1AOIC

Complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
b'GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME AL
publication title Crystal structure of the nucleosome core particle at 2.8 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Dna binding protein/dna
total genus 31
structure length 115
sequence length 115
chains with identical sequence G
ec nomenclature
pdb deposition date 1997-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1aoiC00
2CV5C 3C1BB 3AZIC 3LZ1A 4Z5TC 1R4VA 1P3FB 2F8NB 3B6GA 5CP6B 1HQ3D 4Z66A 1P3AD 2BYMA 4EO5B 3AZEA 1P3IC 3AYWA 3RELD 2FJ7C 2HUEB 1P3OB 1M18B 5FUGB 4H9NB 3KUYC 2F8NK 4J8UC 5AV6D 4J8VA 4AWLC 5JRGA 4YM6B 5GT3B 2NZDD 5BT1D 4Z2MG 3MGPA 1M19B 1N1JB 5B31A 1EQZB 3KXBD 4WU9A 3REKA 3WA9C 4CAYB 3LZ1D 1HQ3C 3A6NB 1P3AC 5AV9D 5JA4A 3RELC 4Z66D 3AZED 5B32B 5AV6C 4G91C 3UTBB 2NZDC 5BT1C 3B0CW 1U35B 4KHAA 5B40A 4XUJB 3LJAA 1P3BB 1M1AA 4NE5A 3MGPD 5GT0B 4JJND 3KXBC 5B31D 4YS3B 3UTAA 3LELA 4J8XD 4WU9D 1P3GB 4WZSB 3LZ1C 3AZGB 4WNNB 5B2IA 3MVDA 2LY8A 4Z66C 3AZEC 2F8NH 3AZNB 3AYWC 4X23A 1P3PD 3W97B 4ZUXB 4KGCB 3O62B 3WKJA 3AZMB 5AVCA 2YFVA 3MGPC 5B40D 5CPKA 1M1AD 4JJNC 3VH5A 5B31C 1KX4A 4H9QA 1AOID 4WU8A 3VH6A 4J8XC 3UT9A 4WU9C 3LELD 3WAAB 1TAFB 3VH6T 1F66A 4E44A 5B2ID 5AVBB 3B6FB 3AFAB 2PYOD 3X1SA 3W96A 1KU5A 3WKJD 3C1CB 4LD9D 1P3LA 2CWEA 5AVCD 4HGAB 3WTPB 5B40C 1M1AC 5B1MB 1KX3A 1AOIC 1Q9CA 4YM6A 3AZFB 2HIOA 5AV5A 3LELC 3UT9D 1JFIA 1BH8B 2YFWB 4ZBJC 3LZ0B 1P3KA 4H9SA 5C3IB 5B2IC 4G92C 1F66D 5BS7A 3R45B 5DNNA 3AZKB 2PYOC 4X23C 4J8WA 3MNNB 1P3FD 2F8ND 5BNXA 3WKJC 1H3OB 5B0YA 4LD9C 3W96D 5B33A 5GSUA 5AVCC 5CPIA 5AY8A 3AN2B 5B24B 1KX4C 5CHLB 4YM6D 5AV5D 2BYKB 3UT9C 2CV5A 1M19D 5GT0A 1F66C 1P3IA 1P3KD 3AZHB 3VH5W 1KX5A 3AV1A 1P3FC 1WWSA 3KUYA 4J8UA 3W96C 5B0YD 3AZNA 3W97A 5B33D 5GSUD 3O62A 5B32D 4YM6C 3V9RB 5AV5C 1M19C 1ZLAB 3AZJA 5GT0D 4YS3D 1P3KC 4H9SC 3RELA 3B0CT 3X1TB 4J8WC 3AV1D 1KX5D 5B0YC 4R8PB 3W98B 3B6FA 5B33C 1BH9A 5KDMA 3AZND 5GSUC 3W97D 3NQJB 4ZUXD 3W99B 4H9RB 3O62D 3MGQB 3KXBA 5B31G 4UUZA 2RVQD 4H9OA 5B0ZB 3WTPA 5BO0B 4CSRB 3REHA 5GT0C 3AZJD 5AV9A 4YS3C 2NQBB 5AV8B 1KX5C 3AV1C 3WAAD 1F1EA 1ID3A 5F99A 3AZNC 3W97C 3B6FD 3X1UB 4ZUXC 3O62C 2IO5C 4JJNA 4J8XA 3WTPD 4QLCA 5B1MD 3AZJC 3REHD 3AZFD 1P3MB 5CPJB 4XZQB 1P3PA 4DRAA 4M6BA 3WAAC 3LZ0D 3X1VA 1ID3D 5B2JA 3B6FC 5F99D 3AZKD 3MNND 4Z2MH 1AOIA 3KWQB 3WTPC 3NQUB 3TU4B 3REHC 5B24D 4QLCD 3AZFC 5AV9C 3REIA 2PYOA 3REJA 5E5AB 4H9PA 3LZ0C 1S32B 4LD9A 3MGSA 1ID3C 5C3IC 5DNMB 3X1VD 4KUDA 5F99C 5B2JD 3AZKC 3MNNC 5B1LB 5G49B 3AZIB 5GXQA 3VH5T 5B24C 4QLCC 5B0ZA 2FJ7B 5BO0A 1P3PC 3C1BA 3REID 1P3FA 2F8NA 1ZLAD 3REJD 4AWLB 5CP6A 3X1VC 3MGSD 5B2JC 4KUDD 1P3OA 1M18A 5FUGA 4H9NA 3MGRB 3W98D 4R8PD 5GT3A 3WA9B 1M19A 1N1JA 1TZYB 1HQ3B 5GXQD 1P3AB 1EQZA 5B0ZD 3REIC 3AZLB 1ZLAC 4CAYA 3REJC 5AV6B 3C1BD 5BNVB 3A6NA 1P3MA 2NZDB 5CP6D 3MGSC 5AV8D 4KUDC 2AROB 5B32A 3KSYA 1P3OD 1M18D 4R8PC 3UTBA 5GT3D 1U35A 4XUJA 1P3BA 3LZ1B 3B6GB 5GXQC 1A7WA 4YS3A 2BYMB 3AZEB 1EQZD 3AYWB 5B0ZC 1P3GA 1ULYA 3C1BC 3AZGA 3AV2B 4J8VB 4WNNA 5CP6C 5JRGB 3A6ND 1P3MD 5AV8C 4EO5C 4KGCA 4ZUXA 2HUEC 5B31B 1P3OC 1M18C 4NE3A 5DNMA 3AZMA 4WU9B 3UTBD 4WV4B 5GT3C 3REKB 1U35D 4XUJD 1P3BD 1HTAA 1EQZC 5JA4B 3B0DB 3WAAA 1TAFA 1P3GD 3TU4D 3AZGD 3A6NC 1P3MC 5AVBA 3AFAA 4KHAB 5B40B 1M1AB 3LJAB 4KGCD 5B32C 3C1CA 5DNMD 3UTBC 3AZMD 3UTAB 3LELB 1U35C 4XUJC 3MGRA 5B1MA 2JSSA 1P3BC 5B1LD 5B2IB 4G92B 3MVDB 3AZFA 4X23B 4DRBA 1BH8A 1P3GC 2YFWA 3WKJB 3LZ0A 3AZGC 5AVCB 3R45A 2YFVB 5AVBD 3AZKA 4KGCC 3AFAD 3MNNA 5CPKB 1KX4B 1H3OA 4H9QB 5DNMC 4WU8B 3C1CD 3AZMC 2RVQC 3UT9B 3AN2A 3B0BA 5B24A 5B1LC 3MGRD 1F66B 2BYKA 3WA9D 3X1SB 1TZYD 3W96B 1P3LB 3AZHA 5AVBC 3AFAC 3AZLD 1P34B 1KX3B 3AV2A 2HIOB 3C1CC 5AV5B 2AROD 1JFIB 2L5AA 3AN2D 4HGAC 3MGRC 5B1MC 1P3KB 3V9RA 5DNNB 4J8WB 1ZLAA 1TZYC 5BNXB 3B6GD 5B0YB 2F8NG 5B33B 5GSUB 3AYWD 5CPIB 5AY8B 3AZHD 3AZLC 3X1TA 1B6WA 3AV2D 4J8VD 4R8PA 3W98A 5JRGD 2AROC 2CV5B 3NQJA 3W99A 4H9RA 4Z5TB 3AN2C 3MGQA 1P3IB 1KX5B 3AV1B 3REKD 3B6GC 4CSRA 3KUYB 4J8UB 2NQBA 5AV8A 3AZHC 2IO5B 5B32G 3X1TD 3AV2C 4J8VC 5JRGC 3X1UA 3LJAD 3AZJB 3W99D 3MGQD 3RELB 4E45A 3UTAD 3REKC 4G91B 3MVDD 3B0DC 1BH9B 4XZQA 5KDMB 5CPJA 2NQBD 4X23D 3X1TC 3KXBB 4UUZB 3W98C 4H9OB 1P34A 3LJAC 3X1UD 3REHB 3W99C 5CPKD 1KX4D 3MGQC 5AV9B 3KWQA 1BFMA 4WU8D 4Z66B 3UTAC 3WTPE 3NQUA 3TU4A 1ID3B 3MVDC 5F99B 2NQBC 5CPJD 4XZQD 5E5AA 3X1SD 3MGPB 4JJNB 1S32A 1P3LD 4J8XB 1WWIA 3X1UC 5CPKC 4QLCB 1P34D 1KX3D 5B1LA 4WU8C 2HIOD 5G49A 3KWQD 1P3PB 3AZIA 4Z5TA 1B67A 3X1VB 4NFTA 5B2JB 2FJ7A 5DNND 4XZQC 5CPJC 3VH6W 3X1SC 4J8WD 5E5AD 1AOIB 1S32D 1P3LC 5CPID 5AY8D 1P34C 1KX3C 4ZBJB 2HIOC 3KWQC 3REIB 3WA9A 2CV5D 2PYOB 3REJB 4NE6A 4H9PB 3AZID 1TZYA 4Z5TD 1HQ3A 1P3AA 4LD9B 3TU4C 3MGSB 4KUDB 1P3ID 5BS7C 5DNNC 2FJ7D 3AZLA 5E5AC 5AV6A 3KUYD 5BNVA 4J8UD 1S32C 2NZDA 5CPIC 5AY8C 2AROA 5GXQB
