 3UT9D 3KXBC 1P3FD 5B1MB 1KX4C 3MNNA 1BH8A 5DNMA 1F66A 5B2IC 5B24C 4J8VB 4Z5TB 2YFWB 3WKJC 3C1BC 4QLCA 1HQ3D 2PYOA 3VH6T 3R45A 3AZFD 5B32G 2F8NK 1U35C 3W98D 5AV8D 2Y2JA 3VH6W 4H9PB 4R8PA 3NQJA 5GT0C 4KUDB 5AV6A 3AZEA 1M19D 4J8XD 4WU8A 5AV5A 5B31D 3AL0C 5E5AD 3W99A 4ZUXB 3AZLC 1TZYC 2YFVA 2BYKA 3AZKC 4YM6C 3LJAB 1P3FC 1BH9B 4WU9A 3FDDA 3UTAA 5GSUD 1P3IB 3EPJA 2Y2LA 3AZMD 5AVBC 3LZ1C 1HQ3C 3WAAA 5AVCD 3AZFC 2Y2QA 5AV8C 5JRGB 1HTAA 3LELA 5B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2J D;  3LZ0 B;  3REJ D;  1P3I D;  3AZI B;  3AYW B;  3X1V A;  5BT1 C;  5B0Y B;  4J8X C;  3X1S C;  1P34 B;  5B31 C;  2HUE C;  5BNV B;  5E5A C;  4XZQ B;  2F8N D;  3AN2 A;  3A6N D;  4J8W A;  3UTB A;  5GXQ C;  3AZI D;  5GT3 C;  4CAY B;  5F99 B;  5GSU C;  1P34 D;  3MGQ B;  4XZQ D;  3AZN A;  1S32 C;  4YS3 B;  3MGP A;  3AZG A;  3MNN D;  5DNM D;  3KWQ A;  5CPK A;  5AVC C;  3UT9 A;  1P3O A;  4QLC D;  5CP6 B;  3AZJ C;  5B2J C;  5F99 D;  3REH C;  3REJ C;  3NQU A;  3O62 A;  5BNX A;  3B0D B;  4G91 C;  1TAF A;  4WZS B;  4HGA B;  5BO0 A;  3AFA B;  2ARO C;  3W98 A;  1P3P C;  3MGS A;  5B1M A;  1M1A B;  3B6F D;  5AV5 D;  3AV1 B;  4Z5T A;  2YFW A;  4H9R B;  3AFA D;  3W96 B;  2HIO C;  3W97 B;  4Z2M H;  4WU9 D;  4H9P A;  3MNN C;  3UTA D;  5DNM C;  2CV5 B;  1M1A D;  1F66 C;  4LD9 B;  1P3B B;  3AV1 D;  4Z2M G;  4WNN B;  4QLC C;  2PYO C;  4ZBJ B;  3VH6 A;  4J8U B;  5CHL B;  1ID3 B;  4ZUX A;  4EO5 C;  3W97 D;  5B40 D;  1P3G D;  4H9S A;  3REI B;  4E44 A;  4R8P C;  3LJA A;  3MVD B;  3X1V D;  1P3M C;  1BH9 A;  5AV6 C;  3AZE C;  4J8U D;  1JFI B;  4WU8 C;  1P3I A;  3W99 C;  5B24 B;  5B32 B;  5BS7 A;  4J8W D;  2BYM B;  1WWS A;  3KUY B;  4WU9 C;  3UTA C;  3LZ0 A;  3B0B A;  3AYW A;  3AZI A;  4JJN B;  1N1J B;  5B0Y A;  1P34 A;  5BNV A;  3WAA C;  4XZQ A;  5CPI B;  5CPK D;  1P3A B;  1P3O D;  5CPJ B;  1ZLA B;  5G49 B;  3LEL C;  5B40 C;  4XUJ B;  3REK D;  3O62 D;  5AY8 C;  4JJN D;  4CAY A;  5F99 A;  1AOI B;  3MGQ A;  1P3A D;  3MGS D;  5CPI D;  5CPJ D;  5B1M D;  4YS3 A;  4Z66 B;  3WTP B;  3AN2 C;  5AVB B;  4J8W C;  1ZLA D;  4J8V D;  3UTB C;  4UUZ B;  4Z5T D;  4XUJ D;  1M18 B;  5CP6 A;  3B6F A;  1F1E A;  4KGC B;  3AFA A;  3AZN C;  1ULY A;  3MGP C;  3AZG C;  3KWQ C;  3UT9 C;  4H9O B;  1P3O C;  4KUD D;  1M1A A;  3B6G B;  1KU5 A;  3AV1 A;  4ZUX D;  4H9R A;  3W96 A;  3O62 C;  5B1L B;  1KX5 B;  3W98 C;  3LJA D;  3W97 A;  1P3G A;  5B33 B;  2CV5 A;  3B6G D;  4LD9 A;  1P3B A;  4Z5T C;  4NE6 A;  4WNN A;  1M19 C;  4J8U A;  3TU4 B;  2IO5 B;  1KX5 D;  1ID3 A;  5JRG D;  3REH B;  1B6W A;  5B31 G;  3MGR B;  3LZ0 D;  2ARO B;  4CSR B;  1P3P B;  3MVD A;  3AYW D;  5B0Y D;  1JFI