1APCA

Solution structure of apocytochrome b562
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Solution structure of apocytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1apcA00
3C63A 1YZAA 2XLOA 4WGYA 5JS5A 5JVEA 2XM0A 2XL6A 3L1MA 4JEAA 4NC3A 1GQAA 3C62A 4CIPA 5JLIA 1E86A 3M79A 4CJOA 3NMIA 3U8PA 1JAFA 3IQ5A 2XM4A 4ER9A 3ZWIA 1YYXA 2QLAA 4CDVA 2J8WA 2YL3A 4D4XA 4CJGA 4IARA 3ZTMA 2YLIA 1M6TA 3QVZA 3FOOA 2YLDA 4CX9A 4N4WA 3DE8A 4EIYA 2XLDA 2XLMA 256BA 3NMJA 3VRCA 3HNKA 1YYJA 1LM3B 3M4CA 4L6RA 5JUAA 3HNIA 1E85A 3ZQVA 3QVYA 4D4NA 1E83A 4U9DA 3QW0A 3HNLA 1NBBA 3NMKA 1CPRA 1S05A 1CGOA 1EKYA 3DE9A 2YLGA 2XLWA 5AGFA 5B3IA 5JSLA 1CGNA 5JT4A 2XLEA 2J9BA 5JP7A 4JKVA 3ZQYA 4IAQA 3M4BA 3M15A 3FOPA 3TOMA 4CDYA 1YZCA 4JEBA 2YKZA 2YL7A 2BC5A 4JE9A 4ULVA 3TOLA 4IB4A 2XLVA 4CDAA 4N6HA 1RCPA 3QW1A 1E84A 1A7VA 2CCYA 2XL8A 2YL0A 1APCA 4WGZA 2YL1A 3ZTZA 1QQ3A 3IQ6A 1BBHA 1MQVA 3HNJA 1CPQA 2XLHA 5JRAA 4U9EA 1QPUA
chains in the Genus database with same CATH superfamily
3C8GB 3LLIA 5DS5A 2B0HA 3RVYA 1D0YA 4JC7A 4WGYA 5JS5A 3TQOA 3SZRA 2XM0A 2XL6A 3L1MA 3FVYA 3J06A 3AJMA 3FMSA 1WOLA 2WZLA 3FAPB 2MHRA 4ONSA 3C62A 1YAUO 2WVQA 5F5HA 2F22A 4CJOA 4CIPA 1WATA 2WL8A 3NMIA 5A6KA 2R7RA 4OIQF 3LS1A 2GA0A 4MVRA 5DS6A 1ZU4A 3EZIA 3ABMC 1G4WR 1QKRA 3GEHA 1JAFA 2HMQA 3IQ5A 1FAPB 4MTGA 4XQ1A 3MFNA 1YYXA 1NFOA 2QLAA 4CDVA 2LCHA 1G8XA 5T3WA 4FAPB 3K1IA 2FGYA 3V5XA 4XPXA 4YL1A 5BQIA 1JR8A 2DYSC 1JMWA 3GM3A 2ETSA 3O55A 1F1MA 2YLIA 5FCLA 1NG1A 1ZW2A 5KYNA 1ZHXA 2UUHA 5COFA 3KMIA 3T6BA 4AE4B 3PHF2 2JX0A 5F5FA 4XWJA 1OQCA 3EFOB 2A68F 3NKDA 3L0IA 3Q7GA 4M63A 1T6QA 1MNEA 1PV3A 3U3BA 5L3VA 1HW2A 1PD1A 4EIYA 2XXAA 3GWLA 256BA 1ZHYA 2JD3A 3N2ZB 3NMJA 3GORA 4J7YA 4J30B 4Z9IA 4C3EA 3K66A 3S9OA 4PFPA 4JTDB 2RD9A 3DZAA 4JZAA 1OW8A 2BL2A 2LP4A 3HNIA 4JRZA 4PJLA 2EPMX 2VCBA 3NRHA 4EBJA 4CSAC 2R7SA 4HE8D 2CNWA 2Q9BA 2PNOA 2NUPB 4BJTA 2J45A 2C04A 2AVKA 3POVA 