1AP2A

Single chain fv of c219
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single chain Fv fragment of P-glycoprotein-specific monoclonal antibody C219. Design, expression, and crystal structure at 2.4 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords MONOCLONAL ANTIBODY C219
total genus 27
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ap2A00
3GRWL 2P8MA 2A83B 5FYLD 4F37K 3RWIA 1S7TA 4OFKA 4RFOH 5DUPH 5D70L 3ROOA 4J23A 1KNOA 2Y36H 3RU8H 4FFVC 5GS0L 2AK1H 3TO4A 1SYSA 1RZGA 5C09A 5DS8A 4G6JL 4XXCA 5C07A 1P7QB 2HLAA 3D6GA 1EAPA 1WTGT 4NCC1 1FFNB 2Y7QB 4R3SA 3QDMD 3V6ZA 1UM6L 5I1AB 4FQXA 1HE7A 4LCIH 5GS3A 3IDYC 4UQ2A 4WI7A 3MMEB 2JCCE 4QHUB 1S7VB 3CFBB 4AM0A 1Q9KA 4CUCA 3C60A 2Q20A 3UCRA 4QHNA 1QKZH 3F58H 4NHCL 4N9GB 3V2AR 5KVGH 3H0TA 4X98B 5DRZB 4JZOB 3T65A 3HZMB 3ALPA 3D25A 1JCKA 5F7MC 4GS7C 4KGLA 1MJJA 3QH3A 3QUYB 4FMFA 5ID1A 1JGDA 3DGGA 3O3BA 5K9QI 4PS4L 5DMIL 1I3GL 3ARBB 4YQXH 1MPAL 5HI4C 5GS2H 1S78C 2CJUH 1DDHB 4KUCF 4F58L 2AK4A 3DMMA 3E2HC 4OZFH 4FFWC 3QEGL 5FYKU 5B4MD 3WJLC 1T7XA 2IADA 1KPRB 4UB0H 1LO0L 3BSZL 1NANH 3MRGB 2HH0H 5J7CC 1V3JA 2D4DA 3GMNB 2WWMC 1U93A 4FHBD 4PREB 3ZTNH 1FLRL 5CEXA 2FGWH 3EIFA 1IT9L 2FBJL 2DQEH 4MMXC 1H3VA 1P7KA 3I9GL 2NY5C 3FB6A 4AZ8A 2H32A 3DX9B 2D4FA 1F6AB 3O3AB 5BV7H 5IESL 1M6OB 1GZQB 4JO3L 1WBZB 3T0ED 5EBGA 2D03L 4H0IA 1NCUA 3BFOA 4PJGE 5D96B 5IB5B 5MERB 4F37F 3FT4A 4RWYL 4JDZB 5D6CA 2VZSA 4YEFA 3QDHA 1ZV5A 4Y2DA 2FYYA 2IQ9L 5HGHA 2HMIC 3BP7B 4XRCA 1BBJA 4YNYA 1ZLWH 3T0EA 4JRXA 2V2XB 4U2YA 5DO2C 4ZAKC 1LEGA 1RJYB 3AXLB 2DQJH 2PXYD 3OPZH 3DIFA 1L7IL 2RBLA 1KT2B 3UTPE 4GUPA 3LRSA 4G9DB 2EXYC 1MCPH 2VLRA 1FORL 4PGCB 2AV7B 4PRBA 4FP8L 4I3RH 2YN3A 3NACL 4LASH 3MLUH 3WNKA 4TPRL 1HDMA 3MR9A 3ZKSD 3NFNB 1G9NH 2DBLH 2DKSA 3W0WE 5AUMA 4HUKB 3ZYOA 2Z31D 2JELH 1IAMA 1NCWH 2FEEI 1S7SB 4PJFA 5EC2A 2BNQB 3L3GB 1ZMYA 2ITCA 4ONGL 3UBXB 1HSBA 4MQ7B 4POZC 5CUSH 4ZD3H 3MGOB 1AQKL 4PTTB 2CLZA 5IBTH 4AG4H 1H3XA 2IQ9H 3FO1A 4TVPD 4KPHH 3HMWH 1L6XA 1WK0A 4N0UA 4EDWH 3BQUC 2VLJE 3DX6A 4YO0A 5F89B 4HLJA 2V2TB 4KJWD 3RWCA 1G7IA 4FFWD 2AABL 5K59F 1H5BC 2I9TA 2BY2A 1NEZB 1C5CH 1BJ1J 4IMKA 2CSPA 1YEJL 1LP9F 4ELMF 1IZJA 3T04D 1MAKA 4LP5A 5EUOF 3ZL4L 4FQPA 3ILPB 2AJYL 2CKBA 3OAZH 4FXKA 1CG9B 1MRCH 5EIVA 1CGSH 5GGTH 5C0BD 5JMRA 4PJBE 3AAZA 4MJIB 3LKNA 5LGJA 1P4LA 3BWUC 1WBYA 3OB8A 3LKQB 2ITDB 5I8KL 3IXAA 4P9ML 3THML 1VGKB 3MRJA 1TQBC 2OX5A 4OTXH 3WFBH 5ISZA 4X6EB 4P2OA 4ZOBA 5DSCB 2FWOB 4XPTL 3BN3B 3PV7A 4K3EL 4M4RA 2CGRL 3DV4B 1KJ3L 3B83A 2WAHA 1GGTA 4XPBL 4YWGL 3BO8B 5CIPA 3TV3H 5B3NA 1RZKC 3P4LA 2XIDA 1W0VA 2F19H 5EZLB 2VLKD 3AC0A 1Q0YH 5T3XE 5DA0B 5KSBF 3KHOA 5FGCB 3N1FC 4LEOA 1DQTA 3MRMA 1BQLL 5I1GL 5MENE 4Q9RH 4K71C 1KIQB 4WW2B 4HBQA 4ZUUB 1ORSB 4YGVA 2XFXB 1NCTA 4R2GC 2VZUA 4OLUH 1T5XB 4IRSA 5CMAA 4FQXD 5D1XD 1MFEH 4QYOA 4JO2H 4K8RL 1L7IH 2FDBP 5EOCH 3DYMA 5JNYB 4YPJA 4OJFH 3CVIL 3VWKC 1EPFA 2AS5M 4YBQC 4EOWL 4KMTL 1Q0YL 3BH8B 1QSEA 2FNBA 1MFAL 3STLA 3GO1L 2F8XC 1CI5A 4S1RH 1S8DB 2OP4H 4BELD 4KTEH 3WJJA 1GCFA 4HS8H 2GHWB 5FUZL 2CUHA 1G7LB 5CD5D 1BPVA 3MLWL 4GOSA 4LQFH 5A43C 2GJ6A 3QR2A 3OX8A 3RKDC 4K3DH 3MA9L 3FB8A 4YHMH 4JLRB 3MBEA 1MFAH 2AV1A 4I18B 3G04B 3U7WL 3OKKA 5JXEA 3VRIB 3QXVA 2B1HL 4X4YB 3UO1H 3NA9L 1D7FA 1HHHA 4O00A 1F4XL 2OQJA 3O4LE 5GRWA 1OAYH 2HJLA 2IANE 2OTUB 4PJAE 3I50H 5GPRA 5IFAL 4K3DL 1MQKL 2V7NB 3VI3E 1DBAL 1PSKH 2OS7A 4NUJA 5TDPB 1VB9A 2YA1A 4K9EC 4X7SH 3CNKA 2R1XA 1NSNH 5ILTH 2R56H 4XCFH 1BBDH 4S1QL 1SQ2N 1II4E 5CBEB 5D1ZA 4J3XA 2V7HA 5I0ZA 4UDTA 4P2QE 4RAUB 2VH5H 1L9MA 3MV9B 1NBVL 3INUL 2X4TA 3ALWA 1QFUH 4MNQB 1KYOK 5HHNB 1GAFH 3MNWA 3TJHD 4KK6C 1BQSA 4PLKC 3IU3B 1VFUA 4KAQH 2VXUH 4WW1B 2APFA 2HWZL 3DX7B 5CD3B 1X5AA 3WIHA 1X6LA 4JDVB 4RA3A 1QVOA 1FE8H 2HVKB 3MLVL 4I5BB 3ULUC 3MLXL 5TJWK 1YC7A 3CSPA 5C0GB 5F9WC 3FFCD 1U42A 4MD4B 2WBJD 3SDXB 2VWEE 4Q74A 1I8LA 4HKJA 3SDCB 1NLBL 5KG9B 4HIXH 1Z5LB 3E2HB 3B9AA 1OT1A 4NUGL 4MLSA 1OAXH 4OSUH 3VFVB 1QFWL 1CFSA 3ARGD 3CH8A 4XP9H 1JWMB 3NZHH 4XAKE 1A6PA 3O8XC 2XN9D 2KQMA 4U1HA 1SHMA 1IQDB 3GO1H 2ICEA 4YH6A 1MUJA 2ATPB 4O58H 3FO2A 1I1FA 3AB0B 3QWQB 4MQ7A 5F1KC 5GS0C 2CLZB 5FXCH 1F4WH 2E6QA 1BQHB 1F5WA 3VFGH 1YEFH 1U36A 3ARRA 4X6CB 1QR4A 4RX4D 3FRUA 4MB5A 1NH6A 3SDDB 3RUGA 3QT2A 1LO5B 5JOPD 3ARFC 5KSUB 3KPOA 3OF6D 4HUUA 3VXMA 1T0NB 1FRGH 2VQ1B 1MI5B 5L7XH 1R0AL 1XGRB 3PWPE 5F7LB 5HGAB 1FG2B 2AJUL 5D8JL 4NO0D 1HEZB 3AMKA 3GSNB 3RVUC 2B4CH 3P30H 3HC0A 3QFJB 4OCRL 3B2UC 3V4PH 2W60A 2XZQL 3CX2A 1IC7L 1NSNL 3ARBD 4JPVL 2FX9H 4TUOB 4P2RA 3TPUB 4OI7A 5FYJH 2EC8A 3PIQB 5DS8B 3KPRE 4XZUB 5E1AB 3IFOA 2C4FU 3VGHA 3WFDH 5FM4A 2VXQH 5ICXB 4M43H 4PJBB 5L8JB 1KC5H 2FRGP 3ABZA 4NBZB 2OCFD 5EU4A 3E8UL 4TUKL 1WICA 3TESA 1A6WL 1F6LL 2FB4H 2CDEA 3DROB 1G6RH 1GOFA 2YHGA 4Q0XL 4G7YL 3GIZL 2FX9L 5A3IC 2XFXA 4O2CB 2XWJA 3BIAX 1N0LA 1A14H 2ARJB 4L29A 4ZSOA 1BLNA 5JHDD 2VC2H 1HHGA 5D7LB 4KK5D 3I6LD 1FV1A 3TJEH 1X5GA 1I1RA 1L0YA 3RJDA 3CFDA 3KPRA 4UBDD 2DOCA 1CT8B 1I9JH 5C0RL 4OF0A 3HNVH 3WN5A 1DE4A 1KACB 3CK0H 1MJUL 2AJSH 4P5KA 2E6PA 5T1MA 