A;  2RVQ D;  3AZM C;  1P3K B;  5B32 A;  4ZUX C;  1P3L B;  5B0Z B;  2NZD B;  3AZH B;  1EQZ B;  2BYM A;  4H9S C;  3LJA C;  4DRB A;  3KUY A;  5DNN B;  3MGQ D;  1P3I C;  3C1C B;  4JJN A;  1N1J A;  1B67 A;  4YS3 D;  4KGC C;  5BS7 C;  5AV9 B;  5B0Z D;  2NZD D;  1P3A A;  5CPI A;  2F8N H;  2FJ7 B;  5CPJ A;  3A6N C;  1ZLA A;  5G49 A;  5CP6 D;  4J8V A;  2F8N G;  5DNN D;  4WV4 B;  3LZ0 C;  4XUJ A;  2NQB B;  3C1C D;  3AZI C;  1KX3 B;  3REL B;  3AV2 B;  1AOI A;  5B0Y C;  1H3O B;  3AZE B;  1P34 C;  1P3M B;  4XZQ C;  4WU8 B;  4Z66 A;  3WTP A;  5AVB A;  3X1U B;  4G92 B;  4UUZ A;  4AWL C;  4KUD A;  3W96 D;  1M18 A;  1KX3 D;  3REL D;  3AV2 D;  3X1T B;  4KGC A;  5F99 C;  3MGQ C;  4X23 B;  3WA9 B;  4YS3 C;  2CV5 D;  4LD9 D;  4H9O A;  1P3B D;  4M6B A;  3KXB B;  3B6G A;  5CP6 C;  3B6F C;  5AV5 C;  3X1T D;  1KX4 B;  5B2I B;  1ID3 D;  3AFA C;  3B0D C;  5B1L A;  3WKJ B;  3C1B B;  4HGA C;  4X23 D;  3WA9 D;  5AY8 B;  1KX5 A;  3REI D;  5JRG A;  1U35 B;  3MVD D;  5B33 A;  5FUG B;  1M1A C;  4NFT A;  1KX4 D;  3AV1 C;  5B24 D;  5B32 D;  3UTB B;  3W96 C;  5GT0 B;  3TU4 A;  3WKJ D;  3REH A;  3W97 C;  3AZL B;  1P3G C;  1TZY B;  3KUY D;  3MGR A;  2CV5 C;  3AZK B;  2ARO A;  3MGP B;  4CSR A;  4DRA A;  1P3B C;  1P3P A;  4YM6 B;  3X1V C;  4KHA B;  5C3I C;  5GT0 D;  4ZBJ C;  4J8U C;  1P3F B;  1P3K A;  1ID3 C;  1P3L A;  3LZ1 B;  5B0Z A;  2NZD A;  3AZL D;  3AZH A;  1HQ3 B;  1EQZ A;  3V9R B;  5BO0 B;  3AZF B;  5AV8 B;  3B0C W;  3MVD C;  4YM6 D;  5DNN A;  1AOI D;  3C1C A;  5B32 C;  4Z66 D;  3WTP D;  5AVB D;  5AV9 A;  3LZ1 D;  1M19 B;  5CPK C;  4J8X B;  2FJ7 A;  3X1S B;  5B31 B;  2HUE B;  5E5A B;  1M18 D;  3KUY C;  4KGC D;  4H9Q B;  2NQB A;  3REK C;  1KX3 A;  3REL A;  4JJN C;  3AV2 A;  5GXQ B;  5GT3 B;  1H3O A;  1P3M A;  5BT1 D;  1P3A C;  5CPI C;  5GSU B;  3MGS C;  3X1S D;  5CPJ C;  5B1M C;  3AZM B;  3X1U A;  1ZLA C;  1S32 B;  4H9N B;  4J8V C;  5AVC B;  4XUJ C;  3REK A;  5B1L D;  4NE5 A;  3X1T A;  5GXQ D;  1AOI C;  5GT3 D;  5KDM B;  5B2J B;  3AZJ B;  5JA4 B;  3REJ B;  4X23 A;  3WA9 A;  2JSS A;  5B33 D;  2CWE A;  4Z66 C;  3WTP C;  4G91 B;  3REI A;  1WWI A;  1S32 D;  2F8N B;  4KUD C;  3KXB A;  1M18 C;  3TU4 D;  3A6N B;  1KX4 A;  5B2I A;  5B24 A;  3AZJ D;  3REH D;  3WKJ A;  3C1B A;  5AY8 A;  3MGR D;  2ARO D;  1U35 A;  1P3P D;  2HIO B;  5FUG A;  3KSY A;  3B6G C;  3MNN B;  1BH8 B;  5DNM B;  1F66 B;  1P3K D;  1BFM A;  1P3L D;  5GT0 A;  4AWL B;  5B1L C;  4QLC B;  3AZH D;  1EQZ D;  2PYO B;  3R45 B;  1KX5 C;  5JRG C;  3AZL A;  1TZY A;  2HIO D;  4EO5 B;  3VH5 A;  5B33 C;  3AZK A;  4E45 A;  2L5A A;  3AYW C;  4YM6 A;  4R8P B;  3NQJ B;  1F66 D;  4KHA A;  1P3F A;  