1AEPA 2Z15A 3QTHA 3RQFA 2KNHA 3X2QC 4E0IA 1E83A 1L7CA 3UMKA 2KJGA 4HFFB 3HNLA 1K40A 1NBBA 1H7IA 1RKCA 2Y39A 3F46A 3LNRA 1KTMA 4KNWA 1GM5A 2L6GA 4YT5A 5L0GA 1NSGB 1S05A 1H6GA 4U5EE 4JW1A 3HJCA 3S90A 3AG2C 4WJ0A 3TD7A 3DWWA 3K7DA 4I3MA 4FESA 2R25A 2V26A 1ZHWA 4DRJB 4LDRA 3DE9A 2L6FA 3EGDB 2QTVA 3RF3A 2XS1A 3A11A 3B0VC 1YVIA 2VCAA 3ATPA 4O6MA 3IPMO 5B3IA 1Y4CA 4K7BA 3VYWA 3AQBA 3T9OA 4IAQA 4LACB 2J0WA 4XPYA 1VB5A 4EKWA 1V74B 1AVOB 1Z5ZA 3TOMA 4H54A 3C18A 3VF0A 1YZCA 3RFYA 1LI5A 3FXHA 2YZSA 1MMDA 1U6HA 2YKZA 4J7TA 1GS9A 2YHSA 4MW3A 4G7HF 2BC5A 2HV7A 2OU6A 1M2OA 3CZ6A 3DI5A 4FX5A 2W9YA 4JTAB 5E33A 2YRFA 3VAYA 2VASA 4IB4A 4NTFA 3U3FA 2WZGA 4BJ6A 5EGYA 1YA7O 2XLVA 2OOCA 4YJWA 1VYIA 3DAGA 4PK4A 3R7CA 1OW7A 4N6HA 3RH3A 4JTCB 1ZVZA 1UG7A 4Q7CA 3W2WA 2CNWD 4YL0A 1OR3A 4BJ5C 1C02A 1JRAA 5T3TA 4N06A 1A7VA 2NPUA 3EHMA 4YN0B 1D0ZA 5BQGA 2VH3A 1NFNA 3IQCA 2R03A 3S28A 2YL0A 4CS8A 2EILC 1W2WA 2A69F 2MWQA 2YL1A 1RMVA 2ZPAA 3IQ6A 3DXJF 2Y3DA 5K0IA 5KYUB 5KYYA 3GM1A 3WG7C 5EHHA 1CPQA 3CEXA 3UNGC 4HFKB 1QPUA 2NG1A 2WB7A 3RQGA 1I5NA 3V5ZA 5AC5A 1YZAA 3KPHA 2QY9A 3W8IA 5DQTA 1HMDA 2I15A 3G4XA 3UGOA 3LNMB 1KU2A 2CGEA 1K04A 2LFFA 3JSEO 1R5ID 2OJED 1T5OA 1TFKB 4JEAA 3DKAA 4MVMA 4NC3A 3WODF 5KYWA 3HTKC 2Q7RA 4H4KC 1D1AA 4PR9A 4U5DE 2HJMA 3KL4A 3M79A 3SXMA 2WVNA 1O5HA 2EIKC 1VLSA 3DD7A 4J32B 2J9WA 3W2VA 4KC9A 2WVOA 1SYQA 2KK1A 4HEAJ 1M2VA 3ZWIA 3NYMA 3AQCA 2J9VA 1HE1A 3KYJA 2J8WA 2A6HF 2YL3A 3PCVA 4LDQA 3SEOA 3U0CA 4D4XA 1NU7D 3DJNB 4IARA 2WZFA 3ZTMA 5DS4A 1LE4A 2EIJC 2EPLX 3QVZA 2YVKA 4MS2A 2YLDA 2OCCC 3L8JA 4XEVA 3UMIA 1ZYRF 4O6NA 1Q0FA 4O7GA 4P6IC 5DQZA 3V7OA 3PDMP 3ABKC 2Q3TA 3DE8A 4CS9A 2XLMA 2OEXA 3VRCA 1VOMA 4B6IA 5B3SC 1LM3B 1LPEA 1WTYA 2DGJA 1M57C 1WWPA 2OJQA 2ZD9A 3M4CA 4O79A 5B1BC 1C17M 4JCZA 2KYHA 3NKEA 1EI7A 5HSWA 2R9RB 4ZLCA 2Y3HA 4L6RA 3ZQVA 4BG0A 1HY5A 2OG2A 5HV9A 2KC3A 1CGME 4IRUA 3AGTA 1TWGA 3S0XA 4JURI 1NLXA 1OCOC 