1AP2A

Single chain fv of c219
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
b'DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY C219
publication title A single chain Fv fragment of P-glycoprotein-specific monoclonal antibody C219. Design, expression, and crystal structure at 2.4 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 27
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ap2A00
4JFDE 3L3OA 1F4XH 1OHQA 4X99B 4P99A 1SYVB 3MACH 4PJHF 5IM7A 4MD0A 2QADB 3MUY1 3BESR 1KUMA 1KCSH 4HS3A 4N0CC 5DS8B 3UC0L 5D2NE 3X17A 1U6AH 2ZOLA 2EE3A 4KK9D 4JREC 5BV7B 5I1KL 4AEEA 4LGSB 1P9MC 1KG0B 3FO2B 3L3JB 4H26B 2JKXA 5KTEH 4BZ1L 1QFPA 3EYFA 1J18A 5C0BA 4HV8B 3TBSB 1OGAE 5CZXC 1DUZA 3N9GL 2APBA 2YZ8A 1MUJA 3OB0H 2FX9L 4I0PA 1JPFB 3MV7D 4HWBL 1MI5A 1UZ6E 1MH5B 2VC2L 4XT1C 4JQVA 3T4YB 4GG6B 4OFVA 5D7JC 4F15B 2Z0BA 4HWNA 1IQDB 3MV7A 1FYTA 3QCTH 2ZUTA 2ADGA 3V4PL 1D6VH 4J12A 4NP4H 4Z7NF 1HWGB 5IIEB 1T03H 1VDGA 3MRGA 5LCVH 3TIEA 3VD3A 1CXKA 3GJFA 4Q0XH 4XPBL 5CD5D 5D1XA 4QRTA 2W92A 1AGDA 2E27H 1HYRC 4R96B 1GGCH 3DECA 4ZQKA 5LBSL 3O2VL 1S9XB 1XIWB 1P69B 3U79A 5FA3A 4ISVA 4NSKA 2IPTH 3O6LL 1ACYH 1FLRH 2IBZX 3N85L 3IXAB 1NANH 2DBLL 3KXFB 4PRNA 2ADJB 4RDQG 5D2LF 5HPMB 3MXWH 1EMTL 5GSRB 3I2CH 1EJ6A 4PP1C 4ZXBB 3WNNA 3ALXA 4PUBL 1NCTA 2JELL 2KBGA 5DMKA 4U1HA 5I9QC 1OSPH 2F74A 3PXJA 3GKZA 3QHZH 2XTJC 1U8IB 1U8HB 4Y4KC 5EH1A 1L7TL 5FYKE 3RKPA 1RSFA 1ROWA 2E7LA 2X1OA 2A0LD 3VXSE 4ELME 5JA9A 3RVVD 4U1GB 4ZUUB 3BYYA 1ZHLB 2IANE 1HXMA 3PJSB 3QH3A 4UQ3A 4ZO9A 3U36B 1DN2A 4KKLC 2FX7H 1A3RL 2BVQA 5IBUG 1E4KC 1WAAE 4WWKB 3DSNA 2NY6C 4NQED 1UFUA 2BNUA 2A6IA 3BE1L 5J13B 5DWUH 5I1JL 2C4FT 3D0LB 2EYSA 3PWJB 3R0NA 4KQ4H 1R3KA 2QBWA 4M7KL 3WIHH 1OCWL 3T77A 1GZQA 1NJ9B 1I7TA 3I50L 4OBRA 4L3CB 5K9OB 4AM0B 4MSWB 3C8HA 3OJ2C 4A6YL 3FFDB 4WGVB 3S37X 3V95A 1OSZB 5FYJU 1CF8L 3VFPB 4M8VA 1BQLL 3ULUH 5HGHB 2FJHB 3BKML 2WP3O 2FDBP 4HQQH 4ODXB 1OL0A 3C87A 3GSVA 4GW4A 3KYNA 5J56B 2WQ8A 1QSFE 4WV1A 1E4WH 4PRHB 3OKLA 1T5WA 3DUSA 2D03H 3ZTNH 4ODWB 4XPHH 4LSVH 4LARL 4YBQD 1OP3K 4PTTA 5F88A 3I6GB 5FA4B 1HOCB 1Y6KR 4PY8I 2VN4A 3AU1B 4HUNB 2CIKB 4DTGL 4RMRA 1EHXA 5CP3A 1SM3H 3U4EA 1OAZL 5HY9B 3DXAE 3EDDA 2WSKA 2GT9A 4LU5L 1UWEL 4Y16B 1AKJD 1ORSB 1U95B 1IQWH 4L29B 4XC1L 3L5XH 3A67H 5ALBL 2XNAA 2UVFA 5I8KL 1DLHB 4PJAF 4FG6C 1AKJA 1S7UB 1CTNA 5ACZB 4UV7L 1NBVH 2P1YA 5GS2H 2DTSA 3DX7A 4X9FA 2P24B 3P0YH 1DQMH 4RAVA 4K94C 4Y7MA 1JYVA 2R23B 3DETD 2YD3A 4R0LA 2VJXA 3D2UD 3E1F1 4Q6YA 4U1KA 4XPFL 4LL9A 2YSSB 5ICYA 1CLZL 3WBDA 1NGWA 4M6OL 1DBBL 4JFZL 4JKPH 3W9EA 3D2UA 3GI8L 4LSSH 4WW2C 5AWNH 5C0BE 2FLBT 1TZIB 3VFOA 3RWEA 1WWBX 4FXKB 1OAKH 1OLZA 1U42A 1RZGA 1VGEH 1TJHL 3QEGH 3HMXH 3SCMC 1BBJA 4AIOA 4QRSB 4M1GH 3H9ZA 4NM4H 3MRMB 1NUFA 4YO0A 3GI9L 3ZZ1A 1X9QA 1MI5E 2W91A 3IDYC 1CFQB 1QKZL 4HWZA 3RX5A 4M1CC 3WO4C 1JVKA 1F4WH 2CKBB 3MV7E 2NY7H 1FYTE 4IJ3B 3LVEA 5ITFB 3NZHH 2W07A 4YIQA 2P8MA 1U58A 4QXTA 1NAML 3VFNB 3HG1D 3SKMA 4FQJL 4UMGA 3ZHKA 1J11A 1IAIH 4HAGA 5E4IA 5FFLA 4LP4A 3EO0A 2UZIL 3RKDC 4CN1A 3HG1A 2UYLB 4XXCA 5FYLD 3AREB 3W5NA 3ORJA 3X14B 4CVZA 5C0EA 5SWQA 5IJVB 3QPQD 3U7AA 2F8OA 3S4SB 4PJBA 1OAQH 3NCYS 4Y5XB 1CL7H 1L4IA 2A77H 3LSOB 4G9DA 2E8ZA 1U3HC 4J1UB 1D6EA 4D0BA 3G5ZA 1IARB 3CXDL 4HCRH 1XGRA 5SV3A 1A7PH 2R2HB 1M7IB 4FZ8L 4YUEH 4R8WL 5E2TL 1C08A 3ARTA 2WUBH 1QQDB 3VG0L 3SDDD 3U6RB 3PF2A 2ZUXA 3ZSSA 1TETL 4IRZL 3OTTA 3RWGA 4YHYB 5EBLB 1J8KA 25C8H 2R56H 3O11B 4ZS6D 2VXVL 3SDDA 3EOAB 4RBPH 3RIAF 3BYTA 1VGKB 3WJJA 2HRPH 2OJEB 4U33A 4ZPTA 5IB3B 4PJCF 1I7ZA 1K85A 4LGPB 3GM0A 1RY7B 2FO4A 1JPGB 5CINL 1YEGH 2Y6SC 1NEZB 4YNYB 5J6GA 5C6TH 3EJZC 1VFAB 1T3FA 5CEYA 1G9NL 2FIKA 2YA2A 5GGVY 2AJ3A 2R2EA 3QNXB 1G6VK 2VSDA 3VXSB 4WFFE 3DGGA 3CK0H 2J12B 1QYGL 2G9HB 3FHQA 2F9BT 1KJ2H 4YXHL 3PV6A 4YXLL 2E9JA 4D9RD 4U6HA 4JQIL 4PD4K 4AT6B 4KZDH 1T1ZB 5EO9A 1G7IA 1INQB 4K9EH 3D18B 2I5YH 4NC0B 4XBPB 2Z8SA 1JGLL 1ZAGA 3HPLB 4OGYH 3QRGL 5F71A 3A0OA 2UVEA 1CK0H 5CFHA 1FGNL 2GCYA 4F9LA 5I1EH 3HE7B 5BQ7B 3JUZA 4AQ1B 5HHNA 5E6ZA 3BZEB 3V6FB 1U8OA 2HFEA 1AGBA 3QPXL 4Z8FH 3PWUB 2FBOJ 5EC1B 4Y19B 3BH8B 4NZUH 4LRNH 2YD7A 3G5XA 1IAKB 1AD0A 2XN9B 3V6ZB 5GGRB 5DLMH 3EFDH 4W4OA 1CE6B 2B1HL 3NACL 4JB9H 4NGHH 2YN5A 1GGIL 4PTUA 4KUCD 3B9DA 5F9WC 3WEXA 5T3ZD 3T0AA 3S5LA 4M7ZB 4AG4L 5FKPB 2PETA 2HLFD 2NXYC 1UM5L 1HH6A 2P7TB 4ZO7A 4YJZL 4RMWA 1KCRL 4L8CB 2DQDH 5JPMA 2D9CA 4XNUH 4ZFGL 5I19H 4WEUD 5A40E 2C26A 5DEGB 3E8UH 4EVNB 1I7UB 3VXOA 2OXHA 1I1AD 1RZJL 1KIQB 3G04B 4MVBD 3U46A 3EUUA 4XNXL 3UPAA 4WI8A 4LSQL 3O9WD 1CXLA 1I1AA 4KGLA 1D5MA 3TCLB 2QL1A 1PAMA 3TFKD 5E8NA 3IRZA 3OAYH 3O9WA 3UJTL 2AP2A 5IHLB 3L5WB 3PWVA 3BISA 1T0MA 1ZSDB 2D7NA 1CE1L 5DYOA 1NAKL 2HTKD 1Q0YH 3ULUC 4H0HB 2DAVA 2I27N 3TEUA 5HYSB 3OPZL 4KMTL 5C9JB 2AEPL 3ARYA 5F1NB 1IC4L 43C9B 1DLFH 4GBXC 1I3UA 5SX4H 3SKOA 1CN4A 4ZPVA 1N5AB 3WE6B 2R29H 1AR2A 1OQXA 1CG9B 4L3ED 3MA7B 4K3EL 4QTIH 5IHUL 1QFWH 3ZHLA 5KSAD 5EZIH 3OX8A 5DUBB 3MV11 2A74B 2CH8A 3HZMB 4PJGA 1G7JA 3HLAB 1DL7H 4L3EA 3E2HB 1EUTA 4RQQA 3ZKXC 4XAKD 5KSAA 2XWJA 1UVQA 