3TU4 C;  5AV9 D;  5AV6 B;  2IO5 C;  2PYO D;  2RVQ C;  2FJ7 D;  3B6F B;  5AV5 B;  3W99 B;  3LZ1 A;  1HQ3 A;  2YFV B;  3V9R A;  3MGR C;  1A7W A;  2BYK B;  3AZF A;  2NQB D;  5AV8 A;  4R8P D;  1P3M D;  5AV6 D;  3AZE D;  4WU9 B;  3UTA B;  1P3K C;  4WU8 D;  3W99 D;  1P3L C;  1R4V A;  3X1U D;  5B0Z C;  2NZD C;  1M19 A;  3AZH C;  4J8X A;  1EQZ C;  3X1S A;  5B31 A;  5E5A A;  3WAA B;  3LEL B;  5DNN C;  4H9Q A;  5B40 B;  1P3G B;  4NE3 A;  3C1C C;  2LY8 A;  5GXQ A;  5GT3 A;  3X1V B;  5AV9 C;  5GSU A;  5C3I B;  2FJ7 C;  3WAA D;  3VH5 T;  3AZM A;  3KXB D;  1S32 A;  1Q9C A;  4H9N A;  3AN2 B;  4J8W B;  3LEL D;  5B2I D;  5AVC A;  2NQB C;  1KX3 C;  3REL C;  3C1B D;  3VH5 W;  3AV2 C;  5AY8 D;  5KDM A;  5B2J A;  3AZJ A;  5JA4 A;  1U35 D;  3REJ A;  3WTP E;  3X1U C;  3AZN B;  4LD9 C;  4G92 C;  3AN2 D;  3AZG B;  2F8N A;  3KWQ B;  5CPK B;  3UT9 B;  3UTB D;  1P3O B;  3A6N A;  3X1T C;  3B0C T;  4X23 C;  3WA9 C;  3NQU B;  1TZY D;  5BNX B;  3O62 B;  3REK B;  1TAF B;  3REI C;  3AZN D;  3AZK D;  3MGP D;  3AZG D;  3W98 B;  3KWQ D;  2HIO A;  3MGS B;  3UT9 D;  3KXB C;  1P3F D;  5B1M B;  1KX4 C;  3MNN A;  1BH8 A;  5DNM A;  1F66 A;  5B2I C;  5B24 C;  4J8V B;  4Z5T B;  2YFW B;  3WKJ C;  3C1B C;  4QLC A;  1HQ3 D;  2PYO A;  3VH6 T;  3R45 A;  3AZF D;  5B32 G;  2F8N K;  1U35 C;  3W98 D;  5AV8 D;  3VH6 W;  4H9P B;  4R8P A;  3NQJ A;  5GT0 C;  4KUD B;  5AV6 A;  3AZE A;  1M19 D;  4J8X D;  4WU8 A;  5AV5 A;  5B31 D;  5E5A D;  3W99 A;  4ZUX B;  3AZL C;  1TZY C;  2YFV A;  2BYK A;  3AZK C;  4YM6 C;  3LJA B;  1P3F C;  1BH9 B;  4WU9 A;  3UTA A;  5GSU D;  1P3I B;  3AZM D;  5AVB C;  3LZ1 C;  1HQ3 C;  3WAA A;  5AVC D;  3AZF C;  5AV8 C;  5JRG B;  1HTA A;  3LEL A;  5B40 A; 
#chains in the Genus database with same CATH topology
 5B2J D;  3LZ0 B;  3REJ D;  1P3I D;  3AZI B;  3AYW B;  3X1V A;  5BT1 C;  5B0Y B;  4J8X C;  3X1S C;  1P34 B;  5B31 C;  2HUE C;  5BNV B;  5E5A C;  4XZQ B;  2F8N D;  3AN2 A;  3A6N D;  4J8W A;  2Y2K A;  3UTB A;  2G5H C;  5GXQ C;  3AZI D;  5GT3 C;  4CAY B;  5F99 B;  5GSU C;  1P34 D;  3MGQ B;  4XZQ D;  3AZN A;  1S32 C;  4YS3 B;  3MGP A;  3AZG A;  3MNN D;  5DNM D;  3KWQ A;  5CPK A;  5AVC C;  3UT9 A;  1P3O A;  3H0R C;  4QLC D;  3H0L C;  5CP6 B;  3AZJ C;  5B2J C;  5F99 D;  3REH C;  3REJ C;  3NQU A;  3O62 A;  5BNX A;  3B0D B;  4G91 C;  1TAF A;  4WZS B;  4HGA B;  5BO0 A;  3AFA B;  2ARO C;  3W98 A;  1P3P C;  2Y2I A;  3MGS A;  5B1M A;  1M1A B;  3B6F D;  5AV5 D;  3AV1 B;  4Z5T A;  2YFW A;  4H9R B;  3AFA D;  3W96 B;  2Y2G A;  2Y2O A;  2DQN C;  2Y2H A;  2HIO C;  3W97 B;  4Z2M H;  4WU9 D;  4H9P A;  3MNN C;  3UTA D;  2JE5 A;  5DNM C;  2CV5 B;  3P5J B;  1M1A