3JYYA 4I1MA 2R7QA 4ZLDA 3DM9B 4LLEA 5KYXB 2IXPA 2RSEB 1B68A 3K1IC 1VTMP 1YARO 3DM5A 4BEJA 2R02A 3E9VA 4G7ZF 2EINC 1LIHA 3O6XA 5CIVA 2CDQA 4JCHA 3AOUA 2V3CC 2LK4A 4R32A 5D91A 1N1CA 1L3PA 2IM8A 2LFDA 4GQHA 1V4AA 3ABLC 4GYTA 1TFOB 4E17A 3NDBB 1TKNA 3X1OA 1U0BB 1FR0A 2Y69C 2W45A 4YL3A 1OKKD 4CBEA 2ZXOA 1TWCA 3TJ6A 4I1OB 1J8YF 1M2VB 2IXMA 3U8VA 2HMZA 2HSQA 4N6CA 5JT4A 1QZXA 2HUJA 1VK5A 3ZQYA 3KH2A 2L81A 2A1DD 1D0XA 3M15A 2Y3BA 1A0BA 3IHUA 1PCXA 1ZHZA 2X0CA 4CDYA 4E7SA 2P0NA 1WN0A 3DAFA 3SXYA 3JZ0A 1VMAA 3Q7LA 4C7OB 2J9UA 3CAXA 2FAPB 4P9FA 4OIOF 1K05A 1V55C 4O6YA 2Q4FA 1Z6AA 1FFTC 2PX0A 4JE9A 2Q9AA 4K1OA 4QDLA 5L0FA 1S7ZA 3FDQA 3MYFA 3S27A 2PF4E 4LLCA 2HV6A 3TULA 4CDAA 1ZW3A 1LKXA 2QUPA 1RCPA 1RKEA 2J7PD 3NYLA 4GEHA 3I4UA 3MBGA 4W8KA 3CSKA 2XL8A 1U89A 1APCA 3RQEA 5DLJA 4BEMJ 3ZTZA 1QQ3A 4IJJA 3QMKA 4RDAA 3PMRA 5JRAA 3GEIA 5A6AA 2PX3A 3C63A 3JRTA 4BPMA 4E0HA 2VB6A 2O9XA 3U9MA 1MMNA 1PD0A 2IXOA 5JVEA 1H9TA 2R7XA 4NTAA 2Q00A 5AC4A 2G3KA 3MYIA 1E86A 5L0JA 3Q6MA 3NYJA 4NTBA 1LS1A 1BDJB 2XXAB 1RXQA 1IZMA 4LDKA 5FZTA 4DRHB 3LESA 4G78A 4ER9A 1SMYF 3RYLA 5BUOA 4DXWA 4BJ6C 5E3AA 3LEVA 3WAQA 2R7TA 5GPGB 3A9CA 3OA1A 1MNDA 2XSEA 4EUKB 5L3QA 1A7EA 4XLPF 2DI3A 5E3CA 3AGUA 4CJGA 5BQHA 3KKBA 2R7VA 2H7OA 3U2MA 3WHNA 4WABA 1M6TA 1BR4A 4OIRF 3LJBA 4BJ5A 1LI7A 2W4MA 3FOOA 3K33A 4W8PA 5D92A 3RKOF 1YLMA 4CS8C 4OIPF 3GEEA 4AL0A 2XS8A 1LE2A 2BE5F 2D4UA 1XZPA 4N4WA 4NCQA 2R05A 1TWHA 2KQ9A 3T6GB 5A6BD 2PP4A 3EG9A 4K0DA 3ZDLA 3JT1A 2QNLA 1I4ZA 1IW7F 1YJGA 4YT4A 3B0UX 3HNKA 5TJ5E 1RKEB 2LIGA 1Q0MA 4MVZA 1Q0KA 4Z9JA 3L8IA 3ZVRA 4PJNA 5JUAA 1FTSA 1ORJA 5DVWA 1E85A 2C03A 2UUIA 3DMDA 1D1BA 2YEVA 2AU5A 3CQZA 1Y6DA 3QVYA 1OKKA 4C3BA 4BJ1A 2QE9A 1J8MF 4U9DA 2HJ3A 5CI8A 1BR2A 1OW6A 5L0DA 3EFOA 4U5BE 3U5SA 2NSGA 1WGWA 3NMKA 4PJJA 1T6UA 1OXBA 4MTOA 2ASRA 2NUTA 1BZ4A 2L7AA 4C3DA 5L0HA 1CGOA 3AG4C 3VM6A 2IOQA 4A4AA 4DBQA 1DOVA 1EKYA 1FNTc 2CW0F 2EIMC 3QZCA 