1AOIC

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 31
structure length 115
sequence length 115
chains with identical sequence G
ec nomenclature
pdb deposition date 1997-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiC00
1P3LA 3MNND 1EQZC 3W96A 5B2ID 3AV2B 1P3BD 3AZLC 3AFAA 1P3PA 1S32D 4X23C 5AV8A 4YS3C 1AOIC 1JFIB 5C3IC 4E44A 3REIB 1P3KC 4WU8C 5AVCC 2YFVA 1U35A 5B2JB 3LELC 4H9RB 3REHB 5B33C 3W98C 5B0ZA 1P3AC 3UTAB 2NZDA 1P34A 3O62B 2HIOD 4J8XA 2AROA 1M19D 4WU9C 5E5AD 3AZFC 5CPIA 5DNMD 4J8VD 3B0CW 3LZ1A 5B1LC 5CP6D 3R45B 4EO5C 5AV5B 5B40C 5GXQB 4J8WA 4LD9D 1H3OB 3RELC 1KX4D 3WTPE 1ID3A 3VH6W 5AV9A 5GT0A 5AVBD 4G91B 1EQZD 3VH5T 5GT3A 2PYOC 3AZLD 4X23D 2BYMB 2FJ7C 5F99A 4XZQC 1AOID 5B2IB 3V9RB 5BS7A 4G92C 4Z66B 4QLCC 3WKJA 5DNNB 1P3KD 3X1VB 4WNNA 4WU8D 4NFTA 5B24C 5AVCD 2NQBA 3LELD 1TAFB 3LZ0C 1P3LC 4YM6B 3MGSB 1P3MA 3AFAC 1P3PC 1P3AD 5JRGA 4AWLB 3MVDA 3WTPC 5B32G 5AV8C 3W99A 3AZEC 3B0BA 4Z2MG 4WU9D 3AZFD 5B1LD 4ZUXB 3UTBA 5CPJB 4R8PA 2HIOB 5B40D 1U35C 5E5AB 5DNMB 5B0ZC 1B67A 5CP6B 3W97A 1P3OC 3RELD 2NZDC 3AV1B 3UT9C 4J8XC 4LD9B 3REKC 5CPIC 4Z2MH 3KUYA 4Z5TA 1KX5A 2PYOD 1P3GA 4H9SA 2FJ7D 1EQZB 4XZQD 3AZIC 4J8WC 1HQ3B 3NQUA 4QLCD 3AZLB 3AZMA 4ZBJB 4X23B 3C1BA 1ID3C 3MGQA 4YS3B 5B24D 5C3IB 5AV6A 5AV9C 4DRBA 3LZ0D 3AZJC 1P3LD 5CPKC 3VH5A 4UUZA 3REJA 5B32A 2F8ND 5GT3C 3C1CA 3AFAD 2LY8A 1P3PD 5KDMB 4H9OA 3LJAA 3MGPA 3WTPD 3AZNB 5B33B 5B1MC 5AV8D 5BNXA 5F99C 3W98B 3AZED 2CV5A 1P3AB 3WKJC 4H9PA 4J8UA 4J8VC 3AZGA 2NQBC 1U35D 4WU9B 1P3FA 5B0YC 3X1SC 5B0ZD 5AY8C 1WWSA 3KSYA 1BH9A 4H9QB 3AN2A 1P3MC 1P3OD 2YFWB 1ZLAA 5GSUB 3MVDC 2NZDD 3X1UA 3KXBA 3WA9A 4KGCB 3W99C 3UT9D 4J8XD 3REKD 5CPID 5BNVA 3RELB 4WZSB 3LZ1D 3AZHA 3AYWC 3UTBC 3AV2A 4R8PC 3AZID 4J8WD 2PYOB 4NE5A 3W97C 2FJ7B 1ID3D 4CSRB 4XZQB 4HGAC 4QLCB 5B2JA 5AV9D 4H9RA 3AZJD 3MGRA 5CPKD 1F1EA 4Z5TC 5GT3D 1KX5C 1P3GC 5G49B 4H9SC 5FUGB 3LZ0B 3UTAA 1TZYB 5B1MD 5F99D 5B31B 4XUJA 2F8NB 2IO5C 3O62A 3AZMC 1P3PB 3WKJD 1A7WA 3WTPB 3KWQB 3X1TB 3B0DC 3R45A 2HUEB 5AV5A 3AZEB 2NQBD 5B0YD 5GXQA 3X1SD 5AY8D 5B32C 1P3MD 3C1CC 1H3OA 3LJAC 3MVDD 3WAAA 5B0ZB 3W99D 3B6GC 3A6NA 1P3OB 1N1JB 3AZGC 3AYWD 3UTBD 4KUDC 5JA4B 1ULYA 3UT9B 4R8PD 3REKB 2BYMA 5BT1C 1P3FC 3MNNB 3B6FC 3V9RA 4JJNA 4Z66A 1P3BB 3W97D 4E45A 1S32B 5DNNA 3AZIB 3X1UC 3KXBC 3X1VA 1TAFA 1P3IA 4YM6A 4Z5TD 3W96C 3MGSA 3AZHC 3AV2C 1P3GD 1KX5D 3AZJB 5CPKB 3AZMD 3C1BD 4H9NB 5B1MB 4ZUXA 5CPJA 2HIOA 5B2JC 1M19B 5E5AA 3MGRC 5B32D 4J8VB 3C1CD 5CP6A 2NQBB 1R4VA 3LJAD 5B0YB 3UTAC 3X1SB 5AY8B 1P34C 4XUJC 3AV1A 4CAYA 3B6GD 4LD9A 2AROC 3MVDB 1KX4B 3AZGD 4KUDD 3LZ1C 1M18A 3W99B 5AV5C 3B0CT 5BT1D 1P3FD 5AVBB 4NE3A 5GXQC 1KX3A 3NQJB 3B6FD 3AYWB 1HQ3A 3UTBB 3AZLA 4X23A 3X1UD 3KXBD 4YS3A 3WAAC 1AOIB 1B6WA 3A6NC 5GT0C 3TU4A 1WWIA 2BYKB 1P3KB 3VH6T 3AZHD 3W96D 4WU8B 3AV2D 5AVCB 5KDMA 5BO0B 3LELB 3AZNA 5B33A 3W98A 4Z5TB 5BS7C 4JJNC 4Z66C 5DNNC 5B31G 1F66A 3X1VC 2F8NG 2IO5B 5B2JD 4WU9A 3AZFB 3MGRD 3AZKA 1P3IC 4YM6C 5B1LB 3MGSC 4EO5B 5B40B 2YFWA 5JRGC 5GSUA 3UTAD 4KHAB 4KGCA 1P34D 4XUJD 1M1AA 2AROD 5BNXB 4ZUXC 3B6GB 5CPJC 5AV5D 3VH5W 5GXQD 4KUDB 1JFIA 3REIA 5CHLB 4XZQA 3WAAD 3B6FB 3AV1C 1BH9B 4G92B 3A6ND 5GT0D 3KUYC 3REHA 1M18C 4DRAA 5B24B 5G49A 1BH8B 5FUGA 3LZ0A 1P3LB 1TZYA 5B31A 1KX3C 3AZHB 2F8NA 4JJND 1HQ3C 4Z66D 3W96B 4ZBJC 3AFAB 5DNND 3C1BC 3WTPA 3MGQC 3KWQA 5AV8B 3X1TA 3X1VD 3AZEA 5AV6C 3TU4C 1P3ID 4YM6D 3VH6A 3REJC 3MGSD 2YFVB 1U35B 5JRGD 3MGPC 3MGRB 3AZNC 2CV5C 1P3OA 4M6BA 2NZDB 1N1JA 1F66C 4J8UC 4ZUXD 1P34B 4XUJB 5CPJD 5JA4A 3UT9A 4J8XB 2AROB 3REKA 5CPIB 3MNNA 3AZKC 3LZ1B 5B2IA 1P3BA 1Q9CA 3AN2C 1S32A 1ZLAC 5GSUC 3AZIA 4KGCC 3WA9C 3AV1D 4J8WB 1M1AC 3KUYD 1ID3B 1M18D 3WAAB 1BFMA 3A6NB 5AV9B 5GT0B 2RVQC 3AZJA 5CPKA 1KX3D 1HQ3D 5GT3B 3REIC 4H9NA 3MGQD 4YS3D 5B1MA 5F99B 4JJNB 5AV6D 1M19A 3WKJB 3TU4D 5DNMA 3REHC 4J8VA 4WNNB 3REJD 2JSSA 2L5AA 5B0YA 3MGPD 3AZND 1P3IB 1TZYC 3X1SA 5B31C 5AY8A 5B33D 3W98D 3O62C 1P3MB 2CV5D 5JRGB 1KX4A 1F66D 4J8UD 3KWQC 3X1TC 2HUEC 5AVBA 1EQZA 3AZKD 3NQJA 3AYWA 3AN2D 4R8PB 1ZLAD 5GSUD 4KGCD 3WA9D 1AOIA 2CWEA 1M1AD 3W97B 4G91C 2F8NK 2BYKA 1P3KA 4WU8A 4HGAB 4CAYB 5AVCA 3LELA 5BO0A 2RVQD 3KUYB 3MNNC 1M18B 5B2IC 4NE6A 1KX5B 1P3GB 1P3BC 3REID 1S32C 1P3AA 1KX3B 3NQUB 3AZMB 3AZFA 3C1BB 3REHD 3MGQB 5B1LA 4H9QA 3B0DB 5B40A 5AV6B 4AWLC 3TU4B 4KHAA 1TZYD 5B31D 4UUZB 3REJB 5B32B 3O62D 3C1CB 4H9OB 3LJAB 1HTAA 3RELA 3MGPB 3X1TD 3KWQD 3B6GA 2F8NH 2HIOC 2CV5B 1M19C 5E5AC 4H9PB 5DNMC 4J8UB 1F66B 3AZGB 4KUDA 2PYOA 5CP6C 1KU5A 1P3FB 2FJ7A 3AZKB 4CSRA 3B6FA 4QLCA 3AN2B 4LD9C 1ZLAB 1KX4C 3X1UB 3KXBB 3WA9B 5B24A 4WV4B 1M1AB 1BH8A 5AVBC 5BNVB