D;  1F66 C;  4LD9 B;  1P3B B;  3AV1 D;  4Z2M G;  4WNN B;  4QLC C;  2PYO C;  4ZBJ B;  3VH6 A;  4J8U B;  5CHL B;  1ID3 B;  4ZUX A;  4EO5 C;  3W97 D;  5B40 D;  2RIQ A;  1P3G D;  4H9S A;  3REI B;  4E44 A;  4R8P C;  3LJA A;  2UWX A;  3MVD B;  3X1V D;  1P3M C;  1BH9 A;  5AV6 C;  3AZE C;  4J8U D;  1JFI B;  4WU8 C;  2ZY5 A;  1P3I A;  3W99 C;  5B24 B;  5B32 B;  5BS7 A;  4J8W D;  2BYM B;  1WWS A;  3KUY B;  4WU9 C;  3UTA C;  3LZ0 A;  3B0B A;  3AYW A;  3AZI A;  4JJN B;  3EPH A;  1N1J B;  2G5I C;  5B0Y A;  1P34 A;  5BNV A;  3WAA C;  4XZQ A;  5CPI B;  5CPK D;  1P3A B;  1P3O D;  5CPJ B;  1ZLA B;  5G49 B;  3LEL C;  5B40 C;  4XUJ B;  3REK D;  3O62 D;  5AY8 C;  4JJN D;  4CAY A;  5F99 A;  1AOI B;  3MGQ A;  1P3A D;  4UPK A;  3MGS D;  5CPI D;  5CPJ D;  5B1M D;  4YS3 A;  4Z66 B;  3WTP B;  3AN2 C;  5AVB B;  4J8W C;  1ZLA D;  4J8V D;  3UTB C;  4UUZ B;  4Z5T D;  4XUJ D;  1M18 B;  5CP6 A;  3B6F A;  1F1E A;  4KGC B;  3AFA A;  3AZN C;  1ULY A;  3IP4 C;  3MGP C;  3AZG C;  2Y2M A;  3KWQ C;  3UT9 C;  4H9O B;  1P3O C;  4KUD D;  1M1A A;  3B6G B;  2Y2N A;  1KU5 A;  3AV1 A;  4ZUX D;  4H9R A;  3W96 A;  3O62 C;  5B1L B;  1KX5 B;  3W98 C;  3LJA D;  3W97 A;  1P3G A;  5B33 B;  2CV5 A;  3B6G D;  4LD9 A;  1P3B A;  4Z5T C;  4NE6 A;  4WNN A;  1M19 C;  4J8U A;  3TU4 B;  2IO5 B;  1KX5 D;  1ID3 A;  5JRG D;  3REH B;  1B6W A;  5B31 G;  3MGR B;  3LZ0 D;  2ARO B;  4CSR B;  1P3P B;  3MVD A;  3AYW D;  5B0Y D;  1JFI A;  2RVQ D;  3AZM C;  1P3K B;  5B32 A;  2ZM5 A;  1PZR A;  4ZUX C;  1P3L B;  5B0Z B;  2NZD B;  3AZH B;  1EQZ B;  4WJ3 C;  2BYM A;  4H9S C;  3LJA C;  4DRB A;  3KUY A;  5DNN B;  3MGQ D;  1P3I C;  3C1C B;  4JJN A;  1N1J A;  1B67 A;  4YS3 D;  4KGC C;  5BS7 C;  5AV9 B;  5B0Z D;  2NZD D;  2XD5 A;  5CPI A;  1P3A A;  2F8N H;  2FJ7 B;  5CPJ A;  3A6N C;  1ZLA A;  5G49 A;  5CP6 D;  4J8V A;  2F8N G;  5DNN D;  4WV4 B;  3LZ0 C;  4XUJ A;  2NQB B;  3C1C D;  3AZI C;  1KX3 B;  3REL B;  3AV2 B;  1AOI A;  5B0Y C;  1H3O B;  3AZE B;  1P34 C;  1P3M B;  4XZQ C;  4WU8 B;  4Z66 A;  3WTP A;  5AVB A;  3X1U B;  4G92 B;  4UUZ A;  4AWL C;  4KUD A;  3W96 D;  1M18 A;  2DF4 C;  1KX3 D;  3REL D;  3AV2 D;  3X1T B;  4KGC A;  5F99 C;  3MGQ C;  1W2E A;  4X23 B;  3WA9 B;  4YS3 C;  2CV5 D;  4LD9 D;  4H9O A;  2FFF B;  1P3B D;  4M6B A;  3KXB B;  3B6G A;  5CP6 C;  3B6F C;  5AV5 C;  3X1T D;  1KX4 B;  5B2I B;  1ID3 D;  3AFA C;  3B0D C;  5B1L A;  3WKJ B;  3C1B B;  4HGA C;  4X23 D;  3WA9 D;  5AY8 B;  1KX5 A;  3REI D;  5JRG A;  1U35 B;  3MVD D;  5B33 A;  5FUG B;  1M1A C;  4NFT A;  1KX4 D;  3AV1 C;  5B24 D;  5B32 D;  3UTB B;  3W96 C;  5GT0 B;  3TU4 A;  3WKJ D;  1Z2C B;  3KFU G;  3REH A;  3W97 C;  