2MHAA 3NIGF 4LHUD 4NNYA 3BWAA 4XVTH 1R3LA 2RBLA 1WGOA 3KYKL 3HG1E 3GRWA 2CLZB 2Q76B 4PP2A 1C8PA 4LHUA 4JJHA 4FQXA 4OI8A 4PJBE 1FZMB 2AABL 3D0VB 5IB4A 2CLVB 4XVUD 1L6ZA 2VDOL 5FECB 3SE4A 5C0FB 4X8XA 4ZYKB 1WZMA 2HN7A 2FYYB 2R0ZL 4MD4B 3TBTA 4LFHG 5TDPB 5JOEA 1RJCA 1SY6H 1UT9A 1XCQA 4P5TC 4MB4A 3MLVL 3MUGB 5LAXA 4G7VL 3SDXA 1CXHA 3TCXA 2YPVL 2ORBL 2VMFA 5ADOL 5ID0A 4G6FB 1AC0A 3GMMA 1INDH 1K8DB 3PWNA 3I9GL 3BSZH 2RR3A 4EQ3A 4XMKL 1JN6B 2VITB 1IGTB 1F45A 3RQ3A 35C8H 4HGWB 4K3GA 4ZUSB 4KGJA 3UTTB 5TQ0L 5E56A 8CGTA 3E6HB 1MJUH 2I9TB 5ILTH 2APFA 1NQBA 2OJZL 4U7SA 1FCGA 1NUNB 2Y5TB 4I77L 1GXEA 1U8JB 5HHMD 1QHOA 4LRIA 5GGQL 4NKIH 4NUJB 4OLXH 5ITBH 4YXKL 3MA9H 4NKMA 1RVFH 4ZD3L 3ZDYF 3MRHA 3RVTD 3F7QA 3VJ6A 4UDTB 4Z5RB 1A4KA 5EBWB 1RZ7L 4I3RH 1GHFL 2VXSL 3GHEH 5KOMC 1DQJB 4D9RE 2I07A 1GZPA 5JXEC 5CD3B 1CGYA 5EWIH 3BHBA 4OZ4B 5FCUH 3I75A 4OLYL 3PV7A 1KTRL 1CD0A 1QFUH 5C8JB 2FO1A 4JPWL 1S9WA 3HAEG 1NL0L 3H9SD 5T5FL 5DURB 1YPZA 4Z9KB 1BFVL 4ODUA 2CPCA 3H9SA 4HAFA 4BZYA 5FXCH 2O5ZH 2OTWA 1CTOA 5DI8A 5A2LH 3CFBA 2WWMD 5MEND 2FR4A 3RUGE 1VEOA 4EN3D 1IGFL 2G5RA 4JN2B 4PLJC 1C16B 1VA9A 4BA8A 4OQ1A 1J87A 5SX5H 1YECH 4BQBA 5HHOD 2H41A 4JPKL 4OF5A 2CLRA 4EN3A 3KYMB 4NBZB 4YQXL 2WIMA 3MLWH 4BFEA 4G8GA 1XGPB 5HHOA 4JFQB 3CX5J 3TBWA 3ARWA 3QIUD 5EZOH 3TA3C 3BDXA 4P2OC 1IEAA 2X4UA 2F8VA 4LSPL 5E2UL 5IBUB 3QIUA 3RTQA 2VLKE 4FNLL 4GRLC 4M3KB 4L8DB 2JB5L 1U3YA 5DJ8B 3INUL 4KH2A 5DVLA 3BDBA 2OMBA 4X7CC 3AM8C 1K6QL 3B9KA 4QLRA 3CDYA 1BFOA 4NJAL 2X4OB 3BQUB 2GHWB 1MFEH 5KOVC 4NHCH 1FVCB 2H26A 1ZVYA 3TYFB 4LNRB 3IS1X 1L7IH 5E8DL 3V4UL 1TZGL 4K9EC 4RGMB 4XP9H 3VGBA 4GT7A 3RDTD 5FO7B 5F1KC 1WFNA 3LV3B 4L9DA 5F3HA 3K1KC 3H2WA 3W5MA 4LSRH 4K7PL 2AXJA 4DKAA 4JO3L 4OLZH 4GQ9H 2EYRA 1MLCA 5IVOA 4YHNB 2EYTA 4HIEA 3NCJH 3VXPB 5IB5B 5GISL 3T09A 1AHWB 3WN5C 4PJGE 43CAA 1EVTC 3ARGC 4OFPA 1ZOXA 1VKXA 4R4BB 1DBJL 2MSPA 5J0BA 1I9RH 2AJXH 4HK0A 4UTBH 3F58L 4X5LA 3B2UD 4V1DB 4XAKE 3Q5OA 3OKDB 4CVWA 5L9DH 4XX1G 4XPGL 3ZTJH 4OF8A 2AJUL 1W0VB 4B50A 1T89C 4G6JL 1OP5K 4GRWB 5LKNA 1MFAH 4ZUVB 1KPUB 1A9EB 3V5HB 4K8RD 5INDB 3BT2L 4NBXB 5F7NC 3DX9B 3T65A 4LIQL 1EUUA 1FVDA 3SDXE 3QCVH 1MCJA 3TBVA 3LIZH 4LVOB 1CLOH 4YDVB 2W60A 5KVGL 2FEEI 4PJDF 1PZUB 3LKSA 3KPPB 3MRPB 4XXDA 1FPTH 5TGBB 2PO6D 5GGRY 1A21A 1BFTA 2FZ3B 5F3BA 2DRUA 1U6AL 1W2KT 3QWQB 1J0KA 3MOAL 2PO6A 3VFMA 1KLGB 1D5IL 1H8SA 4XP6L 1ZT7B 1QLFA 3VMOA 3WNPA 1PG7W 2G5BA 5C86A 2H32H 1JF6A 5F7DB 5HHPA 3BDYL 1I8KA 1DQQA 4F7TA 2W1NA 3KHOA 3CZFB 3NN8A 4QRUA 3SDAD 4UBDD 5DHVB 5F7EH 3X13A 3IKCA 1QLRB 3BZ4B 4HIXL 2BC4A 1YUHB 3O45A 3SDAA 1ZHBB 3EYVA 5H2BB 3R1GL 4TQEL 2X4NA 3IF1A 3CH1B 4WNQA 2IJ0C 3VGGA 4GAYA 5HHME 4AIZA 4LSTH 4R6UA 2C3HA 1G0XA 3PHQB 5SWSB 1C12A 3TJHC 4QHLB 1MREL 4ZUTA 4CDHA 1DVFC 2ZSWA 3MV01 4P4KB 5IMLB 2ED7A 2CKNA 3UPCA 3PXHA 1F90H 2D7PA 3CAFA 3K2UH 1UA6H 4Q9CA 1A1MA 3OJVC 2G2RA 5CP7A 1YPZE 4XCYA 5FYKH 1AQKH 5KVDL 3RWJA 3KLAA 2C4XA 5E99H 4L4VB 3H9SE 2X4PA 1DUYA 4LLDA 1M7DB 2ZUUA 4FZEL 2VISB 3ILPB 2J1KA 2XRAH 1PY9A 4N8PA 5E6ID 4JM2F 2JK5A 1JV5B 3SKJH 1ZEAH 3QRFM 2B5IC 5C0AB 1DQDL 3ZHDA 3EOBB 4G8GE 1M05A 1YMHA 5J4MA 5E6IA 3WDJA 5GS3A 2CDFA 5HVFB 3L7FB 2EC9U 1QSVA 4G9FD 3TNNB 1WEJL 2V2WA 5A43C 4MA3B 3RUGB 4D0DB 3CVHA 3WMSA 1P84K 1RUAL 2EZ0D 3RWDB 3OKEA 4G9FA 5DQJA 1UACL 1B88A 2ICWJ 5CIPB 2BY2A 3CC5B 4Y5YC 5CCKL 4PJXA 2DKUA 5FGCB 2IH1A 3RHWK 3P77B 1MVUB 4UB0L 3U0TB 2W65B 1QEWB 2OI9B 2LV4A 4FTVE 4Z7WA 5H35B 1LO2L 4MAYD 1N0XH 3Q1SH 1W0YT 4H0IA 2VLKB 3QUMB 2MQ3A 2CDEB 2ENYA 3GSXA 4IRJB 5IGXH 1UXSA 1ZA3A 4MAYA 1UM6H 3L3IA 2YMXH 2YRLA 3C09C 1T2JA 3W0WD 1EHLL 1Q9KB 4DW2H 5A3ID 1QNZH 4XPTL 5CBEB 1HEZA 7CGTA 1NCDL 3PDOA 4ALAL 3W0WA 4JRYD 2B0SH 2N7AA 4P3CH 1FFNA 5EZJB 1X4ZA 4KQ3H 4M9PA 4O2FB 3H7LA 2VXQH 3RWIB 2R0LL 4S1DC 3N0PB 4FQ1H 3T04D 1H3PL 3F65A 1F3RB 3P4MA 4TTDC 1EHAA 4Z7OF 2F5AL 3OF6D 2GUOB 4JLRA 2H2SC 3O4LD 1D5XB 1BF8A 3WKMH 2E9IA 4PGEA 1WCBB 3QFDB 2E6JA 4FQQB 4PJHA 2E6QA 2NYYD 3SQBA 3G6AA 3OF6A 2Z31D 4R97C 3O4LA 4Z7UF 5DJ0A 2GTZB 5DD5H 5TF1H 4X83A 3QB7C 1YEEL 2NY0D 2X4SA 4J3SA 1A3LH 3DVNA 2Z31A 4I8DA 4YR6B 1HINL 4HUVB 1S78D 4QRPB 4JZJB 3IFLH 4HF5H 2GSIA 3GSQB 1NH6A 2NNAA 4MMZC 2BJMH 1RUKH 1X5LA 3BPLC 4M9OA 2GSGB 1BZ7B 3MNWA 1WZ1L 4RBPK 5EU5A 4FQLH 2AV7B 4OM0L 1DQML 3WFEL 1ZLVK 2WP3T 4P48A 1B9ZA 3SDYL 1JGVH 1T04B 3RY4A 1VFBB 1CXFA 5F6HJ 4HH8A 2C1PA 3IU3A 1T21B 3GJFH 1NGPH 2YUXA 3NFSH 5C0RH 1A6TA 3VI4F 5EDXA 2CRZA 3CDCA 1W72L 1I9IH 3QEQB 4IIQB 5FK9B 5LXGH 5CBAB 3LEXA 5IESH 2R8SH 1BF2A 4HJGA 1FZOB 4M7LT 5D93B 5DFVD 3TPKA 2EICA 1QPPA 2XPGB 3QISA 3HC3L 4UT6H 1LEIB 2PXYB 4ZNEE 1IC5L 3EDEA 3PUCA 3FQXB 5FOBB 3MRDB 3DWTA 2EXYC 3LRHA 4YAQB 4NJ9H 3T1FA 3OGCA 4PGZA 4GMTH 1BGXH 3GZKA 3MREB 3S34H 1MRDH 1K2DA 1J1PH 3FRPG 4QHNA 1X6NA 5E5MA 3S97C 4ZFFA 2J6EL 4Y89A 5HVWA 5GS1A 4EBQH 3VFWA 4G3YH 3R8QA 5GRJH 2HFGL 5CWSB 1MCNA 1RUQL 4OIIL 5IQ7L 5DQDH 5D2LA 5D2NC 3MBEA 4N1HB 3CLFH 5D7IB 3KPMB 1U2HA 4BYHA 1PW3A 3BEWA 4WW1A 2H9GB 3UX9B 1N3NA 4FXGB 1NMAL 3P2TA 3MR9A 5J1AA 2RIKA 5IKCA 3T4AB 1WT5A 2AK1L 4XAWL 2MWCA 4Y4HC 3JWOL 3MGOA 