chains in the Genus database with same CATH superfamily
1P3LA 3MNND 1EQZC 2DQNC 3W96A 5B2ID 3AV2B 1P3BD 3AZLC 3AFAA 1P3PA 1S32D 4X23C 5AV8A 4YS3C 1AOIC 2G5HC 1JFIB 5C3IC 4E44A 2Y2PA 3REIB 1P3KC 2ZY3A 4WU8C 5AVCC 2YFVA 1U35A 5B2JB 3LELC 4H9RB 3REHB 5B33C 3W98C 5B0ZA 1P3AC 3UTAB 2NZDA 1P34A 2W8SA 3O62B 2HIOD 4J8XA 2AROA 1M19D 4WU9C 5E5AD 3AZFC 5CPIA 5DNMD 4J8VD 3B0CW 3LZ1A 5B1LC 5CP6D 3R45B 4EO5C 5AV5B 2F2AC 5B40C 5GXQB 4J8WA 4LD9D 3H0RC 1H3OB 3RELC 1KX4D 3WTPE 1ID3A 3VH6W 5AV9A 5GT0A 5AVBD 4G91B 1EQZD 3VH5T 5GT3A 2PYOC 3AZLD 4X23D 2BYMB 2FJ7C 5F99A 4XZQC 1AOID 5B2IB 3A1IA 3V9RB 5BS7A 4G92C 4Z66B 4QLCC 3WKJA 5DNNB 1P3KD 3X1VB 4WNNA 4WU8D 4NFTA 5B24C 2VQRA 5AVCD 2NQBA 3LELD 1TAFB 3LZ0C 1P3LC 4YM6B 3MGSB 1P3MA 3AFAC 1P3PC 1P3AD 5JRGA 4AWLB 3MVDA 3WTPC 5B32G 5AV8C 3W99A 4UPKA 3B0BA 4Z2MG 4WU9D 3AZEC 3AZFD 2Y2HA 5B1LD 4ZUXB 3UTBA 5CPJB 4R8PA 2HIOB 5B40D 1U35C 2Y2LA 5E5AB 5DNMB 5B0ZC 1B67A 5CP6B 3W97A 1P3OC 3RELD 2NZDC 3AV1B 3UT9C 4J8XC 4LD9B 3REKC 5CPIC 4Z2MH 3KUYA 4Z5TA 1KX5A 2PYOD 1P3GA 4H9SA 2FJ7D 1EQZB 4XZQD 3AZIC 4J8WC 1HQ3B 3NQUA 4QLCD 3AZLB 3AZMA 4ZBJB 4X23B 2G5IC 3C1BA 1ID3C 3MGQA 4YS3B 5B24D 5C3IB 5AV6A 5AV9C 4DRBA 3LZ0D 3AZJC 1P3LD 5CPKC 3VH5A 4UUZA 3REJA 5B32A 2F8ND 5GT3C 3C1CA 3AFAD 2LY8A 1P3PD 5KDMB 4H9OA 3LJAA 3MGPA 3WTPD 3AZNB 5B33B 5B1MC 5AV8D 5BNXA 5F99C 3W98B 3AZED 3EPJA 2CV5A 1P3AB 3WKJC 4H9PA 2Y2IA 4J8UA 4J8VC 3AZGA 2NQBC 1U35D 4WU9B 1P3FA 5B0YC 3X1SC 2RIQA 5AY8C 5B0ZD 1WWSA 3KSYA 1BH9A 4H9QB 1PZRA 3AN2A 1P3MC 1P3OD 2YFWB 1ZLAA 5GSUB 3MVDC 2NZDD 3X1UA 3KXBA 3WA9A 4KGCB 3W99C 3UT9D 4J8XD 3REKD 5CPID 5BNVA 3RELB 4WZSB 3LZ1D 3AZHA 3AYWC 3UTBC 3AV2A 4R8PC 3AZID 4J8WD 4DQYB 2PYOB 4NE5A 3W97C 2FJ7B 1ID3D 4CSRB 4XZQB 4HGAC 4QLCB 5B2JA 5AV9D 4H9RA 3AZJD 3MGRA 5CPKD 1F1EA 4Z5TC 5GT3D 1KX5C 1P3GC 5G49B 4H9SC 5FUGB 3LZ0B 3UTAA 1TZYB 5B1MD 5F99D 5B31B 2DF4C 4XUJA 2F8NB 2IO5C 3O62A 3AZMC 1P3PB 3WKJD 1A7WA 3WTPB 3KWQB 3X1TB 3B0DC 3R45A 2HUEB 5AV5A 3AZEB 2NQBD 5B0YD 5GXQA 3X1SD 5AY8D 5B32C 1P3MD 3C1CC 1H3OA 3LJAC 3MVDD 3WAAA 5B0ZB 3W99D 3B6GC 3A6NA 1P3OB 1N1JB 3AZGC 3AYWD 3UTBD 4KUDC 5JA4B 1ULYA 3UT9B 4R8PD 3REKB 5BT1C 2BYMA 1P3FC 2FFFB 3MNNB 3B6FC 3V9RA 4JJNA 4Z66A 1P3BB 3W97D 4E45A 1S32B 5DNNA 3AZIB 3X1UC 3KXBC 3X1VA 2Y2JA 1TAFA 1P3IA 4YM6A 4Z5TD 3AL0C 3W96C 3MGSA 3AZHC 3AV2C 1P3GD 1KX5D 3EPLA 3FDDA 3AZJB 5CPKB 3AZMD 3C1BD 4H9NB 5B1MB 4ZUXA 2J8PA 5CPJA 2HIOA 5B2JC 1M19B 5E5AA 2Y2QA 3MGRC 5B32D 4J8VB 3C1CD 5CP6A 2NQBB 1R4VA 3LJAD 5B0YB 3UTAC 3X1SB 5AY8B 1P34C 4XUJC 3AV1A 4CAYA 3B6GD 4LD9A 2AROC 3MVDB 1KX4B 2BG1A 1W2EA 3AZGD 4KUDD 3LZ1C 1M18A 3W99B 5AV5C 3B0CT 5BT1D 1P3FD 5AVBB 4NE3A 5GXQC 1KX3A 3NQJB 3B6FD 3AYWB 1HQ3A 3UTBB 3AZLA 4X23A 3X1UD 3KXBD 4YS3A 3WAAC 2Y2MA 1AOIB 1B6WA 3A6NC 5GT0C 3TU4A 1WWIA 2BYKB 3EPKA 1P3KB 3VH6T 3AZHD 3W96D 4WU8B 3AV2D 5AVCB 5KDMA 5BO0B 3LELB 3AZNA 5B33A 2ZY2A 3W98A 4Z5TB 2ZM5A 5BS7C 4JJNC 4Z66C 2XD5A 5DNNC 5B31G 1F66A 3X1VC 2ZY4A 2F8NG 2IO5B 5B2JD 4WU9A 3AZFB 3MGRD 3AZKA 1P3IC 4YM6C 5B1LB 3MGSC 4EO5B 5B40B 2YFWA 5JRGC 5GSUA 3UTAD 4KHAB 4KGCA 1P34D 4XUJD 1M1AA 2AROD 2Y2KA 5BNXB 4ZUXC 3B6GB 5CPJC 5AV5D 3VH5W 5GXQD 4KUDB 1JFIA 3REIA 5CHLB 4XZQA 3WAAD 2Y2NA 3H0LC 3B6FB 3AV1C 1BH9B 4G92B 3A6ND 5GT0D 3H0MC 3KUYC 3REHA 1M18C 4DRAA 5B24B 5G49A 4WJ3C 1BH8B 2ZY5A 5FUGA 3P5JB 3LZ0A 1TZYA 5B31A 1P3LB 1KX3C 3AZHB 2F8NA 4JJND 1HQ3C 4Z66D 3W96B 4ZBJC 3AFAB 5DNND 3C1BC 3WTPA 3MGQC 3KWQA 5AV8B 3X1TA 3X1VD 3AZEA 5AV6C 3TU4C 1P3ID 4YM6D 3VH6A 3REJC 3MGSD 3EPHA 2YFVB 1U35B 5JRGD 1Z2CB 3MGPC 3MGRB 3AZNC 2Y2OA 2CV5C 1P3OA 1T3UA 4M6BA 2NZDB 1N1JA 1F66C 4J8UC 4ZUXD 1P34B 4XUJB 5CPJD 5JA4A 3UT9A 4J8XB 2AROB 3REKA 5CPIB 3MNNA 3AZKC 3LZ1B 5B2IA 1P3BA 1Q9CA 2UWXA 3AN2C 1S32A 1ZLAC 5GSUC 3AZIA 4KGCC 3WA9C 3AV1D 4J8WB 1M1AC 3KUYD 1ID3B 1M18D 3WAAB 1BFMA 3A6NB 5AV9B 5GT0B 2RVQC 3AZJA 5CPKA 1KX3D 3A1KA 1HQ3D 5GT3B 3REIC 3KFUG 4H9NA 3MGQD 4YS3D 5B1MA 5F99B 4JJNB 5AV6D 1M19A 3WKJB 3TU4D 5DNMA 3REHC 4J8VA 4WNNB 3REJD 2JSSA 2L5AA 5B0YA 3MGPD 2Y2GA 3EG5B 1TZYC 3X1SA 5B31C 5AY8A 5B33D 3AZND 1P3IB 3W98D 3O62C 1P3MB 2CV5D 5JRGB 1KX4A 1F66D 4J8UD 3KWQC 2JE5A 3X1TC 3F6TA 2HUEC 5AVBA 1EQZA 3AZKD 3NQJA 3AYWA 3AN2D 4R8PB 1ZLAD 5GSUD 4KGCD 3WA9D 1AOIA 2CWEA 1M1AD 3W97B 2XD1A 4G91C 2F8NK 2BYKA 1P3KA 4WU8A 4HGAB 4CAYB 5AVCA 3LELA 5BO0A 2RVQD 3KUYB 3MNNC 1M18B 5B2IC 4NE6A 1KX5B 1P3GB 1P3BC 3REID 1S32C 1P3AA 1KX3B 3NQUB 3AZMB 2JCHA 3AZFA 3C1BB 3REHD 3MGQB 5B1LA 4H9QA 3B0DB 5B40A 5AV6B 4AWLC 3TU4B 4KHAA 1TZYD 5B31D 4UUZB 3REJB 5B32B 3O62D 3C1CB 4H9OB 3LJAB 1HTAA 3RELA 3MGPB 3X1TD 3KWQD 3B6GA 2F8NH 2HIOC 2CV5B 1M19C 5E5AC 4H9PB 5DNMC 4J8UB 1F66B 3AZGB 3IP4C 4KUDA 2PYOA 5CP6C 1KU5A 1P3FB 2FJ7A 3AZKB 4CSRA 3B6FA 4QLCA 3AN2B 4LD9C 1ZLAB 1KX4C 3X1UB 3KXBB 3WA9B 5B24A 4WV4B 1M1AB 1BH8A 5AVBC 5BNVB