4DJ9A 1TQGA 2YLGA 1Z63A 1FMWA 2H7VC 1TWAA 2YQYA 3C8GD 2XL4A 4Q5SF 3SXZA 1G5ZA 4CS9C 4XPWA 5A69A 1MMAA 2XLEA 4YT8A 2J9BA 4DRIB 1RJ9A 2J7PA 3T6JA 1Z3IX 3M4BA 3ZIBA 3EH2A 4Z9HA 2M4EA 3MLGA 1LVKA 3FOPA 1KNYA 2P1AA 3SYNA 2AWCA 4JEBA 5KYYB 4MW8A 3EJNA 1JPJA 4DOZA 2YL7A 2OEVA 3NG1A 2X51A 4EWCA 2CYDA 4MVUA 4QI2A 3LS0A 4ULVA 3EZHA 3JYHA 3GANA 3N0TA 4U5FE 1VLTA 3ZSUA 4AX2A 3B71A 4XEKA 4IGGA 4YK5A 4AL1A 4CIHA 3C7JA 5KYWB 3EG9B 4X0RA 3EGDA 4IWBA 2R7OA 3QW1A 2R7UA 3S29A 3SP1A 3W4YA 1LS4A 3JTLO 2GDCA 2CCYA 3EHNA 3GODA 5F28E 2H7BA 5EK0A 2KGOA 1OXKA 1MMGA 2M64A 4WGZA 3H65A 1ST6A 2KSFA 4ULWA 1BBHA 1MQVA 2LQGA 1GGQA 4G7OF 1HE9A 4U9EA 5B1AC 1O3UA 3OEOA 2ZXRA 2XLOA 5JLIA 1DOWA 3K1HA 4EBBA 1T9KA 2Q9CA 1Q0GA 2HZ8A 3ASOC 2NUTB 1EQ1A 1GQAA 2J46A 1HMOA 2EPNA 1HW1A 3N24A 2G62A 1H9GA 2KW3C 3B29A 3O39A 4G0HA 2OQMA 4CSAA 2GAQA 1SZIA 1XWJA 3U8PA 1AUEA 4XTKA 1XZQA 2XM4A 3EPVA 4QI0A 2GFHA 2GWWA 3R2PA 1R4TA 5A6BA 2MYSA 5KYUA 1T6IA 3E70C 4EBKA 2LD6A 4Q4ZF 2EPKX 2J0XA 4UDVA 2R7WA 4IAOA 4MTFA 3LUTB 3H2VA 1RJ9B 3B0PA 3G50A 3ITFA 3TJ5A 2HKVA 4RD9A 1JOGA 4E18A 2W4BA 3RIPA 2A0UA 3RVZA 4F4BA 2FFHA 1OR2A 2NSFA 1QVXA 3JSZA 4FWVA 4PFOA 4CX9A 4A2NB 3EQLF 2A0BA 4LERA 3TK0A 1C03A 3ECSA 3UGPA 3K6BA 2E87A 4KI2A 2XLDA 3BRJA 1ZHTA 2A6EF 3F47A 4MVQA 3SNHA 2H8AA 1YYJA 2IYLD 3ZC4A 4CS7A 2HSBA 3UMHA 4YWQA 1NU9C 1Z23A 2PBEA 4JVSA 1NZEA 1QLEC 2AP3A 1WASA 1FMVA 2Y3GA 4EHPA 4PACA 3KYIA 3EGXA 1YDIA 2P6VA 3W8HA 3Q6NA 3HKKA 5IY5C 2DB4A 5L0IA 1E2XA 3H2UA 3BEHA 1SF8A 4D4NA 1Z7Qc 3C8GA 4E7ZA 4U5CE 3QW0A 4XLNF 1BR1A 2P7VA 2PFDA 2TMVP 3I5PA 5A6JA 1CPRA 4PJMA 1V54C 3C8ZA 4U5GA 3G4ZA 4DVZA 2B0JA 2ZXWC 5COGA 5E2QA 1A7DA 4KBLA 3B9QA 3SXKA 3O10A 1Q0DA 3LAYA 4P9TA 4I44A 3IEEA 2HFIA 4JJGA 2AWYA 2XLWA 5AGFA 1I4YA 2IBFA 4MNDA 1G4US 1T01A 3JRMO 5JSLA 1O87A 3OWTA 1CGNA 3IQTA 4OD4A 3UR3C 1QSPA 1M56C 3V5YA 2ZXPA 2DYRC 2HS5A 2OKUA 3HLZA 4JKVA 4NQFA 3JCUQ 3L34A 5JP7A 3GWNA 4AK9A 4ANJA 