1AP2A

Single chain fv of c219
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
112
structure length
112
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSGNQKNYLTWYQQKPGQPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGAGTKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY C219
publication title A single chain Fv fragment of P-glycoprotein-specific monoclonal antibody C219. Design, expression, and crystal structure at 2.4 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 27
structure length 112
sequence length 112
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ap2A00
3OR6A 2QHLA 5CJ5A 3HB3D 3GJFH 4LDOB 3ARGB 2OX5A 5KSAB 1KG0B 5HGBB 1E4JA 4PP1C 1IAIM 2X89D 3HZYB 5IW1A 1NCBH 3IFPA 3QULA 3ILQD 3MJ7A 1V5JA 4DKFL 5D5MA 4PY7B 3RY4A 5FUCC 5L2KD 2EDFA 2A0LC 4QYOA 3BEWA 1JBJA 4KJPD 3GB7B 5GSRA 5A2KH 1C5BH 2H32B 1C12B 3VD4A 4HEME 2IBZY 4XCNB 3SKOB 2BOCB 1PEZA 1TQBC 3CH8A 1I9RH 3B9DA 4NOFA 1I8MA 3ZKQD 1F90H 2DQJH 5BOPA 4KI1A 2GITB 3KNBA 4PJDF 1GIGH 3MYJB 3RWEB 2XWTB 3NZ8B 3HCVB 4NRXB 1R0AH 4PRBB 1I8LC 5FAAA 3C2AL 3EJZD 2ZWLT 4ZFOL 1KJ2H 3STLB 5GS1A 2YC1A 3U0PA 1I4FB 1IGTB 4S0TD 5HHVL 3GKWL 1QLFA 5ANMA 5IBLD 1R5VB 2BVPB 1SEQL 4M48L 2BY1A 5GZOC 1ZE3C 3RDTD 4O2CB 1SYSA 1IEBA 5IJKC 3OV6A 2DKSA 5T3ZD 4HC1A 4X80L 4NQEB 4W68A 3RWGB 1RZ8B 2ZOLB 2A6DA 3LB6C 4QHUB 3UYRH 4U2YA 5B3JE 5GRZA 3CLEH 4PRDB 1BJ1H 4WW2C 2ZUTA 4YDJB 4Y2DA 1B2WL 4YR6B 1I1AB 3GZKA 4GAYA 1MHCA 5F6IB 4QTIL 2DM3A 1ZGLB 3CK0L 2NY0B 3RAJH 2BVTA 1B0WA 2GYSA 4KY1H 2XN9D 1MSPA 1FV1A 4JRXD 4DGYL 2E8ZA 1P7QA 5DMIH 5J9PA 1HOCB 2IH1B 3RY6C 1T1WB 5I8OH 3NFPA 4X8JA 3TH2T 4WENB 4WEUD 5CS7A 4YFLI 1KFAH 4UTBL 1AXSA 4P99A 1X44A 2BRQA 5A40E 1FFPA 4ZUVB 3QI9B 1J8HB 4XVSH 5KSBB 4WV1A 4OCRL 3AAZB 4LHUB 5E2VL 2WUBH 5DD1L 4JDTH 3O3AB 5E2TL 5I66A 2X4PA 1JWSB 3UP1A 2XPGA 2CMRL 4NWTL 2NX5E 4ZUWA 1YMMB 4EOWL 2FHCA 3RJDA 5I8KH 4HUWA 3OKOB 4Z7WA 1E4XH 1P5VA 2VQ1A 1HK6A 1NJ9B 2BZDA 1M05A 4M1GL 1UG9A 1BWWA 4NKIL 3T2QA 1IBGL 1P4IL 5T3XE 3H6JA 4PJGA 3HPJA 5FUZL 4ZFOB 5EO9B 3HB3C 1HHJB 3I02A 1D9KB 4C83A 3W0WD 2D31B 3GI9L 1A22B 5C08A 1C16B 3ILQC 3MRJB 1RZJL 3VMPA 4JFYB 1UJ3B 3ILPA 2EYSB 4OD2B 5HYEA 4KJPC 5DYOA 2IPUG 1IQWL 1GGTA 4RAVB 3VXME 4U1NA 3GSNA 3UZQA 4ZPVB 1NMBL 1YEKH 3RTQC 5JLZA 1VHPA 3ZLQC 3QQNA 2EE6A 3DMMA 4WWKB 1FZOB 1UB6B 3B4NA 3C5JA 3QNYA 4JJHA 4OZGF 3TEUA 1LILA 1R3JA 4PJXA 3SQOL 3WUWA 5I19H 1CGWA 5I1KL 1UENA 3U7YL 4HBQA 4HKJA 3VMOA 4K3HA 3EJZC 5FF6B 3V6ZB 1PSKH 2UY7A 4NM4H 4P48A 4M8QB 1AGBA 5GGSB 3HE7A 3ETBF 5C6WH 3REVB 4HF5H 4G8GE 3PWVB 2VAAB 1JYWA 1YEDB 1KELH 4QHMA 3A6CH 3P73A 5CBAB 4RGMC 1I1YB 2VLJE 4YHPA 2IPTH 4QTHB 3RDTC 7FABL 4QRSA 2AK1H 5KSAC 2VXQL 2B1HH 3TT3L 3MV8A 4LDEB 2FGZA 3C6LA 5GGVL 1B6UA 1U58B 1R5WB 2ZUQC 3MLXL 3WJJA 2EH7L 1WCBB 2AJUH 3D48R 3STZB 4B0MM 1WZKA 1XT5A 1JV5B 4OQ1A 4LASH 3KPLA 1ACYH 1NCCL 1DVFD 1KB9J 3WLBB 2Y72A 4JCLA 2WWKO 1QSFA 1WFUA 2MTPA 2QKIA 4FQJH 1INQA 1IGFH 4HXAL 5IHZA 3TF7C 3BO8A 1FH5L 1A14H 3KS0J 4NQXA 1AKJD 1QBMH 4KJQD 4HBCH 1Z0MA 3S5LB 1U8JA 5IB2A 5IVXF 3ABZA 5SX4H 1XR9A 1I7UA 4O2EB 4OJFL 4NKMA 1AE6H 5FKPA 1NUNB 5DJ6A 1EEYB 3MRNA 5DD3L 1XF5B 4KMTH 1CWVA 1T1YA 3VXTA 1CE1L 1DANT 2EEBA 2YBRA 4XPBH 4YNYB 2ZCKL 4JPIB 2J8OA 4XRCA 4M7JL 1PBYA 4M3KB 5C0ND 1IGJA 4WCYL 4HGKC 3C8KB 2R1WB 4NO5B 1BQUA 2ENYA 5L7XL 4ZTOL 2V2WA 3VFPA 3BH8A 3LQAH 4MD0A 3T4YB 1B0GA 4P5TA 1SBSL 4M03A 3CJJA 3MRGA 3LKPB 4OUUB 4XP1H 4AMKH 4RRPG 4W70A 4K3DH 1CDYA 1LO5B 4H0GA 3T77A 2NY2D 4MCYA 3HE6D 2AXFA 4I3GA 1IKFL 4LIQH 5HI5C 3RU8H 5IKCA 5I1AA 3Q6GL 1I1AC 4CJ0A 5F1OB 4G5ZH 4OQTH 3VW3H 1MAJA 1T7YA 1ZXQA 3CUPA 4GRWF 5I2IA 2IJ0C 1G9NH 2NY0C 3MRDB 4PGCB 5DS8B 3RA7L 3O8XB 3CDFA 5B38G 1D5BB 4HEPG 2PCPA 2ITCA 3QCTH 3T04D 1BQHG 4DK6A 2Y5TB 1NEZA 3ZYOA 3RIFK 1X5YA 1IGCL 1FZMB 4UOW0 2V2TB 1JGEA 3QI9C 3PWPA 3X17A 3OGCB 2SEBB 1TXKA 1J0KA 3WIIL 1EBAA 1Q9WB 1RJZA 4OIIH 3VI4E 2V5SA 1WK0A 4Z7NE 1UEMA 2P45B 2NTSP 1JHKH 5K9KB 2VDRH 4UB0H 3B5HA 2VLKD 2OK0H 1C7TA 3PGCB 2A38A 4XB8A 2CJUL 1YEIH 3BKJH 3M1BB 5E2WL 4A2LA 2QQKL 5BZDB 3WDIA 4H26B 1G7PB 2QSCH 4U1MA 4PLOB 4FXGA 4HWNA 4Y5YA 1I7ZB 4JRYE 4ONGL 5ESQA 2VN7A 3M45A 5D2LB 1T1ZB 5E5MA 4M6AA 4P4KD 3Q6FB 4MQXC 4F80A 1IKNA 1JGVL 4Y4HD 4D0BA 5DD0L 4U7KA 5JXAH 5JHLL 3VG0L 43C9A 4L5FH 4YFDB 1DEEA 4G42A 1OW0C 3MNVA 5EWIL 1LMKA 1DVFC 2YPKA 5GRWA 5F3BB 2GEEA 2PXYD 1OWWA 3WN5B 2NTFA 3WFBH 2XXMB 4M1CC 4BSJA 1JI2A 2D7TL 4NN7B 1ZEAL 4P46B 5B21A 1UH3A 4YIQB 2PW2A 2KZ1B 1G6RA 2FBOJ 3OAZH 4KRLB 3KAAA 1RUAH 4X6EB 1FAIL 1W2KT 3ARQA 3BI9X 3MBEA 4G9FE 4RMSA 5F7YC 3ES6B 4OM0H 2EH8H 2GSGA 2RFXA 1QBLL 2A6IA 1JGLL 1DLFL 2ADJA 2H41A 4N0UB 4Y16A 4ZFFA 3MJ8A 1YJDH 4Z95L 2IADA 5LAXB 1K9TA 5ALCL 4P2YA 3P4MA 4HWBL 4X0KA 1TPXB 3B6SA 2BNRE 3L3OA 3GO1H 5F7FA 5IB4A 4P2OD 1LDPL 5KOMC 3HNTL 4QF1A 5C0NC 1K3IA 5JQ6H 4PGDB 2P5ED 3HZMA 1KCVL 1MCOH 1RZGA 4HUNB 1SY6L 1WWCA 1KLUB 1MCRA 4E5XB 3V5DA 4LNRB 1TCRB 2AABH 1UM6H 4Q0XL 2NXZB 3MRCB 5JUEL 2NY2C 2NY5L 1IM9A 2IEPA 3CH1A 3TYFA 3DUUA 1KC5L 2Z91A 1G0YR 2JJTC 5TE7L 3RVTD 5DJ8B 4WI3A 3PIQB 3TIDB 4FFZH 1U8PB 4YDVA 5C7XL 6FABL 1NAMA 5L88L 