chains in the Genus database with same CATH topology
1P3LA 3MNND 1EQZC 2DQNC 3W96A 5B2ID 3AV2B 1P3BD 3AZLC 3AFAA 1P3PA 1S32D 4X23C 5AV8A 4YS3C 1AOIC 2G5HC 1JFIB 5C3IC 4E44A 2Y2PA 3REIB 1P3KC 2ZY3A 4WU8C 5AVCC 2YFVA 1U35A 5B2JB 3LELC 4H9RB 3REHB 5B33C 3W98C 5B0ZA 1P3AC 3UTAB 2NZDA 1P34A 2W8SA 3O62B 2HIOD 4J8XA 2AROA 1M19D 4WU9C 5E5AD 3AZFC 5CPIA 5DNMD 4J8VD 3B0CW 3LZ1A 5B1LC 5CP6D 3R45B 4EO5C 5AV5B 2F2AC 5B40C 5GXQB 4J8WA 4LD9D 3H0RC 1H3OB 3RELC 1KX4D 3WTPE 1ID3A 3VH6W 5AV9A 5GT0A 5AVBD 4G91B 1EQZD 3VH5T 5GT3A 2PYOC 3AZLD 4X23D 2BYMB 2FJ7C 5F99A 4XZQC 1AOID 5B2IB 3A1IA 3V9RB 5BS7A 4G92C 4Z66B 4QLCC 3WKJA 5DNNB 1P3KD 3X1VB 4WNNA 4WU8D 4NFTA 5B24C 2VQRA 5AVCD 2NQBA 3LELD 1TAFB 3LZ0C 1P3LC 4YM6B 3MGSB 1P3MA 3AFAC 1P3PC 1P3AD 5JRGA 4AWLB 3MVDA 3WTPC 5B32G 5AV8C 3W99A 4UPKA 3B0BA 4Z2MG 4WU9D 3AZEC 3AZFD 2Y2HA 5B1LD 4ZUXB 3UTBA 5CPJB 4R8PA 2HIOB 5B40D 1U35C 2Y2LA 5E5AB 5DNMB 5B0ZC 1B67A 5CP6B 3W97A 1P3OC 3RELD 2NZDC 3AV1B 3UT9C 4J8XC 4LD9B 3REKC 5CPIC 4Z2MH 3KUYA 4Z5TA 1KX5A 2PYOD 1P3GA 4H9SA 2FJ7D 1EQZB 4XZQD 3AZIC 4J8WC 1HQ3B 3NQUA 4QLCD 3AZLB 3AZMA 4ZBJB 4X23B 2G5IC 3C1BA 1ID3C 3MGQA 4YS3B 5B24D 5C3IB 5AV6A 5AV9C 4DRBA 3LZ0D 3AZJC 1P3LD 5CPKC 3VH5A 4UUZA 3REJA 5B32A 2F8ND 5GT3C 3C1CA 3AFAD 2LY8A 1P3PD 5KDMB 4H9OA 3LJAA 3MGPA 3WTPD 3AZNB 5B33B 5B1MC 5AV8D 5BNXA 5F99C 3W98B 3AZED 3EPJA 2CV5A 1P3AB 3WKJC 4H9PA 2Y2IA 4J8UA 4J8VC 3AZGA 2NQBC 1U35D 4WU9B 1P3FA 5B0YC 3X1SC 2RIQA 5AY8C 5B0ZD 1WWSA 3KSYA 1BH9A 4H9QB 1PZRA 3AN2A 1P3MC 1P3OD 2YFWB 1ZLAA 5GSUB 3MVDC 2NZDD 3X1UA 3KXBA 3WA9A 4KGCB 3W99C 3UT9D 4J8XD 3REKD 5CPID 5BNVA 3RELB 4WZSB 3LZ1D 3AZHA 3AYWC 3UTBC 3AV2A 4R8PC 3AZID 4J8WD 4DQYB 2PYOB 4NE5A 3W97C 2FJ7B 1ID3D 4CSRB 4XZQB 4HGAC 4QLCB 5B2JA 5AV9D 4H9RA 3AZJD 3MGRA 5CPKD 1F1EA 4Z5TC 5GT3D 1KX5C 1P3GC 5G49B 4H9SC 5FUGB 3LZ0B 3UTAA 1TZYB 5B1MD 5F99D 5B31B 2DF4C 4XUJA 2F8NB 2IO5C 3O62A 3AZMC 1P3PB 3WKJD 1A7WA 3WTPB 3KWQB 3X1TB 3B0DC 3R45A 2HUEB 5AV5A 3AZEB 2NQBD 5B0YD 5GXQA 3X1SD 5AY8D 5B32C 1P3MD 3C1CC 1H3OA 3LJAC 3MVDD 3WAAA 5B0ZB 3W99D 3B6GC 3A6NA 1P3OB 1N1JB 3AZGC 3AYWD 3UTBD 4KUDC 5JA4B 1ULYA 3UT9B 4R8PD 3REKB 5BT1C 2BYMA 1P3FC 2FFFB 3MNNB 3B6FC 3V9RA 4JJNA 4Z66A 1P3BB 3W97D 4E45A 1S32B 5DNNA 3AZIB 3X1UC 3KXBC 3X1VA 2Y2JA 1TAFA 1P3IA 4YM6A 4Z5TD 3AL0C 3W96C 3MGSA 3AZHC 3AV2C 1P3GD 1KX5D 3EPLA 3FDDA 3AZJB 5CPKB 3AZMD 3C1BD 4H9NB 5B1MB 4ZUXA 2J8PA 5CPJA 2HIOA 5B2JC 1M19B 5E5AA 2Y2QA 3MGRC 5B32D 4J8VB 3C1CD 5CP6A 2NQBB 1R4VA 3LJAD 5B0YB 3UTAC 3X1SB 5AY8B 1P34C 4XUJC 3AV1A 4CAYA 3B6GD 4LD9A 2AROC 3MVDB 1KX4B 2BG1A 1W2EA 3AZGD 4KUDD 3LZ1C 1M18A 3W99B 5AV5C 3B0CT 5BT1D 1P3FD 5AVBB 4NE3A 5GXQC 1KX3A 3NQJB 3B6FD 3AYWB 1HQ3A 3UTBB 3AZLA 4X23A 3X1UD 3KXBD 4YS3A 3WAAC 2Y2MA 1AOIB 1B6WA 3A6NC 5GT0C 3TU4A 1WWIA 2BYKB 3EPKA 1P3KB 3VH6T 3AZHD 3W96D 4WU8B 3AV2D 5AVCB 5KDMA 5BO0B 3LELB 3AZNA 5B33A 2ZY2A 3W98A 4Z5TB 2ZM5A 5BS7C 4JJNC 4Z66C 2XD5A 5DNNC 5B31G 1F66A 3X1VC 2ZY4A 2F8NG 2IO5B 5B2JD 4WU9A 3AZFB 3MGRD 3AZKA 1P3IC 4YM6C 5B1LB 3MGSC 4EO5B 5B40B 2YFWA 5JRGC 5GSUA 3UTAD 4KHAB 4KGCA 1P34D 4XUJD 1M1AA 2AROD 2Y2KA 5BNXB 4ZUXC 3B6GB 5CPJC 5AV5D 3VH5W 5GXQD 4KUDB 1JFIA 3REIA 5CHLB 4XZQA 3WAAD 2Y2NA 3H0LC 3B6FB 3AV1C 1BH9B 4G92B 3A6ND 5GT0D 3H0MC 3KUYC 3REHA 1M18C 4DRAA 5B24B 5G49A 4WJ3C 1BH8B 2ZY5A 5FUGA 3P5JB 3LZ0A 1TZYA 5B31A 1P3LB 1KX3C 3AZHB 2F8NA 4JJND 1HQ3C 4Z66D 3W96B 4ZBJC 3AFAB 5DNND 3C1BC 3WTPA 3MGQC 3KWQA 5AV8B 3X1TA 3X1VD 3AZEA 5AV6C 3TU4C 1P3ID 4YM6D 3VH6A 3REJC 3MGSD 3EPHA 2YFVB 1U35B 5JRGD 1Z2CB 3MGPC 3MGRB 3AZNC 2Y2OA 2CV5C 1P3OA 1T3UA 4M6BA 2NZDB 1N1JA 1F66C 4J8UC 4ZUXD 1P34B 4XUJB 5CPJD 5JA4A 3UT9A 4J8XB 2AROB 3REKA 5CPIB 3MNNA 3AZKC 3LZ1B 5B2IA 1P3BA 1Q9CA 2UWXA 3AN2C 1S32A 1ZLAC 5GSUC 3AZIA 4KGCC 3WA9C 3AV1D 4J8WB 1M1AC 3KUYD 