1FFHA 5KYXA 1ORYA 3U2LA 3M1CB 4AE4A 2VCCA 3AG1C 2ICWG 3DJUB 3T4RA 1YA9A 3RW0A 2L6HA 2YWAA 3US6A 3I5QA 2VC9A 4DVYP 3TOLA 4NY3A 2IXNA 4JJFA 1D1CA 3EH1A 3GM2A 3LLKA 1ORSC 1ZZPA 2G3VA 1OCZC 2L9JA 3U9JA 1SR2A 5T1DB 1E84A 1OCCC 1JPNA 1ZU5A 3ASNC 1A41A 3FHDA 4JIOA 1UFBA 4OD5A 5COMA 1EA8A 2D5RB 5CI9A 3S84A 4MQ9F 2P61A 3LEOA 4OINF 3MX3A 4U5HA 2JPUA 2NUPA 3ZG1A 4MVOA 5L0CA 4DBRA 1OCRC 2I8BA 1VYKA 3EGXB 3FAJA 4XEFA 3AG3C 4MVSA 4YT2A 3HNJA 4RBNA 4C7OA 2XLHA 2XRHA 4KNVA 1TR2A 2LSEA 2EPOA
chains in the Genus database with same CATH topology
3C63A 1YZAA 2XLOA 4WGYA 5JS5A 5JVEA 2XM0A 2XL6A 3L1MA 4JEAA 4NC3A 1GQAA 3C62A 4CIPA 5JLIA 1E86A 3M79A 4CJOA 3NMIA 3U8PA 1JAFA 3IQ5A 2XM4A 4ER9A 3ZWIA 1YYXA 2QLAA 4CDVA 2J8WA 2YL3A 4D4XA 4CJGA 4IARA 3ZTMA 2YLIA 1M6TA 3QVZA 3FOOA 2YLDA 4CX9A 4N4WA 3DE8A 4EIYA 2XLDA 2XLMA 256BA 3NMJA 3VRCA 3HNKA 1YYJA 1LM3B 3M4CA 4L6RA 5JUAA 3HNIA 1E85A 3ZQVA 3QVYA 4D4NA 1E83A 4U9DA 3QW0A 3HNLA 1NBBA 3NMKA 1CPRA 1S05A 1CGOA 1EKYA 3DE9A 2YLGA 2XLWA 5AGFA 5B3IA 5JSLA 1CGNA 5JT4A 2XLEA 2J9BA 5JP7A 4JKVA 3ZQYA 4IAQA 3M4BA 3M15A 3FOPA 3TOMA 4CDYA 1YZCA 4JEBA 2YKZA 2YL7A 2BC5A 4JE9A 4ULVA 3TOLA 4IB4A 2XLVA 4CDAA 4N6HA 1RCPA 3QW1A 1E84A 1A7VA 2CCYA 2XL8A 2YL0A 1APCA 4WGZA 2YL1A 3ZTZA 1QQ3A 3IQ6A 1BBHA 1MQVA 3HNJA 1CPQA 2XLHA 5JRAA 4U9EA 1QPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C63 A;  1YZA A;  2XLO A;  4WGY A;  5JS5 A;  5JVE A;  2XM0 A;  2XL6 A;  3L1M A;  4JEA A;  4NC3 A;  1GQA A;  3C62 A;  4CIP A;  5JLI A;  1E86 A;  3M79 A;  4CJO A;  3NMI A;  3U8P A;  1JAF A;  3IQ5 A;  2XM4 A;  4ER9 A;  3ZWI A;  1YYX A;  2QLA A;  4CDV A;  2J8W A;  2YL3 A;  4D4X A;  4CJG A;  4IAR A;  3ZTM A;  2YLI A;  1M6T A;  3QVZ A;  3FOO A;  2YLD A;  4CX9 A;  4N4W A;  3DE8 A;  4EIY A;  2XLD A;  2XLM A;  256B A;  3NMJ A;  3VRC A;  3HNK A;  1YYJ A;  1LM3 B;  3M4C A;  4L6R A;  5JUA A;  3HNI A;  1E85 A;  3ZQV A;  3QVY A;  4D4N A;  