3AZL B;  4DQY B;  1P3G C;  1TZY B;  3KUY D;  3EPL A;  3MGR A;  2CV5 C;  3AZK B;  2ARO A;  3MGP B;  4CSR A;  4DRA A;  1P3B C;  2ZY3 A;  1T3U A;  4YM6 B;  3X1V C;  1P3P A;  4KHA B;  2VQR A;  5C3I C;  5GT0 D;  4ZBJ C;  4J8U C;  1P3F B;  1P3K A;  1ID3 C;  1P3L A;  3LZ1 B;  5B0Z A;  2NZD A;  3AZL D;  3AZH A;  1HQ3 B;  1EQZ A;  3V9R B;  5BO0 B;  3AZF B;  5AV8 B;  3B0C W;  3MVD C;  4YM6 D;  5DNN A;  1AOI D;  3C1C A;  5B32 C;  4Z66 D;  3WTP D;  5AVB D;  5AV9 A;  3LZ1 D;  1M19 B;  5CPK C;  4J8X B;  2FJ7 A;  3X1S B;  5B31 B;  2HUE B;  5E5A B;  1M18 D;  3KUY C;  4KGC D;  4H9Q B;  2BG1 A;  2NQB A;  3REK C;  1KX3 A;  3REL A;  4JJN C;  3AV2 A;  5GXQ B;  5GT3 B;  1H3O A;  1P3M A;  5BT1 D;  1P3A C;  5CPI C;  5GSU B;  3MGS C;  2ZY2 A;  3X1S D;  5CPJ C;  5B1M C;  3AZM B;  3X1U A;  1ZLA C;  1S32 B;  4H9N B;  4J8V C;  5AVC B;  4XUJ C;  3REK A;  5B1L D;  4NE5 A;  3X1T A;  5GXQ D;  1AOI C;  5GT3 D;  5KDM B;  5B2J B;  3AZJ B;  5JA4 B;  3REJ B;  4X23 A;  3WA9 A;  2JSS A;  5B33 D;  2CWE A;  4G91 B;  4Z66 C;  3WTP C;  3REI A;  1WWI A;  1S32 D;  2F8N B;  4KUD C;  3KXB A;  1M18 C;  3TU4 D;  3A6N B;  1KX4 A;  5B2I A;  5B24 A;  3AZJ D;  3REH D;  3WKJ A;  3C1B A;  5AY8 A;  3MGR D;  2ARO D;  1U35 A;  1P3P D;  2ZY4 A;  2JCH A;  2HIO B;  5FUG A;  3KSY A;  3B6G C;  3MNN B;  1BH8 B;  5DNM B;  1F66 B;  1P3K D;  1BFM A;  3A1I A;  1P3L D;  5GT0 A;  4AWL B;  5B1L C;  4QLC B;  3AZH D;  1EQZ D;  2PYO B;  3R45 B;  1KX5 C;  5JRG C;  3AZL A;  1TZY A;  2HIO D;  4EO5 B;  3VH5 A;  5B33 C;  3AZK A;  2XD1 A;  2L5A A;  4E45 A;  3AYW C;  4YM6 A;  4R8P B;  3NQJ B;  1F66 D;  4KHA A;  1P3F A;  3TU4 C;  5AV9 D;  5AV6 B;  2IO5 C;  2PYO D;  2RVQ C;  2FJ7 D;  3B6F B;  5AV5 B;  3W99 B;  3LZ1 A;  1HQ3 A;  2YFV B;  3V9R A;  3MGR C;  1A7W A;  2BYK B;  3AZF A;  2NQB D;  5AV8 A;  4R8P D;  1P3M D;  5AV6 D;  3AZE D;  4WU9 B;  3UTA B;  1P3K C;  4WU8 D;  3F6T A;  3W99 D;  1P3L C;  1R4V A;  3X1U D;  5B0Z C;  2NZD C;  1M19 A;  3AZH C;  4J8X A;  1EQZ C;  3EG5 B;  3X1S A;  5B31 A;  5E5A A;  3WAA B;  3LEL B;  5DNN C;  4H9Q A;  5B40 B;  1P3G B;  4NE3 A;  3C1C C;  2LY8 A;  5GXQ A;  5GT3 A;  3X1V B;  5AV9 C;  2F2A C;  5GSU A;  5C3I B;  2FJ7 C;  3WAA D;  3VH5 T;  3AZM A;  3KXB D;  1S32 A;  1Q9C A;  4H9N A;  3AN2 B;  4J8W B;  3LEL D;  5B2I D;  5AVC A;  2NQB C;  1KX3 C;  3REL C;  3C1B D;  3VH5 W;  3AV2 C;  5AY8 D;  5KDM A;  5B2J A;  2Y2P A;  3AZJ A;  5JA4 A;  1U35 D;  3REJ A;  3H0M C;  3WTP E;  3X1U C;  3AZN B;  4LD9 C;  4G92 C;  3AN2 D;  3AZG B;  2F8N A;  3KWQ B;  5CPK B;  3UT9 B;  3UTB D;  1P3O B;  3A6N A;  3X1T C;  3EPK A;  3B0C T;  4X23 C;  3WA9 C;  3NQU B;  1TZY D;  5BNX B;  3O62 