1NMBH 2BNQE 4XCYA 4M4PA 1EO8H 3QSKB 3A6BH 2YPLA 3MLYL 1D5IH 3PP4L 5J11B 4OZIE 1KTLA 3GSWA 3V52L 2XTJC 5DA4A 2X1OA 1FZOB 3UTSB 3B5GA 3PQYA 4ODWA 5DD0H 3RY6A 2DQHL 5DC4B 1KXVC 3C9NA 1J05A 1CIDA 4QXGL 3WSQH 4F33A 5FK9B 1V7NH 4GW4A 3EFFB 1D5BB 3C5ZC 4PP2B 3C08L 1C08B 5EOQL 4PLJC 3RQ3A 4Z77A 5KVGL 1NFIB 1T4KB 1ZHBB 3E1F1 1R3HA 4HDIB 1I85C 5I17A 1RD6A 3NIFF 2V7NA 2YD2A 4J7RA 3R0NA 4LMQE 5D2NA 5IW1B 4YAQB 1CXEA 4NO0B 1J10A 3HZVA 4MHHG 3QZWB 3HG1E 3PNWA 1J1XL 5KS9F 1KLUA 4G6ML 5I1DB 1X5LA 4JQXA 1J8HD 4WHTB 4MHHI 4NO3A 2P42B 4QWWD 3ULVD 3WS6C 4YEEA 4XPAH 4AIZB 4CN6A 5KTEL 3SKNB 4UQ3A 4XMLH 5B39A 3SGDH 3CPLB 5BVJA 5BXFA 4L1HA 3KS0H 4DOHB 3CSYB 2QJDA 1MVUB 1I1AB 3S5LB 1PEWA 1TCMA 4DCQA 1IC5L 3L3DA 1HDMB 2X44D 3KLAA 2LABA 1GZPB 3PDDA 4LLYB 1UJTA 3IFLL 5GRVL 4XH2B 3ZDYF 3PHOB 4DUVA 3TO4D 3P0YH 1TJIL 1YEIH 4LKXA 4QRPB 1W0WA 3BISA 1FORH 4TTDD 5ENWA 1A6WH 4XCCL 1NGYB 2QBWA 2A0LD 4LCWA 4M7ZB 5DQ9A 3S37X 3RHWK 1Y6KR 5DJ8A 1KNOB 2AJVH 4F7CA 2VLRD 5JHDE 2DQJL 3SJVE 5DJZB 2C4XA 3VGBA 3UBXI 1ROWA 3R06B 4WEBL 2YPKB 1I8LC 3TZVD 3DXAD 4PJ9D 2RFXB 5JW4M 4WI2A 4N0FA 5DYOB 4BZ2L 4TN9A 1UADC 3BXNA 3K46A 5F9AC 2FGZA 3DWTA 3CDCA 4HXAH 1H8NA 1I75A 4TVPL 2HTLC 2D9CA 1G9MH 5D1XB 3WKNA 4NQEB 3EO9L 2YD9A 1NBZB 1MI5D 4KK9C 2F5AH 3KYOA 2DJSA 4LDOB 2EDQA 1XIWD 4Q9QH 3OHXB 4LNRA 5TF0A 1UC6A 1RZJC 1BGXH 3EBAA 3KYNB 2R9HD 1IM9A 4PP1C 4RGNC 3V6FA 2HJKA 3TWCH 4Y88A 2E6JA 2ZSWB 4HWBH 4LCYA 4BUHA 3DYPA 1DDHA 1U0QA 1MWAL 3TF7C 3D87B 3MRBB 5L8KB 1CD0A 1XH3B 3O3UN 4NFCA 3C09C 4PJ9A 2NZ9C 4RIRA 3HC0B 3QFJA 4EUPG 1OAUH 4F2MA 1I1YB 2PW2A 1KJVA 3P4NA 4JQVC 3GMPB 3MACH 1FYTA 4H1LB 2XA8H 4JFED 3MXVH 3RWDA 4P2RB 3MRKA 3TWCL 1P4IL 4JZNB 3PWNB 3F7QA 1F3RB 5K9QG 4PJIE 1QOKA 4JZJB 4AENA 4NZUH 4Y89A 2YSSB 5DMIH 1U8LA 4JPWH 1IC5H 1JFQL 2CGRH 4HPOL 5DT1H 5HDOA 5BVPH 4NM4L 3QIUC 4KI5F 3AS0A 4ZO8A 1RJYA 1D6VH 4FTVA 4D8PB 1JYXA 3O4OC 5CEYA 3VGDA 2WUCH 2A9NH 5MP6L 1KT2A 1MHPL 3RIAK 1HCVA 3QNXB 2D7TL 3QCVL 5E2WL 3TZVC 4XVSH 4P5MA 2APTA 2VLRB 3FQXB 4ZUVA 5KSAB 1IEBB 2VDMH 3X13B 5IG7B 3WDJA 5JTWA 5D2LF 2Q7YA 4G8EA 5EFIB 2VUYA 1BIIB 3U0WH 2YR3A 3FB5B 5DQDL 3GIVA 2MJWA 5A2LH 4W4OA 5HI3D 4QO1A 3T3PF 5I1KH 2BNQA 4N0CC 4TOYL 3DVIA 2V2WB 5J57B 5DFVC 4ODWB 4CVUA 1BJMA 4ISVA 1FVEB 3RIFK 2B1AL 4HSQA 3T77A 2VMFA 1ZLWK 2XZAL 2O26U 4FQCH 4RMTA 4NO5A 2FHCA 5E9DD 1HKLH 3ARGB 5KN5A 1J8KA 5ESQA 3ZSTA 1LK3H 3E6HA 3IU4L 3TN0C 1DLFL 4YXKH 3VG9B 1EBPA 1INQB 2DYPD 4XAKD 1L0XA 5B39G 4ELMB 1EERB 2GKIA 2NY6B 4NKIL 1NGWA 5I8CA 4OZFG 1PLGH 4Z18A 3QO0B 3S36L 1K6QH 2JKXA 2AAVA 2ESVB 2XZAH 4PGJA 2GIYA 3EJYD 2VIRB 3B6SB 4PRHE 1UM4L 1CGTA 1R3KB 5IMOB 3CFJB 3U4EB 1GGUA 4G8FA 3V7MA 3LSOB 2DDQL 1S7WB 3CPLA 5DHYB 2UVEA 3CH1A 1I85A 3CSYA 3FQNA 5JR1L 3BX7C 5DMKA 3WHXA 3BN9D 3S8WA 5D1ZD 2P5WA 3CCHA 1FP5A 2H9GA 3MJ7B 1S9KC 1G0DA 4TULL 1P7QA 3U48A 3TNNB 1DBBL 3RZCC 3D9AH 3HA0A 1YUHB 4WHYG 1C5DB 3PHOA 4N8VA 3B9VA 3BJ91 2IWGA 4LKXB 5TE6H 5ITBH 2IPTH 4D0CA 1JN6A 1YY8B 4OM0L 3VJ6B 1SJXA 1DTUA 1A3LL 4G7VH 3V5KA 4ELME 2VLJA 4JY6B 3C60B 5JR1H 5GZOD 5H2BB 4OZFA 3GSRA 3MUGB 1OL0A 1MHCA 2E3VA 3FJTA 4M6OL 4MJ6B 3RGHA 2IH1A 4QXWA 3IAPA 3WUZA 5E9DA 5CHNB 2P5WE 3IDJB 4X8JB 2Z4QB 1MI5A 3DX8B 1S3KH 2YZ1A 4ODVL 1CD8A 3QIBD 4MQXC 2WZPD 5C0JB 3LQAL 3PV6A 3L3KA 3U0TB 4J12A 4KHXH 5ANMB 4PJAB 3SE8L 4QRTA 2FL5A 3HMWL 4ODSH 5D1XC 3HFML 2ADIB 3MOBL 5JHDB 5DQDH 4FQJL 1QQDA 4NSKA 4YHPB 1NBZA 1YNKL 1MEXH 4NQED 3HTLX 1NC2A 3FONA 2AJ3A 4RQQB 1X5XA 4HC1L 1C5CL 2W0LA 1JGLH 2DLGA 3DBXA 2DQIH 4CW1A 4WV1B 4QHKI 2D7NA 1F4YH 4XX1E 4Z5RA 1RFDL 3LEXB 1MCHA 3FQRA 3NA9H 3VCLA 3V4PL 4JG1L 1N6VA 5TPWH 1T6VN 3EYSH 2X05A 1K85A 5HYQB 4HS8L 1ZT1B 4G8GE 4R96A 1EHLH 4LCCA 5L8LB 1KCUL 2CMRL 4PTUB 2X4PA 3WFZA 3N9GL 5C9KA 4GBXD 1BX2B 4HUMB 4HUXB 3SE8H 1WBXB 5T33H 5EZOL 5D5MA 1UXSB 4XP9L 1WZKA 4G9FD 4GAFB 5T3XD 3FFCA 4G6KH 3L5IA 3IU3A 5MEPA 4KJWC 1RUAL 2OL3B 1T66C 1BOGA 3VFTA 1OCWH 4Y19D 1F4WL 4OCYH 2A0LC 4NJ9H 5IROC 1OWRM 4ENEC 1YJDH 1KJMB 1DEEB 4PJFB 5DK0A 1B4RA 5LWYH 3BHBA 2XACC 3Q6GH 4KRLB 3GJFK 3PQYB 4XX1G 1A7OH 4FTVB 4D8PA 1UKQA 3GUTB 2VXVH 1AO7B 3VXNB 4RMRA 4KC3B 3P9LA 3T0XA 1NGXB 5KSAC 4UTBL 3DX6B 4JM4L 5J12C 4NQCB 3SQBA 4K07A 5GJSH 1IGTA 3MRHA 4DGVH 2R0KL 3QYCA 3KPMB 4LSTH 2H26A 1BFVH 2NY2D 3ARDA 4ZYKB 4UINL 1F8TL 3QJHA 1G7PA 1HOCB 5C0NC 3QZWA 1BF8A 4LLWA 4PJHE 1V7NL 2Q86B 5IHZB 1RURH 3QIUB 1SJHA 3HCVB 4MWFA 3H9SD 3O8XA 4YUEL 2EO9A 3RJQB 5KVDL 2XKNA 3NIGE 4QRRB 5J6GB 5INCA 2E7CA 5BXFB 1D6EB 1EHXA 2DM3A 2ZUXA 4FQXC 3QFJE 1JZ5A 1T03H 3QUML 1U8MB 1RK0A 3WBDA 3W0WD 1I9JL 1AHWB 1B9ZA 2EDJA 4PJ8A 1AGBA 1TENA 1OAQH 2AK1L 3PWPB 5AYUH 1BBDL 1ORQB 1I8KB 4AIXA 1FVCA 2AGJH 2J4WH 5F88A 1JNHA 3RGVC 2DLIA 1TXKA 4LARL 2VIRA 2YD3A 3B6SA 1I4FB 4XTRC 1LO2H 3VH8A 1VCAA 2FHFA 2KL6A 3RGVB 4CL7A 4WI8A 3U36A 4XBPA 1FZKA 1INDH 4NJAH 5J8OA 2O5YL 5IEHB 3W9EA 2BVTA 1CFVH 1S9VA 1JPTL 5E5RB 1WAAF 2I07B 3X3GL 4M1CD 3SO3C 3U82B 1RUKL 5D71H 1PZUB 4PUBL 4QHLB 2BSSB 3ARTA 1YEIL 1VADB 5IB2B 1XGYH 1J5OH 1UJ3A 3Q3GB 1DUZB 5JIHA 5TH2B 32C2B 3WJLA 1WCQA 5CJXC 5DQJB 1INDL 4NJAL 2MWCA 4LCIL 5LJYH 