4HIHB 2BNRE 2YHGA 1N6QL 1MCPL 5DMGC 3LS5H 3LRSB 3T8XA 1OAUL 3D25A 5EBMB 1ZT4B 1XF2B 1HI6B 3LQZB 4O4YL 5DVKA 5GHWL 5BW7C 5F7WC 1E4XL 1A1NB 3RX7A 3RZCB 4AH2A 1PYWA 3ULVL 2DLEA 3QI9B 4L1DA 1I75A 2OZ4L 2VABB 3X3FH 4PS4L 1YEJL 1SYSB 5DD1H 4L9LA 3DI2B 3QG6B 2BERA 4FXLA 4ODSL 2ESVB 4JFPB 1I1YA 4G9FE 2A83B 1Q1JH 4AK1A 1A6UH 1VB9A 5C0CD 1T80A 4PJXE 1J05A 4HPYL 4P0DA 2C3VB 4LCWB 3OAUH 4QF1A 5I2IA 3GIZH 4KJPC 4F3FA 2F5BL 1ZHNA 4Z7WE 1U2CA 5DJZB 4LCIH 1MWAB 1CS6A 2SEBA 4CADB 3SDCD 5EIIA 1KV3A 2DYPD 5CEZD 5JW5A 4TUJA 3SDCA 3BP6A 4L5FH 5LGHH 2ZG1A 1P7QD 1TVDA 2DYPA 2NW2B 3FTGB 4HLZG 3SE3C 3HAEB 1MSPA 1TJIH 1ZHKB 1P4LB 4FTVB 3C8DA 1HYSC 5CP3H 1P7QA 2BVOA 2DS4A 4YWGL 1U8QB 3W0WE 4E41D 2X4TA 1DCLA 1QVOB 4X4YA 3WS6A 4DVRL 2I9LA 5C7XL 3DO7B 5GGTL 4D2NA 1QUNA 4IOFC 4E41A 4O9HH 1RIHH 3ZE0E 2LU3A 3GKWL 2AXFB 4YDKH 5JNYA 1ZVSB 4Q6IC 2Y5EA 4JHWL 4DGVH 5C2BL 1RK1A 2AK4B 5EFIB 4PB9L 4DN4L 3NFNB 5J12B 1FIGL 4QY8B 1OTSC 2X1PA 4PJHE 3CIQA 3FQTA 3BPNB 1EO5A 4DGYH 5I1HH 3O4LE 2DQHH 4OCWL 2YRPA 4GAGH 1AXTH 2A73B 3EJYC 1GOHA 4QOKD 1AE6L 4OB5H 5B38G 1QBBA 3LCYA 3VGDA 3C2SA 3QUZB 1Q72L 4QOKA 5SWZD 1FN4A 1RHHB 4P23D 4HWBA 4H25A 4WUUD 2JIXA 4JN1L 4QT5A 1KTDA 5EBGA 2QKIB 4OGAC 4QYOB 4K3DH 4GW5A 5FO8A 3CSYB 5SWZA 3D5OF 5F8QC 1P4IH 1U8PA 1ZLSL 3O3DB 8FABA 4DZBA 4WUUA 4TUKH 5HTSA 2YPKB 5KVFH 3L7EB 4NQVA 1A1OA 1RZKH 3BI9X 1BMGA 3WHE1 2MJWA 2QHRL 3RWHA 2ZJSH 2IPKB 1YC7A 2R69L 4PLOB 4M7ZC 3MUJA 3PDGA 3WHXB 5IMOA 4RA0C 3DHJA 3Q5TA 1ACZA 2IGFL 1MJ7L 5D1ZA 4DCQA 1XF3B 1M6OA 2FBJH 2VDPL 3SE8L 4KDWA 4Z7NE 3BEVA 5C09D 1MCOH 3MV9B 1H15B 1QBML 1MY7A 5FGRA 2R9HC 3MRJB 3RP1A 3AY4A 2CK0H 1LEKB 3GMOA 1FAIL 4IRSB 5DUPH 4Y0GA 1U8LA 3EOTL 3KPLA 4IM8A 1WV7T 4G5ZH 3FO9B 1YJDL 4Y5VB 5IVZB 3FN0L 1MCHA 5C0GA 5D5MB 1ZGLM 5FGBA 1UQSB 4M6NL 5BV7L 5HYJD 4X9BA 3SKNA 5IMKA 4XC3L 4POZD 5ANMA 4K71B 2BHYA 5D2LE 3TO2B 2Q3ZA 3BIKA 4PV8B 5GGUB 1Y6NR 5HYJA 3O6FD 1FDLL 3HI5H 4JFOA 5F8RC 5IG7A 4OD3L 4PPTA 4OIBA 5ICXA 2D9QB 4XBEL 2ILLA 4LHJB 1YNKL 3B4NA 4KK6C 5EA0L 5ESVA 3KJ6L 5FDWA 3O6FA 2EE2A 5HD8D 3WNKA 2ARJQ 3QCUL 2DDQL 4U6VH 4FFZL 1BLNB 3UYRL 4KFZC 3ULVF 3AXLA 1RU9L 3NMEA 3LQAL 3WFBL 4P59L 5JW3H 3V79C 2GAZA 4I0PC 5F96L 3JV4B 3WFHB 4PJCA 4YHLH 1Z3GH 3QNZA 3OG6B 1E6OL 5EN2A 4FQIH 4JQVC 4JY6A 3LD8B 3MJ6A 1Q94A 5I8CA 5AEAA 1WFOA 5LVEA 1RUPH 3CJJA 4MQSB 3O81A 1R3IH 3BP4B 2ID5A 4A6YA 5KSBB 1B0RA 3TNMB 1NBYA 2VXUL 4M03A 4F7CA 3OKNB 4GKOA 2BNRB 5C71A 5HGBB 5GRUL 2FSEB 3PP4H 1DEEA 3F5WA 5D1XC 4HH9A 1XCTB 2DWDB 1NFDB 2VDNL 5T1MB 1BQSA 5JW4Q 3BKYL 2GJZA 3L95A 3THMH 3QHFL 5CD5C 5D6CA 2JCCB 3QNYA 3LN4A 5GJSL 4TUOA 1HHIB 4NO2B 5JOPE 1GGUA 4OZFA 4LCUA 5DGRA 3RVUD 2N56A 1JTOA 3ET9F 3GBNH 5FUOH 3O6KH 4PD4J 4CKVX 3WLWD 2M1KA 3VD9A 4EI6A 1V3MA 2GW5A 1H9VA 4UT9H 5GS0L 1EXUA 1NKRA 2XZQH 4L8SB 4OGXH 1T83A 4AENA 5CJOL 4M5YL 1R3JB 2YR3A 5CEZE 5T1DH 1T1YA 3C6LD 1L0QA 1N8ZA 4JDTL 3GHEL 1RIVL 1KB9K 1CR9L 1YNLL 5L88L 4RCAA 3GSRA 4YGAB 3WCYA 2XG5A 4XRCA 2E7LC 4KKNA 3C6LA 3EHBC 4LLYB 2KPNA 1AD9B 1E27A 4UUJA 5I74C 1OTTD 1UH2A 1BQUA 1Z6JT 4E41E 2CR3A 5CILH 2A0LC 5HHQB 1S9KC 4OM1H 3RNQA 4P2QB 1NBZA 1PFCA 3T0ED 1D7FA 2D7QA 1BIIA 4HUXA 1OQOA 3G9VA 4KUZH 5BMFH 3UMTA 3DUUB 2FEDD 3D9AL 5KVEL 4L1HA 4PJAE 3T0EA 4C55A 4YX2L 3MBXL 5C0DA 3ZYIA 4AEIL 1HHKA 3BXNB 3BP5B 1A7QH 1MCDA 2Z8RA 5J11C 4O58L 2NX5B 4OZHB 5DD3H 4KAQL 5AAMA 1HSAA 5I75B 1EK3A 5DMJB 3FKUS 4XNMB 2Q6WA 1DFBH 1UM4L 3BWUC 3O0RL 1KLUA 3QDMD 4HT1L 4XHJC 1MHHB 4QOKE 4ODHL 5DVOA 3S8WA 4R4FH 3QZWG 2KQNA 3OWEA 3QDMA 1RJYA 1N4XH 2FECI 5SWZE 4WV1C 4MQ7A 4Q97A 5IHBA 4R7DA 1AP2A 3ME0A 2HVJB 4XHQA 1X5HA 1NAMA 1YY9D 3GNMH 5JIIA 2YD6A 3MLRH 1BVZA 1N7ML 4M02A 2VZ1A 1QRND 4PR5B 1EV2E 2YN3A 1K3IA 5KSUA 4BH7A 3QEHB 3QAZB 2OTPA 3PHSA 3ES6A 3GEWB 1QRNA 1QO3A 4YBQC 3FAWA 2HMIC 3V7AE 1DE4A 3GRWH 3CNKA 3OBAA 2XWTB 1CIDA 2VDKL 4QXUL 1DBAL 3T2NL 5TPWH 4KDVA 3S96A 1YQVL 4G6KL 5DRZB 1QR1A 3KPRA 3QR2A 2X70A 2DQEL 3QDJE 4ZUWA 3TO4D 2VQ1A 4KKBD 3VD7A 4LBEB 3BPCA 3UTZB 3TP4A 2IALA 3VFGL 4HPOL 2GEEA 5ALCH 4D9QD 3H3PL 4HUUA 5F70A 3RNKB 1EEZB 5ANME 1H0DB 3TO4A 1V8HA 3QWOB 2PTVA 5T3XD 1NDGA 1PLGH 5HYJE 4R0LC 4FQ2H 2X9WA 4GG6F 2AJVL 3LB6D 4Z95L 1HNGA 3MROA 4NQXA 4AL8H 5KSVB 4P46B 4LVHC 1U8KA 3DETC 4FQCH 4AMKH 2WM0A 2YEZA 5MEQB 3EDKA 1BM3L 1FORL 2XFXB 4BUGA 1H8NA 3EDFA 4JCLA 5DQ9B 4JFHD 4Z18A 1RZ8A 4AEHH 3VE0B 1JHKH 2CKBL 2NY2B 5BZWB 2HKHH 5HDQL 3WKNA 3CU7A 4PJCE 4UIMB 2X05A 5GGSB 1RV6X 2R0KL 5E0QA 1VPOH 3MUZ1 5DJXB 4H1LA 2UY6A 1W0WA 1O7VA 1RZKC 4I5BB 4BKLB 4NKOB 4G8FB 4RISL 2V5SA 1MAMH 2HP4A 4YHIB 1S7RB 2P8PB 1RIUH 4PYGA 5I30H 2ICEB 5IOPB 1MIML 4XXCC 4XMPH 5AZ2H 1T7ZA 3HRZA 3Q2CA 1XGUA 1AFVL 2EDOA 2IADA 3WXWL 2G75B 1C5BH 1F4YL 2A9ML 1ED3A 4U1LB 3QPQC 5LWYL 2XY1A 4DOHE 3DPBA 5CUSL 5ADPL 5E5UB 4JY5L 5E9DB 5CMAB 5ELIA 3QUYB 1HQRA 1CT8B 1LE9A 5J9PB 4DEPB 3WFDH 2PR4H 1T1WB 3LEVL 4OF3A 4OV6F 1I9JH 1DSFL 5GQBA 4HS6A 3B83A 3NH7L 2A1WL 3SDDC 4E5XA 4TTGA 4XNQB 1RZFL 3G08A 3HI6L 2P5WD 3WJJC 4DZ8B 3QUKA 4ZS6C 5JXAL 5DT1L 4HBCH 4LPTA 2P5WA 3G6JB 3K74B 4HIJA 5D7LB 4JY4A 4C58B 1KB5B 3BGFB 3VMNA 5IFAH 4NRZA 3VRLF 