chains in the Genus database with same CATH superfamily
2CV5C 3C1BB 3AZIC 3LZ1A 4Z5TC 1R4VA 1P3FB 2F8NB 3B6GA 5CP6B 1HQ3D 4Z66A 1P3AD 2BYMA 4EO5B 3AZEA 1W2EA 3AYWA 3RELD 1P3IC 2FJ7C 2HUEB 1P3OB 1M18B 5FUGB 4H9NB 3KUYC 2F8NK 4J8UC 5AV6D 4J8VA 4AWLC 5JRGA 4YM6B 5GT3B 2NZDD 5BT1D 4Z2MG 3MGPA 1M19B 1N1JB 5B31A 3EPKA 1EQZB 3KXBD 4WU9A 3REKA 3WA9C 4CAYB 3LZ1D 1HQ3C 3A6NB 1P3AC 5AV9D 5JA4A 3RELC 4Z66D 3AZED 2Y2KA 5B32B 5AV6C 4G91C 3UTBB 3KFUG 2NZDC 2Y2LA 5BT1C 3B0CW 1U35B 3A1IA 4KHAA 5B40A 4XUJB 3LJAA 1P3BB 4NE5A 3MGPD 1M1AA 5GT0B 4JJND 3KXBC 5B31D 4YS3B 3UTAA 3LELA 4J8XD 4WU9D 1P3GB 4WZSB 3LZ1C 3AZGB 4WNNB 5B2IA 3MVDA 2LY8A 4Z66C 3AZEC 2F8NH 2ZY4A 3AZNB 3AYWC 4X23A 1P3PD 3W97B 4ZUXB 4KGCB 3O62B 3WKJA 3H0RC 2ZY3A 3AZMB 5AVCA 2YFVA 3MGPC 5B40D 5CPKA 1M1AD 2ZY5A 3VH5A 5B31C 4JJNC 4H9QA 1KX4A 1AOID 4WU8A 3VH6A 4J8XC 3UT9A 4WU9C 3LELD 3WAAB 1TAFB 3VH6T 1F66A 4E44A 5B2ID 5AVBB 3B6FB 3AFAB 2PYOD 3AL0C 3X1SA 3W96A 1KU5A 3WKJD 3C1CB 4LD9D 1P3LA 2CWEA 5AVCD 4HGAB 3WTPB 5B40C 1M1AC 5B1MB 1KX3A 3F6TA 1AOIC 1Q9CA 4YM6A 3AZFB 2HIOA 5AV5A 2G5HC 3LELC 3UT9D 4DQYB 1JFIA 1BH8B 2YFWB 4ZBJC 3LZ0B 1P3KA 4H9SA 5C3IB 5B2IC 4G92C 1F66D 5BS7A 3R45B 5DNNA 3AZKB 2PYOC 4X23C 4J8WA 3MNNB 1P3FD 2F8ND 5BNXA 3WKJC 1H3OB 5B0YA 4LD9C 3W96D 5B33A 5GSUA 5AVCC 5CPIA 5AY8A 3AN2B 5B24B 1KX4C 5CHLB 4YM6D 2W8SA 5AV5D 2BYKB 3UT9C 2CV5A 1M19D 5GT0A 1F66C 1P3IA 1P3KD 3AZHB 3VH5W 3H0MC 1KX5A 3AV1A 1P3FC 4WJ3C 1WWSA 3KUYA 4J8UA 3W96C 5B0YD 3AZNA 3W97A 5B33D 5GSUD 3O62A 5B32D 4YM6C 3V9RB 5AV5C 1M19C 1ZLAB 3AZJA 5GT0D 3FDDA 2Y2QA 2Y2MA 4YS3D 1P3KC 4H9SC 3RELA 3B0CT 3X1TB 4J8WC 3AV1D 1KX5D 5B0YC 4R8PB 3W98B 3B6FA 5B33C 1BH9A 5KDMA 3AZND 5GSUC 3W97D 3NQJB 4ZUXD 2ZY2A 4H9RB 3W99B 3O62D 3MGQB 3KXBA 5B31G 4UUZA 2RVQD 2J8PA 4H9OA 5B0ZB 3WTPA 5BO0B 4CSRB 3REHA 5GT0C 3AZJD 2JE5A 5AV9A 4YS3C 2NQBB 5AV8B 1KX5C 3AV1C 3WAAD 1F1EA 1ID3A 2FFFB 5F99A 3AZNC 3W97C 3B6FD 3X1UB 4ZUXC 3O62C 2IO5C 4JJNA 4J8XA 3WTPD 4QLCA 5B1MD 3AZJC 3REHD 3AZFD 1P3MB 5CPJB 4XZQB 1P3PA 4DRAA 4M6BA 3WAAC 3LZ0D 3X1VA 1ID3D 2Y2OA 5B2JA 3B6FC 5F99D 3AZKD 3MNND 4Z2MH 1AOIA 3KWQB 3WTPC 3NQUB 3TU4B 3REHC 5B24D 4QLCD 3AZFC 5AV9C 3EPLA 3REIA 2PYOA 3REJA 5E5AB 4H9PA 3LZ0C 1S32B 4LD9A 3MGSA 1ID3C 5C3IC 5DNMB 3X1VD 4KUDA 5F99C 5B2JD 3AZKC 3MNNC 5B1LB 5G49B 3AZIB 5GXQA 3VH5T 2G5IC 5B24C 4QLCC 2DF4C 5B0ZA 2FJ7B 5BO0A 1P3PC 3C1BA 3REID 1P3FA 2F8NA 1ZLAD 3REJD 4AWLB 5CP6A 3X1VC 3MGSD 5B2JC 4KUDD 1P3OA 1M18A 5FUGA 4H9NA 3MGRB 3EG5B 3W98D 4R8PD 5GT3A 3WA9B 2BG1A 1M19A 1N1JA 1TZYB 1HQ3B 5GXQD 1P3AB 1EQZA 5B0ZD 3REIC 3AZLB 1ZLAC 4CAYA 3REJC 5AV6B 3C1BD 5BNVB 3A6NA 1P3MA 2NZDB 5CP6D 3MGSC 5AV8D 4KUDC 2AROB 5B32A 3KSYA 1P3OD 1M18D 4R8PC 3UTBA 5GT3D 1U35A 4XUJA 1P3BA 3LZ1B 3B6GB 5GXQC 1A7WA 4YS3A 2BYMB 3AZEB 1EQZD 3AYWB 5B0ZC 1P3GA 1ULYA 3C1BC 3AZGA 3AV2B 4J8VB 4WNNA 5CP6C 2Y2PA 5JRGB 3A6ND 1P3MD 5AV8C 4EO5C 4KGCA 4ZUXA 2HUEC 5B31B 1P3OC 1M18C 4NE3A 5DNMA 3AZMA 3EPJA 4WU9B 3UTBD 4WV4B 5GT3C 3REKB 1U35D 4XUJD 1P3BD 1HTAA 1EQZC 5JA4B 3B0DB 3WAAA 1TAFA 1P3GD 3TU4D 3AZGD 3A6NC 1P3MC 5AVBA 3AFAA 4KHAB 5B40B 1M1AB 3LJAB 4KGCD 5B32C 2XD1A 3C1CA 5DNMD 3UTBC 3AZMD 2VQRA 3LELB 3UTAB 1U35C 2Y2HA 4XUJC 5B1MA 2JSSA 3MGRA 1P3BC 3P5JB 5B1LD 5B2IB 4G92B 3MVDB 3AZFA 4X23B 4DRBA 1BH8A 1P3GC 2YFWA 3WKJB 3LZ0A 2Y2NA 3AZGC 4UPKA 5AVCB 3R45A 2YFVB 5AVBD 3AZKA 4KGCC 3AFAD 3MNNA 5CPKB 1KX4B 1H3OA 4H9QB 5DNMC 4WU8B 3C1CD 3AZMC 2RVQC 3UT9B 3AN2A 3H0LC 3B0BA 5B24A 5B1LC 3MGRD 1F66B 1T3UA 2BYKA 3WA9D 3X1SB 1TZYD 3W96B 2RIQA 1P3LB 3AZHA 5AVBC 3AFAC 3AZLD 2XD5A 1P34B 1KX3B 3AV2A 2HIOB 3C1CC 5AV5B 2AROD 1JFIB 2L5AA 3AN2D 4HGAC 3MGRC 5B1MC 3A1KA 1P3KB 3V9RA 5DNNB 4J8WB 1ZLAA 1TZYC 5BNXB 3B6GD 5B0YB 2F8NG 5B33B 5GSUB 3AYWD 5CPIB 5AY8B 3AZHD 3AZLC 3X1TA 1B6WA 3AV2D 4J8VD 4R8PA 3W98A 5JRGD 2UWXA 2AROC 2CV5B 3NQJA 3W99A 4H9RA 4Z5TB 3AN2C 3MGQA 2Y2IA 1P3IB 1KX5B 3AV1B 3REKD 3B6GC 4CSRA 3KUYB 2F2AC 4J8UB 2Y2JA 2NQBA 5AV8A 3AZHC 2IO5B 1Z2CB 5B32G 3X1TD 3AV2C 4J8VC 5JRGC 