1ID3B 1M18D 3WAAB 1BFMA 3A6NB 5AV9B 5GT0B 2RVQC 3AZJA 5CPKA 1KX3D 3A1KA 1HQ3D 5GT3B 3REIC 3KFUG 4H9NA 3MGQD 4YS3D 5B1MA 5F99B 4JJNB 5AV6D 1M19A 3WKJB 3TU4D 5DNMA 3REHC 4J8VA 4WNNB 3REJD 2JSSA 2L5AA 5B0YA 3MGPD 2Y2GA 3EG5B 1TZYC 3X1SA 5B31C 5AY8A 5B33D 3AZND 1P3IB 3W98D 3O62C 1P3MB 2CV5D 5JRGB 1KX4A 1F66D 4J8UD 3KWQC 2JE5A 3X1TC 3F6TA 2HUEC 5AVBA 1EQZA 3AZKD 3NQJA 3AYWA 3AN2D 4R8PB 1ZLAD 5GSUD 4KGCD 3WA9D 1AOIA 2CWEA 1M1AD 3W97B 2XD1A 4G91C 2F8NK 2BYKA 1P3KA 4WU8A 4HGAB 4CAYB 5AVCA 3LELA 5BO0A 2RVQD 3KUYB 3MNNC 1M18B 5B2IC 4NE6A 1KX5B 1P3GB 1P3BC 3REID 1S32C 1P3AA 1KX3B 3NQUB 3AZMB 2JCHA 3AZFA 3C1BB 3REHD 3MGQB 5B1LA 4H9QA 3B0DB 5B40A 5AV6B 4AWLC 3TU4B 4KHAA 1TZYD 5B31D 4UUZB 3REJB 5B32B 3O62D 3C1CB 4H9OB 3LJAB 1HTAA 3RELA 3MGPB 3X1TD 3KWQD 3B6GA 2F8NH 2HIOC 2CV5B 1M19C 5E5AC 4H9PB 5DNMC 4J8UB 1F66B 3AZGB 3IP4C 4KUDA 2PYOA 5CP6C 1KU5A 1P3FB 2FJ7A 3AZKB 4CSRA 3B6FA 4QLCA 3AN2B 4LD9C 1ZLAB 1KX4C 3X1UB 3KXBB 3WA9B 5B24A 4WV4B 1M1AB 1BH8A 5AVBC 5BNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3L A;  3MNN D;  1EQZ C;  3W96 A;  5B2I D;  3AV2 B;  1P3B D;  3AZL C;  3AFA A;  1P3P A;  1S32 D;  4X23 C;  5AV8 A;  4YS3 C;  1AOI C;  1JFI B;  5C3I C;  4E44 A;  3REI B;  1P3K C;  4WU8 C;  5AVC C;  2YFV A;  1U35 A;  5B2J B;  3LEL C;  4H9R B;  3REH B;  5B33 C;  3W98 C;  5B0Z A;  1P3A C;  3UTA B;  2NZD A;  1P34 A;  3O62 B;  2HIO D;  4J8X A;  2ARO A;  1M19 D;  4WU9 C;  5E5A D;  3AZF C;  5CPI A;  5DNM D;  4J8V D;  3B0C W;  3LZ1 A;  5B1L C;  5CP6 D;  3R45 B;  4EO5 C;  5AV5 B;  5B40 C;  5GXQ B;  4J8W A;  4LD9 D;  1H3O B;  3REL C;  1KX4 D;  3WTP E;  1ID3 A;  3VH6 W;  5AV9 A;  5GT0 A;  5AVB D;  4G91 B;  1EQZ D;  3VH5 T;  5GT3 A;  2PYO C;  3AZL D;  4X23 D;  2BYM B;  2FJ7 C;  5F99 A;  4XZQ C;  1AOI D;  5B2I B;  3V9R B;  5BS7 A;  4G92 C;  4Z66 B;  4QLC C;  3WKJ A;  5DNN B;  1P3K D;  3X1V B;  4WNN A;  4WU8 D;  4NFT A;  5B24 C;  5AVC D;  2NQB A;  3LEL D;  1TAF B;  3LZ0 C;  1P3L C;  4YM6 B;  3MGS B;  1P3M A;  3AFA C;  1P3P C;  1P3A D;  5JRG A;  4AWL B;  3MVD A;  3WTP C;  5B32 G;  5AV8 C;  3W99 A;  3AZE C;  3B0B A;  4Z2M G;  4WU9 D;  3AZF D;  5B1L D;  4ZUX B;  3UTB A;  5CPJ B;  4R8P A;  2HIO B;  5B40 D;  1U35 C;  5E5A B;  5DNM B;  5B0Z C;  1B67 A;  5CP6 B;  3W97 A;  1P3O C;  3REL D;  2NZD C;  3AV1 B;  3UT9 C;  4J8X C;  4LD9 B;  3REK C;  5CPI C;  4Z2M H;  3KUY A;  4Z5T A;  1KX5 A;  2PYO D;  1P3G A;  4H9S A;  2FJ7 D;  1EQZ B;  4XZQ D;  3AZI C;  4J8W C;  1HQ3 B;  3NQU A;  4QLC D;  3AZL B;  3AZM A;  4ZBJ B;  4X23 B;  3C1B A;  1ID3 C;  3MGQ A;  4YS3 B;  5B24 D;  5C3I B;  5AV6 A;  5AV9 C;  4DRB A;  3LZ0 D;  3AZJ C;  1P3L D;  5CPK C;  3VH5 A;  4UUZ A;  3REJ A;  5B32 A;  2F8N D;  5GT3 C;  3C1C A;  3AFA D;  2LY8 A;  1P3P D;  5KDM B;  4H9O A;  3LJA A;  3MGP A;  3WTP D;  3AZN B;  5B33 B;  5B1M C;  5AV8 D;  5BNX A;  5F99 C;  3W98 B;  3AZE D;  2CV5 A;  1P3A B;  3WKJ C;  4H9P A;  4J8U A;  4J8V C;  3AZG A;  2NQB C;  1U35 D;  4WU9 B;  1P3F A;  5B0Y C;  3X1S C;  5B0Z D;  5AY8 C;  1WWS A;  3KSY A;  1BH9 A;  4H9Q B;  3AN2 A;  1P3M C;  1P3O D;  2YFW B;  1ZLA A;  5GSU B;  3MVD C;  2NZD D;  3X1U A;  3KXB A;  3WA9 A;  4KGC B;  3W99 C;  3UT9 D;  4J8X D;  3REK D;  5CPI D;  5BNV A;  3REL B;  4WZS B;  3LZ1 D;  3AZH A;  3AYW C;  3UTB C;  3AV2 A;  4R8P C;  3AZI D;  4J8W D;  2PYO B;  4NE5 A;  3W97 C;  2FJ7 B;  1ID3 D;  4CSR B;  4XZQ B;  4HGA C;  4QLC B;  5B2J A;  5AV9 D;  4H9R A;  3AZJ D;  3MGR A;  5CPK D;  1F1E A;  4Z5T C;  5GT3 D;  1KX5 C;  1P3G C;  5G49 B;  4H9S C;  5FUG B;  3LZ0 B;  3UTA A;  1TZY B;  5B1M D;  5F99 D;  5B31 B;  4XUJ A;  2F8N B;  2IO5 C;  3O62 A;  3AZM C;  1P3P B;  3WKJ D;  1A7W A;  3WTP B;  3KWQ B;  3X1T B;  3B0D C;  3R45 A;  2HUE B;  5AV5 A;  3AZE B;  2NQB D;  5B0Y D;  5GXQ A;  3X1S D;  5AY8 D;  5B32 C;  1P3M D;  3C1C C;  1H3O A;  3LJA C;  3MVD D;  3WAA A;  5B0Z B;  3W99 D;  3B6G C;  3A6N A;  1P3O B;  1N1J B;  3AZG C;  3AYW D;  3UTB D;  4KUD C;  5JA4 B;  1ULY A;  3UT9 B;  4R8P D;  3REK B;  2BYM A;  5BT1 C;  1P3F C;  3MNN B;  3B6F C;  3V9R A;  4JJN A;  4Z66 A;  1P3B B;  3W97 D;  4E45 A;  1S32 B;  5DNN A;  3AZI B;  3X1U C;  3KXB C;  3X1V A;  1TAF A;  1P3I A;  4YM6 A;  4Z5T D;  3W96 C;  3MGS A;  3AZH C;  3AV2 C;  1P3G D;  1KX5 D;  3AZJ B;  5CPK B;  3AZM D;  3C1B D;  4H9N B;  5B1M B;  4ZUX A;  5CPJ A;  2HIO A;  5B2J C;  1M19 B;  5E5A A;  3MGR C;  