3Q6FB 2CDEB 1KG0B 4L4VE 3VJ6A 3VDAA 3HZKA 5IVXA 1YQ2A 3BP5A 1OP3K 4OI9A 4DGYH 4QGTA 1T7VA 1AKJD 3ILQC 3GIZH 1KPVA 1MHCB 1NCCH 1MCBA 1HHGB 5FFLA 4HD9A 4XNXL 2JB5H 3DO7A 1UWEH 3BP4B 4OFPA 1SEQH 1TQCB 4PG9A 3WN5B 3UJIH 4HJ0D 2PO6C 3S34H 1EZVY 3VXRE 5SV4A 3IDNB 1WZMA 3QEGH 3LPGA 4JCLA 5D96C 1P84K 4Q9CA 1GVIA 4RWHA 4BSVB 5C6PB 1KF9B 4HHAA 4PS4H 3PGCA 5FYKL 4WFED 4RMUA 4Z7UA 5HI5C 3T2NH 4U6XB 1ZANL 1F3JB 5SWZB 5D8JH 3PGFH 2ZCLH 4OBRA 3T0AA 5HBBA 5DJ2B 2X4UA 1B88A 3TA3A 2EDWA 3BYYA 4AIOA 3HMXL 1NUFA 4DFHA 1YDPA 4HUNB 4DVBB 3RWEA 4XP4H 2YS4A 1M7DA 1ZOXA 4IOIB 4KPHL 5KS9B 3CK0L 4QT5B 4RX4A 2HVKA 1YECL 4YAQA 1HWHB 4G8GD 5F7UA 2FATL 2BRQA 2H45A 4E41E 3L5XH 3HR5A 2OXGA 2AERT 3O2WH 3P4MB 4NRZB 2GFBB 3GBNH 3QJFA 2BJMH 4XBEH 5D7IA 1ACZA 3BH9B 3QDGE 1A5FL 5FA3A 1CD9B 2BDNH 1ZLUH 1MRCL 3VMPA 3V4UH 2FX7L 3GB7A 4YXLL 4X4XB 2VAAA 5DWUH 1KEGL 3K1DA 2X4RA 5DF0A 5FCSH 3DI2B 2P48B 5F1IB 1HZHH 1WWBX 2L7JA 4WI6A 3N50A 3QWOB 3LKRA 1FVEA 4FTVD 3UYPA 3IDMB 2MSPA 2X42A 4U4BA 4XP4L 1JF1A 5DJDB 5MEOA 4MJ5A 5HHOA 4LCWB 1CLOL 4EBQL 3C8DA 5JW3L 3KPPB 1T20B 4LVOB 4P3WA 1UWXK 4NO2A 2R29H 4ONFH 5KVMC 1NGQL 1A9BA 4QRUA 3RI5K 2V5SA 4NPYB 4PG2A 2ZJSH 1K8IA 1KB9J 1S7RA 4XNQB 2E8ZA 2YD6A 1A1MA 3Q5OA 1AJ7L 4I0PA 1RZIB 4AQ1B 3MUY1 2UZIL 2EYTA 3O6KH 1J87A 1ZA3B 3VRJA 2VISA 4L8CB 3RUGF 1IGCH 1XGPA 3HUJB 3V0WH 3D48R 5BMFH 4ZS7H 3TM6A 3MYZA 4MAYA 4N0YL 3WFBL 4OZHE 1FFPA 5DMYA 4PJ5D 2MTPA 3PDGA 3ET9F 2BP3A 4QCIB 2H9GB 2YPLD 3WNNA 3LRGA 2R2HA 1B0RB 3T2NL 4KXZI 5ESAB 3MRLA 4PJBA 2LTQB 1NCAL 4XVUD 5GIRA 1NGZB 3FFDB 4PB9H 4EDXB 3MNVA 2OMBA 1TMCB 5J1AB 3P2TA 2VNCA 4K71B 4P48A 3NFPB 4PJ9B 4X5WB 4IHOA 4BZ2H 3H9YA 1UB6A 1DJSA 4LSVH 3T0EC 2DWDA 2OL3L 1S7TB 3UTQA 4DUWA 3CDFA 5H2BA 1QRND 3B43A 1EEUA 3OKLB 4WUUD 4LEXH 3AS3A 4H1LA 2QLVB 1RUPL 2G9HA 2F53D 3VI4E 5IR1A 2NR6D 3BVNB 4KJQD 4OF7A 1FAIH 4XMKL 3CVHL 4K23H 4P4RB 4JRYA 4H20L 1XF3A 3QXAA 5C07B 3RHWF 4LAQH 5HHXH 4L4JA 5C0AA 4ZD3L 3F6LA 3X3FL 3QFDB 2DQGH 3KVQA 4GRLA 5IP4A 4PJCA 2NY4D 3OKOB 1N5YL 2R2CA 1U8JA 2B1AH 2IMNA 4H5SB 4YHNB 4Y4HC 4UV4H 5JW5B 3GKZA 5D7JA 1QLRA 5EU3A 1P84J 5IVNA 5IVXB 2WK2A 3I50L 2D9QB 1GAFL 4A2MA 3HS0A 5ADPH 3TBYB 4WFHE 5HHME 3PL6A 1T0PB 2X4QA 2UYLB 4R26H 2EDTA 1FO0B 3U2SA 5C92A 5HHXL 2EEBA 5GRZA 3TZVA 2W92A 3OSKA 4JHBA 4Z7NE 1F42A 3ARBA 1KIRA 4ELKA 2EKJA 1Z9MA 3D3VA 4Y4HB 3TP4A 4Z5RB 4G8EB 4P5TD 1GOHA 4Y4KC 1JF5A 3W11D 5IOPB 1NGQH 2WBJB 4X6DF 3VXQB 1P4BH 3MREA 5T1LD 4OLVH 2W91A 3PJSB 4HJJH 3O2DH 3MTRA 1TETH 4YDIL 5F1SA 5IBTL 4NUGH 3PWLA 5DFTA 2SEBA 2UUDK 1BEYH 1RPQA 4PGBB 3CSGA 1NJ9B 2GJ6D 3U0WL 5AG9A 1U3HC 1Q94A 5TE4H 5CBAB 2Z91B 1S78D 43CAB 1MFEL 3CFEB 4HLZG 5IB5A 3UXFA 5HDQL 4HUVA 2P8LB 5FV2A 2ZUQB 1Q9OA 2BOCA 4LLYA 3SOBL 3BZFB 3CDGB 4Y1AB 4DFIA 5EUKB 2C3VA 5E5UB 4APQD 3IT8D 5F3HB 1D5ZB 3LPFA 4L4TD 4V1DB 3V5HB 3C5JA 2CRMA 3MJ9A 5MHSE 1XF4A 3HR5B 1REIA 1FN4B 1IJ9A 4PRHD 2R39A 4HWZB 4OCWL 4F15B 4XT1C 4ZXBC 4OLUL 5HGDA 2EDHA 2AV7A 1H9VA 2PW1B 3FFCE 4S11A 5B4MC 4OGAD 4Z6AT 4KJYB 3WV0A 4AMKL 4F9PA 2EXYD 3DV6A 3WIFB 3VFSA 4X4XA 4LPUA 4GQ9L 2DQFA 2VRAA 1G7PB 1HOCA 2LV4A 4GAJH 4Q97A 4DEPC 4O02L 4Y5VC 4DKDC 1ZKAA 5K9OB 3F62A 1C8PA 3DUUA 3IDMA 3NN8A 3H9HB 3C6SA 4J1UB 3PGDA 3I75A 1UZ8A 4J6RL 5AWNL 1B4JH 1KELH 2FECI 1F4YL 2GCYB 4OLWL 1AI1H 3H7BB 3QQ9D 4LNRB 1QSFB 3E6FA 5BS0B 3VXPB 4QRUB 4GMSH 4RGMC 4YHYC 1AHWA 4PJ8B 1NC4B 3WLBA 1K8IB 4UNUA 3S88H 3MZTA 5D6DA 4LPYA 3FO9A 3QPQC 5E6ZA 2BNUA 3OKMA 1UCTA 1T1WA 3JTSB 3MO1B 4LFHD 2EYTB 4JY5L 5IWLC 4V1DE 1IAKA 2DMKA 4GQ9H 1WBYB 1GPOL 2YRZA 3DGGB 3LCYA 1HH6A 4X7SL 1IC4L 4YBHA 5GSRB 3NIGF 4Y1AE 2DM2A 4NQCE 1AH1A 1NPUA 3B4NA 4IJ3C 3RWDB 1KN4L 4MA3A 4PJ9C 2GSIB 1E28B 5E4IA 5TDOB 2YD5A 4PJ5E 1CDGA 1T2QH 4Y8AA 5CZVH 5KOVC 3ZHDA 2XWTB 2R2HB 3OAUH 3IYLW 1DQJA 1VFOA 1I7UB 4HW6A 5TE4L 4XPGH 1QRNB 1FFNA 4M3KB 4YX2L 1A0QL 3FFDA 2YSSA 1JHTB 4BFIB 1NCDH 3ULVE 4HG4K 4U7MA 1CVSC 1EFQA 4QHUA 2V5MA 2EDDA 3QIBB 1X5ZA 4FN0A 4G3YL 3TJHC 4G42A 5D93B 3ZT5A 4X7CC 2DJUA 4C56A 2C1OB 4YHLL 1I8IB 3QG7H 4KQ4L 1B2WH 3OZ9H 2DTSA 1DUYB 2F53E 1OPGH 1TPXC 3GGWB 1FNAA 4PRNA 3GSNL 4FZEL 3D18B 3RVWC 1E6JH 1YNLH 4TNVK 4YHKL 4ZMAT 1S8DA 1U6AH 5EZJB 5KVFH 2YA0A 2FB4L 3VWKD 1A6UL 5HXMA 4WGVB 3G6DH 4JJ5A 1MFBH 1KTDA 4G9FA 5C8JB 2OL3A 5I73C 3EYUL 1C12A 1URLA 2E9IA 4GFTB 1JRHI 5T5FH 1JIBA 4GAYA 3HNTH 4JLRA 2Y25A 2RR3A 4K7PH 1OGTA 4A6YA 1UCBH 1F58L 2MFNA 1RJCA 1G9EA 4TSCL 3DX9A 4POYA 3ARGA 3PHQA 4GBXB 1G9MC 1ED3A 5JLZA 1BJ8A 1ZT7A 4Y4HA 1CTNA 3L3HB 3FN9A 3UC0H 3O6FA 1JWUA 4UILL 3HG1D 1Q1JH 1AQDA 1DQDH 3FTGB 3RNKA 2RCSL 3HNTL 3QO0A 2V2XA 2VWEC 4WO4D 3OG6B 1K5NB 3R4DA 4QXUH 3SO3B 4OM1H 3O6ML 5EU5B 1UXWB 3P4MA 1FNSL 5T1KA 3MUJA 4HKBA 2WW8A 3DXAB 2X4TB 2M2DA 3IAQA 1GPOH 5C3LD 5KTEH 5L6YH 3WIIL 1Y6MR 1EH9A 3RNQB 4JRWA 1KLGA 4K7PL 4QY8A 4AEEA 3VA6A 4PBXA 1UB5A 3NCYS 4WFEE 1V05A 3G9AB 3UTTE 2F58H 4ZXBD 4C83B 3UJIL 5DRNB 1FPTL 3IXAB 3VMOA 1F90L 4ZAKA 3RA7H 3MOAL 3VW3L 5SWSD 1I4FA 4OZGA 2QQLH 2EKSA 5J13B 3KYMA 4XPHH 1FZKB 4Q6IB 4CNIA 1FL3B 2MCPH 2GSGA 4HXBH 5HGDB 2OJEA 1FIGL 1SYVB 1SY6H 1KGCD 3H42H 4HX1B 3ULUF 