3X1UA 1PZRA 3LJAD 3AZJB 3W99D 3MGQD 3RELB 4E45A 3UTAD 3REKC 4G91B 3MVDD 3B0DC 1BH9B 4XZQA 5KDMB 5CPJA 2NQBD 4X23D 3X1TC 3KXBB 4UUZB 3W98C 4H9OB 1P34A 3LJAC 3X1UD 3REHB 3W99C 5CPKD 1KX4D 3MGQC 5AV9B 3KWQA 1BFMA 4WU8D 4Z66B 3UTAC 3EPHA 3WTPE 3NQUA 3TU4A 1ID3B 3MVDC 5F99B 2NQBC 2JCHA 5CPJD 4XZQD 5E5AA 3X1SD 3MGPB 4JJNB 1S32A 1P3LD 4J8XB 1WWIA 3X1UC 5CPKC 4QLCB 1P34D 1KX3D 5B1LA 4WU8C 2HIOD 5G49A 3KWQD 1P3PB 3AZIA 4Z5TA 1B67A 3X1VB 4NFTA 5B2JB 2FJ7A 5DNND 4XZQC 5CPJC 3VH6W 3X1SC 4J8WD 2Y2GA 5E5AD 2DQNC 1AOIB 1S32D 1P3LC 5CPID 5AY8D 1P34C 1KX3C 4ZBJB 2HIOC 3KWQC 3REIB 3WA9A 2CV5D 2PYOB 3REJB 4NE6A 4H9PB 3AZID 1TZYA 4Z5TD 1HQ3A 2ZM5A 1P3AA 4LD9B 3TU4C 3MGSB 4KUDB 1P3ID 5BS7C 5DNNC 2FJ7D 3AZLA 5E5AC 5AV6A 3KUYD 5BNVA 4J8UD 1S32C 2NZDA 5CPIC 5AY8C 2AROA 5GXQB 3IP4C
chains in the Genus database with same CATH topology
2CV5C 3C1BB 3AZIC 3LZ1A 4Z5TC 1R4VA 1P3FB 2F8NB 3B6GA 5CP6B 1HQ3D 4Z66A 1P3AD 2BYMA 4EO5B 3AZEA 1W2EA 3AYWA 3RELD 1P3IC 2FJ7C 2HUEB 1P3OB 1M18B 5FUGB 4H9NB 3KUYC 2F8NK 4J8UC 5AV6D 4J8VA 4AWLC 5JRGA 4YM6B 5GT3B 2NZDD 5BT1D 4Z2MG 3MGPA 1M19B 1N1JB 5B31A 3EPKA 1EQZB 3KXBD 4WU9A 3REKA 3WA9C 4CAYB 3LZ1D 1HQ3C 3A6NB 1P3AC 5AV9D 5JA4A 3RELC 4Z66D 3AZED 2Y2KA 5B32B 5AV6C 4G91C 3UTBB 3KFUG 2NZDC 2Y2LA 5BT1C 3B0CW 1U35B 3A1IA 4KHAA 5B40A 4XUJB 3LJAA 1P3BB 4NE5A 3MGPD 1M1AA 5GT0B 4JJND 3KXBC 5B31D 4YS3B 3UTAA 3LELA 4J8XD 4WU9D 1P3GB 4WZSB 3LZ1C 3AZGB 4WNNB 5B2IA 3MVDA 2LY8A 4Z66C 3AZEC 2F8NH 2ZY4A 3AZNB 3AYWC 4X23A 1P3PD 3W97B 4ZUXB 4KGCB 3O62B 3WKJA 3H0RC 2ZY3A 3AZMB 5AVCA 2YFVA 3MGPC 5B40D 5CPKA 1M1AD 2ZY5A 3VH5A 5B31C 4JJNC 4H9QA 1KX4A 1AOID 4WU8A 3VH6A 4J8XC 3UT9A 4WU9C 3LELD 3WAAB 1TAFB 3VH6T 1F66A 4E44A 5B2ID 5AVBB 3B6FB 3AFAB 2PYOD 3AL0C 3X1SA 3W96A 1KU5A 3WKJD 3C1CB 4LD9D 1P3LA 2CWEA 5AVCD 4HGAB 3WTPB 5B40C 1M1AC 5B1MB 1KX3A 3F6TA 1AOIC 1Q9CA 4YM6A 3AZFB 2HIOA 5AV5A 2G5HC 3LELC 3UT9D 4DQYB 1JFIA 1BH8B 2YFWB 4ZBJC 3LZ0B 1P3KA 4H9SA 5C3IB 5B2IC 4G92C 1F66D 5BS7A 3R45B 5DNNA 3AZKB 2PYOC 4X23C 4J8WA 3MNNB 1P3FD 2F8ND 5BNXA 3WKJC 1H3OB 5B0YA 4LD9C 3W96D 5B33A 5GSUA 5AVCC 5CPIA 5AY8A 3AN2B 5B24B 1KX4C 5CHLB 4YM6D 2W8SA 5AV5D 2BYKB 3UT9C 2CV5A 1M19D 5GT0A 1F66C 1P3IA 1P3KD 3AZHB 3VH5W 3H0MC 1KX5A 3AV1A 1P3FC 4WJ3C 1WWSA 3KUYA 4J8UA 3W96C 5B0YD 3AZNA 3W97A 5B33D 5GSUD 3O62A 5B32D 4YM6C 3V9RB 5AV5C 1M19C 1ZLAB 3AZJA 5GT0D 3FDDA 2Y2QA 2Y2MA 4YS3D 1P3KC 4H9SC 3RELA 3B0CT 3X1TB 4J8WC 3AV1D 1KX5D 5B0YC 4R8PB 3W98B 3B6FA 5B33C 1BH9A 5KDMA 3AZND 5GSUC 3W97D 3NQJB 4ZUXD 2ZY2A 4H9RB 3W99B 3O62D 3MGQB 3KXBA 5B31G 4UUZA 2RVQD 2J8PA 4H9OA 5B0ZB 3WTPA 5BO0B 4CSRB 3REHA 5GT0C 3AZJD 2JE5A 5AV9A 4YS3C 2NQBB 5AV8B 1KX5C 3AV1C 3WAAD 1F1EA 1ID3A 2FFFB 5F99A 3AZNC 3W97C 3B6FD 3X1UB 4ZUXC 3O62C 2IO5C 4JJNA 4J8XA 3WTPD 4QLCA 5B1MD 3AZJC 3REHD 3AZFD 1P3MB 5CPJB 4XZQB 1P3PA 4DRAA 4M6BA 3WAAC 3LZ0D 3X1VA 1ID3D 2Y2OA 5B2JA 3B6FC 5F99D 3AZKD 3MNND 4Z2MH 1AOIA 3KWQB 3WTPC 3NQUB 3TU4B 3REHC 5B24D 4QLCD 3AZFC 5AV9C 3EPLA 3REIA 2PYOA 3REJA 5E5AB 4H9PA 3LZ0C 1S32B 4LD9A 3MGSA 1ID3C 5C3IC 5DNMB 3X1VD 4KUDA 5F99C 5B2JD 3AZKC 3MNNC 5B1LB 5G49B 3AZIB 5GXQA 3VH5T 2G5IC 5B24C 4QLCC 2DF4C 5B0ZA 2FJ7B 5BO0A 1P3PC 3C1BA 3REID 1P3FA 2F8NA 1ZLAD 3REJD 4AWLB 5CP6A 3X1VC 3MGSD 5B2JC 4KUDD 1P3OA 1M18A 5FUGA 4H9NA 3MGRB 3EG5B 3W98D 4R8PD 5GT3A 3WA9B 2BG1A 1M19A 1N1JA 1TZYB 1HQ3B 5GXQD 1P3AB 1EQZA 5B0ZD 3REIC 3AZLB 1ZLAC 4CAYA 3REJC 5AV6B 3C1BD 5BNVB 3A6NA 1P3MA 2NZDB 5CP6D 3MGSC 5AV8D 4KUDC 2AROB 5B32A 3KSYA 1P3OD 1M18D 4R8PC 3UTBA 5GT3D 1U35A 4XUJA 1P3BA 3LZ1B 3B6GB 5GXQC 1A7WA 4YS3A 2BYMB 3AZEB 1EQZD 3AYWB 5B0ZC 1P3GA 1ULYA 3C1BC 3AZGA 3AV2B 4J8VB 4WNNA 5CP6C 2Y2PA 5JRGB 3A6ND 1P3MD 5AV8C 4EO5C 4KGCA 4ZUXA 2HUEC 5B31B 1P3OC 1M18C 4NE3A 5DNMA 3AZMA 3EPJA 4WU9B 3UTBD 4WV4B 5GT3C 3REKB 1U35D 4XUJD 1P3BD 1HTAA 1EQZC 5JA4B 3B0DB 3WAAA 1TAFA 1P3GD 3TU4D 3AZGD 3A6NC 1P3MC 5AVBA 3AFAA 4KHAB 5B40B 1M1AB 3LJAB 4KGCD 5B32C 2XD1A 3C1CA 5DNMD 3UTBC 3AZMD 2VQRA 3LELB 3UTAB 1U35C 2Y2HA 4XUJC 5B1MA 2JSSA 3MGRA 1P3BC 3P5JB 5B1LD 5B2IB 4G92B 3MVDB 3AZFA 4X23B 4DRBA 1BH8A 1P3GC 2YFWA 3WKJB 3LZ0A 2Y2NA 3AZGC 4UPKA 5AVCB 3R45A 2YFVB 5AVBD 3AZKA 4KGCC 3AFAD 3MNNA 5CPKB 1KX4B 1H3OA 4H9QB 5DNMC 4WU8B 3C1CD 3AZMC 2RVQC 3UT9B 3AN2A 3H0LC 3B0BA 5B24A 5B1LC 3MGRD 1F66B 1T3UA 2BYKA 3WA9D 3X1SB 1TZYD 3W96B 2RIQA 1P3LB 3AZHA 5AVBC 3AFAC 3AZLD 2XD5A 1P34B 1KX3B 3AV2A 2HIOB 3C1CC 5AV5B 2AROD 1JFIB 2L5AA 3AN2D 4HGAC 