5B32 D;  4J8V B;  3C1C D;  5CP6 A;  2NQB B;  1R4V A;  3LJA D;  5B0Y B;  3UTA C;  3X1S B;  5AY8 B;  1P34 C;  4XUJ C;  3AV1 A;  4CAY A;  3B6G D;  4LD9 A;  2ARO C;  3MVD B;  1KX4 B;  3AZG D;  4KUD D;  3LZ1 C;  1M18 A;  3W99 B;  5AV5 C;  3B0C T;  5BT1 D;  1P3F D;  5AVB B;  4NE3 A;  5GXQ C;  1KX3 A;  3NQJ B;  3B6F D;  3AYW B;  1HQ3 A;  3UTB B;  3AZL A;  4X23 A;  3X1U D;  3KXB D;  4YS3 A;  3WAA C;  1AOI B;  1B6W A;  3A6N C;  5GT0 C;  3TU4 A;  1WWI A;  2BYK B;  1P3K B;  3VH6 T;  3AZH D;  3W96 D;  4WU8 B;  3AV2 D;  5AVC B;  5KDM A;  5BO0 B;  3LEL B;  3AZN A;  5B33 A;  3W98 A;  4Z5T B;  5BS7 C;  4JJN C;  4Z66 C;  5DNN C;  5B31 G;  1F66 A;  3X1V C;  2F8N G;  2IO5 B;  5B2J D;  4WU9 A;  3AZF B;  3MGR D;  3AZK A;  1P3I C;  4YM6 C;  5B1L B;  3MGS C;  4EO5 B;  5B40 B;  2YFW A;  5JRG C;  5GSU A;  3UTA D;  4KHA B;  4KGC A;  1P34 D;  4XUJ D;  1M1A A;  2ARO D;  5BNX B;  4ZUX C;  3B6G B;  5CPJ C;  5AV5 D;  3VH5 W;  5GXQ D;  4KUD B;  1JFI A;  3REI A;  5CHL B;  4XZQ A;  3WAA D;  3B6F B;  3AV1 C;  1BH9 B;  4G92 B;  3A6N D;  5GT0 D;  3KUY C;  3REH A;  1M18 C;  4DRA A;  5B24 B;  5G49 A;  1BH8 B;  5FUG A;  3LZ0 A;  1P3L B;  1TZY A;  5B31 A;  1KX3 C;  3AZH B;  2F8N A;  4JJN D;  1HQ3 C;  4Z66 D;  3W96 B;  4ZBJ C;  3AFA B;  5DNN D;  3C1B C;  3WTP A;  3MGQ C;  3KWQ A;  5AV8 B;  3X1T A;  3X1V D;  3AZE A;  5AV6 C;  3TU4 C;  1P3I D;  4YM6 D;  3VH6 A;  3REJ C;  3MGS D;  2YFV B;  1U35 B;  5JRG D;  3MGP C;  3MGR B;  3AZN C;  2CV5 C;  1P3O A;  4M6B A;  2NZD B;  1N1J A;  1F66 C;  4J8U C;  4ZUX D;  1P34 B;  4XUJ B;  5CPJ D;  5JA4 A;  3UT9 A;  4J8X B;  2ARO B;  3REK A;  5CPI B;  3MNN A;  3AZK C;  3LZ1 B;  5B2I A;  1P3B A;  1Q9C A;  3AN2 C;  1S32 A;  1ZLA C;  5GSU C;  3AZI A;  4KGC C;  3WA9 C;  3AV1 D;  4J8W B;  1M1A C;  3KUY D;  1ID3 B;  1M18 D;  3WAA B;  1BFM A;  3A6N B;  5AV9 B;  5GT0 B;  2RVQ C;  3AZJ A;  5CPK A;  1KX3 D;  1HQ3 D;  5GT3 B;  3REI C;  4H9N A;  3MGQ D;  4YS3 D;  5B1M A;  5F99 B;  4JJN B;  5AV6 D;  1M19 A;  3WKJ B;  3TU4 D;  5DNM A;  3REH C;  4J8V A;  4WNN B;  3REJ D;  2JSS A;  2L5A A;  5B0Y A;  3MGP D;  3AZN D;  1P3I B;  1TZY C;  3X1S A;  5B31 C;  5AY8 A;  5B33 D;  3W98 D;  3O62 C;  1P3M B;  2CV5 D;  5JRG B;  1KX4 A;  1F66 D;  4J8U D;  3KWQ C;  3X1T C;  2HUE C;  5AVB A;  1EQZ A;  3AZK D;  3NQJ A;  3AYW A;  3AN2 D;  4R8P B;  1ZLA D;  5GSU D;  4KGC D;  3WA9 D;  1AOI A;  2CWE A;  1M1A D;  3W97 B;  4G91 C;  2F8N K;  2BYK A;  1P3K A;  4WU8 A;  4HGA B;  4CAY B;  5AVC A;  3LEL A;  5BO0 A;  2RVQ D;  3KUY B;  3MNN C;  1M18 B;  5B2I C;  4NE6 A;  1KX5 B;  1P3G B;  1P3B C;  3REI D;  1S32 C;  1P3A A;  1KX3 B;  3NQU B;  3AZM B;  3AZF A;  3C1B B;  3REH D;  3MGQ B;  5B1L A;  4H9Q A;  3B0D B;  5B40 A;  5AV6 B;  4AWL C;  3TU4 B;  4KHA A;  1TZY D;  5B31 D;  4UUZ B;  3REJ B;  5B32 B;  3O62 D;  3C1C B;  4H9O B;  3LJA B;  1HTA A;  3REL A;  3MGP B;  3X1T D;  3KWQ D;  3B6G A;  2F8N H;  2HIO C;  2CV5 B;  1M19 C;  5E5A C;  4H9P B;  5DNM C;  4J8U B;  1F66 B;  3AZG B;  4KUD A;  2PYO A;  5CP6 C;  1KU5 A;  1P3F B;  2FJ7 A;  3AZK B;  4CSR A;  3B6F A;  4QLC A;  3AN2 B;  4LD9 C;  1ZLA B;  1KX4 C;  3X1U B;  3KXB B;  3WA9 B;  5B24 A;  4WV4 B;  1M1A B;  1BH8 A;  5AVB C;  5BNV B; 
#chains in the Genus database with same CATH topology
 1P3L A;  3MNN D;  1EQZ C;  2DQN C;  3W96 A;  5B2I D;  3AV2 B;  1P3B D;  3AZL C;  3AFA A;  1P3P A;  1S32 D;  4X23 C;  5AV8 A;  4YS3 C;  1AOI C;  2G5H C;  1JFI B;  5C3I C;  4E44 A;  2Y2P A;  3REI B;  1P3K C;  2ZY3 A;  4WU8 C;  5AVC C;  2YFV A;  1U35 A;  5B2J B;  3LEL C;  4H9R B;  3REH B;  5B33 C;  3W98 C;  5B0Z A;  1P3A C;  3UTA B;  2NZD A;  1P34 A;  2W8S A;  3O62 B;  2HIO D;  4J8X A;  2ARO A;  1M19 D;  4WU9 C;  5E5A D;  3AZF C;  5CPI A;  5DNM D;  4J8V D;  3B0C W;  3LZ1 A;  5B1L C;  5CP6 D;  3R45 B;  4EO5 C;  5AV5 B;  2F2A C;  5B40 C;  5GXQ B;  4J8W A;  4LD9 D;  3H0R C;  1H3O B;  3REL C;  1KX4 D;  3WTP E;  1ID3 A;  3VH6 W;  5AV9 A;  5GT0 A;  5AVB D;  4G91 B;  1EQZ D;  3VH5 T;  5GT3 A;  2PYO C;  3AZL D;  4X23 D;  2BYM B;  2FJ7 C;  5F99 A;  4XZQ C;  1AOI D;  5B2I B;  3A1I A;  3V9R B;  5BS7 A;  4G92 C;  4Z66 B;  4QLC C;  3WKJ A;  5DNN B;  1P3K D;  3X1V B;  4WNN A;  4WU8 D;  4NFT A;  5B24 C;  2VQR A;  5AVC D;  2NQB A;  3LEL D;  1TAF B;  3LZ0 C;  1P3L C;  4YM6 B;  3MGS B;  1P3M A;  3AFA C;  1P3P C;  1P3A D;  5JRG A;  4AWL B;  3MVD A;  3WTP