B;  3REK B;  1TAF B;  3REI C;  3AZN D;  2W8S A;  2J8P A;  3AZK D;  3MGP D;  3AZG D;  3W98 B;  3A1K A;  3KWQ D;  2HIO A;  3MGS B;  3UT9 D;  3KXB C;  1P3F D;  5B1M B;  1KX4 C;  3MNN A;  1BH8 A;  5DNM A;  1F66 A;  5B2I C;  5B24 C;  4J8V B;  4Z5T B;  2YFW B;  3WKJ C;  3C1B C;  4QLC A;  1HQ3 D;  2PYO A;  3VH6 T;  3R45 A;  3AZF D;  5B32 G;  2F8N K;  1U35 C;  3W98 D;  5AV8 D;  2Y2J A;  3VH6 W;  4H9P B;  4R8P A;  3NQJ A;  5GT0 C;  4KUD B;  5AV6 A;  3AZE A;  1M19 D;  4J8X D;  4WU8 A;  5AV5 A;  5B31 D;  3AL0 C;  5E5A D;  3W99 A;  4ZUX B;  3AZL C;  1TZY C;  2YFV A;  2BYK A;  3AZK C;  4YM6 C;  3LJA B;  1P3F C;  1BH9 B;  4WU9 A;  3FDD A;  3UTA A;  5GSU D;  1P3I B;  3EPJ A;  2Y2L A;  3AZM D;  5AVB C;  3LZ1 C;  1HQ3 C;  3WAA A;  5AVC D;  3AZF C;  2Y2Q A;  5AV8 C;  5JRG B;  1HTA A;  3LEL A;  5B40 A; 
#chains in the Genus database with same CATH homology
 5B2J D;  3LZ0 B;  3REJ D;  1P3I D;  3AZI B;  3AYW B;  3X1V A;  5BT1 C;  5B0Y B;  4J8X C;  3X1S C;  1P34 B;  5B31 C;  2HUE C;  5BNV B;  5E5A C;  4XZQ B;  2F8N D;  3AN2 A;  3A6N D;  4J8W A;  2Y2K A;  3UTB A;  2G5H C;  5GXQ C;  3AZI D;  5GT3 C;  4CAY B;  5F99 B;  5GSU C;  1P34 D;  3MGQ B;  4XZQ D;  3AZN A;  1S32 C;  4YS3 B;  3MGP A;  3AZG A;  3MNN D;  5DNM D;  3KWQ A;  5CPK A;  5AVC C;  3UT9 A;  1P3O A;  3H0R C;  4QLC D;  3H0L C;  5CP6 B;  3AZJ C;  5B2J C;  5F99 D;  3REH C;  3REJ C;  3NQU A;  3O62 A;  5BNX A;  3B0D B;  4G91 C;  1TAF A;  4WZS B;  4HGA B;  5BO0 A;  3AFA B;  2ARO C;  3W98 A;  1P3P C;  2Y2I A;  3MGS A;  5B1M A;  1M1A B;  3B6F D;  5AV5 D;  3AV1 B;  4Z5T A;  2YFW A;  4H9R B;  3AFA D;  3W96 B;  2Y2G A;  2Y2O A;  2DQN C;  2Y2H A;  2HIO C;  3W97 B;  4Z2M H;  4WU9 D;  4H9P A;  3MNN C;  3UTA D;  2JE5 A;  5DNM C;  2CV5 B;  3P5J B;  1M1A D;  1F66 C;  4LD9 B;  1P3B B;  3AV1 D;  4Z2M G;  4WNN B;  4QLC C;  2PYO C;  4ZBJ B;  3VH6 A;  4J8U B;  5CHL B;  1ID3 B;  4ZUX A;  4EO5 C;  3W97 D;  5B40 D;  2RIQ A;  1P3G D;  4H9S A;  3REI B;  4E44 A;  4R8P C;  3LJA A;  2UWX A;  3MVD B;  3X1V D;  1P3M C;  1BH9 A;  5AV6 C;  3AZE C;  4J8U D;  1JFI B;  4WU8 C;  2ZY5 A;  1P3I A;  3W99 C;  5B24 B;  5B32 B;  5BS7 A;  4J8W D;  2BYM B;  1WWS A;  3KUY B;  4WU9 C;  3UTA C;  3LZ0 A;  3B0B A;  3AYW A;  3AZI A;  4JJN B;  3EPH A;  1N1J B;  2G5I C;  5B0Y A;  1P34 A;  5BNV A;  3WAA C;  4XZQ A;  5CPI B;  5CPK D;  1P3A B;  1P3O D;  5CPJ B;  1ZLA B;  5G49 B;  3LEL C;  5B40 C;  4XUJ B;  3REK D;  3O62 D;  5AY8 C;  4JJN D;  4CAY A;  5F99 A;  1AOI B;  3MGQ A;  1P3A D;  4UPK A;  3MGS D;  5CPI D;  5CPJ D;  5B1M D;  4YS3 A;  4Z66 B;  3WTP B;  3AN2 C;  5AVB B;  4J8W C;  1ZLA D;  4J8V D;  3UTB C;  4UUZ B;  4Z5T