1E83 A;  4U9D A;  3QW0 A;  3HNL A;  1NBB A;  3NMK A;  1CPR A;  1S05 A;  1CGO A;  1EKY A;  3DE9 A;  2YLG A;  2XLW A;  5AGF A;  5B3I A;  5JSL A;  1CGN A;  5JT4 A;  2XLE A;  2J9B A;  5JP7 A;  4JKV A;  3ZQY A;  4IAQ A;  3M4B A;  3M15 A;  3FOP A;  3TOM A;  4CDY A;  1YZC A;  4JEB A;  2YKZ A;  2YL7 A;  2BC5 A;  4JE9 A;  4ULV A;  3TOL A;  4IB4 A;  2XLV A;  4CDA A;  4N6H A;  1RCP A;  3QW1 A;  1E84 A;  1A7V A;  2CCY A;  2XL8 A;  2YL0 A;  1APC A;  4WGZ A;  2YL1 A;  3ZTZ A;  1QQ3 A;  3IQ6 A;  1BBH A;  1MQV A;  3HNJ A;  1CPQ A;  2XLH A;  5JRA A;  4U9E A;  1QPU A; 
#chains in the Genus database with same CATH topology
 3C8G B;  3LLI A;  5DS5 A;  2B0H A;  3RVY A;  1D0Y A;  4JC7 A;  4WGY A;  5JS5 A;  3TQO A;  3SZR A;  2XM0 A;  2XL6 A;  3L1M A;  3FVY A;  3J06 A;  3AJM A;  3FMS A;  1WOL A;  2WZL A;  3FAP B;  2MHR A;  4ONS A;  3C62 A;  1YAU O;  2WVQ A;  5F5H A;  2F22 A;  4CJO A;  4CIP A;  1WAT A;  2WL8 A;  3NMI A;  5A6K A;  2R7R A;  4OIQ F;  3LS1 A;  2GA0 A;  4MVR A;  5DS6 A;  1ZU4 A;  3EZI A;  3ABM C;  1G4W R;  1QKR A;  3GEH A;  1JAF A;  2HMQ A;  3IQ5 A;  1FAP B;  4MTG A;  4XQ1 A;  3MFN A;  1YYX A;  1NFO A;  2QLA A;  4CDV A;  2LCH A;  1G8X A;  5T3W A;  4FAP B;  3K1I A;  2FGY A;  3V5X A;  4XPX A;  4YL1 A;  5BQI A;  1JR8 A;  2DYS C;  1JMW A;  3GM3 A;  2ETS A;  3O55 A;  1F1M A;  2YLI A;  5FCL A;  1NG1 A;  1ZW2 A;  5KYN A;  1ZHX A;  2UUH A;  5COF A;  3KMI A;  3T6B A;  4AE4 B;  3PHF 2;  2JX0 A;  5F5F A;  4XWJ A;  1OQC A;  3EFO B;  2A68 F;  3NKD A;  3L0I A;  3Q7G A;  4M63 A;  1T6Q A;  1MNE A;  1PV3 A;  3U3B A;  5L3V A;  1HW2 A;  1PD1 A;  4EIY A;  2XXA A;  3GWL A;  256B A;  1ZHY A;  2JD3 A;  3N2Z B;  3NMJ A;  3GOR A;  4J7Y A;  4J30 B;  4Z9I A;  4C3E A;  3K66 A;  3S9O A;  4PFP A;  4JTD B;  2RD9 A;  3DZA A;  4JZA A;  1OW8 A;  2BL2 A;  2LP4 A;  3HNI A;  4JRZ A;  4PJL A;  2EPM X;  2VCB A;  3NRH A;  4EBJ A;  4CSA C;  2R7S A;  4HE8 D;  2CNW