2J88L 2VISB 5EOCL 4PJIB 4OUOA 1I1FB 1ZA6B 3U9UA 1I1RA 1DQLL 1NQBA 5ICZB 5IHLB 1RZJC 1KXQE 2O93L 1UACH 3E8UL 1K4CA 4IHOA 4N9OB 1N5AB 1WLHA 2X10A 5H37H 4L29B 2CUHA 5BO1L 3BXNA 3LKSA 4HUXB 3HRZA 5E9DA 4FNLL 2XNAA 3EFFA 3UTSD 2YD6A 3D39D 4TUOB 4YX2H 2GFBA 1KCKA 3OKDB 5H2BA 3ZE0E 5JOFB 5KW9H 3SJVD 4QRUB 4ENEC 4NNXB 4BQCA 1VFOA 1P7KA 1LP9E 4PJ8B 3FOMB 1MJ7L 3OHXB 15C8H 2FJGB 4X8XA 3ZKMC 3TT1L 4QNPE 5IIEA 1YEGL 4RGNE 1N2RB 1I3RB 4EKXA 1ZLSH 2HFTA 3OTTA 1R24A 1IRAY 1OPGH 5KVGH 5DQDL 1KOAA 4P4KC 5JOPD 5IR1A 4LEOB 2DQFB 4C56A 1MIML 2CK0L 4BSWB 4Y19B 3RVUC 4Y4HC 3VFRA 4RBPH 3VXPB 2NLJB 5EC2A 1G7IB 5MI0B 5JHDB 2LU3A 1BQLH 1DFBH 5CSZA 1YEFL 1LK3H 2K3TA 3K80A 3N1QC 2A6KB 2RR3A 4MA8H 3BAEH 4NYLA 1KENL 1S5IH 1NFDE 4LSQL 4R4ND 3TZVB 5IEHA 3ULVL 4RMUA 5CIPA 4MD4A 3O0RL 3RUGB 3F8UB 1M4KA 2UZXB 3HC3L 1DSFH 2BP3A 2DMBA 3JV6A 4TQEL 5J4MA 3O9WD 1BP3B 4LVEA 4PJ5D 4OLXL 4LSUH 2J8HA 3J8F7 4ZUSA 4G8EB 2HA1A 2ZCLL 3ARED 3MLRH 1ZANH 2DMCA 3QISA 4I13B 4ZAKA 4OFKA 3QIUA 1UADC 5J11B 3KWWA 3G5YA 3HI1B 1QP1A 1LNUA 4OB5L 2QQNL 5CZKA 4P2OC 4Z7OF 4DTGL 2JF1A 4KQ3L 3CFCL 3TM6A 4EI6A 2HFGL 2GJZA 3BP6B 1S7SA 4OD1L 3P4OB 2EO1A 3BKYH 3CLFL 4NRYB 4P3DB 4OI7A 2FATL 2QEJA 1OGTB 4P3CH 3KPPA 4HX1B 5D9SA 4NWUL 1WWBX 4U6TA 1RD6A 5C2BH 4YO0A 2VERN 1GCFA 3GSWA 2WUCL 4F15B 3KXFE 2UYLB 5ALBH 4NNYB 1R3LB 2F58L 1IAII 3F7RA 4ELKB 5I1DA 1HH6B 2IFFH 4ZOCA 2HG5A 4EEEA 2X41A 4ZS7H 2XI9A 1YNLL 2YOCA 4HCRL 5FA4B 4E42B 2ZNXA 4NN7C 1T7VA 1U91A 3OAYH 4KJYB 3GJFK 1AY1H 3MCKB 4GW4A 1C08A 3FCTB 2L4OA 2PYEE 4P2RD 2VE6B 5KJRH 1AIFB 1H3PL 1NBZB 5IMMA 2DQDH 2X7LB 4QXGH 2P5WE 5DJZA 4XVUD 3DOSA 1PKQB 2X1WL 1HSAA 1SEBB 1L7IL 2NY1D 2C1PB 2VKWA 3T4AB 1PYWB 3KPOA 4L8DA 3IFLL 4NFDA 4FABL 1U95A 3IRPX 3BKCL 4U1SA 5DC0A 3PGFH 4L4VD 1QO3A 3P11H 5DMKA 3BD3A 2HAZA 2XA3A 3RNKA 4DEPB 2V7HB 1ZHKB 4LLWB 4XNXH 3NCJH 1A9BA 1F3JA 2GT9A 5C1MB 4TVPE 4LLDB 1CL7H 2J1KA 4P49A 2WWKT 4WDIA 1Z3GL 3SCMA 4QOKE 2DQCL 2D7OA 1JGDB 2NXZC 3CZFB 4OZFH 3V52H 3MRMA 1ES0A 1ZHLB 4I48B 4PLJD 2E6PA 5MEOA 4GT7A 5HD8D 4L4TB 4XHQA 4DQOL 4JHBA 4AL8L 2PKDA 2XYCA 3LPWA 5TH2B 3RFZC 3VCLA 4L9LB 3MJ9L 4JQIH 3UZEA 1IC5H 1VEMA 3D0VA 3OKMB 5JDJA 3WXVH 4WTXA 5EBLA 3EO1B 3FQWA 4R4NC 2OQJA 5C07E 3TGXA 2Y36H 4YK4B 4GG6A 2D03L 1FL3B 4HUUB 4OSUL 1EJOH 4MNQE 4YZFE 3IB4A 1YMHB 5K59E 4MJ5A 4M5ZH 3TIEB 4WU5A 4LGSB 4U49A 4PBXA 2P43B 4PGJA 2VXUL 3U2SA 1GOHA 1MRFH 2DIAA 3Q5YA 5JORA 1KYOJ 3MROA 4YXLL 4Z77B 1CI5A 4ODTH 1EHLH 2UZIH 3BDXA 1N26A 4PJ8C 2FWOA 4QCIA 4CJ1A 1U3HD 2GJJA 4OCLC 2VLRD 2WINA 3DARA 3QEQE 2XTJD 1YN7A 2YRLA 2AAVA 3FRUA 1UZ6F 2XQBL 2W9EH 5EORL 4NFBA 3RGVA 3BW9A 3EW3B 1ORSB 2ED8A 2DLIA 4LLYA 4MB5A 3FO2B 3OF6A 4M1DH 3F6LA 3G5ZA 3O41B 1WEJH 4O2FA 4NZRL 3WO4C 5I1IL 4GBXD 4PB9L 4JREB 5MI0C 3U6RB 1EVUA 4HFUL 1GZPB 1CK0H 3KPTA 3V2AR 5F7DA 4MQ7B 4A2MA 3QA3A 1HDMA 2RBLA 3D69B 3TZVC 4JRYA 3SBWC 1WAAF 4NNPH 5CP3H 1TJGL 1DL7H 1H5BC 4K3EH 4YDKL 4KZDH 4MQSB 1TZHA 3MJGX 1SJXA 3L6FB 2E7LC 3KYKL 5DHVA 2VZSA 2BSRA 3R1GH 4XI5C 1IGIL 3O2VL 2F74B 1IC7H 4JY5H 3RPIA 3BP7B 5IBTL 2P48B 4XNQA 4TNVF 1FC1A 5IQ9A 1SJHA 5TGBA 4ALAH 4NFCA 4JKLA 2NY1C 1FCCA 3HUJE 2DKMA 5J11C 1T7ZA 4GRMA 1EZVY 3MXVH 1PG7W 4MWFB 2W0FA 4XBGB 4G9FA 1ZSDA 4HWZA 4FQXB 4UZGA 1FNHA 1DP0A 4PJ7F 2HVKB 4XCFL 1F6LL 4OBRA 3WYRA 4P4RA 1NAKL 5ICXA 2FGWH 4WRLA 1TVHA 3ULSB 4L3CA 3DV4A 1IE5A 2BNRA 1NBVH 1T20B 4OCWL 5T1LA 4F15C 3IGAA 1T4KA 4G80A 4UQ3B 5D7LB 2MQ0A 5E99H 4NJAH 4IRSB 4CNIB 4JHZA 4PLJC 1S7VB 3EDFA 4HIHB 4N5EC 5J1TC 3RHWK 5M94B 2EXYD 4MNGA 5ADPL 2HMID 4H5SB 4Q7DA 1JN6A 1XH3B 3FOLB 4LFHG 3H9HA 4S11A 4HC1L 4XP4H 4OAWA 1YN6A 3CFEA 5FO7A 2Q6WB 4F7TB 2ZCHH 5DFTA 1D3CA 3IETA 2FL5A 1LO3H 1M7XA 4YBLB 3U79A 5FA3B 1P7HL 3BHBB 4OF8A 2J6EA 3CCHA 4LFHD 2GJ6E 1OAQL 4EIGB 3JTTB 4X4YA 2AJXL 5HSFA 2GW5A 1JZ8A 3LH2H 1FL5A 1M6OB 2W65B 3RX5A 4ZUUA 3F62A 1AR1D 3VFUA 5EIVA 4CKVX 4M7LH 3MOAL 1CQYA 5IT2H 5E8PA 1JWUB 1U8KA 3IF1A 1TENA 3OR6B 5ID0A 1KPUA 4DKFH 5DD6A 4P57B 5BRZD 2BCKA 1U3HC 4OF0A 5IW1B 3PL6D 3IFPB 3QULB 4LHQB 1N3NB 4MAYA 4A6YB 5D5MB 5ITBL 3VWKD 1A7BA 3KLHD 4JO4L 1CF8L 3N50A 3SDCD 3BEWB 1J1XH 5AG9A 4ZD3L 4XMPL 2Y06L 9CGTA 4W6XB 5D1ZB 3TJEL 4CU7A 3ARDD 1AHWA 5BS0E 2OJZL 1N6VA 4D9RD 4L9LC 1I8MB 1CICA 3EOAA 3GIZH 5C86A 1PGRB 3QG7L 4Z7QE 1ZOXA 3TBTA 3KNBB 5J0BA 2WAHA 3VWJD 1Y6MR 1QG3A 4MDIA 1AH1A 4JEGB 5ERWA 1SEQH 2YC1B 3IFOA 3K8LA 4M48H 4U1IA 1FGVH 1RZKL 3U0PB 1I8KA 1QLFB 1T04A 3EUUA 4XWOD 2JJUA 5ANMB 3ZL4L 2X1PA 1XEDA 2YUXA 4AK1A 1Q94B 1QKZL 2EO9A 5E5RB 1SYSB 1IEBB 1KB5A 4LSRH 5J6GB 2DQHL 1RPQA 4JKWA 4KK8D 4U1HA 5DVOA 4AY0A 3EYSL 4TUKH 4D0CA 5SWQB 4FN0A 4JY6A 2WBWB 5ETUA 4IS6A 2F8VA 3GSNL 2A6DB 2EXWD 1B2WH 3HI6H 5DQJA 3DX8B 4P23A 4QTIH 1MEXH 2APXA 5I17A 2GTWA 4G8FB 4JFED 4Y2DB 4ELME 1RSFA 1RK0A 4GAYB 4UAOC 1MHCB 4HLJA 4KTDL 1A7QH 3N1FC 5EH1A 5TE6L 5EUOA 2RJMA 4XNMA 1ODAA 1QFPA 4JREC 1FV1B 1TJIL 1P7QB 2FLRT 5J9PB 5HYSA 4TVSa 3D0LA 1WGOA 3NFPB 4X8JB 4OCRH 3SDYL 2VDKL 1AXSB 5E2VH 3VFGL 4PG2C 5DD1H 2EXYC 3O3UN 3VD3A 1DQJB 1FFPB 4GW1A 2CMRH 2PR4L 4WV1B 1RUML 2BERA 5F96L 5I66B 4OGXL 3FT3A 3AU1A 4J3OC 1MVUA 3KXFA 4ZUWB 4J6RH 2D3VA 