3VFVA 4E41A 4XC1L 3BKMH 2BNRB 3VWJD 2BC4B 1EEQA 1F11A 3WFCL 4GAGH 5HYSG 1FO0L 1AXSB 4KKCD 1DUZA 2DQFB 3HMXH 4WV1C 4YDJB 1EA9C 1XGYL 2PYEA 2ZCHH 5FYKE 4L8BA 4JHAL 4HXBL 1AE6L 3OL2A 1M1SA 2B4CC 1NC2B 1OD9A 5FYJE 4PGDB 4G8GA 1QSEB 5E0QA 5EH1A 3L1OH 4M48H 3RY6C 1S9XB 4NNPL 2H41A 2JIXD 2VXSH 5KSUA 1L6ZA 3VXMD 4OCXL 4QCIA 3N85L 5BRZE 1U3ZA 3QULB 4PPTA 4GKSB 2EZ0D 4LMQI 1EGJH 4X4ME 3EAKA 4NZRL 2W0KA 3FQRB 3MNVB 1NDMA 4NWTH 5IT2L 5LXGL 5CJOH 4F7MB 3RVVC 4OKDA 1H0DB 3I6LE 1IGFH 4R8WL 1FYHB 3KLSA 4UTAH 4M6ML 4XWGL 5BW7A 3U9UA 5LKNA 4W70A 4YDLB 4X5XA 5SWSA 3KPNB 5JOPE 1EEZB 3REWA 1BX2A 4XNYH 1PX4A 5HYJA 1JZ8A 2OTUA 3AUVA 3WD5H 4FABH 2PCPA 2C3WA 4LVHC 3T4YB 3LEYL 4NN6C 4P9HC 4MNGB 4QRQB 4R8WH 1NDGA 3OB0H 1F13A 1IFHL 4RFNC 4LF3A 4ZUWB 1GL4B 3A6OA 3H9SE 1X7QB 3DECA 2AK4D 4NZTL 4H5SA 1DFBL 1GGBL 2UWEF 3F7VB 1MFDH 4ZTPL 4MDJB 2FGWL 5E95B 5FM8A 3KPSA 2MKLC 1AC6A 4LSRL 1BZQK 5HHNA 3EGSB 5JPMB 3C60D 3P0YL 1DLFH 4ZPVB 4LLVB 1PYWA 1FNHA 1CF8H 3NZ8B 5CLWA 4W6WB 4RZCA 2F54B 4LSUL 2XRAL 3IDXL 3SDAD 1CE6A 4Z9KB 1CICB 1VGEL 5JZ7D 2APVA 3BH9A 3S36H 3VGAC 5FYKH 1MHHA 2P5ED 4ZFZA 1ZTXL 4HV8B 4JJ5B 1HXMB 2EE6A 4LSRH 5H94A 2NXYD 2A74B 2EO1A 2F19L 3IJHA 3MCG1 1ADQA 4LAQL 4MA8L 3MRIA 1VFBB 4LLWB 3CX5J 3MXWL 1C5BL 2BMKA 5DFWH 1FZMA 4ZS6C 4Y8DC 2HLFC 2V7HB 1KJ2H 2A73A 4WI4A 2XZCL 5F9JB 3WHE0 4P57B 1BFOA 3RAJL 1CIUA 2G5RA 2DMBA 3KPQA 2X89D 4CMMA 3QDME 5E94B 1J86A 3RBGA 3FMGL 1R5IB 4Y4FB 1YN6B 2VN4A 3TPKA 3V79C 1CXFA 4OGZA 2WBWB 5GXBB 4X9GA 5IQ7L 2V17L 1XGUB 2BERA 4C58B 3U79A 3HN3A 1KSRA 4FQ2L 1A1MB 3NFSL 4H88L 3HPJB 4LCUA 5GGUA 3K74B 3S36X 1HHJA 3LDBC 3BE1L 2UUDH 2P8MB 3ULVH 2P7TA 1J1OL 2DMCA 2J1KA 1XR9B 4RFEA 2BVOA 4YDKH 2VL5B 3X3FH 1OTTD 1KCLA 2R0ZH 4NM4H 2CPCA 4XVTH 3GRWA 3CFKB 5CLTA 3HRZA 1WZ1L 2D7OA 4MA7L 3G5XB 1FJ1B 2F53A 3C2AL 4KRPD 4KZDL 1A1OA 5BMFL 3LD8B 4U6VH 2A9MH 3PE9A 3TYGL 3QCTL 4YBLC 5CFHA 5E56A 3IJSB 2GJ6E 4GRWB 1Q9KB 3QI9D 4JFDA 4OI8A 1H3PH 5GRUH 4F7CB 4FFZH 1QSFA 3E6FB 5BS0A 5I0DA 3ULVF 1XF5A 2AABH 4N0YH 4J3UA 3HLAB 3QFDA 4OV5B 2PETA 1GGYA 3EOBA 4QWWC 3ULVC 4CJ1A 2RQ8A 3JTSA 4RGNB 5IVXF 1CLYH 1BVKA 3CC5B 4BKLA 4DN4H 5GRJH 4LCWE 2HG5B 1ERNA 2NTFB 5FA4B 3MV7A 1UEYA 4KMTH 3KJ6L 4BSVA 1NLDL 4S2SB 5ALCL 4RMSA 3TPUA 5SX4I 4OQTH 1RUAH 1U8QB 1IGIL 3MLZL 1I7RB 2QQNL 3QUZA 4PJEA 2CRIA 4U1GC 4R26L 1JYNA 5JIIA 5DD5L 1YMMB 2ZKHL 3VFMA 1CGWA 4X6DB 3O6KL 3GK8L 4BFIA 3BEVA 4PR5B 1KBGL 1FZOA 4JKWA 2PKDA 1YDPB 2NZIA 3GI8H 3HI6L 1CLZH 4YFDB 2OI9C 3ZE1F 1RIVL 4R4FH 3SHSA 3DSFH 5ALCH 4GW4B 1N5YH 1I1YA 4M02A 3WKML 3EYQC 4OCWH 1NAMB 1VFAA 2NYYD 5SWQB 4Z7UF 5D7KE 1FNLA 5HHVL 3IFPA 4PY7B 4CMHB 3HZYA 5BJTB 1AD0A 4S1QH 3I2CL 3GGWA 1ACYL 4U0RB 4Y4KD 3ZE0F 3SN6N 3GMMB 2Z91A 3W2DL 4JZJA 4JAMB 4RBPH 2HFFB 5JDJA 5E03A 3HZVB 1YEGL 3DARA 5EIIA 4UNVA 3MR9B 1X5IA 4XCYB 1XCTB 3L95A 3V7AG 5DHVA 4NN5B 5AUMB 1EHLL 4MDJA 1EXUB 1LEKB 3GSWB 5GGSY 3V5DB 5FOJA 3EZJB 1WWAX 4UDUA 5E2TL 1ZSDB 3BUYB 3RX5A 5IGXL 1KFAL 5E08H 3X14B 3W2DH 5D7IF 4NZJA 3DGCR 4FQHA 2NXYB 4KFZC 5GGRY 1NANI 1JV5B 3QIWB 2I26N 2B20A 2CKBH 4RNRA 1RJLA 2V9RA 4NRYA 2EH7L 2QR0B 4FQIH 1U3HA 1T2XA 3V52H 5IMMA 2YRLA 4LHQB 3FTGA 7CGTA 3QUZC 3VG0H 2EE2A 3TCLB 2VLJD 4I0PB 3VD4A 3PABB 1K5NA 2CKBB 2R4SL 4FXGA 3LQAH 1MLBA 1FNGB 5FGBC 3HI1A 5HI3C 3V7AE 3HZMA 4KUZL 3BDYL 4BZ1H 1WVZA 1OAKL 3C6SB 4KI5D 1JGDB 2D7MA 4WFFD 1K4DA 1MIMH 3TBTA 1OAYL 4P2RE 1LO2L 2Y72A 4Y19A 4G6FD 4M6OH 3ZKXB 1FFPB 4KV5E 2K9UA 2NLJB 3L3DB 5EZOH 4MX7A 1T2JA 1LP9A 3DVNA 2FJFA 4H1LH 2FR4A 4DKFL 4HIEB 4RMWA 1YYLL 4J3SA 4RRPG 5ETUA 1DL7L 1QLEH 2YUXA 4LCUB 4URTB 5EA0H 3ARED 1FCGA 5JQ6L 1QSED 3WXWL 4KK6D 2FX8L 1MAMH 4MJ2A 5EZIL 3B5TA 3QAZB 4P99A 2HP4A 1UWEL 5IJKA 2JJSC 5I8EB 5GSRA 1CXHA 4KRPB 1KOAA 4L4VA 4RAVB 2C1PA 4DKFH 2F74B 3WHXB 5A16B 4E41B 3D2UB 3QG6A 5EOTA 1CFNA 4PUBH 4I8DA 2VZTA 3HNSH 1NCBL 5LGKA 2QQKL 4JFFA 3HRZB 3BP7A 3D0VB 4XRCB 2A83A 3QHTC 4L4VD 3OAUL 4U6HA 5BOPA 1JHTA 1JPST 2X4SB 2GJZA 5IHUL 2ICWJ 5ERWA 4LLMB 1NC4D 3DIFB 1WEJH 4ERSL 1CL7H 5FYKD 5CS7A 2HFEB 1GGIH 2WNGA 1RIHH 2C1OA 4N1CA 3EOYG 4QTIL 4OCRH 2AQ3A 2R4RH 3GNMH 2ZCKL 1T1YB 3TIEA 4P2QB 2XTJB 3MODL 3LV3A 3A0OA 4Y5XB 5CZKA 3CXDL 1U8IA 4QRPE 4LCYB 1R0AH 4LOUC 1H15B 3FOLB 2AEIT 1E4KC 1UH3A 2APXA 2W9DH 2K7QA 5IUSA 1XIWB 1FIEA 5ANMA 4LHUD 4WTZA 3MCLH 5CJ5A 4KMLB 5CKAA 2VLKB 5I1HL 4NUJB 3ZE0E 3WFCH 2OTPA 2QHRL 2PYFB 2ZUYA 3QUYA 3VFPA 3U9PL 1YMMD 4HKZB 4M7ZC 1A7OL 2IANB 2EIDA 5BOZG 5HHQA 1R3JB 5I73B 3FONB 2IAMB 1T22A 1QBML 5GRVK 2Y06H 2AJSL 4WUKL 2AEPL 4KQ3L 1OGTB 2Q3AA 4CU6A 1SMAA 2XI9A 5F93C 4NWTL 4RFNB 4PJIB 4IIQB 2RHEA 1BWMA 4QOKB 4UT7H 1FGVH 4IRJB 4DJMA 3RKPA 3ARPA 3F6IA 5SV3A 4X4MA 1ZAGA 4KKBC 2VXSL 1GHFH 4OIIL 3WCYA 3JWDH 1OHQA 2ICWB 3MJ9L 4MJIA 3C09B 4JFEE 5JXAH 4WDIB 3EDEA 4KZEL 1QFWI 4F3FA 3SDCC 2GQHA 5T1DL 5JO5A 1AE6H 5ESQB 5CP3A 3M1BB 3G6AA 1J5OL 1XF4B 1N59B 5DUBB 3PWJB 5DI8A 5DJYA 4M43L 4X7EC 3CUPA 5CJQL 1HQRB 5HGHB 2MPAH 4KHTH 4X9IA 3EOAA 1U2CA 2JIXA 2H32H 1GIGL 1C7SA 3GIVB 3AS2A 1QR1A 1TVBA 2Y9RT 2FD6H 3GMOA 4W6YB 5T3ZL 1E4KA 2Y4SA 3K2UH 1JHLL 4NQEE 2YN5A 3TGXA 3QEHA 