C;  5B32 G;  5AV8 C;  3W99 A;  4UPK A;  3B0B A;  4Z2M G;  4WU9 D;  3AZE C;  3AZF D;  2Y2H A;  5B1L D;  4ZUX B;  3UTB A;  5CPJ B;  4R8P A;  2HIO B;  5B40 D;  1U35 C;  2Y2L A;  5E5A B;  5DNM B;  5B0Z C;  1B67 A;  5CP6 B;  3W97 A;  1P3O C;  3REL D;  2NZD C;  3AV1 B;  3UT9 C;  4J8X C;  4LD9 B;  3REK C;  5CPI C;  4Z2M H;  3KUY A;  4Z5T A;  1KX5 A;  2PYO D;  1P3G A;  4H9S A;  2FJ7 D;  1EQZ B;  4XZQ D;  3AZI C;  4J8W C;  1HQ3 B;  3NQU A;  4QLC D;  3AZL B;  3AZM A;  4ZBJ B;  4X23 B;  2G5I C;  3C1B A;  1ID3 C;  3MGQ A;  4YS3 B;  5B24 D;  5C3I B;  5AV6 A;  5AV9 C;  4DRB A;  3LZ0 D;  3AZJ C;  1P3L D;  5CPK C;  3VH5 A;  4UUZ A;  3REJ A;  5B32 A;  2F8N D;  5GT3 C;  3C1C A;  3AFA D;  2LY8 A;  1P3P D;  5KDM B;  4H9O A;  3LJA A;  3MGP A;  3WTP D;  3AZN B;  5B33 B;  5B1M C;  5AV8 D;  5BNX A;  5F99 C;  3W98 B;  3AZE D;  3EPJ A;  2CV5 A;  1P3A B;  3WKJ C;  4H9P A;  2Y2I A;  4J8U A;  4J8V C;  3AZG A;  2NQB C;  1U35 D;  4WU9 B;  1P3F A;  5B0Y C;  3X1S C;  2RIQ A;  5AY8 C;  5B0Z D;  1WWS A;  3KSY A;  1BH9 A;  4H9Q B;  1PZR A;  3AN2 A;  1P3M C;  1P3O D;  2YFW B;  1ZLA A;  5GSU B;  3MVD C;  2NZD D;  3X1U A;  3KXB A;  3WA9 A;  4KGC B;  3W99 C;  3UT9 D;  4J8X D;  3REK D;  5CPI D;  5BNV A;  3REL B;  4WZS B;  3LZ1 D;  3AZH A;  3AYW C;  3UTB C;  3AV2 A;  4R8P C;  3AZI D;  4J8W D;  4DQY B;  2PYO B;  4NE5 A;  3W97 C;  2FJ7 B;  1ID3 D;  4CSR B;  4XZQ B;  4HGA C;  4QLC B;  5B2J A;  5AV9 D;  4H9R A;  3AZJ D;  3MGR A;  5CPK D;  1F1E A;  4Z5T C;  5GT3 D;  1KX5 C;  1P3G C;  5G49 B;  4H9S C;  5FUG B;  3LZ0 B;  3UTA A;  1TZY B;  5B1M D;  5F99 D;  5B31 B;  2DF4 C;  4XUJ A;  2F8N B;  2IO5 C;  3O62 A;  3AZM C;  1P3P B;  3WKJ D;  1A7W A;  3WTP B;  3KWQ B;  3X1T B;  3B0D C;  3R45 A;  2HUE B;  5AV5 A;  3AZE B;  2NQB D;  5B0Y D;  5GXQ A;  3X1S D;  5AY8 D;  5B32 C;  1P3M D;  3C1C C;  1H3O A;  3LJA C;  3MVD D;  3WAA A;  5B0Z B;  3W99 D;  3B6G C;  3A6N A;  1P3O B;  1N1J B;  3AZG C;  3AYW D;  3UTB D;  4KUD C;  5JA4 B;  1ULY A;  3UT9 B;  4R8P D;  3REK B;  5BT1 C;  2BYM A;  1P3F C;  2FFF B;  3MNN B;  3B6F C;  3V9R A;  4JJN A;  4Z66 A;  1P3B B;  3W97 D;  4E45 A;  1S32 B;  5DNN A;  3AZI B;  3X1U C;  3KXB C;  3X1V A;  2Y2J A;  1TAF A;  1P3I A;  4YM6 A;  4Z5T D;  3AL0 C;  3W96 C;  3MGS A;  3AZH C;  3AV2 C;  1P3G D;  1KX5 D;  3EPL A;  3FDD A;  3AZJ B;  5CPK B;  3AZM D;  3C1B D;  4H9N B;  5B1M B;  4ZUX A;  2J8P A;  5CPJ A;  2HIO A;  5B2J C;  1M19 B;  5E5A A;  2Y2Q A;  3MGR C;  5B32 D;  4J8V B;  3C1C D;  5CP6 A;  2NQB B;  1R4V A;  3LJA D;  5B0Y B;  3UTA C;  3X1S B;  5AY8 B;  1P34 C;  4XUJ C;  3AV1 A;  4CAY A;  3B6G D;  4LD9 A;  2ARO C;  3MVD B;  1KX4 B;  2BG1 A;  1W2E A;  3AZG D;  4KUD D;  3LZ1 C;  1M18 A;  3W99 B;  5AV5 C;  3B0C T;  5BT1 D;  1P3F D;  5AVB B;  4NE3 A;  5GXQ C;  1KX3 A;  3NQJ B;  3B6F D;  3AYW B;  1HQ3 A;  3UTB B;  3AZL A;  4X23 A;  3X1U D;  3KXB D;  4YS3 A;  3WAA C;  2Y2M A;  1AOI B;  1B6W A;  3A6N C;  5GT0 C;  3TU4 A;  1WWI A;  2BYK B;  3EPK A;  1P3K B;  3VH6 T;  3AZH D;  3W96 D;  4WU8 B;  3AV2 D;  5AVC B;  5KDM A;  5BO0 B;  3LEL B;  3AZN A;  5B33 A;  2ZY2 A;  3W98 A;  4Z5T B;  2ZM5 A;  5BS7 C;  4JJN C;  4Z66 C;  2XD5 A;  5DNN C;  5B31 G;  1F66 A;  3X1V C;  2ZY4 A;  2F8N G;  2IO5 B;  5B2J D;  4WU9 A;  3AZF B;  3MGR D;  3AZK A;  1P3I C;  4YM6 C;  5B1L B;  3MGS C;  4EO5 B;  5B40 B;  2YFW A;  5JRG C;  5GSU A;  3UTA D;  4KHA B;  4KGC A;  1P34 D;  4XUJ D;  1M1A A;  2ARO D;  2Y2K A;  5BNX B;  4ZUX C;  3B6G B;  5CPJ C;  5AV5 D;  3VH5 W;  5GXQ D;  4KUD B;  1JFI A;  3REI A;  5CHL B;  4XZQ A;  3WAA D;  2Y2N A;  3H0L C;  3B6F B;  3AV1 C;  1BH9 B;  4G92 B;  3A6N D;  5GT0 D;  3H0M C;  3KUY C;  3REH A;  1M18 C;  4DRA A;  5B24 B;  5G49 A;  4WJ3 C;  1BH8 B;  2ZY5 A;  5FUG A;  3P5J B;  3LZ0 A;  1TZY A;  5B31 A;  1P3L B;  1KX3 C;  3AZH B;  2F8N A;  4JJN D;  1HQ3 C;  4Z66 D;  3W96 B;  4ZBJ C;  3AFA B;  5DNN D;  3C1B C;  3WTP A;  3MGQ C;  3KWQ A;  5AV8 B;  3X1T A;  3X1V D;  3AZE A;  5AV6 C;  3TU4 C;  1P3I D;  4YM6 D;  3VH6 A;  3REJ C;  3MGS D;  3EPH A;  2YFV B;  1U35 B;  5JRG D;  1Z2C B;  3MGP C;  3MGR B;  3AZN C;  2Y2O A;  2CV5 C;  1P3O A;  1T3U A;  4M6B A;  2NZD B;  1N1J A;  1F66 C;  4J8U C;  4ZUX D;  1P34 B;  4XUJ B;  5CPJ D;  5JA4 A;  3UT9 A;  4J8X B;  2ARO B;  3REK A;  5CPI B;  3MNN A;  3AZK C;  3LZ1 B;  5B2I A;  1P3B A;  1Q9C A;  2UWX A;  3AN2 C;  1S32 A;  1ZLA