4HUWB 4NKIH 4Z7WB 2EICA 1IBGH 1P4IH 3DXAD 4KAQL 4PTUA 1MRDL 2EZ0D 3FHQA 5GS0L 4M62L 4LIQE 2AEIT 2ZG3A 4LHJB 1BAFL 1M05B 5C92A 1FZJA 3LQZA 3MO1A 4U6VL 3PABA 1OHQA 4KRPB 1QPPA 1BBDL 4PJGB 3HPJB 3OAZK 1GOFA 3H42L 1RZJH 1LE9A 3INUL 5E8DL 3UTZA 2P5WA 1ADQA 1VGEL 3I02B 4TN9A 4C83B 1OAXH 1CFSA 5EDXA 5C08B 3A6OA 5F8RC 3SGEI 1OVZA 4FG6C 4KFZC 1CYGA 1IQWH 3O6KH 4HJJH 3IDUA 3ILPB 5C0CE 3VWKC 3X14A 3QFDB 3KLHC 1W0WA 1OP3H 3SDCC 3VMNA 1CL7I 5DYOB 3VGHA 2I07A 2PUQT 4U1NB 3GSNB 2IBGA 3QO0A 5JLZB 3LD8B 3SQOH 2J4WL 2X4OA 5ISZD 1X5ZA 4GW5A 3U7YH 4PRHD 3C5JB 3QNYB 4J4PA 4JPWL 5KSUA 3ESVF 3T3MF 1R3JB 4PJXB 4QOKA 2APTA 3WUWB 4DKAA 3A67L 2AEQH 3QXTA 3VWJC 1QR4A 3DETD 4KKLD 4JFFE 1LHZA 1IILE 3ZYIA 4RNRA 3GRWA 5KVFL 1AGBB 3GHBL 3QDJE 2P8MA 1G7QA 7FABH 4Y8AA 5E00A 5C3LD 1XCQA 2VXQH 4NC1C 4LOUD 2DLEA 3TT3H 4QHMB 2XRAL 1U8QA 3ARFB 3PHSA 4XPTH 4YHPB 4KTYA 4ZOEA 3I2CL 1EV2E 2JK5A 4N0CC 4QRSB 3MLXH 1NCWL 2QL1A 5T1KA 4KK8C 2W9DL 1CGTA 1TQCB 3MV8B 3QZWG 3C6LB 2R8SL 3TCXA 3W5MA 2Y6SD 3BD4A 4MNQA 1CXHA 2EXWC 4N9GA 1NCAL 1OAYH 1YYML 6CGTA 3KPLB 4WEMB 4JO2L 1I75A 1FH5H 3MUGA 2O5YL 1HYSD 5B3NA 3BWAA 5DHYA 4YDLB 1DBKL 1INQB 5BQ7A 3N06B 3X12A 5IHZB 3L3GA 3DMMD 3BO8B 2R23A 2R4SH 1JPGA 5DMJB 3S36L 4NQXB 2Q3ZA 4OJFH 4JGJA 1EIBA 3KPRA 4O58H 5DD3H 5CEYA 3RZCB 3QEQA 2FH6A 4QRPD 1U8JB 5IB2B 1JCKA 1XR9B 3W11C 1I7UB 1CE1H 4F7CA 4NKMB 4RDQG 2ZCKH 4OCNC 5DJ6B 3MRNB 1CIUA 4U2ZA 5L2JA 3ULUD 4M7JH 1AGCA 5GS1C 3UTTD 1XF1A 3HE7D 1T1YB 3VXTB 1SYVA 3TNMA 2NY4D 4ZFZA 4GLRH 2ZPKL 5EUKA 4WCYH 3SPVA 2BDNL 2B1AH 4XRCB 3BQUA 5L7XH 4ZTOH 1T22B 1N4XL 3W9DA 2Z31D 4RBPK 1MCIA 2EDQA 1SBSH 1IGJB 3QR2A 1F02I 1W0VA 2V2WB 4H1LG 3VFPB 1BFOA 3BH8B 5DJXA 1IKFH 4MD0B 3OZ9L 4HPOH 1B0GB 4P5TB 4N0RA 4L3ED 3MRGB 4K2UL 2BJML 3Q6GH 4LPVA 3H3PL 3MX0A 4Z7VF 3T77B 4MCYB 1G6RL 2AXFB 2C3VA 4Y2DC 5I1AB 3EOBA 1S9VA 4AM0A 4G6FD 4FXKA 2H1PH 5AZ2L 4DKEL 2AXGA 1QSFD 1WSST 3CUPB 5I2IB 5IMOA 2LU4A 1FG9C 2LQRA 3DVGA 1I8IB 2ENSA 2WBJD 2PCPB 3QPXL 2ITCB 5EFIA 2EYRA 1NBYA 1J5OH 2WV3A 1NEZB 3MR9B 3WIIH 1MFNA 4RX4A 2NNAA 5CJOH 3MC0A 4E41A 2O5ZL 4PJDE 1JGEB 1IAMA 3WIHA 1I85A 2X5PA 5GZND 1N0XL 1YPZB 1RJZB 2ESVE 2G75A 1EPFA 3EGSA 4PV8A 1L4IA 5E2WH 4KKLC 3LH2L 4PG9A 1RIUL 43CAA 2EDOA 2CRMA 4YHIA 3RVWD 4PJAA 4ONGH 5DEGA 1U6AH 4LAJH 1X7QA 4U1MB 4LOUC 5MEPA 1BVZA 4KRPC 4UU9B 3RKDD 3BPLB 3OAYK 4FXGB 2F15A 4Y5YB 5E8OA 1JPST 3QFJE 4FTVE 5ESQB 4NO0A 1ZT4A 4N0FA 1MFBL 5DD0H 1CGYA 1ZVSA 2EDYA 1RZKC 5E5MB 5JHLH 2YUVA 3VG0H 1XGUA 2B0SL 5GSVA 1QRND 3P0VL 3HC4L 4FFVD 4D0BB 2IMMA 2WIIA 43C9B 3FMGL 1ZEAH 1DEEB 4G42B 3MNVB 4JG0L 2YPKB 3KR3H 4FMFA 4P9HL 2NTFB 3O6FA 1HYSC 1FAIH 4LCWD 3QAZC 1QBLH 3LD8C 2PW2B 4XHJD 1DLFH 1G6RB 3NMEA 2B5IC 3DMMC 3PWPD 4PJ9D 3TYGL 4Z95H 1HINL 1QSEE 3MBEB 2AJSL 4N68A 2GSGB 2RFXB 2A6IB 2A9NL 5ALCH 2ADJB 3HAEA 4Y16B 1T6VN 2DIJA 4ZFFB 3MJ8B 4L1DA 2YA0A 1MOEA 3VDCA 3FO9A 3ULUC 4YQXH 3P4MB 4X0KB 3HE7C 5BS0A 3L3OB 5CINL 1NDGA 2OJEA 4WY7L 3KPNA 4BH8B 5IB4B 2XQYK 1KCVH 1PD6A 1XGPA 1SY6H 2Z31C 3KPQB 4QF1B 5CZVL 4R90L 2HWZL 1OARL 4Z7WF 5I1EL 3HZMB 5HGDA 4YE4L 4Q0XH 4CN4A 1JHLL 1RZGB 3BWUC 3GHEL 1TQCC 5JUEH 5T3XL 3C6LC 3V0VA 4X6FA 2P44B 3V5DB 1KC5H 2FJHB 2R0WH 5J56B 4C54A 1E28A 3WJJC 3H0TA 2JJSA 2NPLX 1NGQH 3TYFB 3DUUB 3PQYE 4XPAL 3QNXB 5FM5O 5GS0C 5L88H 2J88H 2VZTA 1BVLA 2Z91B 4DOHE 1YNTA 1K4DA 4EN3A 4YDLC 1V3MA 4WNQA 4YDVB 2BY0A 2W0LA 5GRJL 1F3DH 1NH6A 2HLAA 1F2QA 5MEND 2WBJC 3VU2A 3K3QA 1XF2A 4DVRH 3U9UB 3MBXL 4KI5D 2HVJA 3OMZA 5BZWA 4EUPG 5CCKL 4ELMA 4NGHL 4OZGE 4IHOB 1HILA 3QUKA 3BXNB 3HRZB 3DTXA 2XNAB 3B9KA 3EFFB 3F58L 5GZNC 3L7EA 5GGQH 1D5XA 4CN6A 5D7JA 1II4E 2GFBB 3DUSA 4LSDA 5H2BB 5D4QA 3AXLB 1W8OA 5JMOC 3THMH 4KVCL 3QQ4A 3ULUF 1P7KB 1YEGH 2MHAA 4L8SB 4X99B 2J7LA 2VZUA 3ZE2F 4OT1H 1MF2L 3R0NA 4P5TC 1A0QL 3LSOA 3V7AE 4Q9QH 5IIEB 5DQDH 1XF3A 1FZKA 1CIDA 3UJTL 1ZLUH 2WWMD 4ZXBD 1D6VL 4NO3A 4OLUL 2BFVH 2NY6B 4KK5D 1IM9D 5HGGS 5B39A 1R24B 5FYLD 3VA6A 3R0MA 4UV7H 1YEFH 4C56B 5I16A 3V6OC 3DRQA 5LGJA 1V7NL 2B39A 4FFVC 3VFRB 1KCSL 4LSQH 4C58B 5EC2B 1JF1A 1MCEA 1MCWW 4GXVL 3NIFF 5CSZB 5GRUL 4X4XA 3VXRD 3QDGD 5GGRY 3O0RH 4KZEL 2IPKB 3HC3H 1VESA 3C5ZA 5IEHB 1BHGA 1DDHA 5L2KE 5CIPB 4MD4B 2OYPA 4QRTA 4OLXH 4WJ5A 5E9DD 4NZTL 5IVXE 1D5IL 2PTUA 1NGPH 5I73C 1VKXB 2OMNA 5KSVA 4HWUA 1GGYA 5C0CA 3F7PC 4ZYKA 4ZUSB 1HHHA 3IDYB 3VXMB 4LCCA 1NGYA 3CFCH 4JQVA 4XBEH 4ZAKB 1K3ZA 3EYFA 3KWWB 3G5YB 3RJQB 4OD1H 1LNUB 4LCIL 4TTGA 3MREA 3GBNH 3CLFH 1Z6JT 2FATH 4EI6B 4IOIA 2DQTH 4XP5L 4Y5YC 2GJZB 1S7SB 4WUUD 5F88B 4HT1L 3P9LA 4N8VA 3KPPB 4U33A 1WF5A 5INDA 3B2UD 1FDLL 2NXYD 5D9SB 4IOSD 3QDJA 5SV4A 1YNLH 5LGHL 3ARPA 4YO0B 4G8GB 3GSWB 3AUVA 5I1DB 1KCRH 4BUHA 4GRWE 1HZHH 2R9HD 2MKWA 1BD2A 4NUGL 3UC0L 4AG4H 4G3YL 3SN6N 3MLZH 3K4DA 4PRPD 1U91B 2EIDA 1I9IH 3KPSA 4QT5A 4JRWA 4GW4B 3AS2A 4I2XA 3MBEC 2VXSL 4RMVA 3LKOA 1FVDA 1EUUA 3E6HA 4Y16C 1L7IH 3DYPA 4BH7A 5IMMB 3ZYZA 1WICA 3IDXL 4Q6YA 1OM3L 2NY3B 2F5AL 1OTUD 5DJZB 4JRXE 4FABH 3BKCH 1HSAB 1QFWM 1G7LA 3QIUD 3QDHA 3KPOB 4L8DB 1YNKL 1U95B 5DMKB 1QO3B 3F7QA 5EU3A 1RV6X 1XGYL 1B88A 1U3JA 3GSUA 1BFSA 4GLRI 1A9BB 1F3JB 2DQCH 