A;  2Q9B A;  2PNO A;  2NUP B;  4BJT A;  2J45 A;  2C04 A;  2AVK A;  3POV A;  1AEP A;  2Z15 A;  3QTH A;  3RQF A;  2KNH A;  3X2Q C;  4E0I A;  1E83 A;  1L7C A;  3UMK A;  2KJG A;  4HFF B;  3HNL A;  1K40 A;  1NBB A;  1H7I A;  1RKC A;  2Y39 A;  3F46 A;  3LNR A;  1KTM A;  4KNW A;  1GM5 A;  2L6G A;  4YT5 A;  5L0G A;  1NSG B;  1S05 A;  1H6G A;  4U5E E;  4JW1 A;  3HJC A;  3S90 A;  3AG2 C;  4WJ0 A;  3TD7 A;  3DWW A;  3K7D A;  4I3M A;  4FES A;  2R25 A;  2V26 A;  1ZHW A;  4DRJ B;  4LDR A;  3DE9 A;  2L6F A;  3EGD B;  2QTV A;  3RF3 A;  2XS1 A;  3A11 A;  3B0V C;  1YVI A;  2VCA A;  3ATP A;  4O6M A;  3IPM O;  5B3I A;  1Y4C A;  4K7B A;  3VYW A;  3AQB A;  3T9O A;  4IAQ A;  4LAC B;  2J0W A;  4XPY A;  1VB5 A;  4EKW A;  1V74 B;  1AVO B;  1Z5Z A;  3TOM A;  4H54 A;  3C18 A;  3VF0 A;  1YZC A;  3RFY A;  1LI5 A;  3FXH A;  2YZS A;  1MMD A;  1U6H A;  2YKZ A;  4J7T A;  1GS9 A;  2YHS A;  4MW3 A;  4G7H F;  2BC5 A;  2HV7 A;  2OU6 A;  1M2O A;  3CZ6 A;  3DI5 A;  4FX5 A;  2W9Y A;  4JTA B;  5E33 A;  2YRF A;  3VAY A;  2VAS A;  4IB4 A;  4NTF A;  3U3F A;  2WZG A;  4BJ6 A;  5EGY A;  1YA7 O;  2XLV A;  2OOC A;  4YJW A;  1VYI A;  3DAG A;  4PK4 A;  3R7C A;  1OW7 A;  4N6H A;  3RH3 A;  4JTC B;  1ZVZ A;  1UG7 A;  4Q7C A;  3W2W A;  2CNW D;  4YL0 A;  1OR3 A;  4BJ5 C;  1C02 A;  1JRA A;  5T3T A;  4N06 A;  1A7V A;  2NPU A;  3EHM A;  4YN0 B;  1D0Z A;  5BQG A;  2VH3 A;  1NFN A;  3IQC A;  2R03 A;  3S28 A;  2YL0 A;  4CS8 A;  2EIL C;  1W2W A;  2A69 F;  2MWQ A;  2YL1 A;  1RMV A;  2ZPA A;  3IQ6 A;  3DXJ F;  2Y3D A;  5K0I A;  5KYU B;  5KYY A;  3GM1 A;  3WG7 C;  5EHH A;  1CPQ A;  3CEX A;  3UNG C;  4HFK B;  1QPU A;  2NG1 A;  2WB7 A;  3RQG A;  1I5N A;  3V5Z A;  5AC5 A;  1YZA A;  3KPH A;  2QY9 A;  3W8I A;  5DQT A;  1HMD A;  2I15 A;  3G4X A;  3UGO A;  3LNM B;  1KU2 A;  2CGE A;  1K04 A;  2LFF A;  3JSE O;  1R5I D;  2OJE D;  1T5O A;  1TFK B;  4JEA A;  3DKA A;  4MVM A;  4NC3 A;  