3VXNA 4M3JA 5DHYA 3VA2C 1HIML 2HH0L 1X5GA 4N0CD 1UJTA 4JG0H 2O5XH 1Q9OB 3T0EE 5E2VH 1WUNT 1U9KA 3DBXB 1V3JA 1ZEAL 4OLWL 2OTUA 2HTLC 1LO4L 2IBBA 2V5YA 3SGEI 4ACPA 3H0TA 5FDYA 5JO5B 4MNHB 1HHJB 1P9MA 3O6MH 5IW6A 3P73A 1JUFA 3IS0X 3SGDI 4GAJH 4PJAB 3QDME 5F9OL 1R3HA 2OSLB 4F9LC 1RJLB 3O8XB 5D9SB 1MHPL 1ORQB 3RWCB 5F1SA 1OD7A 1A6ZB 1INEH 4X6FB 2MKWA 4G43B 3Q0HA 5DK0B 2IQ9L 3UDWA 2VLRB 3ARZA 3FOLB 3GJFK 4NQCD 1EVUA 2VE6B 4LLMB 2O5YH 5EU4A 5DRWA 5JW4R 3DIFB 1QRNE 1JGDA 2AERT 2VH5L 4QO1A 4U0RC 4PRIA 2N1KA 4NQCA 3HI1A 4W4OC 4YGVB 1MCSA 2CXGA 3NIGE 4TPRL 4J4PD 2XZCL 1C5CH 4F2MB 2P5EB 3KPRE 1QFHA 2OR9H 3IDJA 3KPOB 5HGDB 5E1AA 5I8OH 2NY5L 3FFCE 4J4PA 4KVNH 1XZ0A 5D96B 1IAOB 2VDRH 2FHBA 3ARUA 1WIPA 3CFEA 2HLFC 3RGVD 5ECJE 7FABL 1P5UA 2UWEB 2VLJD 4L4TD 4K8RH 1FAKT 4WO4D 1IKFL 1I1AC 4MVBC 4Y4KD 1KFAH 5CJXA 3RGVA 4XCNA 5B38B 4G6AD 2R4SH 2VLJA 4L4TA 3GMQA 4WO4A 4NCC2 1T6WA 1SQ2N 3BKCL 4LVNB 4XCFH 2EIDA 3IGAA 4G8EA 3IDMB 1H3GA 4Y4KA 3S36X 3FB5B 3IXTB 3MLTB 4PJDA 1S5IH 4KKLD 2A6JA 5EU7E 5MEOB 1EBPA 4OLVL 4CNIA 4X7SH 2XKSA 5E8OB 5F89A 1FZKB 4IHOA 4X8JA 5IB2A 2BDNH 3U9UB 2NY6D 1HILB 1F3DJ 3PWPD 1ZGLP 1IL1A 4XGZB 2HTKC 2DWEB 2VZUA 4NQEB 3P11H 4XWOD 4PRAB 4YK4B 3T77B 3I6KA 4J3UA 3PWPA 1A2YA 1RZIB 1A6AA 2HFTA 2FJFB 2YK1L 4NYLB 4YE4H 3DMMD 3NA9H 4NFCA 3DLQR 1PSKL 1OAYL 5KSAC 4M5ZH 3J7HA 5KW9L 1LO0H 2GK2A 3ZDYE 3DMMA 3VWJB 1G7QA 5ACMA 3ZKSD 1X4YA 4KC3B 5EIQA 3MFGB 4FQXC 2R1XB 4P57B 3VH8A 3OXRB 1HDMA 1WICA 2Z92B 4X6CB 3F7YB 4LSUH 4U2YA 2CRMA 3JV6B 1NC4D 1X5YA 2Z4QB 2Y36L 1OGTB 4NNXB 2WBKA 1QACA 3SE4C 3KLHC 1KIRB 4J3WA 1FJ1A 3IFPA 4K55A 3V0VB 2ZP0T 5TJWK 4XVUC 4MWFA 4CGTA 1NC4A 4OUOA 3BIAX 2YUVA 4NJ9L 1UEYA 3S88H 2VZSA 4XVSL 4OKVB 2P42B 4X7TA 4WCYH 1J5OH 5TE6L 4CUCA 4ODVH 3FONA 2R1WB 3X12A 4PV9A 1QA9A 4O02L 3HMWL 5B21A 3CPLB 3O41B 1JNJA 3TIDA 4JM2A 3MRCB 2X1XR 1UB6B 3PGDA 3CVIL 2F53D 3CVHH 1A64A 5DK2A 1N59B 2FH8A 2VL4A 5BJTA 4JDZA 4FG6D 3UO1H 2IH3A 1OARH 3SO3B 2F53A 1T7XA 4JO4L 3BP7A 4M00A 5A16B 1IEBB 2VQUA 3VFRA 1X3DA 1MRCH 1DQTA 1J8HD 1EX0A 4LRIC 5GRVK 2L0DA 3BO8B 1X7QA 1P84J 4R7NB 5DDHB 1JGUL 2YD2A 3C08H 1KELL 4R90L 3IFOB 1J8HA 4NN5C 3MRKA 4OQTL 4U1MA 1FNSH 1FZJA 4X0KA 2ITCA 1T2XA 5ERWB 1PGRB 4B7LA 2C5DC 1RMFH 4NRYA 5I15H 4JM4L 3MRFA 5I1LA 1BP3B 1CICD 1AGCB 1CFVH 1D5ZA 3DVIA 1PQZA 3LDBC 3ZDXF 5F7LB 1CICA 3KJ4B 1S7XB 1FNEA 5GGSY 4PLKD 4MA1C 3H42H 3QEUB 4GXVL 3A6BH 4CW1B 2LAGB 3MLZH 2V7NA 3T0VA 3FT2A 3MLUH 2Y06L 2AJZB 3OL2A 3W39A 4UNUA 3TJEH 2WWMC 1KIPA 3W2DL 4HXAL 5INCA 3RBGA 3RKDD 4EN3C 2VSCA 4JPIB 2BHUA 4LKXA 5GSVA 3TGXA 6CGTA 4PRIE 2WZPD 5JHDB 4NQCE 2ZUQB 3D3VA 3W11D 1IMHC 4PIRF 3TPUB 2CIIB 1LK3H 1FV1A 5D70H 4PJFB 4PJEF 3QIUC 3RTQC 4U4BA 3IDNA 3T3MF 2PTUA 2NMSA 5CZVH 1NMCC 4XP4H 2DD8L 4PJ5D 1IGIL 4Z7UA 5FUZH 3F12B 1JNHB 3ABZA 2BP3A 3IETB 4E0RA 2RJMA 4Q2ZB 2YKLL 3PABA 1TQCC 4PJ5A 3QQ4A 5B8CB 3B9KC 3O3AB 4MNGB 1LEGB 3VFSB 4F33A 3JUYA 4WFEE 4WTWA 3HNVL 1I1RA 2F19L 5D7SH 3C5ZA 5I1CH 1JK8A 5AYUL 2VLJE 4L4TE 3V4VH 5JTWA 2YS4A 5KAQG 1GPOL 1YEHH 4PJDE 1QD0A 4XVJH 3HZKA 1YN7B 1T1XA 2NXZD 2YWZA 5CJBA 5DJAB 2ZCHH 3QZWB 5CKAA 4WENB 4IDJH 1EGJL 5IB1A 5C08D 3SEPA 3GBMH 3EJZD 2PYED 4JAMA 3MLXH 1KTLA 2J5LB 3BVNB 2LFGA 1BJ1H 4ZDHB 2BOBB 1XF5A 1ZGLA 2IPUK 5C08A 1FQ9C 2PYEA 2O61B 3L3GA 3PWPE 1V7NH 3B3IB 5ESQB 3V6BR 4J6RH 1IM9B 3V5KB 3B8SA 5FO9B 4X4XA 3OB8A 4HBQA 3GB7A 2EDNA 3MTRA 4Z0BH 1BD2B 4MHHI 1CFNB 1A5FH 3JTSB 5EG6C 3QUZC 3U48A 4JKKA 1FG2A 2CK2A 4JFEA 3EYUH 3K8MA 3SY0B 3LKNB 1KCLA 1IC1A 2OP4L 5DHXB 1EO7A 3JTTA 5CSGA 2VDQL 3B2UC 5D6DA 3QIWB 1IT9L 2KDGA 3AS0A 5IQ9A 4NQDB 1JPSL 3GSOA 3PG2A 1XFPA 5TDOA 3IAGC 1MJ8H 2NY4D 4XMLL 3VXRD 4WHTB 4LLWA 4KKCD 5HYQB 4K8RC 5BO1H 1IEHA 6FABH 4MCZA 3WIFA 1PG7H 3FT4A 1A14H 2LTQC 3O4OB 4MCYA 4JRXD 4PG2A 3VXRA 3P4NB 3H3KA 3MRIB 1DQLL 2XOTA 4CN4A 4EI5D 2D7OA 4YHKH 4JRXA 2PO6C 4M43L 4J3XA 1M71B 1MCRA 4EI5A 1P2CA 1V5JA 2MPAH 5ENWB 1NSNH 3QIBC 2F53E 4DUXA 3MCLL 3PGCA 3E6FB 5KJRL 4NCDA 4XBGA 1KCKA 2WUCH 1PBYA 2X4QA 1CDJA 3O9WB 1HCVA 3JWDL 2Q7YA 3ALPA 3SDAC 4N90E 4RDQF 4UBDC 4HZLA 4XTRD 1CZ8H 4EKXA 3G9AB 1NLDL 3ARQA 2QSQA 5DYOB 3O3UN 1MCKA 3KPSB 4N5UA 2QSTA 4LLUA 3GK8H 3FCTB 2PTTB 4UV4L 1KJMB 3B9VA 4TOYL 3CH8A 2ARWA 3J8F7 1OY3B 3AFLA 5CEZH 4LQFL 3LZFH 3O3EB 3TVMB 2NZIA 4U1IA 3L5HA 1I8IB 4M6ML 4PB0H 3C8KB 2RHEA 2YC1A 5IBTL 2P43B 1T20A 1I8LA 4XNZB 4YHPB 2DI9A 1XGTB 3B6SB 4RRPG 2EXWD 4CVXA 1MNUL 4BSWA 2F54A 4KY1L 3DRQA 4RAUB 3UC0H 5K9KB 1OF2B 3NIDF 3BGMB 4MJ2A 5EIVA 5I66B 2V2TB 5E6IC 3D3VE 3ISWA 5I1KH 3DOSA 1G84A 3UROR 4N9GB 4PRPA 5ESAB 1ZLUH 4BZ1H 4Z7OE 1UYWH 2YPLB 5C07D 3KAAA 5J6HA 3T2QA 4DQOL 4R2GD 3RL1B 4MAUL 4QCIA 5LAXB 3K8KA 4LIQE 4HK3N 4P5TD 3N9GH 2BFVL 1K4DB 4UT7L 2JLLA 4Z7UE 2APTA 3MCG1 2MCG1 3L1OL 3X11B 2EZ0C 2FX9H 3BW9A 4HWBH 3GGWA 4OD2A 2VC2H 3QUML 5K9JL 2BSTA 1KPRA 1BHGA 3MFFA 4PJ5E 5DXWA 4CN6A 3EGSA 4NDMA 4QRQB 4RGOL 2B2XL 1R5VA 3V4PH 3DX8A 3JSSA 4OJFL 4WU7A 1PX4A 2V9QA 1MHEB 1N0LA 3R4DA 4XPBH 5F7MC 2BMKA 3BFOA 1W72A 1AIFB 5LBSH 3O2VH 2PYFA 3KWWA 3GMNB 5L7XL 4Z77B 3PNWA 5I71C 3O6LH 5A3IC 3N85H 5C08E 1MJJB 2DBLH 