5I1HH 3I6GA 3PHQA 1NGXA 3QQ3A 4TRPL 3U4BL 3NCBB 3MRHB 5KVDL 3V8OA 4WDIB 3SCMB 1CG9A 3EKCA 4DQOH 2AJVL 4AL8H 4BK4A 3MRMB 1ES0B 4KK5C 3REWA 3D2UA 5EULV 1BZ9B 1KGCE 3NIDF 5MEOB 1J10A 5J6HA 1E6OL 3MJ9H 1BGXL 3P30L 1T03H 2GSIB 3VCLB 2G2RA 5F9JA 1EZVX 4G6KL 4DAGL 2YXMA 4LPCA 4TOYL 4OSUH 3W0WE 5F1IA 3D0VB 1OP5H 5C0AA 4NQTA 1EX0A 4G6JL 5EBLB 3FQWB 4R6UA 4GG6B 4XX1E 4DK3A 1J88A 3P9MB 3LV3A 2VXUH 3WFCL 3HPLA 2DQUL 2FRGP 4MJ5B 4WU5B 4Z9KB 2AV7A 5JORB 3O6MH 3UJJH 3LEVL 3MROB 3EDJA 4QRRD 2R2EA 4IMKA 3D87B 5F9WB 1BBJB 2P1YA 4MXVF 2FWOB 4QCIB 1H8OA 5K93A 3EJJX 2XQBH 3HG1D 1IZJA 4PJDA 4HK3N 4GG8A 4RGOH 3H7LA 1X5LA 2NY6C 3P0YL 1Q9OA 1JZ5A 3FRUB 2C4FU 1YEJL 2YWZA 1PEWA 2ZNWA 1JNJA 3BW9B 4PB9H 5D6CB 4LLYB 1YY9D 4HFUH 3I50H 2LABA 3G5ZB 5ECJE 3B2UC 4O2FB 5CD5D 4X5LA 2J6EL 3U0TA 4XCCL 1EDQA 1Z0NA 1TJGH 4M43L 2W9LA 5F7DB 1GH7A 3QA3B 2HJFA 1HDMB 2VC2L 1MCBA 3PDGA 4JRYB 4FTVA 3QFJA 4WFED 1I3GH 3PXJA 4PD4J 1IGIH 4OM1L 1TZHB 4HLZH 4KH2A 3U9PL 2M26A 3B9AA 5IBTH 5DHVB 1B9ZA 2DTSA 3W2DL 2BSRB 3SE9H 5JW4N 1H15A 1J86A 3DURB 1NMCB 3RPIB 3WUZA 2J8UF 4NC2B 4XNQB 1BEYL 1GJIA 5HHPA 4JO3L 3V95A 1OP3K 5IQ9B 4LSPH 1SJHB 4OKVA 2VO5A 4ZAKC 5GISL 3QIUC 3VXNA 1MCQA 1A7RL 4GRMB 3K0WA 4ZUTA 4D9LL 1YYLL 2OM5A 2W0FB 4J3SA 1NAKH 5KANG 4G9FB 1ZSDB 4HWZB 1DBJH 2Q76A 1OF2A 4AIXA 2QR0B 3RGVD 4P4RB 3BPCA 5ICXB 4AEIL 4OCWH 3DV6A 1TVHB 2EYTA 4H8WC 2CUMA 3OR7A 3WCYA 3DV4B 2HH0H 2YMXL 2BNRB 3C08L 4JN2A 4XP6H 5T1LB 3IGAB 4G80B 1XIWA 5F3HA 4HC1H 3QCUH 3SY0A 2ID5A 2VWEE 3K1KC 3IU3A 1KIPA 1OGAA 1KB5L 1JN6B 1MFEL 3H9HB 3I85A 1ZGLM 5I76A 3P9WB 5FO7B 1YN6B 3CFEB 1OAQH 1QLEL 3ZSSA 2AJXH 3IETB 1JL8A 2FL5B 2KH2B 5MEQA 3LDBB 3QH3A 3PQYA 3LS4L 4UT7L 2FR4A 2O5XL 1BPVA 3CCHB 4X4YB 1CFVL 5HHOD 2EIEA 2Z92A 1QFWH 1FL5B 3P4NA 4ZUUB 2VUYA 3VFUB 5DFVD 4P5MA 5DRXA 1B4JH 3B9EA 4WHYG 5E8PB 1U8KB 3IF1B 5ID0B 1KPUB 3MRLA 5DD6B 2W60A 4ODBD 5ITBH 2BCKB 3K2MC 4Z7OE 2FECI 5DJCA 1QD0A 3ARTA 4OZHA 1EMTL 2HT4D 4MAYB 4BELD 3MV7D 4ZD3H 3IKKA 4XMPH 2Y06H 4NQDD 2VLKE 3V6BR 2I5YH 3TJEH 3GMPB 2KQNA 2OJZH 4JANA 5L8KB 1KIRB 3VGBA 4Y88A 1AHWB 3MV01 4LP4A 3WS6A 3AFLA 3QG7H 4H88H 4OZFA 5EOCJ 1FYTD 2HRLA 4Q6IA 1EAPA 1BMGA 3EOAB 3JV5A 4K8RL 2Q8AL 3QWRA 5DD5L 1WIPA 3TBTB 4RGNB 2V5RA 2EKJA 3M17B 3SDXA 1RZKH 1XF4A 1I9JL 1KEML 1FFRA 5ERWB 5T33L 4M61A 4PRNA 2CDEA 2UUDH 4U1IB 1I8KB 1T04B 4HMEA 4RAHA 1QKZH 5I1CL 5JPNA 3BZDA 1ADQL 5HHXH 5GJTL 1T6WA 1SBBA 2X89A 4G6AC 1RUPL 1GGCL 1KB5B 1X6NA 3GSNH 2GUOB 1FC2D 1NFDB 5ESVA 2FB4L 4U1HB 4HD9A 5L2KA 4D0CB 1F58L 3V5KA 1U8MA 5ETUB 4IS6B 3BZ4A 4PR5B 1PX3A 5IVXA 4KTDH 3FO1A 1G0DA 5I17B 4X7CC 3FZUD 2GTWB 5TE6H 1UJTA 3RGVC 4M8VA 2BRRL 1RK0B 1A02N 3ULUH 5FDYA 1DBAL 1TJIH 1HCVA 4XNMB 2P5EE 5DUPL 1CICD 4OCMC 3GRWL 3SDYH 3BRFA 5HYSB 3F6IA 5F7WC 3NA9H 4KRMB 2AS5M 3D0LB 1NGZA 5HHQA 1C5CL 4M9PA 5ACZA 2OSLA 3U46A 4GW1B 4FP8H 5I6XB 4PY8J 1MWAA 4TNVK 1J05A 2JCCA 4HZAA 2W0KA 5C09D 3IJYB 3FT3B 3AU1B 4GG6F 1MVUB 2NZ9C 2VDQL 3KXFB 3LS5L 1NMCC 4M62H 4QHKJ 5GS0H 5E2UH 4U1LA 5KVMC 5C2UB 4HDIA 3TJHC 4JDZA 1QHOA 3I75A 4N0UE 1BBDH 5HI4D 4JKPL 5FM8A 1NCBL 1M71A 1MCWM 1OQOA 1FZJB 2D7NA 3LQZB 5C0IA 1JF6A 3PABB 1G7HB 1VGEH 4FQQA 4P23D 5DFVC 3UTQA 5E7BA 5GGSY 1LE9B 4OF3A 3JTSA 3UTSE 4YPJA 3T3PF 2HFFA 3D39E 3OKYA 3UTZB 2P5WB 4CVZA 5CWSA 1CFSB 2XN9A 2Q86B 4JRXA 4B50A 1OAUH 5IEKA 3UCRA 3SJVE 2C4XA 2ATPB 2YKLH 1KN4H 3KJ4C 1UZ6E 4X7FC 1F90L 1FNEB 4K55A 3X14B 3P4LA 5EB9A 1EA9C 4K23H 2J4WH 3HMXA 2I07B 2H2SC 4JPWH 1E4KA 4XPHL 3Q1SL 3QO0B 4LMQI 5DZLA 1KJ2L 1SQ2N 3RWDA 3A67H 2X4OB 3MRBA 4GW5B 5KSUB 5JOPE 3SHSA 1HHKA 4PJFF 1S8DA 1WAAE 4M6NH 4QOKB 2XWBA 3AGVA 4X6BA 5E24E 5LKNA 3GHBH 1UB5A 3ZHKA 4X9GA 3LPGA 1X5FA 4Y2OA 3EHBD 4RNRB 5A43C 1RUQH 3VE0A 1ZS8A 2P8MB 2LAAA 4ZNEE 1G7QB 4ODHH 5E00B 1NCWH 2FSEA 3CLEL 1U8QB 1J87A 3W0WA 1AGDB 1NMAH 1MFAL 2FX9L 3WNOA 2OMBA 3IS0X 4Y0GA 2ZG2A 4PJ5E 5C07B 5T1KB 2XWJA 3EO9L 1YYMH 4MNQB 4JO2H 4MAYC 3RAJL 4MJ2A 2N7AA 5AUMB 4N9GB 4PJ7E 4KY1L 2DLTA 2DM2A 3G08A 2X6MA 3GJFB 5FDWA 1CVSC 3WIHL 1KULA 4LQFH 4EBQH 3SE8L 3S36H 5DVKA 3MUGB 5I8OL 2VXTL 3AMLA 4I3SL 1AHWC 1KFAL 1NEUA 3BWAB 1DQQB 5BQ7B 2V17L 4KPHH 3X12B 1OP9A 3L3GB 3MODL 5JZ7D 2R23B 1KV3A 4LKCA 1CICC 1JPGB 3DYOA 4XVSL 1X5GA 3V79C 2WUBL 3KPRB 4JDTL 5CEYB 3QEQB 4ERSL 5IFHL 4F7CB 5KAQG 1ZLUK 2ZPKH 5ABDE 5I8KL 5ID1A 2BDNH 2E6JA 3WNPA 2Z8SA 5L2JB 1XCTA 1AGCB 2G9HA 4OIAA 3FN3A 5SWSD 1SYVB 5GGVY 3TNMB 4ZFZB 5EUKB 3SPVB 3BQUB 4HWEH 3W9DB 1F00I 2AV1A 2NR6D 3OZ9H 1KJ2B 3OJ2C 4K2UH 2AW2A 3DHMA 3SEPA 4P2RE 4ORZC 5C0FA 2I60H 1W0VB 1G6RH 3MLTA 5HI4C 1BFOB 3C60D 5DJXB 3KYMA 5D1XD 1DVFA 4EDXA 4G9DA 4P23C 3MRPA 3GMQA 2AQ1A 2C3VB 4JZJB 3EOBB 1S9VB 4AM0B 4FXKB 3D85D 3U4AA 2AXGB 3RX7A 1AKJA 3G6AA 1QRKA 5IMOB 2J2ZA 3U7AA 1CXKA 2XZQH 1DANU 3T0WA 4ONHA 5K9OA 3BZFA 4RAUB 3P3YA 3B3IA 4YBQD 1CXIA 3KPRD 4GUPA 4LBEA 4NKOA 1Z9LA 2O5ZH 4H20H 5EFIB 2EYRB 1NBYB 1KLFA 2ATKA 1X5AA 1BOYA 3NCCB 1N0XH 5IVZA 1PSKL 2NNAB 5HGAA 4E41B 2DIBA 1CVRA 4M7ZC 3NCEB 1JRHI 2XKUA 2D0FA 2RIKA 4BQ9A 1ITCA 2CDGA 4HF5L 4IDLA 5HJ3A 2CUIA 3MOQA 1G9EA 1A4KA 1KELL 2G75B 1M7DB 3A6CL 2X4NA 3EGSB 4N1HB 4PV8B 5HYFA 4F9LC 