C;  5GSU C;  3AZI A;  4KGC C;  3WA9 C;  3AV1 D;  4J8W B;  1M1A C;  3KUY D;  1ID3 B;  1M18 D;  3WAA B;  1BFM A;  3A6N B;  5AV9 B;  5GT0 B;  2RVQ C;  3AZJ A;  5CPK A;  1KX3 D;  3A1K A;  1HQ3 D;  5GT3 B;  3REI C;  3KFU G;  4H9N A;  3MGQ D;  4YS3 D;  5B1M A;  5F99 B;  4JJN B;  5AV6 D;  1M19 A;  3WKJ B;  3TU4 D;  5DNM A;  3REH C;  4J8V A;  4WNN B;  3REJ D;  2JSS A;  2L5A A;  5B0Y A;  3MGP D;  2Y2G A;  3EG5 B;  1TZY C;  3X1S A;  5B31 C;  5AY8 A;  5B33 D;  3AZN D;  1P3I B;  3W98 D;  3O62 C;  1P3M B;  2CV5 D;  5JRG B;  1KX4 A;  1F66 D;  4J8U D;  3KWQ C;  2JE5 A;  3X1T C;  3F6T A;  2HUE C;  5AVB A;  1EQZ A;  3AZK D;  3NQJ A;  3AYW A;  3AN2 D;  4R8P B;  1ZLA D;  5GSU D;  4KGC D;  3WA9 D;  1AOI A;  2CWE A;  1M1A D;  3W97 B;  2XD1 A;  4G91 C;  2F8N K;  2BYK A;  1P3K A;  4WU8 A;  4HGA B;  4CAY B;  5AVC A;  3LEL A;  5BO0 A;  2RVQ D;  3KUY B;  3MNN C;  1M18 B;  5B2I C;  4NE6 A;  1KX5 B;  1P3G B;  1P3B C;  3REI D;  1S32 C;  1P3A A;  1KX3 B;  3NQU B;  3AZM B;  2JCH A;  3AZF A;  3C1B B;  3REH D;  3MGQ B;  5B1L A;  4H9Q A;  3B0D B;  5B40 A;  5AV6 B;  4AWL C;  3TU4 B;  4KHA A;  1TZY D;  5B31 D;  4UUZ B;  3REJ B;  5B32 B;  3O62 D;  3C1C B;  4H9O B;  3LJA B;  1HTA A;  3REL A;  3MGP B;  3X1T D;  3KWQ D;  3B6G A;  2F8N H;  2HIO C;  2CV5 B;  1M19 C;  5E5A C;  4H9P B;  5DNM C;  4J8U B;  1F66 B;  3AZG B;  3IP4 C;  4KUD A;  2PYO A;  5CP6 C;  1KU5 A;  1P3F B;  2FJ7 A;  3AZK B;  4CSR A;  3B6F A;  4QLC A;  3AN2 B;  4LD9 C;  1ZLA B;  1KX4 C;  3X1U B;  3KXB B;  3WA9 B;  5B24 A;  4WV4 B;  1M1A B;  1BH8 A;  5AVB C;  5BNV B; 
#chains in the Genus database with same CATH homology
 1P3L A;  3MNN D;  1EQZ C;  2DQN C;  3W96 A;  5B2I D;  3AV2 B;  1P3B D;  3AZL C;  3AFA A;  1P3P A;  1S32 D;  4X23 C;  5AV8 A;  4YS3 C;  1AOI C;  2G5H C;  1JFI B;  5C3I C;  4E44 A;  2Y2P A;  3REI B;  1P3K C;  2ZY3 A;  4WU8 C;  5AVC C;  2YFV A;  1U35 A;  5B2J B;  3LEL C;  4H9R B;  3REH B;  5B33 C;  3W98 C;  5B0Z A;  1P3A C;  3UTA B;  2NZD A;  1P34 A;  2W8S A;  3O62 B;  2HIO D;  4J8X A;  2ARO A;  1M19 D;  4WU9 C;  5E5A D;  3AZF C;  5CPI A;  5DNM D;  4J8V D;  3B0C W;  3LZ1 A;  5B1L C;  5CP6 D;  3R45 B;  4EO5 C;  5AV5 B;  2F2A C;  5B40 C;  5GXQ B;  4J8W A;  4LD9 D;  3H0R C;  1H3O B;  3REL C;  1KX4 D;  3WTP E;  1ID3 A;  3VH6 W;  5AV9 A;  5GT0 A;  5AVB D;  4G91 B;  1EQZ D;  3VH5 T;  5GT3 A;  2PYO C;  3AZL D;  4X23 D;  2BYM B;  2FJ7 C;  5F99 A;  4XZQ C;  1AOI D;  5B2I B;  3A1I A;  3V9R B;  5BS7 A;  4G92 C;  4Z66 B;  4QLC C;  3WKJ A;  5DNN B;  1P3K D;  3X1V B;  4WNN A;  4WU8 D;  4NFT A;  5B24 C;  2VQR A;  5AVC D;  2NQB A;  3LEL D;  1TAF B;  3LZ0 C;  1P3L C;  4YM6 B;  3MGS B;  1P3M A;  3AFA C;  1P3P C;  1P3A D;  5JRG A;  4AWL B;  3MVD A;  3WTP C;  5B32 G;  5AV8 C;  3W99 A;  4UPK A;  3B0B A;  4Z2M G;  4WU9 D;  3AZE C;  3AZF D;  2Y2H A;  5B1L D;  4ZUX B;  3UTB A;  5CPJ B;  4R8P A;  2HIO B;  5B40 D;  1U35 C;  2Y2L A;  5E5A B;  5DNM B;  5B0Z C;  1B67 A;  5CP6 B;  3W97 A;  1P3O C;  3REL D;  2NZD C;  3AV1 B;  3UT9 C;  4J8X C;  4LD9 B;  3REK C;  5CPI C;  4Z2M H;  3KUY A;  4Z5T A;  1KX5 A;  2PYO D;  1P3G A;  4H9S A;  2FJ7 D;  1EQZ B;  4XZQ D;  3AZI C;  4J8W C;  1HQ3 B;  3NQU A;  4QLC D;  3AZL B;  3AZM A;  4ZBJ B;  4X23 B;  2G5I C;  3C1B A;  1ID3 C;  3MGQ A;  4YS3 B;  5B24 D;  5C3I B;  5AV6 A;  5AV9 C;  4DRB A;  3LZ0 D;  3AZJ C;  1P3L D;  5CPK C;  3VH5 A;  4UUZ A;  3REJ A;  5B32 A;  2F8N D;  5GT3 C;  3C1C A;  3AFA D;  2LY8 A;  1P3P D;  5KDM B;  4H9O A;  3LJA A;  3MGP A;  3WTP D;  3AZN B;  5B33 B;  5B1M C;  5AV8 D;  5BNX A;  5F99 C;  3W98 B;  3AZE D;  3EPJ A;  2CV5 A;  1P3A B;  3WKJ C;  4H9P A;  2Y2I A;  4J8U A;  4J8V C;  3AZG A;  2NQB C;  1U35 D;  4WU9 B;  1P3F A;  5B0Y C;  3X1S C;  2RIQ A;  5AY8 C;  5B0Z D;  1WWS A;  3KSY A;  1BH9 A;  4H9Q B;  1PZR A;  3AN2 A;  1P3M C;  1P3O D;  2YFW B;  1ZLA A;  5GSU B;  3MVD C;  2NZD D;  3X1U A;  3KXB A;  3WA9 A;  4KGC B;  3W99 C;  3UT9 D;  4J8X D;  3REK D;  5CPI D;  5BNV A;  3REL B;  4WZS B;  3LZ1 D;  3AZH A;  3AYW C;  3UTB C;  3AV2 A;  4R8P C;  3AZI D;  4J8W D;  4DQY B;  2PYO B;  4NE5 A;  3W97 C;  2FJ7 B;  1ID3 D;  4CSR B;  4XZQ B;  4HGA C;  4QLC B;  5B2J A;  5AV9 D;  4H9R A;  3AZJ D;  3MGR A;  5CPK D;  1F1E A;  4Z5T C;  5GT3 D;  1KX5 C;  1P3G C;  5G49 B;  4H9S C;  5FUG B;  3LZ0 B;  3UTA A;  1TZY B;  5B1M D;  5F99 D;  5B31 B;  2DF4 C;  4XUJ A;  2F8N