5GJTL 1C1EH 1DANT 4QGYA 3WHE1 1I8MB 2FIKB 5TF1L 4OLZH 1OM3H 1A4JB 3T8XB 4NGHL 2BVQA 3NFNA 3VXNA 1H5BA 5DURB 3ZO0A 4YR6B 4RGMB 3GJEB 1YQVL 2GK0A 4JO3H 4NQCA 1GYAA 1BVLA 5JORA 4E0RB 4JO4L 2DD8H 4DTGH 5CAYB 4AEIH 5FOBB 4LSVL 4OQ1A 1IGFL 2Y6SD 4R7NB 1YEJH 1EVTC 2KZWA 5DRXB 4WWID 1BD2E 5ABDE 3QRFM 2DYPB 5TQ0L 1HIML 1ZLSL 2AV1B 4I18A 4N9OB 4NNXB 2X1WL 3TLRA 4G8FB 5CEZH 2GEEA 2HN7A 1D6VL 1DLHA 5DHYA 2C4FT 1NBQA 5F8RC 3UJJH 1AO7E 5L2JA 2HRPL 3DO3A 3V0WL 2GSIA 2DIAA 4MCYB 4HFUH 4WENB 3PQYE 5IVZB 1RK0B 4M5YL 4WGWB 1NUNB 1RVFL 2DRUA 1OB1A 5ICXA 4NQCD 4Y1AD 1QQDB 4NSKB 2ITDA 4O4YH 1ZT4A 4EN3C 5F88B 3QUXB 4G9FE 4XI5C 4OD1H 5C08A 5D6DC 4I3RL 5T3XH 4JQIL 3LQZA 3BKYL 2OL3H 2A6DA 2WP3T 4YDVA 2ARJA 1KB5A 1E4XH 3DVFA 3ZKQD 4WIQA 3HG1A 4P5TA 3TVMD 4DVRH 2BRRH 3ARUA 4EUPA 8FABB 3UDWA 4BH7A 3GZKA 5T1LA 4U1MB 5DDHA 3GHEH 4GBXC 5DUPL 2FIRT 2J5LB 3P0VH 3EJJX 1C12B 4RRPA 5LGHH 3MLWH 5LAXA 4YHIA 3RZWA 5A2IH 3VRLE 3S6CA 4IMLB 4PJGB 5F1NA 4P9MH 3THMH 1N3NB 2YMXH 5FGSA 3O41B 3D1MC 1KCKA 1X5HA 1J0JA 3GBNL 1RZKH 3UTOA 4NGHH 4PP2A 4Y5XA 4L9LB 1JZ2A 4V1DD 5BQ7B 1DEEA 3MUHL 4ETYA 2VDML 1AGEB 5F7NC 3MNZA 1I9IL 4EI5A 4TUJB 2X7LB 1CF8L 4LDEB 2DF3A 3C2AH 3PF2A 3QCVH 4AY0A 3GUTA 5IW6B 5DEGB 4KH2A 1TJIH 4U05A 4PBWD 4XNMA 4LCCB 3OKDA 3BRGC 1N2RB 4ZFGL 1MH5B 4BZYA 5EUOE 2NY7H 5DD5H 5E5MB 3RVTD 3F7PC 4U6TA 3I02A 4WW2C 1NCNA 3MV7D 4PJEE 5DWUL 3MV7E 3TVMA 3MGTB 1NLDH 1QRKA 4HJ0C 3PXHA 1S7QA 1RIVH 4R4FL 4LP4A 4RMQA 4ZUSA 4XVSL 4XI5D 1IKFH 4P2OD 1E4WH 5C0CB 1VEOA 2Z35B 2D31A 4L8SA 3AROA 3BT2L 4U3CA 3MLTA 1KJMA 5DK0B 3C5SB 3PDOA 1FCCA 1IBGH 5E8OA 2V9TA 1CLOH 3ARFB 5I18H 3VXOA 1U8KB 3MNWB 3FMGH 4Z76B 1NMCB 2EH8H 5F1OB 4XWOD 1NMAL 4H25A 2YXFA 5KBNC 4RNRB 5EB9A 1TZIB 2CKNA 5DJ8B 1W72A 3ZDXF 3HAEB 3RGVD 1PG7H 3QI9A 4KKAC 5A1AA 4WFGD 1NL0L 4MXQC 3EOAB 5F7FA 3HE7C 1IBGL 1VKXA 3LS5L 1UM4H 2XPGA 4Y7MA 2Z31C 4X6CE 4HUWA 4LVEA 2P44B 4XBPB 3QJHB 1HCFX 2XWJB 4TRPH 5GSVA 3B2VL 4OZGF 1ZEAL 3CMOH 3WIHH 5F9OH 5HD8C 3GSOB 3OMZA 2BNRD 4NQEA 5EN2B 1RZGB 2VH5L 1JP5A 3TBTB 1J0ZA 4JPIB 2ZKHH 3BJLA 4APQA 4OGYH 4ZUTA 5JHLH 1UYWL 1IC4H 4MAUL 2VZOA 1IEHA 3MLSH 1KGCE 3UYRH 1RZJL 4HIEA 3P77A 1KJ2B 2YC1B 4HGWB 2ED8A 5ETUB 5DRXA 2I9LB 2WWMD 5I16A 1CICC 3O4LD 4YIQB 5J0BA 3H3PL 1H3WM 5DC0A 3H3KA 1ZA3A 3ZDXE 3RDTA 1T0MA 1T7ZA 3QUMH 2VLKE 3ROOB 4BQBA 1TLKA 2OZ4A 4UU9A 2UZYB 3GDBA 2OI9B 4DQOL 1ZHBA 2EDLA 5EULV 1CL7I 4C56E 4PJEB 4PJHB 4GKZA 4H88H 3NFSH 1ONQA 4H0GA 1VERA 1IGIH 1DBBH 3HE7A 3UTSD 1UKSA 4LPTA 3P73B 5FHAH 1BZ7B 5F6HI 3SKJH 5J1AA 4DKAA 4U1GB 3VXSD 4RISL 2WUBH 5I1JL 2OJZH 3VXUA 1OTSD 3S5LG 3IF1A 2JTDA 4HZAA 4R7DB 1GZQA 2DI7A 5DRWA 3EYVA 5FKPA 1ADQH 3HG1B 5EO9B 4DEPB 3ARGC 1WZLA 3N1MC 3DI3B 1CD1A 3FOMB 3DO7B 3BYTA 4L3CA 4FQQB 5BCAA 3NH7L 5DVMA 5IG7A 1KB5L 1BOYA 4LGPB 5SWSE 3TO2B 2R4SH 5I76B 1LE9B 1MJUH 4K8RC 3L9RA 4JM2F 1DP0A 1FSKC 2VDQH 1RZ7L 4ZS6D 3RL1B 3TBWB 1A7NL 1QBLH 4Q2ZA 3V5DA 2GFBA 3AS1A 1TZHB 4JANB 2KZ1B 2V2WA 4RGOH 1QLFB 4M9PA 1NKOA 4IIQC 1G6RA 5KZCB 2WQ8A 2BNQD 3KYKH 3QNZA 1FDLH 1JV5A 2ZG2A 3QIWA 4YBLB 3HC3H 5D2LA 3Q2CA 1YYLH 5FECA 5GISL 3QDGD 5B8CB 2RFXA 4QLRA 2MNUA 5E94A 4U1JA 4RBPK 1CLYL 4XBGB 1MCOL 5CWSA 2VDOL 2JCCF 5D1XA 4PTTA 4MGXA 1MCWM 4JJHA 3J7HA 4RGOL 4MJ5B 1XCQB 4XXDA 4NDMA 4GKOA 4XMPH 1YPZF 4ORZC 4MNHA 3OKDB 1LEGB 4WUUE 3KYOB 2J6EL 1BIHA 1FNGA 4TTGA 3G5ZB 3O3EA 4B5EA 2W0PA 5DJXA 2RGSA 4NO2B 5MEND 3LRSB 1XR9A 2E5EA 5HHPA 4Z7VB 1NEZA 1LDSA 1OARL 4PGZA 2Q8AH 3CH1B 4V2BA 2Z92A 1JTOA 1EJOL 2OZ4L 3QIWD 3WNPA 2PTTA 3P4OB 3TJEL 1I9EA 3BZFA 4FQIL 3TNNA 1JTTA 1D5ZA 3RTQC 3MLYH 3NOIA 5T3ZE 1LDPL 2OTWB 4Z7QE 4CAGA 3VFWB 4CVXA 2MOVA 5F1IA 1HSBB 1FYTB 3QISA 1Y0LB 3ARFD 3JTTB 5E8EA 4M8QA 3LKRB 1JPGA 3NIDE 1BZ9B 2V5YA 1JF1B 4LRNL 4KMQA 4OD3L 1I3RA 1YNTB 1QFWM 1MNUL 2QKIB 1TZIA 4JFPB 4JO1L 2MCPL 1W0VB 5EZLA 5T1DH 3BGFC 1NGZA 4OCYL 3QNYB 4RAHA 3FT3B 2CR3A 5ITFA 1QPPA 5IEKA 1JNLH 1WC7A 3KJ4B 3F5WB 4G6FB 4G80A 2UZXB 2W65B 2AJXH 1FO0H 3LN9A 3BPLB 5DQ9B 3WMSA 2GJZB 4GS7B 4WU7B 1MFBL 3ULSA 3H0TB 3DUUB 3M17B 4GW1A 4AL8L 2JJWA 2FJHA 1MCCA 3I6KB 4PRAA 5KSAA 5HY9B 3K3QA 6CGTA 3VGGA 3QXUA 2NY2C 1JTPA 2Q7YB 2XT1B 1VPOL 4MCYA 1CFQA 4PRHB 2A6KB 2XN9A 4GO6B 5L0QB 1J88A 1YMME 4OCXH 4Y16B 3FB5A 3V6BR 1OB1B 2R1YB 3C8KB 1A5FH 2BSTA 3QQ9C 1OSZA 4QNPE 4M7JL 1LD9B 3KNBB 3FO0L 3WLWD 1X44A 2X5PA 3FQUB 3K2UL 1UB6B 1LMKA 1RAMA 4K7PY 3ISWA 3H9SB 3LH2H 4GRMA 4WCYL 1IILE 2KKQA 4OKVB 5DHVH 3RBSA 5I1LB 4G5ZL 4MNGE 3U9PH 4GXVH 1DSFH 1OGAA 1N6QL 4PY7A 3UPCA 1VHPA 4JY4A 2NXZB 1S9YB 4XPFH 1JPFB 1QD0A 3CAFA 2PW2B 2CLRA 3AREA 3IJYB 3KHQA 4MLIA 2M1KA 2EDKA 3LOWA 4PJXF 4N90E 1TIUA 2YXMA 2Z93A 4X83A 1KTRL 1VACB 1A6TB 4XWOC 3ZTNL 1I7ZB 1HI6B 3RY4A 1CBVL 3CFJA 1FL6A 3U4EA 2RAMA 4G42B 5JIKA 3SBWA 4C56B 2H2SC 5D5MF 4AENB 4XNZC 4ODXB 5IJVA 2DM4A 4HWEL 2QADC 1HK6A 1OPGL 3MRRA 1KIRB 3J8F7 4ELKB 4JDVA 5FYLE 1F00I 4KQ3H 5EC1B 4NIKB 4PRPA 1Q38A 1G9ML 1U58B 2FATH 3DMMC 5HD8D 1KIUA 3HNVL 1C16A 5ICYA 5BV7B 2QSCL 4XC3H 4IRJD 3HE6B 1PKOA 4PJ7E 3TCLA 1ZGLB 1Q9LB 4XNMB 1T5WA 2B5IC 4WNQB 5HVGB 5D1ZB 3W82A 4GG6E 3TYFB 2WBKA 1M7IB 