3MGRC 5B1MC 3A1KA 1P3KB 3V9RA 5DNNB 4J8WB 1ZLAA 1TZYC 5BNXB 3B6GD 5B0YB 2F8NG 5B33B 5GSUB 3AYWD 5CPIB 5AY8B 3AZHD 3AZLC 3X1TA 1B6WA 3AV2D 4J8VD 4R8PA 3W98A 5JRGD 2UWXA 2AROC 2CV5B 3NQJA 3W99A 4H9RA 4Z5TB 3AN2C 3MGQA 2Y2IA 1P3IB 1KX5B 3AV1B 3REKD 3B6GC 4CSRA 3KUYB 2F2AC 4J8UB 2Y2JA 2NQBA 5AV8A 3AZHC 2IO5B 1Z2CB 5B32G 3X1TD 3AV2C 4J8VC 5JRGC 3X1UA 1PZRA 3LJAD 3AZJB 3W99D 3MGQD 3RELB 4E45A 3UTAD 3REKC 4G91B 3MVDD 3B0DC 1BH9B 4XZQA 5KDMB 5CPJA 2NQBD 4X23D 3X1TC 3KXBB 4UUZB 3W98C 4H9OB 1P34A 3LJAC 3X1UD 3REHB 3W99C 5CPKD 1KX4D 3MGQC 5AV9B 3KWQA 1BFMA 4WU8D 4Z66B 3UTAC 3EPHA 3WTPE 3NQUA 3TU4A 1ID3B 3MVDC 5F99B 2NQBC 2JCHA 5CPJD 4XZQD 5E5AA 3X1SD 3MGPB 4JJNB 1S32A 1P3LD 4J8XB 1WWIA 3X1UC 5CPKC 4QLCB 1P34D 1KX3D 5B1LA 4WU8C 2HIOD 5G49A 3KWQD 1P3PB 3AZIA 4Z5TA 1B67A 3X1VB 4NFTA 5B2JB 2FJ7A 5DNND 4XZQC 5CPJC 3VH6W 3X1SC 4J8WD 2Y2GA 5E5AD 2DQNC 1AOIB 1S32D 1P3LC 5CPID 5AY8D 1P34C 1KX3C 4ZBJB 2HIOC 3KWQC 3REIB 3WA9A 2CV5D 2PYOB 3REJB 4NE6A 4H9PB 3AZID 1TZYA 4Z5TD 1HQ3A 2ZM5A 1P3AA 4LD9B 3TU4C 3MGSB 4KUDB 1P3ID 5BS7C 5DNNC 2FJ7D 3AZLA 5E5AC 5AV6A 3KUYD 5BNVA 4J8UD 1S32C 2NZDA 5CPIC 5AY8C 2AROA 5GXQB 3IP4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 C;  3C1B B;  3AZI C;  3LZ1 A;  4Z5T C;  1R4V A;  1P3F B;  2F8N B;  3B6G A;  5CP6 B;  1HQ3 D;  4Z66 A;  1P3A D;  2BYM A;  4EO5 B;  3AZE A;  1P3I C;  3AYW A;  3REL D;  2FJ7 C;  2HUE B;  1P3O B;  1M18 B;  5FUG B;  4H9N B;  3KUY C;  2F8N K;  4J8U C;  5AV6 D;  4J8V A;  4AWL C;  5JRG A;  4YM6 B;  5GT3 B;  2NZD D;  5BT1 D;  4Z2M G;  3MGP A;  1M19 B;  1N1J B;  5B31 A;  1EQZ B;  3KXB D;  4WU9 A;  3REK A;  3WA9 C;  4CAY B;  3LZ1 D;  1HQ3 C;  3A6N B;  1P3A C;  5AV9 D;  5JA4 A;  3REL C;  4Z66 D;  3AZE D;  5B32 B;  5AV6 C;  4G91 C;  3UTB B;  2NZD C;  5BT1 C;  3B0C W;  1U35 B;  4KHA A;  5B40 A;  4XUJ B;  3LJA A;  1P3B B;  1M1A A;  4NE5 A;  3MGP D;  5GT0 B;  4JJN D;  3KXB C;  5B31 D;  4YS3 B;  3UTA A;  3LEL A;  4J8X D;  4WU9 D;  1P3G B;  4WZS B;  3LZ1 C;  3AZG B;  4WNN B;  5B2I A;  3MVD A;  2LY8 A;  4Z66 C;  3AZE C;  2F8N H;  3AZN B;  3AYW C;  4X23 A;  1P3P D;  3W97 B;  4ZUX B;  4KGC B;  3O62 B;  3WKJ A;  3AZM B;  5AVC A;  2YFV A;  3MGP C;  5B40 D;  5CPK A;  1M1A D;  4JJN C;  3VH5 A;  5B31 C;  1KX4 A;  4H9Q A;  1AOI D;  4WU8 A;  3VH6 A;  4J8X C;  3UT9 A;  4WU9 C;  3LEL D;  3WAA B;  1TAF B;  3VH6 T;  1F66 A;  4E44 A;  5B2I D;  5AVB B;  3B6F B;  3AFA B;  2PYO D;  3X1S A;  3W96 A;  1KU5 A;  3WKJ D;  3C1C B;  4LD9 D;  1P3L A;  2CWE A;  5AVC D;  4HGA B;  3WTP B;  5B40 C;  1M1A C;  5B1M B;  1KX3 A;  1AOI C;  1Q9C A;  4YM6 A;  3AZF B;  2HIO A;  5AV5 A;  3LEL C;  3UT9 D;  1JFI A;  1BH8 B;  2YFW B;  4ZBJ C;  3LZ0 B;  1P3K A;  4H9S A;  5C3I B;  5B2I C;  4G92 C;  1F66 D;  5BS7 A;  3R45 B;  5DNN A;  3AZK B;  2PYO C;  4X23 C;  4J8W A;  3MNN B;  1P3F D;  2F8N D;  5BNX A;  3WKJ C;  1H3O B;  5B0Y A;  4LD9 C;  3W96 D;  5B33 A;  5GSU A;  5AVC C;  5CPI A;  5AY8 A;  3AN2 B;  5B24 B;  1KX4 C;  5CHL B;  4YM6 D;  5AV5 D;  2BYK B;  3UT9 C;  2CV5 A;  1M19 D;  5GT0 A;  1F66 C;  1P3I A;  1P3K D;  3AZH B;  3VH5 W;  1KX5 A;  3AV1 A;  1P3F C;  1WWS A;  3KUY A;  4J8U A;  3W96 C;  5B0Y D;  3AZN A;  3W97 A;  5B33 D;  5GSU D;  3O62 A;  5B32 D;  4YM6 C;  3V9R B;  5AV5 C;  1M19 C;  1ZLA B;  3AZJ A;  5GT0 D;  4YS3 D;  1P3K C;  4H9S C;  3REL A;  3B0C T;  3X1T B;  4J8W C;  3AV1 D;  1KX5 D;  5B0Y C;  4R8P B;  3W98 B;  3B6F A;  5B33 C;  1BH9 A;  5KDM A;  3AZN D;  5GSU C;  3W97 D;  3NQJ B;  4ZUX D;  3W99 B;  4H9R B;  3O62 D;  3MGQ B;  3KXB A;  5B31 G;  4UUZ A;  2RVQ D;  4H9O A;  5B0Z B;  3WTP A;  5BO0 B;  4CSR B;  3REH A;  5GT0 C;  3AZJ D;  5AV9 A;  4YS3 C;  2NQB B;  5AV8 B;  1KX5 C;  3AV1 C;  3WAA D;  1F1E A;  1ID3 A;  5F99 A;  3AZN C;  3W97 C;  3B6F D;  3X1U B;  4ZUX C;  3O62 C;  2IO5 C;  4JJN A;  4J8X A;  3WTP D;  4QLC A;  5B1M D;  3AZJ C;  3REH D;  3AZF D;  1P3M B;  5CPJ B;  4XZQ B;  1P3P A;  4DRA A;  4M6B A;  3WAA C;  3LZ0 D;  3X1V A;  1ID3 D;  5B2J A;  3B6F C;  5F99 D;  3AZK D;  3MNN D;  4Z2M H;  1AOI A;  3KWQ B;  3WTP C;  3NQU B;  3TU4 B;  3REH C;  5B24 D;  4QLC D;  3AZF C;  5AV9 C;  3REI A;  2PYO A;  3REJ A;  5E5A B;  4H9P A;  3LZ0 C;  1S32 B;  4LD9 A;  3MGS A;  1ID3 C;  5C3I C;  5DNM B;  3X1V D;  4KUD A;  5F99 C;  5B2J D;  3AZK C;  3MNN C;  5B1L B;  5G49 B;  3AZI B;  5GXQ A;  3VH5 T;  5B24 C;  4QLC C;  5B0Z A;  2FJ7 B;  5BO0 A;  1P3P C;  3C1B A;  