D;  4XUJ D;  1M18 B;  5CP6 A;  3B6F A;  1F1E A;  4KGC B;  3AFA A;  3AZN C;  1ULY A;  3IP4 C;  3MGP C;  3AZG C;  2Y2M A;  3KWQ C;  3UT9 C;  4H9O B;  1P3O C;  4KUD D;  1M1A A;  3B6G B;  2Y2N A;  1KU5 A;  3AV1 A;  4ZUX D;  4H9R A;  3W96 A;  3O62 C;  5B1L B;  1KX5 B;  3W98 C;  3LJA D;  3W97 A;  1P3G A;  5B33 B;  2CV5 A;  3B6G D;  4LD9 A;  1P3B A;  4Z5T C;  4NE6 A;  4WNN A;  1M19 C;  4J8U A;  3TU4 B;  2IO5 B;  1KX5 D;  1ID3 A;  5JRG D;  3REH B;  1B6W A;  5B31 G;  3MGR B;  3LZ0 D;  2ARO B;  4CSR B;  1P3P B;  3MVD A;  3AYW D;  5B0Y D;  1JFI A;  2RVQ D;  3AZM C;  1P3K B;  5B32 A;  2ZM5 A;  1PZR A;  4ZUX C;  1P3L B;  5B0Z B;  2NZD B;  3AZH B;  1EQZ B;  4WJ3 C;  2BYM A;  4H9S C;  3LJA C;  4DRB A;  3KUY A;  5DNN B;  3MGQ D;  1P3I C;  3C1C B;  4JJN A;  1N1J A;  1B67 A;  4YS3 D;  4KGC C;  5BS7 C;  5AV9 B;  5B0Z D;  2NZD D;  2XD5 A;  5CPI A;  1P3A A;  2F8N H;  2FJ7 B;  5CPJ A;  3A6N C;  1ZLA A;  5G49 A;  5CP6 D;  4J8V A;  2F8N G;  5DNN D;  4WV4 B;  3LZ0 C;  4XUJ A;  2NQB B;  3C1C D;  3AZI C;  1KX3 B;  3REL B;  3AV2 B;  1AOI A;  5B0Y C;  1H3O B;  3AZE B;  1P34 C;  1P3M B;  4XZQ C;  4WU8 B;  4Z66 A;  3WTP A;  5AVB A;  3X1U B;  4G92 B;  4UUZ A;  4AWL C;  4KUD A;  3W96 D;  1M18 A;  2DF4 C;  1KX3 D;  3REL D;  3AV2 D;  3X1T B;  4KGC A;  5F99 C;  3MGQ C;  1W2E A;  4X23 B;  3WA9 B;  4YS3 C;  2CV5 D;  4LD9 D;  4H9O A;  2FFF B;  1P3B D;  4M6B A;  3KXB B;  3B6G A;  5CP6 C;  3B6F C;  5AV5 C;  3X1T D;  1KX4 B;  5B2I B;  1ID3 D;  3AFA C;  3B0D C;  5B1L A;  3WKJ B;  3C1B B;  4HGA C;  4X23 D;  3WA9 D;  5AY8 B;  1KX5 A;  3REI D;  5JRG A;  1U35 B;  3MVD D;  5B33 A;  5FUG B;  1M1A C;  4NFT A;  1KX4 D;  3AV1 C;  5B24 D;  5B32 D;  3UTB B;  3W96 C;  5GT0 B;  3TU4 A;  3WKJ D;  1Z2C B;  3KFU G;  3REH A;  3W97 C;  3AZL B;  4DQY B;  1P3G C;  1TZY B;  3KUY D;  3EPL A;  3MGR A;  2CV5 C;  3AZK B;  2ARO A;  3MGP B;  4CSR A;  4DRA A;  1P3B C;  2ZY3 A;  1T3U A;  4YM6 B;  3X1V C;  1P3P A;  4KHA B;  2VQR A;  5C3I C;  5GT0 D;  4ZBJ C;  4J8U C;  1P3F B;  1P3K A;  1ID3 C;  1P3L A;  3LZ1 B;  5B0Z A;  2NZD A;  3AZL D;  3AZH A;  1HQ3 B;  1EQZ A;  3V9R B;  5BO0 B;  3AZF B;  5AV8 B;  3B0C W;  3MVD C;  4YM6 D;  5DNN A;  1AOI D;  3C1C A;  5B32 C;  4Z66 D;  3WTP D;  5AVB D;  5AV9 A;  3LZ1 D;  1M19 B;  5CPK C;  4J8X B;  2FJ7 A;  3X1S B;  5B31 B;  2HUE B;  5E5A B;  1M18 D;  3KUY C;  4KGC D;  4H9Q B;  2BG1 A;  2NQB A;  3REK C;  1KX3 A;  3REL A;  4JJN C;  3AV2 A;  5GXQ B;  5GT3 B;  1H3O A;  1P3M A;  5BT1 D;  1P3A C;  5CPI C;  5GSU B;  3MGS C;  2ZY2 A;  3X1S D;  5CPJ C;  5B1M C;  3AZM B;  3X1U A;  1ZLA C;  1S32 B;  4H9N B;  4J8V C;  5AVC B;  4XUJ C;  3REK A;  5B1L D;  