4JDVB 4J2XA 3VI4E 2X7LA 1MFDL 2J6EA 3K81A 4JJ5B 3DI3B 5IFJB 1EO8L 1EMTH 4GRWF 5GRXG 1XF4B 4NT6A 4E42A 1ZWIA 4O51B 3FOMA 4PUBH 2JELH 2FHCA 3K2MC 2HLAB 1UJ3B 3VXUB 3IB4A 2AKRB 1XGYL 2AS5M 4G8IA 4JFEE 3HKFA 3L3DA 4IOIB 2ED9A 1L7TH 4HUKB 4PY7B 4F8TA 3P0VL 3D69A 5JDSA 4HD9A 1U8NA 4OT1L 4MNQD 1RJZB 4LPXA 2FJGA 5ID1B 4HC1L 3CFKA 2NYYC 1AR1C 1R5WB 2Z31C 2P48B 5HVHB 1AO7A 5L2JA 1A3RH 3UXFA 3V5DB 4MNQA 2E9BA 2VUYA 5MENB 3KGRA 3ULVD 4RFEB 5FOJA 5F1IA 3BE1H 2EIZA 1A9BA 1I4FB 4KJYB 4APQA 5I1JH 2IAMB 3H3BC 3NZ8A 3TBWB 1TJGL 1KXQE 2NTFB 5DRXB 2OZ4A 4M7KH 5EU3B 5FHBL 1OCWH 3VXRE 4RZCB 5I1IL 3I50H 5C3TA 4BSVA 3BAEL 4A6YH 2ZKHL 4JRXE 2XA8H 3SPVB 3SGEH 4ZFOB 2AVGA 1CF8H 5JMRA 1BQLH 4GKSB 3BKMH 3ARPA 3TBYB 4QHMA 1A6VL 3SGDH 1B0GA 2KUTA 3BKJL 4Y8DC 4G42A 3MNVA 3FB8B 2B7DT 2CSPA 3IJHA 3BD5A 5DFVC 4KTEL 3G5YB 2DQIL 4OZFH 4XH2B 4QHUA 5L0QB 1HNFA 4F37K 4LARH 4UOW1 4NN7C 4OKDA 4JHBA 4XWGL 5DJDB 5GS1C 1ZA6B 2ITDA 2OK0L 3ARFB 1FL5A 5CAYB 4XZUB 3GMPA 1RULL 2BRRL 2N4IA 4DTGH 3RDTB 4RGND 3MBEC 2IG2L 3MJ9L 4PLNC 3LKRB 1OAZH 1CDIA 2YD5A 4HKZB 1S7SA 4LP5A 3HE6B 4X9GA 4IMLB 1JRHL 1YN6B 4LU5H 4PJ8D 1UWEH 5EOTB 5GGTA 2AJSL 3QO0A 4XC1H 5BZDB 3DJ9A 1YEKL 1J1OL 4PGBB 1RD6A 1X5ZA 3DV6A 5C0ND 5ALBH 5I8KH 1HHGA 4NO0D 1HH9B 3WUWG 3RHWF 4PJ8A 3HNSL 1I1CA 3FO1B 1G6RB 3QXAB 4UV7H 3VFUA 2F54E 12E8L 4LOUD 4NO0A 4DKDC 3I3EA 5IK3A 3STZA 1KB9J 1NGXB 3MUHL 4NN6B 3L6FA 1MVFA 1UWXH 1WJ3A 4PRPE 4XPFH 1FFPA 1CLZH 1XH3A 4M6OH 1ZVHA 1DBBH 4L9LC 4H5SB 4JFZH 4YDJB 3DX6A 3GI8H 1JZ3A 4R3SA 1H5BB 3OKMB 5BRZD 5I17A 5HI4D 2D7TH 3TZVA 4JG1L 3QXTA 3TBVB 1TJHH 3OHXB 2HJLB 5BRZA 4F7MB 5AUMA 3QULA 5IUSA 2NLJA 1F6AB 2VAAA 3CFDA 3GIVA 3TLRA 1MWAL 1TZHB 3GI9H 5I1DB 1QKZH 5D1QB 2O93L 4PGCB 5I76B 4PRBA 5DVNA 5E2WL 1EEYB 1A4JA 1G0YR 4HXBL 2FH6A 1JHTB 4QTHB 1NAMH 1LE5B 1Q0XL 1I8KB 5FHAL 4FQJH 5KN5A 5JR1L 3AMKA 3HA0A 3PIQB 2V2XA 3SDCC 4D8PA 3MPCA 2UZIH 1FSKC 4Z0XB 4X99A 2QADD 1SYVA 2JB6B 3EW3B 3IDIB 3QQ9D 2HG5B 2HT4D 4MA7L 5GRWA 2QV2A 4ZAKB 5T1KD 3IF1B 1VFMA 4IOSD 3CXDH 3RVXD 3WS6C 2VXTL 3UTOA 3QWRA 5DS8A 5CGYC 4FZ8H 4R8WH 5BXFB 5E2TH 2ERJB 1U91B 1CWVA 3VG0H 5IJKA 3FO2A 1KG0A 3L3JA 4H26A 4OZIB 1TETH 4IRZH 4OF6A 1HKLL 1UWGL 3MODL 4HV8A 2VXVH 4FQHB 3TBSA 1YC8A 2RAMA 4BQ8A 4JVWA 2OX5A 2E8YA 4X4MA 1VENA 4Y4FB 1JPFA 1MH5A 3T4YA 1AO7E 1HZHL 5CINH 4GG6A 4MNQE 1IQDA 2IBGA 1JYXA 3TN0B 4KROC 4PY8J 1G9NH 5IIEA 3ULVE 3KYOB 2XYCA 1XIWD 5IROA 1QYGH 4TYUA 2BSSB 3IJSB 4H1LH 4R96A 2C1OB 4YXHH 4YXLH 3E0GA 1S9XA 4JQIH 2X44D 1XIWA 4N0UB 5K9QG 3KXFD 1F58L 3MLYL 5CJQL 3MMEB 3IXAA 5D1ZC 3ZT7A 1MEXL 5D96C 1C7SA 4G80B 3KXFA 4OCRL 1RHFA 2ADJA 5D7IF 5HPMA 1JGLH 5GSRA 2WBJB 1PKOA 3QRGH 4M61B 3TH4T 4MLIA 1FGNH 4DUWA 5E94B 4NQSB 3AY4C 4Z76B 1YMMB 5GS0D 4ELKB 5E8EB 5J89A 4X4ZA 3QPXH 3L3IB 4PBVC 1U8IA 4JO1L 1AY1L 4PGJA 1U8HA 1SJHB 3RGHA 3A6CL 5FGBC 4LCYB 4NKQB 2VZTA 5HGAB 4C59B 4Y88A 2WIIB 3OXSB 4ZUUA 1ZHLA 1A7NL 4WWKD 4C83B 3PJSA 1NGQL 3U36A 5ISZD 2B1HH 3NACH 4TVPE 4POZC 1GGIH 4RGNE 3D85D 4WWKA 5IHZB 4JRYB 3MRQB 5EOCJ 5A2FA 1P1ZA 4AG4H 1A7RL 2UZYB 3O6FC 5IVXB 1G7MB 1UM5H 1KCRH 3HN3A 3D0LA 3PWJA 3WSQL 4ZFGH 1AI1L 4PBWD 3CX5K 2ZUWA 4TTDD 3BD4A 1RZJH 4QRRB 1NJ9A 4F7EB 1E4XI 2ZNXA 4ZSOB 4L3CA 4XNXH 5K9OA 4MSWA 4Y2OA 3SBWA 4LSQH 4F9PC 2H2SD 3FFDA 3D87B 4DUVA 2VERN 3G6DL 3R06B 5I73C 4EQ2A 1OSZA 1RUML 5J1SC 5D72L 3VFPA 2AEIT 3NABL 5HGHA 2FJHA 3P9MB 3UJTH 4GRMB 2R2CA 2HWZL 4PRHD 2VIRB 4ODXA 2ZPKL 2NY0B 4GKZB 4TSAL 5FB8B 5HI5D 1CE1H 1NAKH 4WEBL 1CFTB 4PRHA 4WI9A 1ETZB 2ARJB 3OPZH 4WTXA 5BRZE 4KMTH 5IV2B 2AEPH 1YYML 1IC4H 4ODWA 5DFTA 4UNTA 3MRBB 3I6GA 3VXMB 5FA4A 5C0IB 4BK5A 1GYAA 1HOCA 4OAWB 4K3EH 5IHUH 2CIKA 3I84A 5E1HB 4M93C 1WWWX 2OMNA 4Y16D 3PL6B 2APXA 1RFDL 5HY9A 2MKLC 3RVUC 4Z78B 3NFPB 4HWEL 1HQ4B 3BZFB 3WLWC 1DBML 1T83C 4Y16A 1ITBB 2HVKB 1ORSA 1U95A 4L29A 4CJ0A 2ICWI 3KYKH 3MV8D 1PEZA 2ATPB 4PJIB 1DLHA 5FEBA 1JPTL 3WHE0 3UTQB 5IR1B 1B0WA 3L9RB 2AABH 1S7UA 5ACZA 4JRWA 1CDUA 2VDOH 1EIBA 3C6LC 2P24A 2YBRB 2R0ZH 3SQOL 2R23A 3U1SL 2ZSVB 1QSEB 3SGKA 3MLVH 4OFYD 1AQDA 4U31A 1R6VA 1XGQB 2YSSA 4G7VH 1OTTC 1EFXB 4EZMA 2YPVH 2ORBH 3HZYB 4OF0A 3A6BL 4OFYA 5A2IH 5ADOH 1NCNA 4FFYL 2GITB 4KVCL 3T0EC 2Q7NA 1TZIA 3V8CA 4O5LL 3I9GH 3GMRB 2ADFL 4FXKA 2FEDC 4X4ME 4HJJL 3QA3B 4QRSA 2NY1C 1EAPB 1CXEA 3MRMA 1YEFL 1CFQA 3CSGA 2ZCKL 1PZ5B 2JJSC 1UEMA 4GG6E 5TQ0H 2CKBA 3ARDB 5ITFA 5DMGD 1LNUA 2OJZH 1FC2D 5CZVL 3QDGB 4I77H 1EHNA 3VFNA 2Z8VC 3BH9B 5GGQH 4FMFA 1VSCA 4TNWK 4YXKH 1T0PB 1ADQL 4ZD3H 5BVPL 2VDML 2QHLA 2UYLA 3ZE2F 3AREA 3X14A 1RZ7H 3LAFA 5IJVA 3RWFB 1GHFH 3GMLB 3S4SA 3P4OB 2VXSH 2P44B 4Y5XA 2AQ3A 3LSOA 1JI2A 4RMUA 5D5MF 3X3GL 1J12A 5E6YA 4PJ9B 3TM6A 1URLA 1BZ9B 1IC7L 3REWB 4DVBB 5C0CB 3KXFE 4OLYH 4HUWB 3JZ7A 4JPWH 2R2HA 5DD6B 1FL3B 1M7IA 1NDMB 1NL0H 5T5FH 3MLSL 3OJDB 4KJPD 4YZFF 5EULV 1TTGA 1BFVH 1QQDA 1NCAL 3ELAT 3U6RA 1YNTB 4I18B 1FP5A 3CFIC 5FKAB 5AAWA 5EBLA 5HDLA 3M1BB 2HAZA 1A6WL 1F2QA 1JP5A 5M94B 3O11A 3BP6B 3EOAA 1IGFH 2IMMA 1VGKA 3ALWA 3B2VL 1WSST 1TNMA 2OJEA 2DTML 4JPKH 2VLLB 1WCQA 4BFBD 2BVOB 4YQXH 5IB3A 3TO4C 1VEMA 4KKBC 2V9TA 