3REI D;  1P3F A;  2F8N A;  1ZLA D;  3REJ D;  4AWL B;  5CP6 A;  3X1V C;  3MGS D;  5B2J C;  4KUD D;  1P3O A;  1M18 A;  5FUG A;  4H9N A;  3MGR B;  3W98 D;  4R8P D;  5GT3 A;  3WA9 B;  1M19 A;  1N1J A;  1TZY B;  1HQ3 B;  5GXQ D;  1P3A B;  1EQZ A;  5B0Z D;  3REI C;  3AZL B;  1ZLA C;  4CAY A;  3REJ C;  5AV6 B;  3C1B D;  5BNV B;  3A6N A;  1P3M A;  2NZD B;  5CP6 D;  3MGS C;  5AV8 D;  4KUD C;  2ARO B;  5B32 A;  3KSY A;  1P3O D;  1M18 D;  4R8P C;  3UTB A;  5GT3 D;  1U35 A;  4XUJ A;  1P3B A;  3LZ1 B;  3B6G B;  5GXQ C;  1A7W A;  4YS3 A;  2BYM B;  3AZE B;  1EQZ D;  3AYW B;  5B0Z C;  1P3G A;  1ULY A;  3C1B C;  3AZG A;  3AV2 B;  4J8V B;  4WNN A;  5CP6 C;  5JRG B;  3A6N D;  1P3M D;  5AV8 C;  4EO5 C;  4KGC A;  4ZUX A;  2HUE C;  5B31 B;  1P3O C;  1M18 C;  4NE3 A;  5DNM A;  3AZM A;  4WU9 B;  3UTB D;  4WV4 B;  5GT3 C;  3REK B;  1U35 D;  4XUJ D;  1P3B D;  1HTA A;  1EQZ C;  5JA4 B;  3B0D B;  3WAA A;  1TAF A;  1P3G D;  3TU4 D;  3AZG D;  3A6N C;  1P3M C;  5AVB A;  3AFA A;  4KHA B;  5B40 B;  1M1A B;  3LJA B;  4KGC D;  5B32 C;  3C1C A;  5DNM D;  3UTB C;  3AZM D;  3UTA B;  3LEL B;  1U35 C;  4XUJ C;  3MGR A;  5B1M A;  2JSS A;  1P3B C;  5B1L D;  5B2I B;  4G92 B;  3MVD B;  3AZF A;  4X23 B;  4DRB A;  1BH8 A;  1P3G C;  2YFW A;  3WKJ B;  3LZ0 A;  3AZG C;  5AVC B;  3R45 A;  2YFV B;  5AVB D;  3AZK A;  4KGC C;  3AFA D;  3MNN A;  5CPK B;  1KX4 B;  1H3O A;  4H9Q B;  5DNM C;  4WU8 B;  3C1C D;  3AZM C;  2RVQ C;  3UT9 B;  3AN2 A;  3B0B A;  5B24 A;  5B1L C;  3MGR D;  1F66 B;  2BYK A;  3WA9 D;  3X1S B;  1TZY D;  3W96 B;  1P3L B;  3AZH A;  5AVB C;  3AFA C;  3AZL D;  1P34 B;  1KX3 B;  3AV2 A;  2HIO B;  3C1C C;  5AV5 B;  2ARO D;  1JFI B;  2L5A A;  3AN2 D;  4HGA C;  3MGR C;  5B1M C;  1P3K B;  3V9R A;  5DNN B;  4J8W B;  1ZLA A;  1TZY C;  5BNX B;  3B6G D;  5B0Y B;  2F8N G;  5B33 B;  5GSU B;  3AYW D;  5CPI B;  5AY8 B;  3AZH D;  3AZL C;  3X1T A;  1B6W A;  3AV2 D;  4J8V D;  4R8P A;  3W98 A;  5JRG D;  2ARO C;  2CV5 B;  3NQJ A;  3W99 A;  4H9R A;  4Z5T B;  3AN2 C;  3MGQ A;  1P3I B;  1KX5 B;  3AV1 B;  3REK D;  3B6G C;  4CSR A;  3KUY B;  4J8U B;  2NQB A;  5AV8 A;  3AZH C;  2IO5 B;  5B32 G;  3X1T D;  3AV2 C;  4J8V C;  5JRG C;  3X1U A;  3LJA D;  3AZJ B;  3W99 D;  3MGQ D;  3REL B;  4E45 A;  3UTA D;  3REK C;  4G91 B;  3MVD D;  3B0D C;  1BH9 B;  4XZQ A;  5KDM B;  5CPJ A;  2NQB D;  4X23 D;  3X1T C;  3KXB B;  4UUZ B;  3W98 C;  4H9O B;  1P34 A;  3LJA C;  3X1U D;  3REH B;  3W99 C;  5CPK D;  1KX4 D;  3MGQ C;  5AV9 B;  3KWQ A;  1BFM A;  4WU8 D;  4Z66 B;  3UTA C;  3WTP E;  3NQU A;  3TU4 A;  1ID3 B;  3MVD C;  5F99 B;  2NQB C;  5CPJ D;  4XZQ D;  5E5A A;  3X1S D;  3MGP B;  4JJN B;  1S32 A;  1P3L D;  4J8X B;  1WWI A;  3X1U C;  5CPK C;  4QLC B;  1P34 D;  1KX3 D;  5B1L A;  4WU8 C;  2HIO D;  5G49 A;  3KWQ D;  1P3P B;  3AZI A;  4Z5T A;  1B67 A;  3X1V B;  4NFT A;  5B2J B;  2FJ7 A;  5DNN D;  4XZQ C;  5CPJ C;  3VH6 W;  3X1S C;  4J8W D;  5E5A D;  1AOI B;  1S32 D;  1P3L C;  5CPI D;  5AY8 D;  1P34 C;  1KX3 C;  4ZBJ B;  2HIO C;  3KWQ C;  3REI B;  3WA9 A;  2CV5 D;  2PYO B;  3REJ B;  4NE6 A;  4H9P B;  3AZI D;  1TZY A;  4Z5T D;  1HQ3 A;  1P3A A;  4LD9 B;  3TU4 C;  3MGS B;  4KUD B;  1P3I D;  5BS7 C;  5DNN C;  2FJ7 D;  3AZL A;  5E5A C;  5AV6 A;  3KUY D;  5BNV A;  4J8U D;  1S32 C;  2NZD A;  5CPI C;  5AY8 C;  2ARO A;  5GXQ B; 
#chains in the Genus database with same CATH topology
 2CV5 C;  3C1B B;  3AZI C;  3LZ1 A;  4Z5T C;  1R4V A;  1P3F B;  2F8N B;  3B6G A;  5CP6 B;  1HQ3 D;  4Z66 A;  1P3A D;  2BYM A;  4EO5 B;  3AZE A;  1W2E A;  3AYW A;  3REL D;  1P3I C;  2FJ7 C;  2HUE B;  1P3O B;  1M18 B;  5FUG B;  4H9N B;  3KUY C;  2F8N K;  4J8U C;  5AV6 D;  4J8V A;  4AWL C;  5JRG A;  4YM6 B;  5GT3 B;  2NZD D;  5BT1 D;  4Z2M G;  3MGP A;  1M19 B;  1N1J B;  5B31 A;  3EPK A;  1EQZ B;  3KXB D;  4WU9 A;  3REK A;  3WA9 C;  4CAY B;  3LZ1 D;  1HQ3 C;  3A6N B;  1P3A C;  5AV9 D;  5JA4 A;  3REL C;  4Z66 D;  3AZE D;  2Y2K A;  5B32 B;  5AV6 C;  4G91 C;  3UTB B;  3KFU G;  2NZD C;  2Y2L A;  5BT1 C;  3B0C W;  1U35 B;  3A1I A;  4KHA A;  5B40 A;  4XUJ B;  3LJA A;  1P3B B;  4NE5 A;  3MGP D;  1M1A A;  5GT0 B;  4JJN D;  3KXB C;  5B31 D;  4YS3 B;  3UTA A;  3LEL A;  4J8X D;  4WU9 D;  1P3G B;  4WZS B;  3LZ1 C;  3AZG B;  4WNN B;  5B2I A;  3MVD A;  2LY8 A;  4Z66 C;  3AZE C;  2F8N H;  2ZY4 A;  3AZN B;  3AYW C;  4X23 A;  1P3P D;  3W97 B;  4ZUX B;  4KGC B;  3O62 B;  