2DDQL 2IPTL 4QLRA 4PB0L 1VB9A 2CR3A 3AB0B 2IQ9L 4PG9B 4B5EA 43CAB 1A64A 4YHIB 3HE6A 1NAMH 3L5IA 3MGAA 1IAIL 4PJAB 5DEGB 1OY3B 4LVNB 4P2QD 4WI7A 5JW3L 3LMJL 1X7QB 1CN4A 1PKQE 1UVQA 5MEPB 5JPMA 2JJTA 4S1SH 1GSMA 5E8OB 1A7PL 1QFWI 4RRPA 4NO0B 1RJLA 1ZT4B 4N0FB 2FD6L 1LO2L 1ZVSB 3T0EA 1NANH 5E6IB 4CMMA 1XGUB 4DGVH 5GSVB 5I1JL 3FMGH 4FQJL 1NUFA 2GJ6B 4JG0H 3TNNB 3WL9A 4BZ2L 1IGFL 5D71H 4GSDL 2WIIB 5GQBA 2XY1A 1A14L 3MLYL 4HV8A 3H7BA 4V2CB 2VLRE 5DRZA 1AD0A 5IHBA 3S34H 4S10A 3FRPG 5B38A 3TYGH 2XTJE 1HINH 2YPLD 3KYAA 3O6FB 5EUOF 2AJSH 1NBQA 2R0ZL 1BQHA 1JYXA 2A9NH 4KMTL 3L3JA 5LJYH 5HI3C 3BP4A 4G6MH 5FM4A 1DUYA 1MREH 1MCKA 3MA7A 2V6HA 1TJHH 3WS3A 2VLKA 1K6QL 4TSAH 3L9RA 3DLQR 1LWRA 4WY7H 4Z6AT 2IWGA 4XGZA 5JDSA 3ZKSD 3B83A 2Q1EA 1T0MB 1IEHA 4MXQD 3LQAL 5BS0B 4JM4H 4U3HA 1NDGB 2D9QB 2OJEB 3KPNB 4IMLA 5I1EH 4XP1L 4AMKL 1FAKT 4YE4H 3WXWH 4K3DL 1JHLH 4UT6L 4P4KA 3GHEH 1XGPB 1U8HA 2NR6C 4LIQL 3U1SL 4Y4HA 5CIPH 5HGDB 3BH9A 2ZUXA 5KTEH 1OP5K 4G5ZL 3V0VB 4X6FB 5IESL 3VW3L 4I4WB 1G9NL 4XPAH 5D1XC 2Y25A 3QUXD 3H0TB 2PXYA 5IV2A 4UV4H 2DLGA 4XMLH 1F8TL 3QXAA 3EZJB 4JHWL 1CD1A 2P4AB 5GRJH 1BVLB 1YNTB 4URTB 1K4DB 4EN3B 4NN6C 4WNQB 3MBXH 1Z9SA 3RBGA 2B8OT 2FBJL 2BXZA 3M8OL 5GHWL 5CCKH 2HLAB 4YBQC 1VCAA 3QIWD 3CSGA 5IWLA 1XF2B 4KDWA 2ADIB 2HVJB 2VIRA 2L7UA 5FB8A 3MQIA 5BZWB 3H2WA 3PGDB 4ELMB 4D0DA 1JHKL 1IVLA 2VDRL 4P2OA 4WHDA 3T3ME 4H8WH 3GSQB 3QUKB 1PDKA 3DTXB 2APFA 1YEIL 1I7RA 3B9KB 3BKJL 3L7EB 3E1F1 1D5XB 3MFFA 1U8NA 5D7JB 3GIVB 1EFQA 3BQUC 3BPOB 1FL6A 4PTTA 3DUSB 4RA3A 4LLVA 3SDAD 1IL1A 2CSPA 4BYHA 4L3AA 1ROWA 1A0QH 1JPFA 3QQ4B 2MHAB 4RFEA 4F33A 2V5YA 3UJTH 1K5NA 4LMQE 1XGTA 4I9WD 5DMYA 4YUEH 3LSOB 4EI5D 3CSPA 1XF3B 1FZKB 5JXAL 5KAQF 1K85A 4NO3B 1BF2A 3ALXA 5IW6A 3FQRA 3VRIA 4F2MA 5B39B 1V7NH 3S96A 1N6QL 1R3IL 4GXVH 5GRUH 5I16B 4MX7A 4KZEH 3DRQB 3AS0A 5LGJB 4OLVL 3C6SA 2LTQC 4Z78A 1AJ7H 1JF1B 5BRZE 1RUAL 4X4XB 4ZO7A 2EH8L 2X1QA 2P47B 3C5ZB 4PGBA 3EIFA 1DDHB 4NZTH 3UTSA 1ZWIA 1I9EA 4QRTB 1DE4A 2FYYA 4WJ5B 1I85C 3SGDH 4MDJA 5KSVB 5IROA 5C0CB 1XMWA 1VA9A 3ZKXB 4D9RE 1R3KA 3GUTB 2EDTA 1HHHB 2QADD 1SJEB 4LCIH 1NCNA 4LCCB 1VACA 4IRJD 4APQD 3IDIA 1CLZL 2BHZA 4YXKL 4XP5H 4OIBA 3EYFB 4MXQC 3U0WL 5AG8A 3SO3B 4LVNC 2CK2A 5FYJL 3QCVH 3MREB 1UM6L 1YECL 4HT1H 4IOIB 1WAAA 1G9MC 1CXLA 4UINH 4LGPB 5HDQH 4WFGD 4BQ6A 1AO7D 2X70A 5ILTH 4V1DA 4NC1E 5LGHH 4JFFB 1MI5A 3P9LB 2F54D 3QP3A 4Z7VE 4UBDD 1L9NA 5INDB 2X4TA 4FFZL 5EIQA 3QDJB 4NUGH 4U6YA 3QUXC 3QB7C 4G3YH 1EBPA 3EDEA 3KHOA 4MS8D 5EC1A 1QFOA 3HNSL 1BD2B 2PTTA 4HMCA 3O6FC 3O9WA 5CEXA 2VXSH 1T7WA 3NPSB 3MLVL 4PJ5A 4JFEE 5E4IA 3NACH 5KS9F 3KPSB 3IDXH 4HUVA 1HH9A 4NPYA 3O4OB 4PJ7A 1FVDB 3AREA 3BN9D 1AC6A 3QIWC 3E6HB 1URLA 4BH7B 4NOBA 1TZGH 1YNKH 2IAND 5A2FA 4UOW1 1NKOA 3CDYA 4OGYH 4ZPTA 1J9CT 1G7LB 4Y5XC 4P9ML 2X05A 1XGYH 2JB5H 3GMRA 3KLAB 5EIIA 5T1DH 3CNKA 3IJSA 3U4BH 1D5ZA 2EC8A 3KJ6H 5EU3B 2E9JA 3GSUB 1FBIH 2AJVH 3PHQB 1NGXB 3QQ3B 3K4ZA 2AJ3A 3LRHA 3O3DA 1CG9B 5KOVC 4ISVA 1BGXH 5F9OH 3P30H 1DFBL 3FT2A 4JQXA 1LK3L 1ZHBA 3REWB 1MLCA 3D2UB 2UUDK 1H5BA 3PDOB 1JNLL 5J6HB 4DAGH 2E7LA 2N56A 2AXJA 5C6PB 3B5GA 3LVEA 4EN3C 2G2RB 2FZ3A 3I6LD 3TFKD 4P2RA 1X5HA 5CILH 3GBLA 1DSFL 1CR9H 4LK4A 1KCLA 5F1IB 5IBUG 1A6UL 2E3VA 4M93B 5C0AB 3RNQA 2DQUH 3WNLA 1MQKH 1P53A 4LPYA 1JPSH 2GQHA 3LV3B 1QHPA 2ICEA 4Z5RA 3HPLB 3S7GA 3UX9B 4L4VA 1T5WA 3B9KC 2AV7B 4F37F 5D7JC 2QTEA 4NBYB 3BE1L 4FQLH 3UPAA 4R97B 2R2EB 5ISZE 1U3YA 4CDGC 4PRHE 4RWYL 2OXGA 4YGAB 2QADC 3RWHA 2BSTA 3CFKA 4IRJC 3MRFA 3BJ91 4PIRF 3P0YH 2XA8L 4MHHG 2XXCB 4KGJA 2UVEA 4PJDB 5B4MC 4GG8B 4Z7WE 4LP5A 2EIZA 3DVNB 3VRJA 5C2BL 5IMKA 1L6XA 3H9YA 3RI5K 5DRWA 5F97E 1Q9OB 4XAWL 4ZS7L 1ZAGA 3KYOA 4GS7C 4M43H 3QUZB 3TA3A 2P7TA 3JBG7 4OF5A 1NANI 2BK8A 1NC2D 5C08E 4MS8C 4OM1H 3C5ZC 2HJFB 2HT3D 4QXGL 5EOTA 3WLWD 4FTVB 3QFJB 1G9NC 1FRGL 1EK3A 4XMKL 3W2DH 3ZDXF 4F7EA 3JSSA 3BIAX 2C3WA 5A3IC 3I84A 5A16A 3OXRA 3TVMD 1QQDA 4HS6A 4LVOC 3ARBD 1U93A 2OR8A 1LQSR 4JO3H 3BN9C 1H15B 2VLRA 3V5HA 1A7RH 4HK3J 1MY5A 2ERJB 3NCJL 3MRIA 4D9LH 5HHPB 1YYLH 2FO4A 4LCCC 1NCDH 4JQVC 2VABA 4OKVB 4QRPE 3OAUH 1CL7L 3SO3C 2NX5D 3JV0A 3ULUE 1F5WA 3UTTE 2Q76B 1TQBB 3ZE2E 2I26N 1INDL 1P84J 4P5KA 2IH3A 2R2BA 2YMXH 1KJVB 4GBXA 1FG2A 2A77L 4POZD 3C08H 4PGEB 1SM3H 4K71C 1VADA 1V3LA 4I77H 4J23A 3DV6B 2EYTB 3ARVA 1N6UA 2YEZA 1P69B 2C4FT 4JN2B 4JQIL 3LKNA 1IC5L 3TBSA 4XNUL 1EO5A 3BYTA 1C1EL 5DK0A 3U36A 2JIXD 5I1GH 5FOBA 5F3HB 4L3EE 1KB5H 5J8OA 1MFEH 3ALPA 3FT4B 3I3EA 3SY0B 4EDWH 3NIFE 4BSVB 3IU3B 1EJOL 5DJ2A 1KIPB 4KKAD 2QSQA 1OGAB 1QLEH 3TFKC 1GGBH 1TNMA 2Y4SA 3TP4A 4M5ZL 2GCYA 3JWNC 3LS4H 5I76B 3D6GA 1QSFE 4FFWD 4RMRA 2PO6D 1CFVH 4CGTA 3UROR 2F53A 3FQTA 3QH3B 3PQYB 3EJYD 3VFVA 2FR4B 4ETQA 5GRXG 1J1PL 4Q9CA 3S35H 2A83A 2Z92B 1JGUH 4PJHF 3P4NB 1GYAA 3VFOB 4G43A 3EOYG 3R06A 1AP2A 4NZUH 4P5MB 4QWWC 1RAMA 2DS4A 3RVXD 2ZSWA 4PPTA 4IIQA 4YEFA 2W60B 1TVBB 5DZNA 4RISL 5DJCB 1BOGA 4M1DL 4OZHB 4NKDA 3OSKA 4NQSA 2VLJD 1SMOA 4PG2A 3BDBA 1XIWD 1MNUH 4JANB 1INEH 1MWAL 1DQML 1RU9L 3QUMA 1Z5LA 2BOBA 4PREA 4HAGA 4JVWA 5T3ZL 3MACH 2DQIL 5DD5H 5TF1H 