3FQNB 2X4TB 1ULVA 1JPGA 3CD4A 3DTXB 3S35L 1NEZA 1TPXB 1YEIL 4YNYA 1KCUL 3VXSD 5KSBF 1VFAA 4LSPH 5E2UH 3SO5A 2IAND 3LB6C 3HNTL 4FNLH 3QNXA 3VXSA 1SBBA 5EU7C 2JB5H 2NW3B 5FYJL 2G9HA 3INUH 2CR6A 1FNFA 1MCWW 5CSZB 1N2RB 1G9NC 1NFDF 2OR8A 1VCAA 1S8DB 3U0WL 2WWKO 5MP6L 2JCCF 1K6QH 4AT6A 1T1ZA 4ZTOL 4LAJH 4NJAH 1EERB 1CU4L 1NC2D 1INQA 3D18A 3VRLE 1MF2L 1SHMA 4KTDH 4XBPA 1PG7L 1X5FA 3HPLA 2WINB 5E8DH 3V4UH 3U0PB 1TZGH 1QSZA 3HE7A 3UTSB 1T2QL 4NUGL 4PRHE 5EOCL 5BQ7A 4OZGE 1HE7A 4Y19D 4P23B 3BZEA 3V6FA 2JTDA 1JHLL 4WUUB 3PWUA 4ZFZB 3EO9L 4K7PH 4KRPB 2XN9D 4I9WD 4JO3H 4WJ5B 2R4RL 5EC1A 4Y19A 5B39G 1BX2B 3DV4B 4GMSL 5L6YL 3BH8A 1ES0B 1PKQB 3NCMA 1L9MA 1S3KL 1E6JL 1IAKA 2XN9A 2NR6D 3V6ZA 2NTSP 5GGRA 5GISH 3VDAA 1OLLA 4KPHL 3BX7C 5KVMC 1CE6A 2VDLL 3MC0A 4LCCB 4W6WB 4KMQA 4UQ2B 2VAJA 4Y1AB 1DBJH 3ZKMD 1FIEA 2DM7A 3F58H 1FBIL 2E3VA 4C56B 5FKPA 2P7TA 3MXVL 4L8CA 5C09B 3BRDA 1H3TA 4IEFB 1JZ8A 4XPGH 5DEGA 4MZ2A 4EVNA 1I7UA 2AJUH 3NPSC 4N8VB 4OZHF 1KIQA 3G04A 1KB5L 3WUWB 4KHTL 4BQ9A 1EEUA 3HC4L 4G6JH 1CD1B 2OQJB 5H37H 1T7WA 3CFCL 2DI7A 3CFJB 4NRXB 3TCLA 3BT2H 4HKXB 1RZJC 4LIQH 1QFOA 2PCPB 3L5WA 4JFFE 1JWMB 5KVGH 3GJEB 1ZSDA 1WBZB 3K1DA 4FS0A 5HYSA 5C9JA 5F1NA 43C9A 1PD6A 4KK6D 3MOAH 1D5IH 4XP6H 2VR5A 5C0BD 1N5AA 3WE6A 1JJUA 1UYWL 2QSCL 4J3TA 2EO9A 1J0JA 3BDYH 1CG9A 3RIAK 2LE9A 3MA7A 1EH9A 3V9FA 4I0PD 5DUBA 2A74A 1P4BL 2AEQL 3HZMA 1MI5D 4HIXH 1DBKL 3HLAA 5EO0B 4KV5F 1I3GL 2BXZA 3DURB 3FMGL 1CD9B 3R1GH 4TQEH 3FQRB 1FYTD 4Y2DB 1NMBL 2EDBA 2X09A 2CLZA 2Q76A 3B5TA 4CL7A 3PHOB 1NGYB 1MQKL 2V6HA 1FZMA 3UDWC 2P4AB 1MREH 1MFNA 3D0VA 3ILQD 5D1XD 2CLVA 4L8BB 4YEEA 5FECA 5I8EB 5TFSL 5I0ZA 5C0FA 1KTKE 4ZYKA 2FYYA 4MD4A 4X6BB 2AI0L 5TDPA 5FAAA 4O2CB 3MUGA 2JJTA 2AEWA 4JFXB 1G0DA 3EYOB 3L3HB 4G6FD 4JGMA 3HB3D 5KVDH 3GSNB 1LQSR 2A6DB 4PFEA 2OCFD 1FH5L 1XT5A 4OCXL 2X42A 1AJ7L 1K8DA 4FZEH 4J4PC 4NWTL 4S10A 1O7SA 2FATL 3FAXA 5IWLA 2RQ8A 1DQDH 4UZGA 4U1JB 1QPXA 3ARBB 2VITA 1IGTA 5CJXC 4HGWA 4ZUSA 3RGVC 3UTTA 4XPAL 5HVGB 5TF0A 1QOKA 1WEJH 3F8UB 3E6HA 4YC2B 2I9TA 3EHBD 1X5XA 3PP3H 4WO4C 1RUAH 2Y5TA 3ZKQD 2YA1A 1UACH 1U8JA 4G6AC 1G9ML 5C6WH 3OAZH 4NUJA 5CCKH 5FYKU 4IS6B 4UB0H 4BFGA 4UAOC 4UDTA 4Z5RA 3OKOB 2J8UB 1K8IB 1ZT1A 2FX8L 1WZLA 3DGCR 5BVJB 4WFFD 1LO2H 1DQJA 1UWXK 1HSAB 2GK0B 5CD3A 5DURD 3LH2L 5DJ2B 4OZ4A 4OQTA 4TULL 4XWOC 3S98A 4ZG1A 5C8JA 3MO1B 4D9LL 4U6TA 3S3SA 3K0WA 2FRGP 5HVHC 1DN0A 3EJJX 4XHJD 3DMMC 1EHLH 3WXVL 3B9EA 4XPTH 2XA8L 1NCDH 2APVA 1JBJA 4ALAH 4JN2A 2FLRT 1C16A 4M7LL 2VR4A 4Y19E 5JHLL 2H45A 3BMVA 2NCMA 5HDBF 2DL9A 2R1YB 5HJ3B 2XN9E 3KYMA 4I9WE 2R0LH 5JORB 1RAMA 3H9HB 1XGPA 5E4EC 4BH7B 1T4KB 1A7OL 3G6JF 3VWKB 1H3PH 4JFQA 3QUXB 3Q6FB 1J0YA 3ZDXE 1GVIA 4OZGB 1Z9LA 3AB0B 3TV3H 1KPVB 3UYOD 2F5AH 3PWLB 2AV1B 2Y72A 4FP8L 2HMID 2N7BA 1HCFX 1Q8MA 3EO1B 4ONFL 4L8DA 4N0YL 4LAQL 5IBLC 5EZLB 5DJ8A 3C60C 4JM2C 2K3TA 3QJHB 4GS7C 1YEEH 3BQUD 2WANA 1NCWL 1HINH 4MD5B 2BNQB 4NZTL 2B20A 4P49A 2X4OA 3BQUA 5I6XB 1SBSL 4S1SL 1FVCA 1NDGB 4PJEE 1R0AL 2Q8BL 2KZWA 5HHVL 3BPOB 3TYFA 4LNRA 3T3ME 1AXSB 1G7HB 4MGXA 1WZ1H 3UP1A 2H8PB 1UADC 2QSVA 3I6LD 4OM0H 3WFEH 5FO7A 4QHKJ 1T7YA 4P2CG 3LV3A 3SDYH 1I3RB 1JWUB 1WC7B 4MDIB 1EGJA 4NM8L 1MLBB 2NY3B 4WHYH 1IGCL 1W72H 4YHNA 4JFFB 4F58L 3HFML 5C0JB 5KS9B 3VXPA 3U9PL 2QQLL 2D7TL 3RPIB 5IB5A 2LU4A 3P9LB 1JZ6A 3HC3H 1AHWA 1MIEL 1IC5H 5F6IC 4V1DD 1CICC 4R4BA 1EBAA 3D39B 4NFDA 1FO0B 4YDIL 4V1DA 2J6EH 1EFQA 3OKDA 2FNBA 3O2DL 4PLKC 5EUKB 2HFGH 5FYLL 2ICCA 5KANG 3U82B 1RUQH 5IQ7H 3L5JA 4OIIH 4JE4B 1W0VA 2C9AA 2KZ1B 3U2SB 2ENSA 1C5DB 2UWEF 4JGUA 1Y6MR 3M8OL 4ZUVA 1KPUA 1A9EA 1MCLA 1OPGL 3V5HA 5INDA 1NMAH 3DX9A 5B4MC 4S11A 4YPJA 5H8DA 3W11C 4YDVA 4K3HA 4DJMA 2AK1H 4XAWH 1CBVL 2ATKB 3KPPA 2FGWL 3MRPA 3JWOH 5TGBA 4HDIB 2V5MA 3T0XA 2FZ3A 3UYPA 1MCPH 3DVFA 1N6QH 1BEYL 1FVEB 5F93C 4OCMC 4NO3B 1L0YA 1P6AB 3QXUA 1OAUH 1HXYB 2DKSA 1K5NB 4O4YH 5GHWH 3S37L 3TWCL 1E4XH 1KLGA 1ZT7A 4YBLC 3U4AA 1U8MB 3ULVH 3C5ZC 5F7DA 3UTTE 2OZ4H 3K4AA 4PS4H 1YEJH 3CZFA 2P5WB 1MFBL 4EOWL 3B9AA 4ODSH 4HIJB 4NPYB 5DHVA 1LO5B 4JY4B 4LF3B 1QLRA 3BZ4A 1YUHA 3HTLX 1KN4L 4HKJB 5JPNB 1ZHBA 4DWHA 2DB8A 5H2BA 1IGML 2EKSB 4W70A 2Y7QB 4HPYH 3CH1A 5SWSD 4OTXL 2HFFB 2L7JA 3MRRB 5KG9B 2MOVA 2NXZC 2X4RB 2ZWLT 3CUPB 4WI2A 4N9OB 2F5BH 4K07A 3PHQA 5SWSA 1FE8L 4X6CF 4QHLA 1LK2A 4BSJA 4JREB 4P4KA 5EUOB 5IMLA 3B8YA 1CFSB 2HTLD 2FD6L 4I3SL 3DSFL 5DA4A 3DVGB 1TQBC 3FB7B 3VG9C 5F21B 4LSDA 2HJFB 5IEHB 4QXWA 3GHBL 4L4VA 1TVHB 5MI0C 4YWGH 2GYSA 1M7DA 5C0AD 1MOEA 3OR7B 2VISA 3ILPA 3SHSA 1JGEB 4WI5A 2XY2A 4FABL 4DVRH 5C7XH 5D6DC 1JV5A 5D7JB 5GGTH 5IF0B 3BMWA 5C0AA 3EOBA 3BUYB 5IMMB 1RURL 3GKWH 5DRWB 4M48L 1H3WM 3L7FA 5CHNB 4YFLF 3TNNA 4HFWB 5CJ5A 1GIGL 4JHWH 5C2BH 4TSBL 5JLZB 2D0FA 4PB9H 3RUGA 4D0DA 4DN4H 3T08A 3RWDA 1FIGH 1K4CB 2ICES 5T3ZL 4NZDA 5I1AB 1LD9B 5CIPA 2NY4C 5FM5O 4J23A 4PG2C 4KKCC 3VW3L 4OCWH 1Q9LB 3MNZB 3ZE1F 1D9KC 4K2UL 3P77A 1AE6H 1MVUA 3U0TA 2W65A 1S5HB 3NIDE 1QEWA 5DD0L 3RI5F 2VLKD 4EI5C 1ZANL 5TE7L 1Q72H 2JJWA 5H35A 4P9ML 2G60L 1ZS8B 4DGIL 5JUEL 4JN1H 2VLKA 3QUMA 1A02N 