3WKJ A;  3H0R C;  2ZY3 A;  3AZM B;  5AVC A;  2YFV A;  3MGP C;  5B40 D;  5CPK A;  1M1A D;  2ZY5 A;  3VH5 A;  5B31 C;  4JJN C;  4H9Q A;  1KX4 A;  1AOI D;  4WU8 A;  3VH6 A;  4J8X C;  3UT9 A;  4WU9 C;  3LEL D;  3WAA B;  1TAF B;  3VH6 T;  1F66 A;  4E44 A;  5B2I D;  5AVB B;  3B6F B;  3AFA B;  2PYO D;  3AL0 C;  3X1S A;  3W96 A;  1KU5 A;  3WKJ D;  3C1C B;  4LD9 D;  1P3L A;  2CWE A;  5AVC D;  4HGA B;  3WTP B;  5B40 C;  1M1A C;  5B1M B;  1KX3 A;  3F6T A;  1AOI C;  1Q9C A;  4YM6 A;  3AZF B;  2HIO A;  5AV5 A;  2G5H C;  3LEL C;  3UT9 D;  4DQY B;  1JFI A;  1BH8 B;  2YFW B;  4ZBJ C;  3LZ0 B;  1P3K A;  4H9S A;  5C3I B;  5B2I C;  4G92 C;  1F66 D;  5BS7 A;  3R45 B;  5DNN A;  3AZK B;  2PYO C;  4X23 C;  4J8W A;  3MNN B;  1P3F D;  2F8N D;  5BNX A;  3WKJ C;  1H3O B;  5B0Y A;  4LD9 C;  3W96 D;  5B33 A;  5GSU A;  5AVC C;  5CPI A;  5AY8 A;  3AN2 B;  5B24 B;  1KX4 C;  5CHL B;  4YM6 D;  2W8S A;  5AV5 D;  2BYK B;  3UT9 C;  2CV5 A;  1M19 D;  5GT0 A;  1F66 C;  1P3I A;  1P3K D;  3AZH B;  3VH5 W;  3H0M C;  1KX5 A;  3AV1 A;  1P3F C;  4WJ3 C;  1WWS A;  3KUY A;  4J8U A;  3W96 C;  5B0Y D;  3AZN A;  3W97 A;  5B33 D;  5GSU D;  3O62 A;  5B32 D;  4YM6 C;  3V9R B;  5AV5 C;  1M19 C;  1ZLA B;  3AZJ A;  5GT0 D;  3FDD A;  2Y2Q A;  2Y2M A;  4YS3 D;  1P3K C;  4H9S C;  3REL A;  3B0C T;  3X1T B;  4J8W C;  3AV1 D;  1KX5 D;  5B0Y C;  4R8P B;  3W98 B;  3B6F A;  5B33 C;  1BH9 A;  5KDM A;  3AZN D;  5GSU C;  3W97 D;  3NQJ B;  4ZUX D;  2ZY2 A;  4H9R B;  3W99 B;  3O62 D;  3MGQ B;  3KXB A;  5B31 G;  4UUZ A;  2RVQ D;  2J8P A;  4H9O A;  5B0Z B;  3WTP A;  5BO0 B;  4CSR B;  3REH A;  5GT0 C;  3AZJ D;  2JE5 A;  5AV9 A;  4YS3 C;  2NQB B;  5AV8 B;  1KX5 C;  3AV1 C;  3WAA D;  1F1E A;  1ID3 A;  2FFF B;  5F99 A;  3AZN C;  3W97 C;  3B6F D;  3X1U B;  4ZUX C;  3O62 C;  2IO5 C;  4JJN A;  4J8X A;  3WTP D;  4QLC A;  5B1M D;  3AZJ C;  3REH D;  3AZF D;  1P3M B;  5CPJ B;  4XZQ B;  1P3P A;  4DRA A;  4M6B A;  3WAA C;  3LZ0 D;  3X1V A;  1ID3 D;  2Y2O A;  5B2J A;  3B6F C;  5F99 D;  3AZK D;  3MNN D;  4Z2M H;  1AOI A;  3KWQ B;  3WTP C;  3NQU B;  3TU4 B;  3REH C;  5B24 D;  4QLC D;  3AZF C;  5AV9 C;  3EPL A;  3REI A;  2PYO A;  3REJ A;  5E5A B;  4H9P A;  3LZ0 C;  1S32 B;  4LD9 A;  3MGS A;  1ID3 C;  5C3I C;  5DNM B;  3X1V D;  4KUD A;  5F99 C;  5B2J D;  3AZK C;  3MNN C;  5B1L B;  5G49 B;  3AZI B;  5GXQ A;  3VH5 T;  2G5I C;  5B24 C;  4QLC C;  2DF4 C;  5B0Z A;  2FJ7 B;  5BO0 A;  1P3P C;  3C1B A;  3REI D;  1P3F A;  2F8N A;  1ZLA D;  3REJ D;  4AWL B;  5CP6 A;  3X1V C;  3MGS D;  5B2J C;  4KUD D;  1P3O A;  1M18 A;  5FUG A;  4H9N A;  3MGR B;  3EG5 B;  3W98 D;  4R8P D;  5GT3 A;  3WA9 B;  2BG1 A;  1M19 A;  1N1J A;  1TZY B;  1HQ3 B;  5GXQ D;  1P3A B;  1EQZ A;  5B0Z D;  3REI C;  3AZL B;  1ZLA C;  4CAY A;  3REJ C;  5AV6 B;  3C1B D;  5BNV B;  3A6N A;  1P3M A;  2NZD B;  5CP6 D;  3MGS C;  5AV8 D;  4KUD C;  2ARO B;  5B32 A;  3KSY A;  1P3O D;  1M18 D;  4R8P C;  3UTB A;  5GT3 D;  1U35 A;  4XUJ A;  1P3B A;  3LZ1 B;  3B6G B;  5GXQ C;  1A7W A;  4YS3 A;  2BYM B;  3AZE B;  1EQZ D;  3AYW B;  5B0Z C;  1P3G A;  1ULY A;  3C1B C;  3AZG A;  3AV2 B;  4J8V B;  4WNN A;  5CP6 C;  2Y2P A;  5JRG B;  3A6N D;  1P3M D;  5AV8 C;  4EO5 C;  4KGC A;  4ZUX A;  2HUE C;  5B31 B;  1P3O C;  1M18 C;  4NE3 A;  5DNM A;  3AZM A;  3EPJ A;  4WU9 B;  3UTB D;  4WV4 B;  5GT3 C;  3REK B;  1U35 D;  4XUJ D;  1P3B D;  1HTA A;  1EQZ C;  5JA4 B;  3B0D B;  3WAA A;  1TAF A;  1P3G D;  3TU4 D;  3AZG D;  3A6N C;  1P3M C;  5AVB A;  3AFA A;  4KHA B;  5B40 B;  1M1A B;  3LJA B;  4KGC D;  5B32 C;  2XD1 A;  3C1C A;  5DNM D;  3UTB C;  3AZM D;  2VQR A;  3LEL B;  3UTA B;  1U35 C;  2Y2H A;  4XUJ C;  5B1M A;  2JSS A;  3MGR A;  1P3B C;  3P5J B;  5B1L D;  5B2I B;  4G92 B;  3MVD B;  3AZF A;  4X23 B;  4DRB A;  1BH8 A;  1P3G C;  2YFW A;  3WKJ B;  3LZ0 A;  2Y2N A;  3AZG C;  4UPK A;  5AVC B;  3R45 A;  2YFV B;  5AVB D;  3AZK A;  4KGC C;  3AFA D;  3MNN A;  5CPK B;  1KX4 B;  1H3O A;  4H9Q B;  5DNM C;  4WU8 B;  3C1C D;  3AZM C;  2RVQ C;  3UT9 B;  3AN2 A;  3H0L C;  3B0B A;  5B24 A;  5B1L C;  3MGR D;  1F66 B;  1T3U A;  2BYK A;  3WA9 D;  3X1S B;  1TZY D;  3W96 B;  2RIQ A;  1P3L B;  3AZH A;  5AVB C;  3AFA C;  3AZL D;  2XD5 A;  1P34 B;  1KX3 B;  3AV2 A;  2HIO B;  3C1C C;  5AV5 B;  2ARO D;  1JFI B;  2L5A A;  3AN2 D;  4HGA C;  3MGR C;  5B1M C;  3A1K A;  1P3K B;  3V9R A;  5DNN B;  4J8W B;  1ZLA A;  1TZY C;  5BNX B;  3B6G