4NE5 A;  3X1T A;  5GXQ D;  1AOI C;  5GT3 D;  5KDM B;  5B2J B;  3AZJ B;  5JA4 B;  3REJ B;  4X23 A;  3WA9 A;  2JSS A;  5B33 D;  2CWE A;  4G91 B;  4Z66 C;  3WTP C;  3REI A;  1WWI A;  1S32 D;  2F8N B;  4KUD C;  3KXB A;  1M18 C;  3TU4 D;  3A6N B;  1KX4 A;  5B2I A;  5B24 A;  3AZJ D;  3REH D;  3WKJ A;  3C1B A;  5AY8 A;  3MGR D;  2ARO D;  1U35 A;  1P3P D;  2ZY4 A;  2JCH A;  2HIO B;  5FUG A;  3KSY A;  3B6G C;  3MNN B;  1BH8 B;  5DNM B;  1F66 B;  1P3K D;  1BFM A;  3A1I A;  1P3L D;  5GT0 A;  4AWL B;  5B1L C;  4QLC B;  3AZH D;  1EQZ D;  2PYO B;  3R45 B;  1KX5 C;  5JRG C;  3AZL A;  1TZY A;  2HIO D;  4EO5 B;  3VH5 A;  5B33 C;  3AZK A;  2XD1 A;  2L5A A;  4E45 A;  3AYW C;  4YM6 A;  4R8P B;  3NQJ B;  1F66 D;  4KHA A;  1P3F A;  3TU4 C;  5AV9 D;  5AV6 B;  2IO5 C;  2PYO D;  2RVQ C;  2FJ7 D;  3B6F B;  5AV5 B;  3W99 B;  3LZ1 A;  1HQ3 A;  2YFV B;  3V9R A;  3MGR C;  1A7W A;  2BYK B;  3AZF A;  2NQB D;  5AV8 A;  4R8P D;  1P3M D;  5AV6 D;  3AZE D;  4WU9 B;  3UTA B;  1P3K C;  4WU8 D;  3F6T A;  3W99 D;  1P3L C;  1R4V A;  3X1U D;  5B0Z C;  2NZD C;  1M19 A;  3AZH C;  4J8X A;  1EQZ C;  3EG5 B;  3X1S A;  5B31 A;  5E5A A;  3WAA B;  3LEL B;  5DNN C;  4H9Q A;  5B40 B;  1P3G B;  4NE3 A;  3C1C C;  2LY8 A;  5GXQ A;  5GT3 A;  3X1V B;  5AV9 C;  2F2A C;  5GSU A;  5C3I B;  2FJ7 C;  3WAA D;  3VH5 T;  3AZM A;  3KXB D;  1S32 A;  1Q9C A;  4H9N A;  3AN2 B;  4J8W B;  3LEL D;  5B2I D;  5AVC A;  2NQB C;  1KX3 C;  3REL C;  3C1B D;  3VH5 W;  3AV2 C;  5AY8 D;  5KDM A;  5B2J A;  2Y2P A;  3AZJ A;  5JA4 A;  1U35 D;  3REJ A;  3H0M C;  3WTP E;  3X1U C;  3AZN B;  4LD9 C;  4G92 C;  3AN2 D;  3AZG B;  2F8N A;  3KWQ B;  5CPK B;  3UT9 B;  3UTB D;  1P3O B;  3A6N A;  3X1T C;  3EPK A;  3B0C T;  4X23 C;  3WA9 C;  3NQU B;  1TZY D;  5BNX B;  3O62 B;  3REK B;  1TAF B;  3REI C;  3AZN D;  2W8S A;  2J8P A;  3AZK D;  3MGP D;  3AZG D;  3W98 B;  3A1K A;  3KWQ D;  2HIO A;  3MGS B;  3UT9 D;  3KXB C;  1P3F D;  5B1M B;  1KX4 C;  3MNN A;  1BH8 A;  5DNM A;  1F66 A;  5B2I C;  5B24 C;  4J8V B;  4Z5T B;  2YFW B;  3WKJ C;  3C1B C;  4QLC A;  1HQ3 D;  2PYO A;  3VH6 T;  3R45 A;  3AZF D;  5B32 G;  2F8N K;  1U35 C;  3W98 D;  5AV8 D;  2Y2J A;  3VH6 W;  4H9P B;  4R8P A;  3NQJ A;  5GT0 C;  4KUD B;  5AV6 A;  3AZE A;  1M19 D;  4J8X D;  4WU8 A;  5AV5 A;  5B31 D;  3AL0 C;  5E5A D;  3W99 A;  4ZUX B;  3AZL C;  1TZY C;  2YFV A;  2BYK A;  3AZK C;  4YM6 C;  3LJA B;  1P3F C;  1BH9 B;  4WU9 A;  3FDD A;  3UTA A;  5GSU D;  1P3I B;  3EPJ A;  2Y2L A;  3AZM D;  5AVB C;  3LZ1 C;  1HQ3 C;  3WAA A;  5AVC D;  3AZF C;  2Y2Q A;  5AV8 C;  5JRG B;  1HTA A;  3LEL A;  5B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...