1UM6H 4LLUA 3WIFA 3VFNA 3C5ZD 3C8HA 4KGJA 3SPVA 5CBAA 4KKLC 4YXHL 3KJ4C 1MF2L 3V0VB 1W8NA 2XA8L 2QSCH 4NQSA 1J9CT 2PO6A 2H1PL 4H20H 5IMKA 1U91A 2E7MA 3KXFD 4F8TA 4JFEA 4HEME 4NWUL 3O2VL 1FH5L 2ADIA 3V6OA 4LPVA 3RNKB 4JREC 2DD8L 1T21A 5D72L 4YHPA 1PW3A 3QO1A 4FP8H 1VGKA 3MRJB 2IGFH 2IPKB 2XZCH 4JCMA 4HCRL 4X6EA 3EJZD 3G5ZA 3O3EB 3MRNA 4L1DA 4PLOB 4UT6L 3QHFL 3NTCH 3OJ2C 1T0NA 3GHEL 4L4TB 3L6FB 1FHGA 1CDYA 2C1PB 3FN3A 5F9DC 3X12B 1E27B 4QY8B 4U3XA 4JFFB 3D39B 4JVUA 4P4KA 1FVDB 3SGKC 4XNUL 1IGCL 3P0GB 1ZGLP 3PWVA 4MB4A 4Z8FL 3S4SB 2AXFA 2ZOLA 3D2UD 3I3BA 4M03A 1JPGB 2VDRL 4TYUA 3O2VH 3MFFB 3BAEL 1FLRH 4QTHA 1WAAA 5CKGA 2VB5A 4ZQKB 1T7WA 4CNIB 1MCSA 1UZ8B 2CJUL 3LEVL 2L4OA 3MV9E 5GRUL 2GSGB 2AJYH 2P8PB 4LLDA 1QRNA 1NCAH 1UWXH 1C5DA 5K9JL 1LO4L 4HIJA 1E4XL 1T1YA 5MEPB 5DEZA 3UZEA 2OMNA 3SDYH 3KDMA 4M5ZL 3LEYH 5IEKB 3BP4A 2I24N 5K9KB 3QEUB 2ORBL 5IQ9B 5FUCE 5HYSB 3ULUH 5JOFA 3ULSB 1AFVL 4UUJA 5C0DB 1P9MC 2J8UF 2YUWA 3EDDA 5LAXB 1XMWA 1EIBA 1WAAE 4NHCH 1A7RL 3T3PE 4HULB 1U95B 2EH8L 1MREH 3C6LD 1N26A 1IGYB 3WO4B 4AEIL 2EYSB 3GSXB 4Z78B 5C0JA 1FFOA 1OT2A 2KH2B 4KJPD 1RJZA 4LU5H 5CP3H 3E0GA 3C6LA 4KKCC 3VFRA 5F6IC 5IM7B 2HMID 3L7EB 4WY7H 3RX8A 3MPCA 4U7SA 5L9DH 1R6VA 4GW5A 3QIUA 1BHGA 4OT1H 2AJ3B 4LDLB 4PB0H 3TT3L 4L3EA 3MC0A 4EI5B 4JN1L 2CUIA 5D7SL 1LO3H 3VXTB 4O2CA 4ZTOH 5CGYD 5DLMH 5HYJD 3T08A 5FKPB 4JHWH 4U0RC 1AFVH 4ZFGH 2F8VA 1PD6A 4GG8B 1H3PL 1AKJB 5I19H 15C8L 4OT1L 5EPMA 1AGBB 1OGAE 1MRDL 4OLEA 5I71B 1X5KA 3BP6A 2HWZH 2JJTA 4G9FB 1KTDB 3GM8A 3G5YA 3DHJA 4Y5YC 1JWSA 2EE9A 4NKQB 3DTXB 4HG4J 4HT1L 1QR1B 1ZVHA 4Y2DD 4KROB 4U1LB 4FQLH 1QFUL 3DRTA 3NIDF 3W9EB 5I30H 3C87A 3TA3C 1P9MA 1MEXL 1CYGA 1QLFA 1RHHB 4DW2L 1Z9OA 3DVGB 1WLHA 2WSKA 1KEMH 5JOEA 1H5BB 2ZOKA 3B9KC 1GC1C 4FG6D 1TFHA 4GLRH 5EA0L 5I1AA 4O9HL 2ATPA 3TFKC 4JM2D 1WZ1H 1YMHB 4HDIA 1R3HB 3MMEA 5H94B 4LLAA 1AC0A 3RPIB 1BQHA 3DUSA 3GSQB 4K55A 1HILA 4AEHL 4TSCH 4H1LG 2HA1A 1QNZH 1LO5A 1TCRA 2CIIA 3KXFB 3RWJB 4HUUB 1HSAB 4YHZH 2IH3A 5E4EC 4OUUA 4LSQL 3HUJA 4WWKC 5E2VH 2FX8H 2ATKB 5E7BA 3C5ZB 4UAOB 2QHLA 5DUML 3SDAA 3EZ8A 2AK4B 4O02H 4TQEL 2WINB 1XF2A 3KPTA 1KB5H 3MYJA 3AFLA 3HAEH 3O45A 1WFTA 2JLLA 4I3SH 4KVCH 1FNFA 2COQA 3O6MH 1GRWA 1N0XH 3MRGA 3W0WB 2I60H 4ZAKB 1ADQL 3NFPA 3BRFA 5ENWB 3KLDA 2EKSB 2FLRT 4BFGA 3RDTB 2P46B 4RFEB 5BRZB 3AY4C 2HJKB 4OFVA 1Z0NA 5IGXH 1YEKH 2ZSWA 1X3DA 4EN3B 2LU4A 4G43B 3X12A 1NDMB 2OLDA 4PJBF 3Q6GL 2D2OA 3VFGL 4BH7B 3DROA 1JGEB 2YK1L 1J12A 2YUVA 4ALAH 4M62L 2HFGL 4GRLB 1LK2A 4OLXL 1CFTB 2IAMD 3L7FB 4XPHL 5E00B 3OKOA 4GH7B 5IFAH 1A2YB 1RU9L 2J3SA 2EECA 3G6JF 4X0KA 3KWWB 4U1IB 5LQBL 2GT9B 2YBRA 3DHMA 4G3YH 1FAKT 5IB2A 2NY0D 2YEZB 5DRWB 1NFDE 2ZP0T 4LSTL 3L5JA 2DQCH 2DQTH 3O2DA 1X4ZA 4HBCH 3CVIH 4OUOA 3K8LA 5E6IC 2X1XR 4PJCF 3WIIH 1BFTA 5D7IE 4AM0B 1DN0A 3EYSL 3ZE2F 3HKFA 1FRGL 1S7SA 1K3IA 2XG5A 1RU9H 4YHLH 4OZIB 3L3JB 5JOFB 4OGXL 2X7LA 4WEUD 5KVDH 5A40E 3RL1A 4JVWA 4K7FA 1JK8A 3JWDC 5CJQH 4OLWH 3O4OB 2ERJC 3ZLQC 4N1EA 2BFVL 1ZHKB 2DQUH 5DZLA 1P1ZA 1G6RB 1EMTL 2AW2A 4KZEH 5ICZB 5F3BB 1HYSC 3VWJA 4NPYA 1S9YA 2O5YH 3DETD 4ENED 1ZA6B 3IRZA 1T2QL 4F7TB 1T7YA 1YMMA 5CD5C 1OTSC 3NCEB 2LTQC 3LQMA 4ZUSB 1MRFL 4J3TA 4XBGA 1NDGB 3BEVB 5FYLL 3QUMB 5K59E 5D5ME 5D7KD 1U2HA 3ARYA 2IFFL 3PDOB 3DYOA 5IKCB 1ZHNA 5MI0B 5GS0D 1DZBA 2AEPH 1N4XH 2YOCA 2BHYA 4OZGE 4P2OB 3S5LA 3OF6A 1F45A 4Z76A 3G5VA 4OD2A 3OG4B 1TNNA 1AKJA 2FEDC 5DJ0B 4Y2DB 4PYHA 4KK8D 4JRXB 4L8DA 1IKNA 1AI1L 1MHHB 4ZFZB 4JKLA 4KAQL 1ETZB 3G5YB 1VKXB 3AXLA 1EDQA 4JFYB 4PV8A 2A77L 4ZUUA 4JKPH 1KTKE 1U8HB 3UTZA 4WRLA 5D7IB 1ZSDA 4WNQA 4XNXH 5B21A 3QDJE 4ZO9A 1MI5E 3ALXA 4B53A 4FQHB 4LSSH 3MRPB 3WL9B 1IEAA 1GGCL 1RJLB 1A7QH 1P2CB 4JFFD 4NQSB 4Z7WF 4N8VB 1LGVA 2ITCB 1FLTX 2C3GA 1QBLL 2OZ4H 1S9WB 3SE3C 1Q1JL 3FO1B 3K4ZA 2FSEB 2XXMB 3GSRB 4JDTH 1A64A 3VG0L 1MFCL 1I7TA 4YPGB 2V2TA 4M00A 2AI0H 5IB4A 3U7YH 4K8RD 2BVOB 5FCUH 4X6BB 2VABB 3RTQD 2HFTA 3QDGB 2F54D 4MA3B 2JB5L 3IXTB 2IQAA 4NNYB 2HJFB 5A2FA 1BVKB 3CC5A 4BFEA 2NTFA 1KEGH 4L8CA 4FNLH 3MRFA 2FX7H 5ACZA 5IF0A 1E6OH 2BSRA 1UH2A 2BX5A 2E7HA 4FOMA 4NQDB 1DBJL 3PWNA 4N8CL 1UVQB 2VLJB 4I0PD 4JY6A 3UMTA 2EYRA 4D0BB 4K9EL 3RIAF 1BJ1H 1J0IA 5EZIH 2P8PA 4LLDB 2O5XL 3CFEA 2JJUA 4M6AA 5DEFB 4EDWL 1I3GH 2ZUWA 1CE1L 1A4KA 4JY4B 1DSFL 4FNLL 3R8BB 3GMQA 5HPMA 5EZJA 5CUSL 4TVSa 3F58L 2Q8BL 1HHIA 2ZZUT 1T5XA 2CDFA 2J88L 3NGBB 3P3YA 5IR1B 5BZDA 3JV5A 1PZ5A 1N5AB 2RCSH 3SDXA 3U0PA 5D5MB 4U1IA 3SDCA 4HCRH 1RZ8B 2P24A 4X7TA 5KJRL 4OBSA 3U4BL 4ZFFA 5EBWA 1SEBB 2EE3A 2FBOJ 3IS0X 1FFOB 2NX5B 1CZ8L 3HB3C 2QSVA 4NWUH 2A1WL 5F7YC 3TIEB 3UAJC 5DHVB 4PLNC 5B8CA 4IDJH 5C0RH 1KN2L 4PJFE 4JM2A 2O5XH 2N1KA 4UDUB 1TZGH 3HS0B 4AL8H 4M5YH 4PJCE 2XYCA 3HUJE 3VFOA 1FGNL 5IBUG 3P9MA 4IRSD 4ISVB 2WMPA 5FDWA 4U6YA 1JZ4A 3SKMA 4I18C 3GSVB 4HKZA 4YZFF 2GCYA 4OLZL 1ZHKA 1PG7L 1AQKH 4LU5L 3WXVL 2PYEE 3OR6B 5E9DE 4M7LH 3VXMB 1TJGH 4NN5C 3S37H 5TDPA 3GI8L 3HI6H 1A7RH 2O5ZL 2R29L 4ONFL 4MNQD 5EIIB 3BUTA 4ZNEA 4CU8A 4GAGL 5JA8B 1YPZA 5FGCE 3VWKB 5IMOA 1NJ9A 1ZK9A 4KKNA 4QRRA 5MI0C 4CVXB 