D;  5B0Y B;  2F8N G;  5B33 B;  5GSU B;  3AYW D;  5CPI B;  5AY8 B;  3AZH D;  3AZL C;  3X1T A;  1B6W A;  3AV2 D;  4J8V D;  4R8P A;  3W98 A;  5JRG D;  2UWX A;  2ARO C;  2CV5 B;  3NQJ A;  3W99 A;  4H9R A;  4Z5T B;  3AN2 C;  3MGQ A;  2Y2I A;  1P3I B;  1KX5 B;  3AV1 B;  3REK D;  3B6G C;  4CSR A;  3KUY B;  2F2A C;  4J8U B;  2Y2J A;  2NQB A;  5AV8 A;  3AZH C;  2IO5 B;  1Z2C B;  5B32 G;  3X1T D;  3AV2 C;  4J8V C;  5JRG C;  3X1U A;  1PZR A;  3LJA D;  3AZJ B;  3W99 D;  3MGQ D;  3REL B;  4E45 A;  3UTA D;  3REK C;  4G91 B;  3MVD D;  3B0D C;  1BH9 B;  4XZQ A;  5KDM B;  5CPJ A;  2NQB D;  4X23 D;  3X1T C;  3KXB B;  4UUZ B;  3W98 C;  4H9O B;  1P34 A;  3LJA C;  3X1U D;  3REH B;  3W99 C;  5CPK D;  1KX4 D;  3MGQ C;  5AV9 B;  3KWQ A;  1BFM A;  4WU8 D;  4Z66 B;  3UTA C;  3EPH A;  3WTP E;  3NQU A;  3TU4 A;  1ID3 B;  3MVD C;  5F99 B;  2NQB C;  2JCH A;  5CPJ D;  4XZQ D;  5E5A A;  3X1S D;  3MGP B;  4JJN B;  1S32 A;  1P3L D;  4J8X B;  1WWI A;  3X1U C;  5CPK C;  4QLC B;  1P34 D;  1KX3 D;  5B1L A;  4WU8 C;  2HIO D;  5G49 A;  3KWQ D;  1P3P B;  3AZI A;  4Z5T A;  1B67 A;  3X1V B;  4NFT A;  5B2J B;  2FJ7 A;  5DNN D;  4XZQ C;  5CPJ C;  3VH6 W;  3X1S C;  4J8W D;  2Y2G A;  5E5A D;  2DQN C;  1AOI B;  1S32 D;  1P3L C;  5CPI D;  5AY8 D;  1P34 C;  1KX3 C;  4ZBJ B;  2HIO C;  3KWQ C;  3REI B;  3WA9 A;  2CV5 D;  2PYO B;  3REJ B;  4NE6 A;  4H9P B;  3AZI D;  1TZY A;  4Z5T D;  1HQ3 A;  2ZM5 A;  1P3A A;  4LD9 B;  3TU4 C;  3MGS B;  4KUD B;  1P3I D;  5BS7 C;  5DNN C;  2FJ7 D;  3AZL A;  5E5A C;  5AV6 A;  3KUY D;  5BNV A;  4J8U D;  1S32 C;  2NZD A;  5CPI C;  5AY8 C;  2ARO A;  5GXQ B;  3IP4 C; 
#chains in the Genus database with same CATH homology
 2CV5 C;  3C1B B;  3AZI C;  3LZ1 A;  4Z5T C;  1R4V A;  1P3F B;  2F8N B;  3B6G A;  5CP6 B;  1HQ3 D;  4Z66 A;  1P3A D;  2BYM A;  4EO5 B;  3AZE A;  1W2E A;  3AYW A;  3REL D;  1P3I C;  2FJ7 C;  2HUE B;  1P3O B;  1M18 B;  5FUG B;  4H9N B;  3KUY C;  2F8N K;  4J8U C;  5AV6 D;  4J8V A;  4AWL C;  5JRG A;  4YM6 B;  5GT3 B;  2NZD D;  5BT1 D;  4Z2M G;  3MGP A;  1M19 B;  1N1J B;  5B31 A;  3EPK A;  1EQZ B;  3KXB D;  4WU9 A;  3REK A;  3WA9 C;  4CAY B;  3LZ1 D;  1HQ3 C;  3A6N B;  1P3A C;  5AV9 D;  5JA4 A;  3REL C;  4Z66 D;  3AZE D;  2Y2K A;  5B32 B;  5AV6 C;  4G91 C;  3UTB B;  3KFU G;  2NZD C;  2Y2L A;  5BT1 C;  3B0C W;  1U35 B;  3A1I A;  4KHA A;  5B40 A;  4XUJ B;  3LJA A;  1P3B B;  4NE5 A;  3MGP D;  1M1A A;  5GT0 B;  4JJN D;  3KXB C;  5B31 D;  4YS3 B;  3UTA A;  3LEL A;  4J8X D;  4WU9 D;  1P3G B;  4WZS B;  3LZ1 C;  3AZG B;  4WNN B;  5B2I A;  3MVD A;  2LY8 A;  4Z66 C;  3AZE C;  2F8N H;  2ZY4 A;  3AZN B;  3AYW C;  4X23 A;  1P3P D;  3W97 B;  4ZUX B;  4KGC B;  3O62 B;  3WKJ A;  3H0R C;  2ZY3 A;  3AZM B;  5AVC A;  2YFV A;  3MGP C;  5B40 D;  5CPK A;  1M1A D;  2ZY5 A;  3VH5 A;  5B31 C;  4JJN C;  4H9Q A;  1KX4 A;  1AOI D;  4WU8 A;  3VH6 A;  4J8X C;  3UT9 A;  4WU9 C;  3LEL D;  3WAA B;  1TAF B;  3VH6 T;  1F66 A;  4E44 A;  5B2I D;  5AVB B;  3B6F B;  3AFA B;  2PYO D;  3AL0 C;  3X1S A;  3W96 A;  1KU5 A;  3WKJ D;  3C1C B;  4LD9 D;  1P3L A;  2CWE A;  5AVC D;  4HGA B;  3WTP B;  5B40 C;  1M1A C;  5B1M B;  1KX3 A;  3F6T A;  1AOI C;  1Q9C A;  4YM6 A;  3AZF B;  2HIO A;  5AV5 A;  2G5H C;  3LEL C;  3UT9 D;  4DQY B;  1JFI A;  1BH8 B;  2YFW B;  4ZBJ C;  3LZ0 B;  1P3K A;  4H9S A;  5C3I B;  5B2I C;  4G92 C;  1F66 D;  5BS7 A;  3R45 B;  5DNN A;  3AZK B;  2PYO C;  4X23 C;  4J8W A;  3MNN B;  1P3F D;  2F8N D;  5BNX A;  3WKJ C;  1H3O B;  5B0Y A;  4LD9 C;  3W96 D;  5B33 A;  5GSU A;  5AVC C;  5CPI A;  5AY8 A;  3AN2 B;  5B24 B;  1KX4 C;  5CHL B;  4YM6 D;  2W8S A;  5AV5 D;  2BYK B;  3UT9 C;  2CV5 A;  1M19 D;  5GT0 A;  1F66 C;  1P3I A;  1P3K D;  3AZH B;  3VH5 W;  3H0M C;  1KX5 A;  3AV1 A;  1P3F C;  4WJ3 C;  1WWS A;  3KUY A;  4J8U A;  3W96 C;  5B0Y D;  3AZN A;  3W97 A;  5B33 D;  5GSU D;  3O62 A;  5B32 D;  4YM6 C;  3V9R B;  5AV5 C;  1M19 C;  1ZLA B;  3AZJ A;  5GT0 D;  3FDD A;  2Y2Q A;  2Y2M A;  4YS3 D;  1P3K C;  4H9S C;  3REL A;  3B0C T;  3X1T B;  4J8W C;  3AV1 D;  1KX5 D;  5B0Y C;  4R8P B;  3W98 B;  3B6F A;  5B33 C;  1BH9 A;  5KDM A;  3AZN D;  5GSU C;  3W97 D;  3NQJ B;  4ZUX D;  2ZY2 A;  4H9R B;  3W99 B;  3O62 D;  3MGQ B;  3KXB A;  5B31 G;  4UUZ A;  2RVQ D;  2J8P A;  4H9O A;  5B0Z B;  3WTP A;  5BO0 B;  4CSR B;  3REH A;  5GT0 C;  3AZJ D;  2JE5 A;  5AV9 A;  4YS3 C;  2NQB B;  5AV8 B;  1KX5 C;  3AV1 