4I4WB 1FNAA 4Z7QF 2CDEA 4IRJA 5I9QB 4HEPG 1TCRB 4MZ3A 4LKCA 1ZLSH 2XTJB 1BWWA 3C9NB 4EUPH 4CU7A 3M17B 1GH7A 3IGAB 1Q9KA 2QHRH 5CBEA 2Z91B 3SE9L 2EE9A 2R69H 1FG9C 3HCVB 3I6LE 2ZUYA 1BVLB 4S2SB 4XTRC 2H2PC 1FFOA 2IGFH 1MJ7H 1VFOA 4PJEB 2VDPH 3SE8H 5EZJA 5C9KA 4P5MA 4O2FA 4D3CL 1J9CT 1QBMH 4RA3A 5B39B 2AGJH 2NY6B 2BK8A 5D8JL 2BSRB 4ENED 1FAIH 1Q9WB 1Z5LB 3IVKB 5DSCB 3EOTH 1NKOA 2GUOA 4P5KB 4PJFF 3QQ3B 3VFVB 1D5XA 1I8LC 4V1DE 1YJDH 1FNGB 3FN0H 4CMMB 1WCBA 3QFDA 4FQQA 3B43A 3I02B 4OV5B 3CXHK 4M6NH 5BV7H 1FL6B 2BCKB 4RWYL 2GTZA 4XC3H 3IDXL 2C7UB 5FIEA 2EXWC 2XG4A 4GRWE 4YR6A 4P9HL 1FDLH 4HUVA 1T5XB 2ADIB 2AXGB 3OZ9L 4FQXD 4OD3H 4QRPA 5DEFB 4CMHC 3GSQA 1ZLWK 3QYCA 4XBEH 4HC1A 5C6PB 1YNKH 5EA0H 3KJ6H 3L3KB 3KLHD 3QCUH 1GCFA 2DDQH 4FFZH 3UYRH 1J10A 3QXWA 2GSGA 1VFUA 1RU9H 1BZ7A 4Q58C 1WWAX 3LQAH 4HSQA 3WFBH 3QFJB 1MCQA 1Z2KA 4P59H 4EIGB 1D3CA 5ACLA 2AV7A 3WDIA 4R2GC 5F96H 5CLWA 1JTPA 1QA9B 5DJYB 1WBYB 1E6OH 1T04A 1VFBA 4H8WL 2V7HB 1G7LB 1MHCB 4HKBB 4EDWL 4IIQA 1N26A 5FK9A 5CBAA 4JVPA 1FZOA 3UPRB 4GUPB 3VXQB 2VXUH 2XPGA 5EORL 2IFGA 2PXYA 5GRUH 1LEIA 5JDJA 3SJVB 4YDLC 3QJFB 3FQXA 5FOBA 3MRDA 4YAQA 2VDNH 1SJEB 3MREA 4JR9L 3UZEA 3BKYH 3QHFH 5KZCB 3N50A 5D7KD 5GJSH 5SWSE 3DARA 1Y0LB 2WAHA 4LPVA 4POYA 4WGWB 4X6DB 5CWSA 3U30C 2Y1VA 3U7YL 5D7IA 3VDBA 3KPMA 4LFHD 1NLBL 5GS0H 2H9GA 1U41A 2JJVA 4GOSA 1I7RB 1S7VB 2XACC 4FXGA 4WW2B 2H6PB 4ETQB 2ZUSA 5CS7A 1WQVT 4PG9B 5CJOH 4M5YH 3MJ9A 3AS1A 3GBLA 4G7YL 4L4VE 4DAGL 3T4AA 3SCMB 4JDTH 1V7ML 2APWA 1RIVH 3MJ8B 2JE8A 1CR9H 1YNLH 5L88H 3KPTA 4HIHA 5K59F 3IDYB 3RZCD 4W6YB 1LDPL 3LRSA 3C6SB 3QI9D 2EEDA 5EBMA 5C0AE 1XF2A 1ZT4A 1EAJA 1HI6A 3LQZA 3RAJL 1IGJB 3JWOC 3UBXG 5EC2B 3RZCA 2NZ9D 2ESVD 3QI9A 2VABA 1UC6A 1SYSA 3QG6A 3F6IA 4APQC 4N5EC 3KG5A 3D9AH 5KVEH 2ESVA 3WLBB 1A0QL 4G8GD 4YX2H 3ULVC 3EBAA 4JFPA 3MBXH 2A83A 4AEIH 4ZFOL 5IT2L 4O58H 4KAQH 4W4NA 4KK8D 5FGCE 2C3VA 5H94B 4TSCL 1U3HB 4JZOB 4NO5B 1KEGL 2HA1A 1OWWA 1UM4H 1U93B 3RTQD 3O0RH 5JQ6L 4HT1H 4XP1L 1IFHL 2GFBB 4ODHH 2BY0A 5DJZA 3BRGC 1MWAA 4KHXL 2GJJA 4CADA 4EDXA 4ORGA 1UZ8B 4M7JL 4LEOB 4TNVK 2DQTL 1Y18B 5FF6B 2E7BA 2K7QA 3B9KD 2WW8A 4FTVD 2EDDA 3O3BB 5GRYA 3FTGA 2NW2A 3IDUA 3HAEA 1ZHKA 4PJ7B 1P4LA 4FTVA 1T1XB 1N7MH 2EEAA 3VGAC 1U8QA 1QBLL 3UAJD 4DKFL 3FQUB 5IB1B 4X9IA 1QVOA 4KTDL 2WNGA 1CLCA 1UG9A 3DO7A 1P7KA 2UY7A 2C3XA 5DUML 2KKQA 2PYEB 3FQWB 2VDKH 4QXUH 3T2NH 1DBAH 2AXFA 4RGNC 1ZVSA 1G6RL 1KYOJ 1YQVH 4G6KH 3OB0K 3BGAA 2CMRL 5CKGA 4OBSA 2AK4A 5EFIA 3QXDB 2Y07L 5TE4L 3NFNA 2DQEH 4PJ8C 4QY8A 2FWOB 3VFGH 4HPOH 5C0NC 3H3PH 3QUZD 1R5IB 2A73A 1BAFL 4N0RA 4ESKA 1BJ1J 4X80L 4BK4A 4LOUC 2AJVH 3QUZA 4QRPE 4Z95H 3UZQA 2XQBL 4M62L 4UIKL 1RHHA 4M4RA 1RK0B 3IAPA 2GJ6B 2WWKT 2QKIA 1BM3H 4QYOA 1FORH 5MEPB 3CSYA 3TZVC 2YD9A 3O3DA 2YPKA 2CKBH 3L7EA 1TENA 4X5WA 5HDQH 5HI4C 2W9DL 2IF7A 2IPKA 2R0KH 4YHZL 5F9JB 3WHXA 2FGZA 1XF3A 3QEQE 4F7PB 2W9LA 4EIZC 3PP3K 4UINL 5F9WB 4IRSD 3MV9A 3UEZA 1H15A 4RISH 2F8XC 3OQ3B 2B1AL 1UKQA 3MRJA 2NXYB 4N8CL 1LEKA 3HRPA 4KJQD 3QIBD 4MJ6A 4IRSA 4XCCL 2GKIA 1MIMH 4GXUM 2X41A 3FO9A 4Y5VA 3QIBA 5IVZA 4MXWL 1AFVH 1YEDB 1UKTA 3WXWH 4JGJA 4GH7B 5D5MA 2QADC 1UQSA 3FB6B 1F4YH 4K7FB 2A9MH 4P3DB 3QQ9C 1CL7I 2HT4C 5D7KE 5LWYH 3TO2A 1YJDC 4ZNEA 5D7IE 4PV8A 5GGUA 5CUSH 3LOWA 4MMXC 5AZEL 5ADPH 2W59A 5BV7C 3RVXC 3CLEL 5I1GL 4JY5H 5I18L 5IJKC 2OM5A 4UTAL 3LPGA 3RL2B 1CQKA 3IDGA 3VCLB 5M95B 1BLNA 3LEVH 3F7VB 1DSFH 3NH7H 4GBXB 2A1WH 1BQHA 5E8PB 1RZFH 3HI6H 4JPVL 3GUTB 4UOW0 1S9VB 3REVB 4LLVB 2J8OA 2ZUVA 1IGYB 3JV4A 5JXAH 5DT1H 3WFHA 1UENA 3K4DA 2DQUH 3QG7L 3LQAC 1AGFB 3ZLQC 4F15C 4M4PA 1F13A 1LWRA 2BNRD 2CGRL 3D48R 1HIMH 2HH0H 3ZKXB 3BP4A 5DZOA 5KSBA 3TNMA 1UB5A 4HLJA 3MJ7B 4OGZA 3GM8A 3OKNA 1VHPA 2ESVE 5JQHC 1IKNA 2BNRA 5HGBA 3WFCL 2FSEA 5IROC 4OFIA 1GGBL 4OLWH 1XCTA 1LO4H 2DWDA 4JFYB 3AS3A 3N1PC 2BOCB 1NFDA 5T1MA 4BFIB 4LCWE 1J1XL 1XIWC 5C07B 2JCCA 2DQCL 3ZTJG 4YBHA 3FO0L 1HHIA 1TFHA 4NO2A 5C2UB 1IAMA 3OKKB 1TITA 4P5TB 5EU6B 3TYGL 4OD2B 1MY5A 1T6VN 1FCCA 3KYAA 3N1MC 1KBGL 4WUKL 5F9OH 4ZXBC 5B3NA 3CZJA 4HEME 4IDLA 4Q9BA 2EIEA 4L8SA 1MHPH 5I16B 1FC1A 4YPGB 4JANB 1R3JA 2PW2B 5TH2B 1IM3B 5GS0C 2DQJL 3S4SG 4JHZA 2IQ9H 3ULSB 4PREB 3HS0B 5ETUB 3AGVA 4LLYA 4U1GC 1AD9A 1MAKA 2VH5H 4WWID 5FGSA 1JRHI 5HHQA 4P2QA 2QQNL 4ZO6A 4TPRH 4WWKC 1VACB 2XZCH 2CJUL 4GW1B 1F8TL 2JF1A 2AK4E 2IQAB 3JXAA 3DRTB 5J13C 3DUUA 5L2KB 2NY5H 2GIYA 3W9DA 3WYRA 4HK3J 1H3VA 2NPLX 3BXNA 2P8LB 3BP5A 5GJTL 3RFZC 4OZHA 2NX5A 4NOFA 3SBWC 7FABH 4MX7B 5T1LB 4XNMA 3MCKB 1IKFH 4K7PY 3ARXA 2QR0B 3TV3L 4JZNB 4LPWA 1MHHA 3V8OA 3QO1B 3BKCH 5L2JB 1OB1B 4DFIA 4GQPH 1DANU 1AR1D 2A6KB 5IW3A 4OLVH 3B5GA 2HVJA 4OUUB 3U4BL 5HI5C 2W0FB 4OIAA 1LDSA 5F7KC 2DLFL 4PR5A 3RU8L 4OFKA 1ADQA 4TRPL 3QEHA 3KHQA 4NZRL 2YK1H 5CGTA 3C5JB 2Z35B 3TA3B 2DMBA 2VQTA 3MV9E 1UXWB 4P2OB 4RFNB 1PSKH 1OAYH 2XWTA 5KW9H 3F62A 1DDHB 4GRLB 4OZIF 4Y16C 4BZ2L 1GGTA 5DRZA 3ZE2E 3QBTB 2XTLA 4NKDB 3KNBB 3ROOB 4J7RA 5IEKB 1NEUA 1UCBL 3BPOC 4LBEA 3UTZA 1CGSL 5D5ME 3K7UA 1D5BB 3NVQA 3WNLA 2Y36H 1JF1B 5F7HA 1KJ2B 1EEZA 1H0DA 1KT2B 