1OGAD 4K07A 4K3EL 4OZFB 5L9DH 4KZDL 4Q6IB 4FA8A 1F4AA 4LL9A 1EAPB 3EFDL 2XG4A 4M4RA 5AZEH 1I9JH 4HGMA 3V6OE 1GXEA 1AFVL 4BK5A 1BREA 4HHAA 3LN4A 5T33H 1DZBA 3I9GL 2HT3C 5I1CH 1OCWL 1TIUA 3WLWC 1XF4B 3B2VL 2VDMH 4NQCD 1B4RA 5GJTH 3D3VD 1X5JA 1S7UA 3RWIA 2KL6A 4ALAL 4M61B 4PRNB 2CDEB 2YD2A 1UZ8A 5CGYD 5JPNB 3TVMC 1KTRL 3MXVL 2YXFA 4LCWE 5AYQA 3ARBC 3FTGA 4ETYA 3BRGC 2FB4H 2E8YA 5BRZA 3T08A 4R97C 1ACZA 3PWPE 4GKNA 4RFOH 3PL6A 4IMKC 1RY7B 5ESVB 4LLMB 3VWKA 5L2KB 4UOJA 1S9WA 3V5KB 1U8MB 2ICWJ 3HMXL 3EBAA 3SDCA 4KROD 4C57C 3K1DA 3BZ4B 3ZHDA 3KVQA 4PJBF 2BRRH 1QBBA 5IVXB 1NBVL 3FO1B 3MFGB 3ARDA 12E8L 3HZKA 4GRLD 5FHBL 3SKUD 5A2JH 5HHNA 1J0JA 5DUPH 1OSZA 1JNNL 3WE6A 1GZQA 2PW1A 5CUSH 2Y5EA 4ZS6D 2X4RA 5EO0A 3NIDE 3VWJA 5TDPA 2W91A 1C5CH 3QWRD 1HNGA 1T0NA 4I0CC 1LEGB 3VXSD 4HG4K 1NLDH 2H3NA 2XFXA 1LO3L 4CADA 1NGZB 5HHQB 3WHXA 3FAXA 5ACZB 2ZSVA 2OSLB 1L9MA 3U46B 1JZ7A 2R4RH 4LKXA 4JFDD 4Z7VA 2VDQH 3LS5H 3MSPA 3RDTB 1MWAB 1DLHA 1J05B 2JCCB 3VH8G 4YLQT 4F57H 4M7LL 2X4QA 2PO6C 4N1EA 2VN4A 5IT2L 5FGCE 4JKPH 3OB8A 4U1JA 4AQOA 3IJHA 4GRWB 4U1LB 3BX7C 3EJYC 2ERJC 4HDIB 1N7ML 2ZUQB 4JDZB 5MENE 3T1FA 1DUZA 4LU5H 3I75B 2R29H 4YHYB 4EIZC 4I1NB 1M71B 4JFEA 3NFSL 3CXHK 4PUBL 5C0IB 3FO0L 5B8CA 4JKKA 4MXVE 5TDNA 4B7LA 3UTQB 5FYKD 2MOVA 4YDIH 4OCSH 3RVXC 5KANI 4J8RA 1J1XL 3JTSB 3UTPD 4CVZB 2Y1VA 2VOTA 2OZ4A 5CWSB 2XN9B 3S3SA 4JRXB 5IEKB 3TPKA 4JY4A 1OTTD 1CTNA 1QBAA 3C9NA 3PWNA 1A6PA 1KNOA 3T1WA 3GIZL 3WBDA 1N64L 4XPHH 3RWCA 5ITFB 3Q1SH 3LN5B 5IG7B 1XIWC 2BSSA 1IM3A 2YK1L 3NCMA 3PUCA 4UDTA 5I71B 1DQDH 1VPOL 5IJVA 5GRYA 3RWDB 3MRBB 5FYLE 4HQQH 1U8LB 5IB5A 1FGVL 1HHKB 1S8DB 1FGNL 4X6BB 3WSQL 3DXAA 1UB5B 3TWCH 3IKCA 1KCUH 1WJ3A 4LSRL 2NW2A 5IK3A 3QDGE 4D8PA 2VSCA 2V7NA 2FHBA 3VE0B 1ZS8B 4TUKL 4HFWA 5CGYC 5F7MC 3TESA 4XWGH 1HKFA 2R0LL 1K8DA 1MFAH 2FX9H 4N0YL 2J8UE 3HI6L 1RHFA 3GMMA 2FSEB 2XKNA 3NTCL 3EO9H 1MEXL 3W0WB 2XACC 5E9DE 2CLVA 1FO0A 1ZT7A 2HLFC 3JV4A 3OPZL 2GAZA 1A7QL 3WIHH 3FB7B 3L3KA 4LGRB 4KROC 3WFEH 1NCUA 4MJ6B 3IT8D 3SE8H 2VXTH 3G08B 4I3SH 4KU1A 3RL2A 3MLUL 4CDHA 5FDWB 4I5BA 2V17H 4MSWA 3MODH 5C6TL 5ISZA 4PP2A 1KTKE 4PRHA 2OLDA 4M7KH 3WS6C 1S7XB 1WT5A 4ERSH 4WUUE 4Q6IC 4NSKA 4JAMB 4LKCB 2VUOA 1G7JA 5IFHH 4C56E 1G9MH 1JVKA 1BX2A 1UYWH 5DJDA 1DN0B 4J6RL 1CDJA 4OFPA 5ID1B 4WIQA 2AVGA 5DA4A 1XCTB 1S7QB 4PY8I 3DGCR 5DTFA 1HI6A 4PRPE 2FCBA 1IEAA 2FIKA 1WZ1L 2AV1B 5GS2H 4CUCA 3JUYA 5C0FB 5BMFH 4PJEF 3G6JF 1OAXL 3MLTB 1CU4H 2DJUA 5F21B 4MVBD 3KYMB 1BFVL 3QIBD 1Z9MA 3QZWA 1DVFB 4EDXB 3O6KL 4G9DB 4HJJL 4RA0C 3HAEH 1NPUA 1C8PA 3MRPB 3PF2A 3GMQB 2FDBP 2WQRA 2EDBA 4OZHF 1AKJB 1GAFH 3G6AB 2AXHA 3UBXG 1SJVA 2R2HA 1OTTC 2YD5A 4QY8B 3LAFA 4JFOB 4QRPA 3VGFA 1ORQA 4ONHB 5K9OB 3BZFB 3B3IB 3TV3H 1ULVA 1KT2A 4GUPB 2MPAH 4LBEB 4JZNA 2DQEH 4Z8FH 5IM7A 4NKOB 3UTTA 3DIFA 2AEQL 2ATKB 1ZGLP 3BGAA 1MCDA 4PLNC 3ARGA 2VDPL 5DR5H 3W39A 3VG9C 3TO4D 1S3KH 5HGAB 1F3RB 1U8IB 5F7HA 3HZYA 5IBLC 3V4PL 3QHTC 1HHIA 2Z31A 2BVYA 2DDQH 2CDGB 4PB0H 1S7WB 5HJ3B 2IQ9H 4IDJH 3IYLW 3SDXF 2CGRH 2X4NB 4XPTL 1IAIH 4AT6A 4YJZL 4L3EA 3CPLA 4YH6A 2H32A 1C12A 3LMJH 5JW3H 5HPMA 2NY2B 2PETA 3D9AH 3HE6B 4YHYC 4R96A 1A7PH 2FD6H 1LO2H 4H1LA 2BY3A 2GK0A 2LVCA 1UVQB 3MA9H 5F71A 5I1JH 3MGTA 1OAYL 2GITA 3FFCD 5DWUL 3BT2H 4BZ2H 1RJLB 1TTFA 5D7IF 1TVDA 4GSDH 2DYPD 3MLYH 4BQBA 3QSKB 4HZLA 1RK1A 2WBJA 4U1KA 3WL9B 1O7SA 2G5BB 2EDKA 2R4SL 4HV8B 3H7BB 1RJCA 5SWZD 5TPWL 5DRZB 2R0ZH 3PP4L 1AD0B 4O58L 1R5VA 3HG1E 5FXCH 1PAMA 5INCA 1E4KC 5IW3A 5I71C 3IU4H 2H26A 4BUGA 1BQHB 3DI2B 3MUJA 3DBXA 2CIKA 3L3JB 1K6QH 4NQEA 2DBJA 1MVFA 1J0ZA 3IVKB 1DUYB 4QHUA 2B1AL 2VLKB 1U3ZA 3GDBA 5HYIA 4M6ML 2UV3A 2NZIA 4AQ1B 1ZKAA 3L9RB 5EZJA 1WQVT 3E2HC 2MCG1 4YR6A 4XGZB 5JDSB 1MPAL 1P4LA 5BJTA 4UT6H 2PYED 4S2SA 2ZKHL 5CJXA 2EDHA 3V0WH 4HPOL 4GG6E 4RMQA 3U1SH 2JCCF 4IMLB 4WFEE 5AYUH 4B7IA 1BZ7B 5JIKA 4P4KB 1IGML 4DZBA 3AS3A 3IXTA 3TN0D 3V6OA 5IESH 2HTKD 1QRNA 2NW3A 2UWEF 4K9EC 1G1CA 1LO4L 4Y4HB 3BH9B 3GM8A 3T0ED 1S9YA 2H1PL 2J12B 1B6DA 1F8TH 2X2YA 3MLWL 4JHWH 2PXYB 1P1ZA 3T3PE 5IV2B 3SDDD 1ZA3B 1IARB 1U8OA 4LCWA 3WFHA 2BMKA 2VMFA 3QXAB 2C3GA 1CD1B 4PJ9A 1ZTXL 1J5OL 2HKFH 2FBJH 3M8OH 5GHWH 4DKDC 1F4HA 5CJOL 3CMOL 3VXUD 4BM7A 3S88L 1ETZA 4LRNL 5EO9A 2VIRB 5FB8B 5EU7C 1MCJA 2QQQA 4D9QD 4PFEA 3E3QC 4D0DB 4P2OB 4PJFE 3H9SD 1HHJA 5D96C 3TO4C 4R4FH 5BOZG 3RKPA 2D31A 1C16A 4AH2B 1I7RB 1T0PB 1TETL 1U6AL 3MFFB 2BNUA 1U8NB 1UJ3A 2P5EB 2EYSA 5HVWA 1FL6B 4PTTB 2YPVH 4YHLH 4LLVB 3BESR 1IL1B 4I0PD 4F9PA 1F6FB 5GPRA 3MRRA 1JPFB 3UJIL 4RAVA 4RFEB 4F33B 4XVJH 4ZPVA 5IHUL 1XGTB 4HW6A 1U92A 4NT6A 1N6QH 3U48A 4Q2ZA 1R3IH 3HS0A 3VXOA 4JO1H 5C0GA 5HHOE 5IW6B 1MHEA 4F2MB 2A74B 4OLVH 1IAOA 2CQVA 3KR3L 2NYYD 3V6ZA 5FF6A 1NGWA 3HHRB 4MX7B 4KJQC 5DFWH 4XPFH 5MENA 1UCBL 4ODVL 5HDOA 3C6SB 2BNQD 2Z8WC 3F7YA 3REVA 4JFPA 1R3HA 1A7OL 3PWVA 4KJWD 5CBAA 4PGBB 3MV7E 1I1YA 3CSYA 1TFHA 2PYFA 3PWJA 4NQDE 3UTSB 2YUZA 3D39B 3FL7A 3QXVA 4F58H 1F45A 1DE4B 3EYVA 4MLSA 4YQXL 3SJVB 4EUPA 4Q97A 4MDJB 1WCBA 2H45A 4MNGE 2CR6A 4ODXA 1CLZH 4YXKH 1R3KB 5ACLA 5JA9A 3U0WH 4BQ8A 5LG1A 5FYJH 4XC3L 1BWMA 