3I2CH 3EYOA 4EJ1C 3BD4A 5C0BA 1LEIA 1UJ3C 1QSFD 2APBA 3G6AB 5FO9A 5BS0D 3QEQD 3MRNB 2VDPL 2XTLA 1HINH 4K94L 3DMMD 3PWJA 3HMXA 3KJ6H 4BH8A 2IAND 3U46A 4M93C 5ADPL 1XIWC 5F3HA 3MJGX 1P69B 4WEMB 1QSFE 5BS0E 12E8L 5EU4B 5HPOA 5DVOA 4LHUB 4UV4L 2BHUA 1A1NB 1BGXL 1NL0H 4MJIE 5C0GA 4NFDA 4Z7OE 5EBMA 4UIMA 4JFYA 1KFAH 2HTLD 2CRYA 3BWAB 3MXVL 1KCRH 4FFVD 1QFOA 3PABA 3EO1A 4WU5A 1MLBB 1SJHB 3SGEI 4OCNC 4PRIA 4MD5A 1A4JA 3RWFB 1JYVA 4LEXL 3UDWC 5INCB 3I6KA 4PGDA 3DX8A 4B50A 4WY7L 3T3MF 1K8DA 5HYFA 4XNYL 4U6VL 2FO4B 3O9WB 4QHKJ 2ARWA 1LP9B 2NTSP 3O2DL 5DQJA 5GGQL 5TQ2H 1KG0A 1R5WA 4KU1A 1U3YA 4NQUA 5DVLA 4MXVE 3D3VD 1A02N 4P4KC 2EC9T 2NR6C 3B3IA 4N9GA 4UUJB 4FQJH 2UY6A 1KLFA 1J05B 4GQPH 2OSLA 5I30L 3BW9B 3U36B 3DUHA 4JRXD 4DKEL 5I18L 2X9YA 4WV1A 4XCNA 2DL2A 1OGAB 1MHEB 2LU3A 4KI1A 3O6FB 3OKMB 3VE0B 1XIWA 3MA7A 1U3JA 5J06A 4OQTL 4EQ2A 3QHZL 3VFRB 4F8QA 3O3DB 4LGRB 5IM7A 4YK4C 5M94B 2FCBA 2W1NA 4ODUA 1U93B 4O4YL 1VACA 3C6LC 1LNUB 3SDDC 4RISH 3IU4H 1E28A 3Q5YA 3M8OL 1Q9WB 4UQ3B 1DEDA 3NCJL 4GRLD 2HFEA 1VA9A 4XZUA 5E1AA 4YHYB 2QADB 3OKNA 3ZKNC 1YY9D 5D7LE 5IBUB 2DBJA 2VDLL 3ULUD 3U1SL 4DVBA 3TN0D 1UQSB 5GGRA 1MCLA 5C2UB 4PJXA 1MY7A 2NX5E 4OZIA 4QRPA 1WJ3A 3TT1L 3LIZH 2NY1D 1JK8B 1SVCP 5KVEL 4F7PA 5ANME 4YHML 2R0LH 4LSQH 2YPLE 1T89C 3W11C 1N3NA 1F4AA 1P1ZB 1MAML 4QKXB 4PV9B 5FA3B 3CDYA 3S3JA 5FHBH 3IDIB 2EIEA 2VAAB 3LY6A 3O9WD 1FNEA 3DURA 1P7HL 3BXNB 2AKRB 2AEQL 2C3HA 4XCFL 1BAFH 2YRPA 1EBAA 1Q0XH 3UTSA 3A67H 3B9KA 4O9HH 2BFVH 5KS9E 3HAEG 2H2SD 3ECBA 4QT5A 1RZJH 3CFCH 2XKNB 1K2DA 1JMZA 2CKBL 2IPKA 3WN5C 3QUKB 4P46D 4OIBA 1LE5B 5JLZB 3TIDA 3EYFA 1D3CA 1Z6JT 4APQC 3OHXA 4JFFE 3NPZB 3W5NA 2VKXA 5T33L 3FKUS 5DJ0A 3ROLB 2VL5A 1G7HA 3L6FA 3U83A 4I0CC 4L8DB 1OSPH 3IVKA 1JGVH 3PWUB 3KPRD 2IPTL 5E2VL 3SDAB 4MAYC 4MMZC 3QDAA 2P5EB 1XAUA 4NT6A 3TBSB 3QUXD 3AAZB 2A6IB 1A6ZB 1NC2D 2IG2H 1UXWA 5KANG 4NQXA 4JFDE 5E70A 5GS2D 1TTGA 3W0WA 1WWWX 1WQVT 1FBIL 5L2JB 4OSUL 3S96A 3RL2B 3TO4B 3LMJH 1YNLL 3KLAB 4YHKH 2RJMA 5DVKA 1JGLL 1K9TA 2DDQH 3WYRA 5ESAA 4CVZB 4XH2A 5J9PB 2GK0B 3EDFA 3V6ZB 3T0WA 5I9QC 2GAZA 4HIJB 4U1KA 5DZNA 3PP3H 1E4JA 1A1NA 2R1WB 5DD1H 4X9HA 3FHAA 4M3JA 1SMOA 7FABH 2KPNA 4DZBB 1IMHC 3BWAA 4FS0A 4DW2H 4QHNB 1WFOA 4C4KO 2EEDA 2Y07H 1EJ6A 4X6CF 2C7UA 1DQDL 2PUQT 1RUKH 5D71L 1ZHLB 1KIPB 3VRJB 3IDGB 3SJVB 4G6AD 1TQCC 2Z9TA 3MV7B 4U1MA 2YEZA 3BZ4A 5C7XH 3Q1SL 1DQLH 1YEEL 3QWRD 3TBVB 1RY7B 2A74A 3MSPA 5I1EH 2LVEA 5JHLL 2DIBA 4PBVC 2FH8A 4GG6B 3P77B 4JKKA 1Q72L 5HYIA 5I1JH 2B39A 4NRXB 1ZLSH 3RZCA 1VFBA 4ZFOA 2Z8SA 1M7XA 3N1GC 4YC2C 2HAZA 4GW5B 4IMLA 2DJ4A 1FZMB 1ITBB 1WTLA 3B3IB 4HS3A 2Q7NA 4X5WA 3O6FD 5L6YL 1EJOH 4K7FB 4I48A 3BW9A 1CICD 3T4AB 2ADFL 2MHAA 3FB6B 1UA6H 2A6DB 5E2UL 3GI9H 3OKLA 1I9RH 5SWQA 1KB5B 1MLCA 4HIIB 4PJEF 4PJHF 5I1EL 3FT4B 4GG8A 4XP5L 4OFYD 2WBJA 1XF3B 3QXAB 4P23C 4UT9H 5D1QC 5EPMB 2X09A 5T1KD 3GMLB 4UTBH 4YNYB 1D9KD 5C0AB 2R69H 2WANA 1BFVL 3EHBD 2CDFB 1NBVH 1OD7A 4XAWL 4PGEA 4PD4J 5HTSA 4OF3A 2XXCB 1YECH 5C3TA 3UZQA 2P7TB 5JW5A 3ARSA 1EGJA 1IAIH 1RUQH 3BI9X 2EDFA 4JM4H 4I0KA 1R3IH 1JF6A 1CL7L 4ZODA 3OKNB 4BYHA 2RB8A 1MRFH 3QIBC 2QHRH 4OZHA 1YA5A 3ELAT 3IFNH 5SX5K 4HUVB 2AJZA 3GB7B 1IC1A 4ODTH 5DD3L 5C6TL 5J56B 4Q7DA 1ZS8A 4JM2B 5AZ2H 3CXDH 2EDEA 5E8OB 3NAAH 3O0RH 4OFYA 4QF1B 1OCWL 3MNZB 5IOPA 2HKFH 1EZVX 1CK0L 1HIMH 1RV6X 2V6HA 4R90L 3SKOB 2Y36L 3BPCA 4D9RD 3V5KB 4ODHL 5C09E 5A2JH 3RA7L 4OIIH 4OZFB 1QKZL 1N2RA 1QFWH 1BM3L 2EIZA 2X4NB 3X13A 4Y5XC 4YO0B 5F89A 2E9JA 2PW1A 4M93B 3KXFA 3LPWA 2W0FA 1TZGL 4W4OC 4EQ3A 3W9DA 3VFSB 1IT9H 1U8NB 4P2QD 1QSVA 2PYED 4PJ7A 4I3GA 3ILQD 2BMKB 3FO2B 5CGYC 1CZ8H 2GY7B 3FB7B 3GSOA 3CDGA 4Y1AA 4OCSL 1U8OB 4XPAL 2X89A 3BPNB 3MLTB 5DD3H 1WF5A 3SE3A 2VISB 1Z3GH 4PJ5A 3UJTL 3BKYH 2CK0H 5HGBA 3EYOB 2W9LA 2IGFL 3C5JB 2FH6A 3FRUB 5FO9B 1NKRA 3BMVA 1MPAH 5IBLC 1F2QA 1OP5K 5DJXB 3HUJF 2A9NL 4X4ZA 1I7RA 4PRPD 3STZB 4WTWA 3LKPB 5IV2A 1R5VB 3JUYA 2AI0L 3U7YL 2H1PH 3E3QE 1QYGH 1AXIB 5BO1H 4F7EB 4M48L 4ZTPH 5KZCD 4WTXA 4P59H 5E8PA 1CBVH 4G43A 2O93L 5A16A 5DT1L 4NC0B 3VMNA 3OKYA 1HEZA 2CDGB 4HH8A 1MCJA 4M61A 2IQAB 2P5EA 3AY4A 3TBSA 1V5JA 4YXLH 5DK2B 4HK3N 3QDJA 3ARBC 3LKSB 5IFJA 1HH6B 1CDBA 2VAJA 4LSUH 3OAZK 1WV7T 3FT2A 1IZKA 1DR9A 4R0LA 1C7TA 2F8OA 3CVHA 4R2GD 5E8NB 1YEDA 2ENSA 5C0BE 5LBSH 1OGAD 3KWWA 3NN8B 2VUOA 2P5WB 4P4RA 1BD2D 4M6MH 4XWGH 2UWEE 3GJFA 3RVXC 3KPSD 1X5YA 2LE9A 3NCYP 4Z7UE 3TH3T 1F2XK 2DI9A 4KV5F 1A1OB 1NMCC 35C8H 4M6NH 1KCRL 3VXPA 2L0DA 4I2XB 1HHKA 3B2VH 1MWAH 3MV9D 3VXUB 2FEDD 3HI5H 4ORGB 5C0CD 3GRWH 1WIPA 1H15A 4I0PC 1EV2E 2HTKC 3NCCB 5D9SB 3BUYA 5LBSL 1YYML 2AJXL 4FTVE 5C0EA 1DUYA 4Q6IC 2UZIH 1D5MA 1N5AA 3D69B 2B0SH 1N8ZA 4X4YA 4TSAH 5K9JH 4Y2OA 1OW0A 2FJHB 3D18A 4PRAB 35C8L 3MRDB 4LIQH 1FZJA 4X80L 1NMAH 1NCWL 1MREL 5JW4Q 2HJLB 5C1MB 1AR1C 4MD0B 4P5KB 5F3BA 3L3KB 2CD0A 2G60H 3MA7B 2NY4C 4U2ZA 5EORL 5IVXE 3GFUA 4ZFOB 5KJRH 2DICA 5FB8A 4YE4H 1A6VH 3BGAA 3MV8E 3DSNA 4LIQL 4LLQB 4D3CH 5IK3B 3BDXA 4U6YB 2NPLX 3EFFA 4R0LC 1G7JA 1ZEAH 4EXPX 5DD6B 1RZFL 4OKVA 4U1NB 1C08A 5JW4R 1G6VK 