3QWOA 4XX1E 4RMVA 3AUVA 4RIRB 3MJGX 2EH8L 1FL5B 3SGKC 4I13B 4YZFE 4XVSH 5IW1B 1L0XA 4RNRB 1R24B 5KSVA 4P46A 5TE6H 4JO2L 4WFGD 4MJIB 5T33L 4WI3A 1XR8B 5MEQA 3MBED 2HJKB 3JVGC 2XFXA 2H1PL 2NY2D 4O02H 3HMWH 2ZG3A 2IMNA 4S1QL 5DQ9A 5LGJB 1MFCL 3TF7C 5KAQF 3VE0A 4Z7VB 4JCMA 5BZWA 3CVIH 4UIMA 5GGSA 4WFHE 4HULB 5E7BA 5DJXA 3WN5B 5MERB 4JO4H 4IJ3C 3ARGB 3NPZB 4K3JL 4I5BA 5KSBE 4BKLA 4LGRB 4G8FA 1PJ9A 3JV5A 1F11B 3FRUB 5E2JA 4YHIA 1S7RA 2P8PA 1DJSA 3LHPL 3GSWB 5HYSG 1JGUH 1NFDE 1KELH 1SJXA 1ZMYA 3KS0H 4R90H 5IOPA 1NUGA 2RB8A 1ONQB 3AREC 4I48B 4OQTH 1S7WB 3OSKA 2JCCE 4XNYL 1KEML 3H9YA 4LNVA 2RCSL 2G75A 4Y5XC 3CFDB 3MRLB 4JM4H 4U1LA 5E03A 1V05A 4I2XB 5E9DD 3QUYD 4V2CB 2CO7B 5BS0B 3IJYB 4DKEL 1VESA 5JOPD 1LP9B 5E9DA 5CMAA 3QUYA 1CT8A 5J9PA 4JQXA 1TMCB 4MXQC 4YHYC 5IVXF 5EB9A 1T1WA 4GXVH 4MLSA 4RFOL 4XNQA 4J3VA 4QXGL 3OAYK 2Y06H 3FZUD 4DZ8A 1JPST 3CDGB 4DN3L 3NIFF 3W2DH 4HXAH 5D7LD 3ECBB 3N06B 3G6JA 4U05A 4KRLB 4P2QE 1NGZB 5D7LA 1KB5A 3MRNB 1TTFA 5T1KB 3UBXB 5DF0A 2YZ1A 5C1MB 1Q9OA 5CGYD 4TVPL 3O2WL 2PN5A 2QEJA 2DD8H 3DBXA 1FGVL 1IGIH 3EFFB 3OGOE 4WY7L 4X5XB 4OZHE 2NX5E 3OKYA 5DRNB 3PE9A 1DVFB 5JO5A 4MNHA 3VXTB 2YKLH 1HHJA 4GSDL 1QR4A 3KPQB 4UU9B 3CCHB 1F02I 3H7BB 2F19H 2L4OA 3HNVH 3AMLA 5AYUH 2X9YA 3UJIL 4PJAA 3O8XD 1GPOH 1HSBB 3MGAA 4PGDB 1RI8A 1MPAL 2OSLA 1GC1L 3HE7C 1RJLA 3O8XA 5D9SA 2KL6A 1EGJH 2PW1B 1ORQA 2XWBB 3RWCA 2VLRD 1XR9B 1A6ZA 4KROD 4X6FA 2JIXD 2FL5B 4XI5D 4G43A 4PJIF 2WV3A 2B5IB 5DK0A 1BFSA 2VLRA 32C2B 2EDHA 3FOLA 4LLMA 2VE6A 3NAAL 3DIFA 5TQ2L 2GTWB 2P5ED 4YGVA 4KV5E 4UNVA 3HUJB 2NR6C 1N64L 2D31B 1OP5H 3EYSL 1A47A 5D1ZD 1EA9C 1YY8B 4F2MA 1O5DT 4Y5YB 2P5EA 3EAKA 5CEXB 3CU1A 3KPOA 3MYJB 4GRWH 5HGDA 3ZKMC 2OP4H 5MHSD 5IFHL 3AAZB 3HC0B 2VDQH 4UILL 1IAOA 4KI5F 4OLEA 2COQA 3UCRA 1F3DH 3T0WA 3VFTB 2AGJL 5JIPA 3BOVA 1NCCL 2VL5B 1IT9H 2OL3B 2UWEA 2NY5C 2JJUA 3QDJD 1JPSH 2XXMB 3GSUB 5DJ6B 5GGVL 2HRLA 3PQYB 5B38A 2ZOKB 2EDTA 4XMLH 1A8JH 3QDJA 4TNWF 5ICZA 4MA8L 3IDMA 2E6PA 3C09B 3FB5A 3IXTA 3MLTA 1EZVY 3TT3L 3C5SB 5MEOA 1SMAA 4L4JA 1KF9B 1P1ZB 5E8OA 4WFGE 5ISZB 1DQLH 1FZKA 3U9UA 4WU5B 3D85B 1HILA 5FV2A 4M43H 4XGZA 2DWEA 4NQEA 1I8MB 1EJOL 5DHVH 2QQKL 4PRAA 5FYJE 1XAUA 3QSKB 3MOBL 4U7MA 5LQBL 3MCLH 5KJRH 3T0DA 1RZIA 2FJFA 1ND0B 4ONHB 4P2RB 4NYLA 2Z9TA 3VWJD 3HPJB 1SEQL 1FRGL 5HHXL 5SX5K 3E2HC 3JWDH 3I3BA 4D0CB 1CDBA 5DJCB 4F9PA 5K33A 3VWJA 5M7QA 1NLDH 4R97B 3B5HA 3BZDA 4BH8B 2A9NL 4NNPL 2LQRA 4XB8A 4FA8A 2R0WL 3G5VB 3WD5L 2R1XA 4P57A 3OXRA 2Z92A 4X6CA 3F7YA 4UV4H 2F58L 3JV6A 4TOYH 2Z4QA 1OGTA 4NNXA 3GSNL 1KIRA 2EE6A 1KJVB 4PRDB 4X6EB 3ILQC 2EIBA 4WDIB 4LQFH 3V0VA 3BPLB 2JJTC 5D71L 4M6MH 4OKVA 2XKNB 2Z93B 4QNPF 5E9DE 5IBTH 4HHAB 1M1SA 3RIFF 1KC5L 3GO1L 1ERNA 4S1RL 2R1WA 1LHZA 5DMIL 2I24N 3ZYZA 3HB3C 2FB4L 4HIIB 3W82A 1MNUH 3CPLA 3O41A 4KY1H 3MRCA 3RA7L 4NHUB 5HDBE 4ERSL 3LY6A 4U6YB 1UB6A 5IWLC 1S7TB 3MOQA 4U1NB 3MV8B 1KNOB 1N59A 1JIBA 3G6JE 3KR3L 1TVBB 3VDCA 5D7LE 5CIPH 4J8RB 1BOYA 4KRMB 4U1SB 4ODTL 3LKOB 5A16A 4XCEB 1IBGL 1IEBA 1P6FA 4DQOH 4JFDB 4KK5D 1AQDB 2X40A 1T0NB 4MAUH 1B4JL 2BFVH 4UT7H 3STLB 3WL9B 3BO8A 4KZEL 3L1OH 1S9YB 4R7NA 5DDHA 4NWUL 2D7MA 5KBNC 4V2BA 4FN0A 3IFOA 3M07A 1HKFA 4Q7DA 1EEQA 3QUMH 2Q8AL 5K9JH 1OAXL 5D2NB 1NFIB 5BCAA 5ERWA 4RGOH 2B2XH 5B3JF 1VERA 2J7LA 1BBDL 1AGCA 3VD5A 1U3ZA 2RFXB 2NY1D 4U49A 4OJFH 1U92A 4OCNC 1GAFL 4ZODA 4LLAA 1LNUB 3DROA 1OGAB 1S7XA 4GO6B 4Y4HB 2VKWA 2J4WL 1B90A 3LEYL 4U6XB 5TDNB 2JJSA 4OCYL 5L7XH 3P3YA 3QEUA 4CW1A 2DLIA 3FT3B 3OR6B 3RZWA 3LRGA 2VLRE 5JHDD 2AJZA 1BECA 2W0PA 2IPUG 1MFDH 4F57L 4H88L 2PKDA 1EO8H 5DA0B 3VRJB 4JPIA 3O2DA 5JHDA 5EPMA 1YDPB 4HJ0D 2LU7A 3TPUA 1X5JA 2CIIA 2H32B 1G7PB 2BZDA 2DQGL 1XGYH 4PJFA 3K8LA 4HX1B 5GZND 3WJLA 2P5EE 1KCVL 3HZVB 1JNLL 3P0VH 1I1FB 2AXHA 4OT1H 5JW4M 4LASL 3F12A 4HC1H 3GFUA 4K23L 4XP5L 4NQUA 4R4NC 1JNHA 4ZTPL 3KPRD 3IETA 5MHSE 2UWEE 4Q2ZA 3CXHJ 5B8CA 1CLYL 1ZLVH 3O3AA 4MNGA 1LEGA 3FFCD 5E7FA 3VFSA 3LKPB 5T3XL 4UDUB 3BQUC 2V17L 3HR5B 4BM7A 3FFCA 2DJSA 1TJGH 3LKQB 4FFVD 3U7WL 1YN7A 3V0WL 4RGMC 5DJAA 5FHBH 1QTYT 3QZWA 3NTCL 4HMCA 5I1IH 3BAEH 4I0CC 1F3JB 3LN5B 4ELMB 4WVRA 2ZKHH 2J3SA 4G6ML 3BVNA 4NQEE 4ZDHA 1IM9D 2BOBA 2IANB 3QHTC 4H20L 2BVPB 3U83A 3S5LG 1AGEB 5DFWH 2O61A 1BD2D 1SEBB 4S0TD 3B3IA 1WBXB 5ESQA 1A6VH 4BUHA 1VADB 1IM9A 1E28B 4LLQB 2H3NB 3CMOL 4Q6IB 3V5KA 3BKJH 5FO9A 5IVNA 1AHWC 1CYGA 1FO0L 5AD0B 5DTFB 1BD2A 3WUZA 1CFNA 2GY5A 3JTSA 4KTEH 2DQIH 4P2YA 1HHHB 1NC2B 5E00B 5HGGS 4XWGH 3ROLB 3LKNA 4N0FB 1B2WL 3SY0A 4YHML 3QIWD 2Q86B 2OK0H 1BOGB 4X6CE 3JWNC 4RMSA 1RULH 2BRRH 4NQDD 4A2LA 4MJ5B 4CRPA 2IG2H 3MJ9H 3QIWA 2QJDA 1MCEA 2EEBA 1PEWA 2YD1A 1WLHA 3Q3GB 4X98B 3SN6N 4NQDA 3KDMB 1JRHH 1QSFB 2AJSH 1YEKH 1J1OH 1DANT 1OTUD 4GFTB 4OD1H 4WHTA 4LVOC 5HYQA 3SOBL 5HPOA 3HNSH 5L8KB 3UJJL 5GIRB 4OSUL 4W81A 2DIBA 2CQVA 2V5RA 3P4NA 12E8H 3MRIA 4LEXL 3CSBA 2DOCA 4O2EB 2W9EL 4GKNB 4I0KA 4Q9RL 1II4E 2DQFB 2J8UF 4OCSL 1JNNL 1M71A 1W8NA 4MDJB 5ENWA 3IKKA 4GG8B 2DKMA 3DXAB 3E6FA 4BJLA 1KENL 1T22B 2BXYA 1BVKB 1JWSA 1GJIA 4LHUG 2EH7L 4P4RB 4X7EC 2K9UA 2AJYL