B;  2IO5 C;  3O62 A;  3AZM C;  1P3P B;  3WKJ D;  1A7W A;  3WTP B;  3KWQ B;  3X1T B;  3B0D C;  3R45 A;  2HUE B;  5AV5 A;  3AZE B;  2NQB D;  5B0Y D;  5GXQ A;  3X1S D;  5AY8 D;  5B32 C;  1P3M D;  3C1C C;  1H3O A;  3LJA C;  3MVD D;  3WAA A;  5B0Z B;  3W99 D;  3B6G C;  3A6N A;  1P3O B;  1N1J B;  3AZG C;  3AYW D;  3UTB D;  4KUD C;  5JA4 B;  1ULY A;  3UT9 B;  4R8P D;  3REK B;  5BT1 C;  2BYM A;  1P3F C;  2FFF B;  3MNN B;  3B6F C;  3V9R A;  4JJN A;  4Z66 A;  1P3B B;  3W97 D;  4E45 A;  1S32 B;  5DNN A;  3AZI B;  3X1U C;  3KXB C;  3X1V A;  2Y2J A;  1TAF A;  1P3I A;  4YM6 A;  4Z5T D;  3AL0 C;  3W96 C;  3MGS A;  3AZH C;  3AV2 C;  1P3G D;  1KX5 D;  3EPL A;  3FDD A;  3AZJ B;  5CPK B;  3AZM D;  3C1B D;  4H9N B;  5B1M B;  4ZUX A;  2J8P A;  5CPJ A;  2HIO A;  5B2J C;  1M19 B;  5E5A A;  2Y2Q A;  3MGR C;  5B32 D;  4J8V B;  3C1C D;  5CP6 A;  2NQB B;  1R4V A;  3LJA D;  5B0Y B;  3UTA C;  3X1S B;  5AY8 B;  1P34 C;  4XUJ C;  3AV1 A;  4CAY A;  3B6G D;  4LD9 A;  2ARO C;  3MVD B;  1KX4 B;  2BG1 A;  1W2E A;  3AZG D;  4KUD D;  3LZ1 C;  1M18 A;  3W99 B;  5AV5 C;  3B0C T;  5BT1 D;  1P3F D;  5AVB B;  4NE3 A;  5GXQ C;  1KX3 A;  3NQJ B;  3B6F D;  3AYW B;  1HQ3 A;  3UTB B;  3AZL A;  4X23 A;  3X1U D;  3KXB D;  4YS3 A;  3WAA C;  2Y2M A;  1AOI B;  1B6W A;  3A6N C;  5GT0 C;  3TU4 A;  1WWI A;  2BYK B;  3EPK A;  1P3K B;  3VH6 T;  3AZH D;  3W96 D;  4WU8 B;  3AV2 D;  5AVC B;  5KDM A;  5BO0 B;  3LEL B;  3AZN A;  5B33 A;  2ZY2 A;  3W98 A;  4Z5T B;  2ZM5 A;  5BS7 C;  4JJN C;  4Z66 C;  2XD5 A;  5DNN C;  5B31 G;  1F66 A;  3X1V C;  2ZY4 A;  2F8N G;  2IO5 B;  5B2J D;  4WU9 A;  3AZF B;  3MGR D;  3AZK A;  1P3I C;  4YM6 C;  5B1L B;  3MGS C;  4EO5 B;  5B40 B;  2YFW A;  5JRG C;  5GSU A;  3UTA D;  4KHA B;  4KGC A;  1P34 D;  4XUJ D;  1M1A A;  2ARO D;  2Y2K A;  5BNX B;  4ZUX C;  3B6G B;  5CPJ C;  5AV5 D;  3VH5 W;  5GXQ D;  4KUD B;  1JFI A;  3REI A;  5CHL B;  4XZQ A;  3WAA D;  2Y2N A;  3H0L C;  3B6F B;  3AV1 C;  1BH9 B;  4G92 B;  3A6N D;  5GT0 D;  3H0M C;  3KUY C;  3REH A;  1M18 C;  4DRA A;  5B24 B;  5G49 A;  4WJ3 C;  1BH8 B;  2ZY5 A;  5FUG A;  3P5J B;  3LZ0 A;  1TZY A;  5B31 A;  1P3L B;  1KX3 C;  3AZH B;  2F8N A;  4JJN D;  1HQ3 C;  4Z66 D;  3W96 B;  4ZBJ C;  3AFA B;  5DNN D;  3C1B C;  3WTP A;  3MGQ C;  3KWQ A;  5AV8 B;  3X1T A;  3X1V D;  3AZE A;  5AV6 C;  3TU4 C;  1P3I D;  4YM6 D;  3VH6 A;  3REJ C;  3MGS D;  3EPH A;  2YFV B;  1U35 B;  5JRG D;  1Z2C B;  3MGP C;  3MGR B;  3AZN C;  2Y2O A;  2CV5 C;  1P3O A;  1T3U A;  4M6B A;  2NZD B;  1N1J A;  1F66 C;  4J8U C;  4ZUX D;  1P34 B;  4XUJ B;  5CPJ D;  5JA4 A;  3UT9 A;  4J8X B;  2ARO B;  3REK A;  5CPI B;  3MNN A;  3AZK C;  3LZ1 B;  5B2I A;  1P3B A;  1Q9C A;  2UWX A;  3AN2 C;  1S32 A;  1ZLA C;  5GSU C;  3AZI A;  4KGC C;  3WA9 C;  3AV1 D;  4J8W B;  1M1A C;  3KUY D;  1ID3 B;  1M18 D;  3WAA B;  1BFM A;  3A6N B;  5AV9 B;  5GT0 B;  2RVQ C;  3AZJ A;  5CPK A;  1KX3 D;  3A1K A;  1HQ3 D;  5GT3 B;  3REI C;  3KFU G;  4H9N A;  3MGQ D;  4YS3 D;  5B1M A;  5F99 B;  4JJN B;  5AV6 D;  1M19 A;  3WKJ B;  3TU4 D;  5DNM A;  3REH C;  4J8V A;  4WNN B;  3REJ D;  2JSS A;  2L5A A;  5B0Y A;  3MGP D;  2Y2G A;  3EG5 B;  1TZY C;  3X1S A;  5B31 C;  5AY8 A;  5B33 D;  3AZN D;  1P3I B;  3W98 D;  3O62 C;  1P3M B;  2CV5 D;  5JRG B;  1KX4 A;  1F66 D;  4J8U D;  3KWQ C;  2JE5 A;  3X1T C;  3F6T A;  2HUE C;  5AVB A;  1EQZ A;  3AZK D;  3NQJ A;  3AYW A;  3AN2 D;  4R8P B;  1ZLA D;  5GSU D;  4KGC D;  3WA9 D;  1AOI A;  2CWE A;  1M1A D;  3W97 B;  2XD1 A;  4G91 C;  2F8N K;  2BYK A;  1P3K A;  4WU8 A;  4HGA B;  4CAY B;  5AVC A;  3LEL A;  5BO0 A;  2RVQ D;  3KUY B;  3MNN C;  1M18 B;  5B2I C;  4NE6 A;  1KX5 B;  1P3G B;  1P3B C;  3REI D;  1S32 C;  1P3A A;  1KX3 B;  3NQU B;  3AZM B;  2JCH A;  3AZF A;  3C1B B;  3REH D;  3MGQ B;  5B1L A;  4H9Q A;  3B0D B;  5B40 A;  5AV6 B;  4AWL C;  3TU4 B;  4KHA A;  1TZY D;  5B31 D;  4UUZ B;  3REJ B;  5B32 B;  3O62 D;  3C1C B;  4H9O B;  3LJA B;  1HTA A;  3REL A;  3MGP B;  3X1T D;  3KWQ D;  3B6G A;  2F8N H;  2HIO C;  2CV5 B;  1M19 C;  5E5A C;  4H9P B;  5DNM C;  4J8U B;  1F66 B;  3AZG B;  3IP4 C;  4KUD A;  2PYO A;  5CP6 C;  1KU5 A;  1P3F B;  2FJ7 A;  3AZK B;  4CSR A;  3B6F A;  4QLC A;  3AN2 B;  4LD9 C;  1ZLA B;  1KX4 C;  3X1U B;  3KXB B;  3WA9 B;  5B24 A;  4WV4 B;  1M1A B;  1BH8 A;  5AVB C;  5BNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...