1VACB 1YECH 3IDIB 4ZXBA 5LCVL 2VWEC 3HE6C 1ED3A 2R0WL 5CSGA 5T5NG 3GGWA 5E8EA 5H8DA 5F7KC 3TN0C 1NGQL 1JFQH 4AENB 5E6ZA 4ZNCD 2X70B 1UC6A 3T0EC 5DI8A 2Y23A 5J89A 3VXRA 3QDGA 2X4TB 5FKAA 3CXDH 3RWFA 3HNSH 3CX5K 5M7QA 3MV9D 1L7TH 2B4CL 1VFUA 2J8UA 3MLVH 3BFOA 5EC1B 3VGDA 4DVRL 3U30C 2PTTB 3V4VH 2C3XA 3O9WB 5CEXB 2R1WA 3FFDA 3WNMA 1Q0XL 4PJ5B 4HS8H 1DTUA 5CSBA 3LZFL 1CGSL 4HUVB 1YQVL 4OUUA 5GGQL 5T1MB 4NPYB 4KV5F 1P2CA 1YDPA 1LO5A 4PJ7B 3AREB 2FECL 4YAQA 5DMGD 4WW1A 4P9MH 4BKLA 3FN0H 3THML 4L8CA 1VEPA 2WQ8A 3KDMA 4OT1L 3T0XA 4WUUA 3GMOA 4Q9QL 3GMRB 2C3HA 5EIIB 3VFSA 3IJSB 1D5ZB 2BFVL 2C1OB 4JFXA 3WO4B 3Q3GA 4V1DD 3RL1A 4C4KO 1MI5D 1J0HA 4UV7L 5C09E 1UM4L 2ARJQ 4YPGA 2AJ3B 3O3DB 3UAJD 1OD9A 1CFQA 1JNLH 4ISVB 2PXYC 3FT2B 1RIHH 5EO1A 1HKLL 1WZLA 1ZHBB 4PRPA 1MLCB 4XTRD 1H5BB 3ZTNL 3QWOB 2OR7A 3X3FH 2AK4D 1LE5A 4D3CH 2FZ3B 1A6UH 4P2RB 5HY9A 3H3KA 1AXTH 4Y89A 1DBMH 1EXUA 2E7CA 4JKMA 1CLOL 1NGPL 4DN4H 1LK2B 4KJWC 5EUOE 5FO9A 3RNQB 3QJFA 5IWLC 4EZMA 4JE4B 1I7ZA 2NY1B 1NFIA 2B2XL 5D2LA 4UMGA 3BE1H 1REIA 1BM3H 2ICEB 4Z5RB 3DX6B 4FS0A 4XCEA 4XBEL 4L4VB 1T5WB 4RWYH 2IAMD 3GBNL 1IMHC 3SKMA 2DQTL 2XA8H 5DUBA 4X4MA 4POUB 1CD8A 3RWHB 2EDJA 2BSTB 3CFKB 3WN5A 1QR1B 3MRFB 3OWEA 4P46A 5F9DC 2MCPL 4OD3L 4YIQA 4XAWH 3RVVD 1CBVL 5DQ9A 3VRJB 3C2SA 5DRWB 4Y4KD 3RVTC 4NCDA 4KKNA 1KCRL 2Z4QA 1HZHL 2WM0A 4U7MA 4ESKA 4N90D 3KYOB 4AG4L 5DJYA 3MLZL 1ZVHA 2WIMA 1KPRA 4WTZG 1CD0A 5F1KC 5JXED 2P7TB 4ONFL 1I9IL 2XIDA 2VLLA 5FV1L 2DN7A 1FRGH 4XMKH 4O02H 4JGMA 5L8LB 2DI9A 5EU5A 4F7EB 3LIZH 1T5XA 2P8PA 1QFUL 5A16B 4QRRA 3OXRB 3SKJH 2DBLH 3SGEH 1QQDB 4HS6B 2Y7QA 3I3BA 1UXWA 5IROC 2VSDA 5DMGC 1U3HB 2HTLD 2VLRB 5EU4A 3V5HB 3OJMB 3HG1A 3MRIB 5F1SA 2FO4B 5C0EA 5I1HL 4PRID 5DJAB 2XTJB 2VABB 2P49B 3QUML 1H3GA 1MCHA 1INDH 1CFTA 2ITDA 4NDMA 3JXAA 2A77H 3NCYS 2DWDA 4PJIA 4WHCA 1CS6A 5SWSE 2A1WL 4QEGA 4YHZH 2X1XR 1MHHA 4P5KB 2R2BB 5ICZA 4GBXB 4LLUA 3D18A 4WO4D 5JW5A 1VADB 2BC4B 1T03L 4XNUH 3TA3D 1C1EH 4ZFGL 2FLBT 3O11A 3P40A 2YEZB 4G7VH 2CDFA 3UAJC 4HKXA 4KUZL 3TBSB 3L5WA 4TUOA 5DK0B 3U36B 5JOFA 5FOBB 3V7MA 4DW2L 2YD4A 2RB8A 1BJ8A 3O9WC 3P77A 5IB1A 5T5NF 5DJ2B 3WNKA 2VZ1A 4UIKL 2K7PA 4QXTA 3ZE1F 4XPGL 1CFNA 1BQSA 4LPUA 2GCYB 5FYKH 3OBAA 3O6ML 4KK9D 3UJJL 3AREC 1FFNA 1J1PH 1GGIL 4DFHA 3B5TA 1T83A 3FQTB 3VFVB 3KPRE 1FSKB 2DQFA 2A83B 1JTTA 5L0QB 4Y19A 2IAMC 5CKAA 5JTWA 4F3FA 3VXPA 1JIBA 4LARH 4G43B 3R06B 4RGOL 4RISH 1AP2B 4UAOB 3FONB 5D2NA 2ZSWB 3JUZA 4R2GD 2XZAL 4IIQB 4LAQL 2XKSA 2VYRE 1SHMA 1C5DA 1BOGB 3ESUF 3I50L 4YC2C 4PJFA 3FB8B 3KLSA 4NKDB 4NQSB 1MWAH 3DHJA 1DQMH 1RU9H 5HYQA 4W4OC 2Z93A 5T3ZH 4JQXC 4JM2D 5EU6D 2DQIH 1F4XH 2D7QA 4GRWH 1FPTL 1P4BL 3QUMB 3JWDC 2MJWA 2BOBB 3EFDH 1NC4D 4PREB 4R8WL 4X7TB 1FIEA 4MJID 1I3GL 1IGYA 1AFVH 3IXAA 3I6KB 4HSQA 1JZ2A 3X13A 3O4LD 3I9GH 1OCWH 4ZO8A 5IQ7H 1AI1L 3B2VH 1WIOA 4JDVA 3SE9L 4XVUC 4L4JA 4Q9RH 3F12A 3LN4B 4HHAB 5HHOA 2DWEA 5KS9E 2F53D 3CDCA 4KHTL 4F37K 2QLVB 1KIQA 1LGVA 2YSSA 1S7UB 2JJVA 3RWIB 2B4CC 4LSPL 4DZ8A 2DAVA 5I30H 1UZ8B 4Y8DC 2P8LA 4Z76A 2JB6A 2OZ4L 1PLGH 4MA3A 3FTGB 4R26L 5BRZB 4E41E 4MXWL 2UYLA 2HTLC 3EO0A 3HMXH 1DBJL 4GKNB 4KHXH 3BJLA 2BSED 3PL6B 3R8BB 2E6QA 3QXUA 4HXBH 1ERNA 1XR8A 1EO8H 2ZUUA 3MV7A 4NQDA 1KACB 3VWKB 2OCFD 3HMWL 1S9WB 12E8H 2ILLA 3SDCB 2FNBA 1FN4A 4KJYA 4MHHI 5FHBH 3LCYA 1LO0H 5HD8C 2HH0L 1JNNH 4XP6L 1H3UA 1MJ8H 2EEDA 3ARDB 3HZKB 4UDUA 4Y1AD 4PJAE 3DSFL 3OG6B 4IJ3B 1JRHL 1JTOA 5F44A 5HHNB 1FYTA 5E7FA 5TFSH 3WE6B 3QCUL 4AEEA 1GZQB 2PW1B 3QEGH 5FECA 3DX9A 3TA3C 2YWYA 2X4RB 5EO0B 3VWJB 3IDNA 5TDPB 2E7HA 5FO8A 5EOQH 2DL2A 4U05A 5HGHA 1WIUA 4TPRH 1A6WH 2H3NB 4K9EH 2HRPH 2XFXB 4CADB 1B3JA 4I0KA 1ZT1A 5HYJD 4K7PX 3BOVA 4M5YH 3WHXB 2ZSVB 1JYNA 3NABH 1JZ4A 3VDBA 1FO0L 2HKHL 4RMWA 4LKXB 4U1GB 1JPTH 4Z7VB 1QFWL 3BMWA 4L1HA 1DLHB 1N7MH 4OFVA 1ZHLA 4I48A 1B4JL 3UYPA 2A6JA 2N7BA 4U1JB 3KG5A 3IJHB 4R0LC 3MJ7B 3NFSH 4L4TA 4PUBH 3GSXA 3FO0H 3T1FB 1DUZB 2XTJC 2YN3A 4Z7UA 2VR4A 4QYOB 2ESVD 3KS0H 4JFEB 1E0OB 2AI0H 3BDYL 5B8CB 5GSRB 4ZQKA 5TDNB 2I5YL 4J8RB 1L6ZA 1PZUB 1S9XA 4GBXC 4HUUA 2R1YA 1GGUA 1N64H 5KN5A 1TZIA 4H88L 4JY4B 1YMHA 3PWLA 3C9NB 2YK1H 1V7ML 1HYRC 3FQNA 1KNOB 1JZ6A 4JM2C 3RWCB 4Y4FD 1VPOH 4I9WE 1MJJA 2BSSB 5GS1B 1F4YL 1IM3B 4OZ4A 3O3EA 4UDTB 1PJ9A 1FJ1A 2WK2A 3KHQA 5KZCD 4PP1D 1FGNH 5IJVB 1VERA 4JHAL 3WSQH 5C09A 5IB5B 5IB3A 1MFDH 4YHML 4HIXL 5I9QB 3S36X 5HHXL 5C70A 3X3GL 3ZDXE 1OAKH 3DXAB 2VDOL 1HCFX 1FNLA 3IKCB 4GOSA 5HHMD 2R0LH 2OI9B 4N0YH 2NW2B 5IK3B 1QSED 1FSKC 1U2CA 4D8PB 2V7NB 4MA7L 4Z0XA 3NTCH 4C4KT 4HFWB 3VFTA 1VSCA 5L0QC 5H94A 1K8DB 4X6DA 3OPZH 3GMMB 2XKNB 3CSBA 1EEZA 3VI3F 4MQ7A 1YEEH 2CLVB 2VJXA 1FO0B 4IIQC 1ZT7B 3JV4B 2XG5A 5CKGA 2ICWI 2GAZB 3DYMA 3ULUL 3MLUH 4TSBH 4WFFE 3N1PC 2E27H 5IP4A 1AGFA 3TBYA 3WFDH 1L0QA 5C6TH 5IOPA 5D6DA 4ODWA 5MP6H 3RL2B 3LOWA 4I5BB 1WTGT 4WGVB 4MSWB 2HMIC 2YD1A 3CVIH 5ISZB 3NA9L 4PP2B 4PRHB 4LCYA 2X4PB 4ZG1A 4WFGE 2XPGB 3VD7A 4F7PA 1AO7E 4NSKB 4ZTPL 1G7JB 4F9LA 3LB6D 3QO1A 4JM2F 4FP8L 2F54E 4W4NA 1BX2B 5DJDB 2VQ1B 4FQXA 4FQCH 3VJ6A 3ECBA 3DECA 5E2UL 5AWNL 1QZ1A 4GAGH 1AR1C 1WZ1H 