1HWGB 4KK8C 1N59A 5DUBA 1AGDB 3BPOB 3KPSE 4XCEA 2BOCB 4UT6H 3CUPB 4EN3D 1FAIL 2DS4A 4XMKH 1JNJA 2FJFB 4ZOEA 4YE4L 1JNNL 2VXTH 3FHQA 5ID0B 1L9NA 5I76A 1MJ8L 4PGEB 2G60L 3V95A 1MIEL 3MX0A 3RDTC 4MD4A 5EO1A 3LB6C 3DXAA 2OK0H 5IEHA 3MROB 4HPYL 1QO3B 1MF2H 5TDNA 4JFQA 4RAVA 3VI3F 3RNQA 4OZHB 5CZXC 2VXTL 3T0DA 4CN4A 3GMRB 1BOGB 1CFSB 5D2LB 4O2EB 1P2CA 2Y23A 3UYRL 2DLEA 5TH2A 3WLWC 5CEZE 5IB1B 3OXRA 3LDBB 3I6GA 1Z9LA 5FUZH 1LO4H 3QPXH 4K94H 3HE6A 4JGJA 4L5FL 2ENYA 1NFDF 4TQEH 3VXSB 4YDKL 2WLZA 1T5WB 4Y4FC 3HC3L 4JG0H 5ITBL 3H7BA 4X98A 3T65B 4MYWB 4IRZH 5EU5A 4L9LC 1VENA 5IB4B 4LLUB 2BNRA 2YPKA 4BQ6A 3O3BB 4KRPC 4F80A 2XQBL 1AY1H 2DWEB 5EU6A 3ARDB 3CXHJ 3UROR 4TULH 4I9WE 4OAWA 1YPZE 2PTTB 3P4OA 5F9OL 3CMOL 1SM3H 2GTZA 1RK1B 5DLML 1R5WB 4L8SC 1OTTC 1EHNA 4A2LA 2NYYC 4HWNA 1KPRA 1L4IA 1BECA 3NCMA 1D6EA 4Z7WE 4Z0BH 4DZ8A 3JV4B 4QRPD 3LZFL 2XNAA 1BZ9A 1JUFA 4PRHA 5GGQH 2R2BA 4EZMA 2EYRB 1F3JA 5SWZA 4CMHC 2D7TH 5E2WH 4NKMA 2ICCA 5AEAA 1CQYA 1FYTD 4WTZG 5E6IA 4HX1A 2XA3A 5MEQB 1AIFB 2LFGA 4U1KB 3FT3A 1LD9A 4FQLL 1EUUA 1XH3A 1JNHB 3HC4H 5E2TH 5I74C 4XP6H 2FYYB 3ZL4H 4XPGL 1F11B 4RIRB 4K8RH 3KLHD 4KDWA 4FZ8H 1KJVB 3P4NB 4D9QE 1UKTA 1I8IA 5DJCB 4KZDH 5EU7C 4EXKA 4P2YA 1PGRB 3M17A 4GW1B 2Z0BA 3ES6B 1XF1A 3MFFA 4G9DA 2BSSA 3O6LH 3EUUA 1HQRA 3MOQA 4PJGA 3VXUD 2ARJQ 1DN2A 5DJ6A 3P30L 3SKJL 4ODBD 3JBG7 4I2XA 4ZUWA 4JFZH 4NOFA 1MSPA 4JPKH 1JVKA 2OXHA 2VLRE 1CGYA 2G5BB 3ORJA 5C0IA 1FL6B 2P45B 1OSZB 2QL1A 3EJZC 3BP5B 3O81A 5JPMA 3SDXF 4ZXBB 3K8KA 3MGOA 4HF5L 3SKUD 5GGVH 2CXGA 1WCBA 7FABL 4RZCB 3DLQR 3SKMB 3TT1H 3GBML 5I19L 5FF6B 3U9UB 3PHQB 4GBXA 4R2GB 3IETA 1EEZA 3UTTD 5CJXA 4KRMB 4P2RD 1C16B 2PR4L 5FOBA 2ZG3A 4O58L 3FQTA 1AQDB 4ODSL 4KI5E 2A77H 1JPFA 5KW9L 3H3BC 5J3HD 3WXWH 5GHWH 4NKDB 1FBIH 3K81A 2N7BA 5I1DA 2DYPA 1RQ5A 1I7ZA 2A73B 4G5ZH 3JV0A 5B3JF 5HYJE 4R4NC 3W39B 4PY8J 5BVJB 5DXWA 2DB8A 1RZ7H 5ISZB 3U7AA 2OR9H 3BRDA 3V0VA 1I1AA 1M71A 3QPQD 2ZUTA 2FHBA 3VGFA 4IOFD 4PRDA 4CVWA 3REVB 1DVFD 3GBMH 2ICWA 3BDBA 2VLLA 3BPOC 3UPRA 3QQNA 1GGCH 5FKAA 3W81A 1HNGA 2ED9A 2W9DL 5EBMB 3EKCA 1NEZG 4PD4K 1X6NA 1ZWIA 2E9BA 4BFBD 3WFHB 3T1FA 2AGJL 3LSOA 2WIIB 3WNOA 1CDCA 3UC0L 1OY3B 1RHHA 4Y2DC 4QYOB 4I77L 2VC2L 5DMKB 1UWGH 3FL7A 4YFEA 3MBEC 5FYJU 2VDKH 4P57A 3VD7A 8FABA 4JRYB 3O11A 3KYKL 2BC4A 4UOJA 2NX5D 3W9DB 5HI4D 1F58H 2ZOKB 4YLQT 2IG2L 3STLB 3HHRB 2X4RB 3MCLL 4CVZA 5EOCJ 4HK3J 1A7BA 3NCBB 2VO5A 4PJDB 1M05A 4TUKH 1O0VA 4ALAL 1I8MA 1JGVL 2Y06L 3IKCA 4OD3H 4HXAL 5F7HA 3EOTH 1UWGL 3U6RA 4JFXB 4LBEB 4MS8C 5CSZB 2F9BT 5FYJL 4M8VA 2HKFL 4QXUL 1CFVL 5GISH 4HF5H 4C55A 1UENA 3OAYH 1JMXA 3KYNA 3ZKMC 1DQQB 2XWBB 4P9HL 3B8SA 4HMEA 3QEQB 1QFHA 3D3VB 1S7RB 5LCVL 5I75C 1MIML 1MHEA 4JM2C 4ZDHA 3MRBA 3ILPA 5HYSA 3EOBB 2P47B 2VXVL 2FJGB 4M61B 4ONHA 5EU6E 3ZDYE 4F7MA 4XVJH 3LKNB 3ZE2E 4YHOL 2FD6L 3SDCD 3QXWA 1R3IL 1AXTH 3X11B 3KPNA 1QTYT 1J7VR 5HYJB 4UDTB 3FZUC 4JZNA 4RGNE 4KHTL 3VWJC 4J2XA 4MZ3A 3B5HA 4CW1B 3GJFB 3TFKD 3BKJH 5D2NE 4QRQA 2MQCA 3L7EA 3LEXA 4EN3A 5DK3A 4WJ5A 2Z35A 3DX7A 5CD3A 4R90H 5I1CL 4H8WL 4B7LA 4M9OA 3OXSA 1UA6L 1VEMA 4DGYL 2W59A 2UWEB 4LVOC 3JWDL 2DLTA 4ZO7A 1GHFL 4JR9L 3QUYC 4P3CH 1F3DH 3UTSE 3BVNA 1D5MB 4MQSB 5BJTA 4MAYD 1UACH 2CLVB 3STBA 3V4UL 3JZ7A 1E0OB 3TCXA 3ZZ1A 5D2LE 2R8SL 1U92A 4Z0XB 5KAQF 5I74B 5I1IH 3OR7B 1JJUA 1JWSB 1OAUL 3L95B 1U8JB 4UTAL 3E8UH 5C2BH 4OZIF 1U6AL 2BK8A 4U0QB 4U1HB 2BVPA 4ODTL 5GSVB 4FXLA 3BHBB 4UIKH 3D39D 3H8NA 5IROA 4HWBL 3D3VE 3VXRA 3QEQE 3K1KC 2X1PA 4NZRH 4MA1C 5F9JA 3ECBB 4LLQA 3VI4F 4M7KL 1DBMH 2CQVA 2I5YH 4NDMB 4IEFB 3KPQB 12E8H 2X4NA 3E6HB 4WVRA 4P59L 1MCPL 1DFBH 4KDTC 1PQZA 5HHPB 4MNQE 5J13C 4Y4KB 2ZUSA 1NC4A 1EMTH 1G7HB 3WLBB 1U8NA 3MRQA 2VDPH 3T3ME 3IVKB 3PJSA 3FO0H 3FCTB 4EKXA 4JO4H 2JCCA 4NKDA 2JELL 4R97C 1NEUA 2JJSA 3D85B 3SGJA 1MCQA 2ZCHL 2Y5TA 3ZKND 3PWLB 1R3LB 2VDRH 3NVQA 2Z8WC 4U1LA 5I8OH 3MV9A 4NQXB 1BMGA 4MDIB 2VITA 3RUGE 5HGBB 4XC1H 4NKOB 5TDNB 2X2YA 2PXYC 5EBLA 3FAWA 5GS1A 3BPNC 4JB9L 1N4XL 1OF2A 1UT9A 1RULH 5C0CA 1I3RB 1YNTA 3QB7C 4PIRF 5CJOL 2WINA 1ONQB 4P49A 1FJ1A 5J1TC 3K2MC 1HNFA 4BM7A 4D0DB 3C5SA 4DGIH 4Y16C 1BZ7A 3S4SG 5FKAB 4S1SH 3HE6C 5I8OL 1NBYB 3F5WA 4P46C 2MMXA 3U4BH 3GBLA 1CDUA 3NCFB 3RGVA 3T2OA 3LKSA 5IESH 3QRGL 3IDYB 4QEGA 1JHLH 1BLNB 5GZNC 2HT4C 3WIHL 5I15L 4UAOC 5C6TH 2ZJSL 5EOTB 2I27N 3CLFH 3SCMD 2WWKO 4QRRD 3D0VA 4U7KA 1T04A 3DXAE 3QPXL 5C0AE 3C5ZA 1EFXA 4YXHH 3PV6B 3R0MA 1MUJB 4Y0GA 2QEJA 4PRID 4QOKE 3BMWA 2NY0B 4PJAA 1L7TL 2J8HA 1TTFA 1S5IH 3C8KA 4Y5VB 4NP4H 2JB6B 3PGDB 4X6CA 4TOYH 2VQTA 2VTFA 4S2SA 5LG1A 3KNBA 1BVZA 3T0BA 2J2ZA 3JV4A 3RUGB 3QNZB 3QA3A 3MJ8B 3C60C 4OTXL 4X6BA 4P5TC 3VFMB 2BY3A 5DGQA 4HWEH 2ZUUA 8CGTA 1HKFA 4N1HB 3MO1A 4TSBH 5ELIA 1Z3GL 2M8XA 5KVEH 5LGHL 1MCEA 1XCQA 4XXDB 43C9B 5FIEA 3INUH 2W60B 5FB8B 5E00A 3MRFB 1R3JA 4GAJL 4E9LA 1CR9H 4O2FA 5F96L 5CEXB 4X0KB 3BD3A 1CGXA 5T1KB 1P5VA 5I71C 2IALA 3QDMB 1F02I 2GT9A 4TNWK 1TETL 2Z8RA 3N0PB 4PJHA 4KKAD 1IM3A 3SDAC 4CJ0A 2D3VA 2HRLA 3GK8H 4U31A 4BSWA 2BSED 4FQ2H 3TVMC 3QUMA 3OJDA 1F4XH 4HMCA 3KS0J 2DQGL