C;  3WAA D;  1F1E A;  1ID3 A;  2FFF B;  5F99 A;  3AZN C;  3W97 C;  3B6F D;  3X1U B;  4ZUX C;  3O62 C;  2IO5 C;  4JJN A;  4J8X A;  3WTP D;  4QLC A;  5B1M D;  3AZJ C;  3REH D;  3AZF D;  1P3M B;  5CPJ B;  4XZQ B;  1P3P A;  4DRA A;  4M6B A;  3WAA C;  3LZ0 D;  3X1V A;  1ID3 D;  2Y2O A;  5B2J A;  3B6F C;  5F99 D;  3AZK D;  3MNN D;  4Z2M H;  1AOI A;  3KWQ B;  3WTP C;  3NQU B;  3TU4 B;  3REH C;  5B24 D;  4QLC D;  3AZF C;  5AV9 C;  3EPL A;  3REI A;  2PYO A;  3REJ A;  5E5A B;  4H9P A;  3LZ0 C;  1S32 B;  4LD9 A;  3MGS A;  1ID3 C;  5C3I C;  5DNM B;  3X1V D;  4KUD A;  5F99 C;  5B2J D;  3AZK C;  3MNN C;  5B1L B;  5G49 B;  3AZI B;  5GXQ A;  3VH5 T;  2G5I C;  5B24 C;  4QLC C;  2DF4 C;  5B0Z A;  2FJ7 B;  5BO0 A;  1P3P C;  3C1B A;  3REI D;  1P3F A;  2F8N A;  1ZLA D;  3REJ D;  4AWL B;  5CP6 A;  3X1V C;  3MGS D;  5B2J C;  4KUD D;  1P3O A;  1M18 A;  5FUG A;  4H9N A;  3MGR B;  3EG5 B;  3W98 D;  4R8P D;  5GT3 A;  3WA9 B;  2BG1 A;  1M19 A;  1N1J A;  1TZY B;  1HQ3 B;  5GXQ D;  1P3A B;  1EQZ A;  5B0Z D;  3REI C;  3AZL B;  1ZLA C;  4CAY A;  3REJ C;  5AV6 B;  3C1B D;  5BNV B;  3A6N A;  1P3M A;  2NZD B;  5CP6 D;  3MGS C;  5AV8 D;  4KUD C;  2ARO B;  5B32 A;  3KSY A;  1P3O D;  1M18 D;  4R8P C;  3UTB A;  5GT3 D;  1U35 A;  4XUJ A;  1P3B A;  3LZ1 B;  3B6G B;  5GXQ C;  1A7W A;  4YS3 A;  2BYM B;  3AZE B;  1EQZ D;  3AYW B;  5B0Z C;  1P3G A;  1ULY A;  3C1B C;  3AZG A;  3AV2 B;  4J8V B;  4WNN A;  5CP6 C;  2Y2P A;  5JRG B;  3A6N D;  1P3M D;  5AV8 C;  4EO5 C;  4KGC A;  4ZUX A;  2HUE C;  5B31 B;  1P3O C;  1M18 C;  4NE3 A;  5DNM A;  3AZM A;  3EPJ A;  4WU9 B;  3UTB D;  4WV4 B;  5GT3 C;  3REK B;  1U35 D;  4XUJ D;  1P3B D;  1HTA A;  1EQZ C;  5JA4 B;  3B0D B;  3WAA A;  1TAF A;  1P3G D;  3TU4 D;  3AZG D;  3A6N C;  1P3M C;  5AVB A;  3AFA A;  4KHA B;  5B40 B;  1M1A B;  3LJA B;  4KGC D;  5B32 C;  2XD1 A;  3C1C A;  5DNM D;  3UTB C;  3AZM D;  2VQR A;  3LEL B;  3UTA B;  1U35 C;  2Y2H A;  4XUJ C;  5B1M A;  2JSS A;  3MGR A;  1P3B C;  3P5J B;  5B1L D;  5B2I B;  4G92 B;  3MVD B;  3AZF A;  4X23 B;  4DRB A;  1BH8 A;  1P3G C;  2YFW A;  3WKJ B;  3LZ0 A;  2Y2N A;  3AZG C;  4UPK A;  5AVC B;  3R45 A;  2YFV B;  5AVB D;  3AZK A;  4KGC C;  3AFA D;  3MNN A;  5CPK B;  1KX4 B;  1H3O A;  4H9Q B;  5DNM C;  4WU8 B;  3C1C D;  3AZM C;  2RVQ C;  3UT9 B;  3AN2 A;  3H0L C;  3B0B A;  5B24 A;  5B1L C;  3MGR D;  1F66 B;  1T3U A;  2BYK A;  3WA9 D;  3X1S B;  1TZY D;  3W96 B;  2RIQ A;  1P3L B;  3AZH A;  5AVB C;  3AFA C;  3AZL D;  2XD5 A;  1P34 B;  1KX3 B;  3AV2 A;  2HIO B;  3C1C C;  5AV5 B;  2ARO D;  1JFI B;  2L5A A;  3AN2 D;  4HGA C;  3MGR C;  5B1M C;  3A1K A;  1P3K B;  3V9R A;  5DNN B;  4J8W B;  1ZLA A;  1TZY C;  5BNX B;  3B6G D;  5B0Y B;  2F8N G;  5B33 B;  5GSU B;  3AYW D;  5CPI B;  5AY8 B;  3AZH D;  3AZL C;  3X1T A;  1B6W A;  3AV2 D;  4J8V D;  4R8P A;  3W98 A;  5JRG D;  2UWX A;  2ARO C;  2CV5 B;  3NQJ A;  3W99 A;  4H9R A;  4Z5T B;  3AN2 C;  3MGQ A;  2Y2I A;  1P3I B;  1KX5 B;  3AV1 B;  3REK D;  3B6G C;  4CSR A;  3KUY B;  2F2A C;  4J8U B;  2Y2J A;  2NQB A;  5AV8 A;  3AZH C;  2IO5 B;  1Z2C B;  5B32 G;  3X1T D;  3AV2 C;  4J8V C;  5JRG C;  3X1U A;  1PZR A;  3LJA D;  3AZJ B;  3W99 D;  3MGQ D;  3REL B;  4E45 A;  3UTA D;  3REK C;  4G91 B;  3MVD D;  3B0D C;  1BH9 B;  4XZQ A;  5KDM B;  5CPJ A;  2NQB D;  4X23 D;  3X1T C;  3KXB B;  4UUZ B;  3W98 C;  4H9O B;  1P34 A;  3LJA C;  3X1U D;  3REH B;  3W99 C;  5CPK D;  1KX4 D;  3MGQ C;  5AV9 B;  3KWQ A;  1BFM A;  4WU8 D;  4Z66 B;  3UTA C;  3EPH A;  3WTP E;  3NQU A;  3TU4 A;  1ID3 B;  3MVD C;  5F99 B;  2NQB C;  2JCH A;  5CPJ D;  4XZQ D;  5E5A A;  3X1S D;  3MGP B;  4JJN B;  1S32 A;  1P3L D;  4J8X B;  1WWI A;  3X1U C;  5CPK C;  4QLC B;  1P34 D;  1KX3 D;  5B1L A;  4WU8 C;  2HIO D;  5G49 A;  3KWQ D;  1P3P B;  3AZI A;  4Z5T A;  1B67 A;  3X1V B;  4NFT A;  5B2J B;  2FJ7 A;  5DNN D;  4XZQ C;  5CPJ C;  3VH6 W;  3X1S C;  4J8W D;  2Y2G A;  5E5A D;  2DQN C;  1AOI B;  1S32 D;  1P3L C;  5CPI D;  5AY8 D;  1P34 C;  1KX3 C;  4ZBJ B;  2HIO C;  3KWQ C;  3REI B;  3WA9 A;  2CV5 D;  2PYO B;  3REJ B;  4NE6 A;  4H9P B;  3AZI D;  1TZY A;  4Z5T D;  1HQ3 A;  2ZM5 A;  1P3A A;  4LD9 B;  3TU4 C;  3MGS B;  4KUD B;  1P3I D;  5BS7 C;  5DNN C;  2FJ7 D;  3AZL A;  5E5A C;  5AV6 A;  3KUY D;  5BNV A;  4J8U D;  1S32 C;  2NZD A;  5CPI C;  5AY8 C;  2ARO A;  5GXQ B;  3IP4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...