3MOBH 1F2XK 2X4UA 5I15L 1J8KA 1HI6B 2GKIA 3WMSA 1IEAB 4Y7MA 4X9IA 2FIKB 5FYJU 5DK2A 4UQ3A 4HK0A 3DGGA 3PL6C 1OT1A 4WI4A 3BUTA 4PJHE 4XCYA 1BFVH 5GJSH 4HIHA 3D1MC 3KLDA 5C71A 3NFNA 4RQQA 4NN5B 3BSZH 1QYGL 5DT1L 2KDGA 1OAUL 4H5SA 4L9DA 3V7AG 2YKLL 3ZTJG 1UA6L 1KN4L 2IANE 3MGOA 4KTEH 3FOLA 3QZWB 2XQYG 1VFBA 4K7PL 1QFHA 4S0SD 1MCPH 3TBWA 3ARDC 5HVHB 3QAZB 4K23L 2V9QA 4JLRA 4IJ3C 4JZOA 2B5IB 3DMMB 4PYHA 3F65A 2YZ8A 2CXGA 3S4SG 1JE6A 4HKZA 2R2HB 5F6HJ 4WFHE 4QRPB 4JN1H 3DSNA 4OKDA 1X9QA 4HKJB 4ZDHA 2VDPH 1KT2B 4M6NL 5E95B 2DRUA 5IM7B 3SOBL 2YA2A 4KDTC 3UTTB 3DIFB 3V4PH 2WP3O 3HE7B 5SWSA 2NY4B 3RPKA 4P57A 4XWOC 3W39B 1TITA 2Y9RT 3RZWA 1RUQL 5F1NA 3P73B 1HHIB 2Z31B 4U1GC 1BD2E 1H0DA 1N3NA 4A6YA 4QHNA 3AVEA 2F8XC 1GC1L 4ODHL 3I6LE 3ARWA 1EFXD 3GSOA 3KPSE 4AT6B 4CMHC 3C60A 1NMAL 1CGVA 2R56H 4OV5A 1KBGH 4L3EB 3CPLB 4I2XE 4LVHB 5D1XA 5TDOA 5D1ZA 5HPMB 3RTQD 4R96B 5EPMA 2V9RA 5DWUH 1J7VR 4H1LB 4OLEA 4G6FB 2GK0B 5B8CC 1MQ8A 3D85A 3P0GB 3ZT5A 2AGJL 4X5WA 1QSFB 2QKIB 3MGTB 1SMAA 2H9GA 1U2HA 1I7TA 1E4WH 4LQFL 4DUVA 4EBQL 3V9FA 4P59L 4RFNB 4PJBE 1A4JA 5LGKA 5TPWH 3K8KA 4HZLB 1JHTA 3C09C 1RK1B 3PP4H 4FQIH 2WBJB 4Z0BL 4KPHL 3VRLF 4U1KB 4OZIA 1FLRL 1A9EA 2AQ3A 1JUFA 4BJLA 3L1OH 1A1NA 1FFQA 4FZ8H 2ZUWA 5FKPB 1RVFH 7CGTA 5C0BD 2R15A 2AJZA 1Q94A 5INCB 4DVBA 5J6GA 3ARGD 1JZ3A 2YBRB 5KSAD 2H26B 4TSCH 4ZODA 3DBXB 1H8SA 4C59B 5SWQA 2CIKB 4M6MH 2VZ3A 3RRQA 1RZIA 5I9QC 2EE3A 5FYJE 1MPAH 1A21A 4KMLB 3DX8A 1OL0A 4HWEL 5DF0A 2ZKHH 4G8FA 3ARRA 5EZJB 2EZ0C 1Y0LA 2OI9C 4P2QA 2XT1B 1P4LB 5BJTB 5C0AE 2I60L 1IGMH 3B8SA 4S2SB 5FGBA 2DL9A 5GGTA 3O2DH 2XZZA 1G0XA 5DC9B 5IKCB 1LO4H 4MJ4A 4QXWA 3R4DA 4DZBB 2EC9T 5E8NA 4QGYA 3IXTB 2Q20A 4DGIL 1QRNB 2NW3B 2Q3AA 2YD9A 3MLWH 5KS9A 4GJTB 1S9YB 2JELL 1DQJA 4U6XA 2XZQL 1ZTXH 3SO5A 1T80A 1P1ZB 4FZEL 2YPLA 1U8OB 4LCWB 3WFHB 1A6TA 3CFBA 2BMKB 3ISWA 4WU7A 3CMOH 1RQ5A 4H20L 3PWPB 4PJ9B 5CEZD 2YN5A 4HKBA 4NRZA 3EYUL 5I73B 4GXUN 3FRPA 3S88H 2MQCA 4IM8A 1WT5C 1KPVA 2KUTA 4NQED 4LRNH 4X98A 1KGCD 3DETC 1A2YA 4PS4H 5EZOH 4R7DA 4JB9L 4MB3A 1ETZB 4X9FA 5HI5D 4XX1G 5FYLL 1P5UA 2QBWA 1UXSA 1MHPH 1TETH 3IDGA 4NBZB 1I1AD 4TNWF 2VITA 3ZMRA 3QXDA 5MERA 4XVTH 1NAML 1FE8H 2NY0D 4J1UA 2BNUB 3G04A 3UJIH 1UKSA 5FCUL 3QFDA 4WW2F 4X7DC 4S1SL 5IHUH 3QDMA 4LHUG 2Y6SC 3MRRB 3JWOL 4NN5C 3QUXA 2KPNA 4DGVL 1JF5A 4PYGA 1U92B 2VR9A 2X09A 3QI9D 4NT6B 1J8HD 5E56A 5D71L 1FNAA 3U4EA 4Q2ZB 4LHUD 3DVIA 3NH7L 3PE9A 3HS0B 3VXOB 5C0GB 1CLYH 4KXZI 1MHEB 2GY7B 5E1AA 5HVHC 1UCBH 4ODVH 3S34L 1IAOB 1YMMD 5FGCB 4W81A 1A7OH 1EGJH 25C8H 4MAUL 1NGWB 1VGKA 3GNML 4PJCA 5MENB 1EAJA 1BIHA 3WEXA 3QIWA 3UBXI 4HH8A 3F7YB 4JFPB 1LD9A 1R3HB 4G6ML 1MREL 2IADB 3SKNA 1TJHL 3ARFA 4TSAL 3CSYB 2PYFB 3B6SB 3PWJB 4Y5XA 4GMTL 4X6CF 5TQ2L 2NY4C 3ARGC 1FFOA 5K9QG 1D9KD 3FJTA 2Q87A 4MQXD 3EYVB 5BV7L 3MZGB 5FYKU 3SDAA 4EUPB 1IZKA 4IRZH 4JM4L 3NIGF 3MLSL 5DRNA 1G7MA 2F5BH 4XC3H 2BVEA 3WXWL 1OGAE 4ODXB 3FQUA 4MMZC 5LCVH 3JWDH 2APWA 4TTDD 5CGTA 4WUKL 4EI5A 4LVHC 5KTEL 4M1CD 3S3PA 4ZXBB 1IM9B 4HGWA 1ED3B 5D7KD 3CH1B 1OAZL 4NQCE 4WWKD 3GGWB 3D25A 3D3VE 5E8EB 1DQTA 4UV4L 3WDHA 3RZCA 2F19H 4PJEE 4UNTA 3G6JE 4X9HA 4XMLL 1HN1A 4O4YL 1EH9A 3RQ3A 1UKQA 4U3XA 3BEVA 1NAMB 4FQHA 4RFNC 4J2XA 5DI8B 1YEHH 2VLMD 1WBXA 2B4CH 3VXRB 2ORBL 3QDGB 5FKAB 3EAKA 1YUHA 3RWFB 2DLHA 3QEHA 4UNVA 5IMLA 2J8UB 4OZHE 1Q0XH 5DXWA 1T22A 1K4CB 2GIYA 4CVWA 3SE4A 3LZFH 1CGSH 3LKSB 3J7HA 1S9KC 5E9DB 1NL0L 1BZQK 1YQVH 2BVQA 4Q74A 3FFDB 2HN7A 4H8WL 4MA1B 2CKNA 5BVJA 5HTSA 4NJ9H 1P2CB 1YDPB 1H3VA 4B41A 3BIKA 4YAQB 3AY4A 4KDVA 4APQA 4WW1B 4IRJA 4R7NA 4MCZA 2W07A 3RVWC 2IC2A 4HJ0D 4BKLB 4L8CB 3VDAA 1ITBB 3LRSA 3S5LG 1NSNH 5F6IC 3BD5A 3VXSE 1X3DA 3RKDC 5CJXC 4RDQF 3PG2A 3KDMB 5C0RL 3SDXE 3CFDA 3ARYA 4WWID 4YUEL 1I3VA 4XBPA 4WUUB 2GTZA 3GMOB 1I8IA 1QACA 1AO7A 1NLBH 3VFSB 5IR1B 2F54A 4JFDE 1UM4H 5BV7B 4JFXB 2NXYB 1B0RA 1LEKA 3Q3GB 3RL1B 1CDGA 1N8ZA 3MR9A 1GC1C 1HKLH 3HRPA 4GKSA 3JVGA 4YPGB 4NYLB 3ZTNH 3RWJA 1CFQB 1AJ7L 5D7IE 1ONQA 1YPZA 5EO1B 4PRPB 1XGQA 2Y07H 4WI9A 1OTSD 4NUJA 5TE4H 4XHJC 4ENED 3JV6B 2MQ3A 4PJ9C 1QPXA 3QQ9D 1GPOH 1LE5B 1CLOH 4PJHA 5EBGA 3ZO0A 2YRZA 5FYKE 3WHE0 5HY9B 2D7MA 3HNVL 1EXUB 3ZKMD 1ZHNA 4WHTA 2B2XH 1MCLA 4XC1H 3UTPE 1T3FA 2IANA 1K2DA 3MMEA 5FO9B 4MQTB 4UU9A 3QJFB 5CD3A 1KEGL 3G6DL 8FABA 3TLRA 1NFIB 3QIUB 2VL5A 1D9KC 2J5LB 4XCEB 4FHBD 5AAWA 5D7SH 3RVUD 3GKZA 2EDRA 3QCVL 1UJ3C 3O8XD 3SKMB 4F9PC 2MCPH 4OD3H 5DUBB 5D8JL 3RBSA 4UINL 1MRCL 4TTDC 5HDQL 1QA9A 4GAJL 1CBVH 1Q8MA 2JCCE 2OTWA 5ILTL 4O9HL 4FQPA 5T3ZE 3VFWA 1JI1A 4Q9BA 5E94A 2HG5B 4X7EC 4WWKC 5DQ9B 5IGXH 4UT9L 2UWEE 5DLML 3HA0A 5ADOL 4U0QB 2Z4QB 4ONFH 1A5FL 2WLZA 1PG7H 2WP3T 5DJYB 1C08B 5FUOL 1KPRB 3NN8A 3GM0A 1KB9K 5EG6C 2VZVA 2DD8L 4ZMAT 5KSBF 3NACL 2VLLB 4KI5C 3VXQA 4LSTH 4BH8A 5JA8B 5J1AA 2XN9E 3BKMH 2IPUK 4XNZB 2BY2A 4OLZH 1QFUH 2A73A 5CJQH 3IAPA 1MELA 5ESAA 1X4XA 2IMNA 3KPQA 1W0YT 4NP4H 5EU5B 1TZGL 1MIEL 3WKMH 5C0DA 4L8BA 4PJBA 1T5XB 2P8PB 4U1SB 4OGYL 4TUJA 2CLRA 4QRRB 3G9VA 3RNKB 2FJHA 2JB5L 3S37X 5LWYH 2B7DT 2Y7QB 5E5UB 1UXWB 2GT9B 5T1DL 4QKXB 1A3QA 3AC0A 3QUMH 5EU4B