3WOD F;  5KYW A;  3HTK C;  2Q7R A;  4H4K C;  1D1A A;  4PR9 A;  4U5D E;  2HJM A;  3KL4 A;  3M79 A;  3SXM A;  2WVN A;  1O5H A;  2EIK C;  1VLS A;  3DD7 A;  4J32 B;  2J9W A;  3W2V A;  4KC9 A;  2WVO A;  1SYQ A;  2KK1 A;  4HEA J;  1M2V A;  3ZWI A;  3NYM A;  3AQC A;  2J9V A;  1HE1 A;  3KYJ A;  2J8W A;  2A6H F;  2YL3 A;  3PCV A;  4LDQ A;  3SEO A;  3U0C A;  4D4X A;  1NU7 D;  3DJN B;  4IAR A;  2WZF A;  3ZTM A;  5DS4 A;  1LE4 A;  2EIJ C;  2EPL X;  3QVZ A;  2YVK A;  4MS2 A;  2YLD A;  2OCC C;  3L8J A;  4XEV A;  3UMI A;  1ZYR F;  4O6N A;  1Q0F A;  4O7G A;  4P6I C;  5DQZ A;  3V7O A;  3PDM P;  3ABK C;  2Q3T A;  3DE8 A;  4CS9 A;  2XLM A;  2OEX A;  3VRC A;  1VOM A;  4B6I A;  5B3S C;  1LM3 B;  1LPE A;  1WTY A;  2DGJ A;  1M57 C;  1WWP A;  2OJQ A;  2ZD9 A;  3M4C A;  4O79 A;  5B1B C;  1C17 M;  4JCZ A;  2KYH A;  3NKE A;  1EI7 A;  5HSW A;  2R9R B;  4ZLC A;  2Y3H A;  4L6R A;  3ZQV A;  4BG0 A;  1HY5 A;  2OG2 A;  5HV9 A;  2KC3 A;  1CGM E;  4IRU A;  3AGT A;  1TWG A;  3S0X A;  4JUR I;  1NLX A;  1OCO C;  3JYY A;  4I1M A;  2R7Q A;  4ZLD A;  3DM9 B;  4LLE A;  5KYX B;  2IXP A;  2RSE B;  1B68 A;  3K1I C;  1VTM P;  1YAR O;  3DM5 A;  4BEJ A;  2R02 A;  3E9V A;  4G7Z F;  2EIN C;  1LIH A;  3O6X A;  5CIV A;  2CDQ A;  4JCH A;  3AOU A;  2V3C C;  2LK4 A;  4R32 A;  5D91 A;  1N1C A;  1L3P A;  2IM8 A;  2LFD A;  4GQH A;  1V4A A;  3ABL C;  4GYT A;  1TFO B;  4E17 A;  3NDB B;  1TKN A;  3X1O A;  1U0B B;  1FR0 A;  2Y69 C;  2W45 A;  4YL3 A;  1OKK D;  4CBE A;  2ZXO A;  1TWC A;  3TJ6 A;  4I1O B;  1J8Y F;  1M2V B;  2IXM A;  3U8V A;  2HMZ A;  2HSQ A;  4N6C A;  5JT4 A;  1QZX A;  2HUJ A;  1VK5 A;  3ZQY A;  3KH2 A;  2L81 A;  2A1D D;  1D0X A;  3M15 A;  2Y3B A;  1A0B A;  3IHU A;  1PCX A;  1ZHZ A;  2X0C A;  4CDY A;  4E7S A;  2P0N A;  1WN0 A;  3DAF A;  3SXY A;  3JZ0 A;  1VMA A;  3Q7L A;  4C7O B;  2J9U A;  3CAX A;  2FAP B;  4P9F A;  4OIO F;  1K05 A;  1V55 C;  4O6Y A;  2Q4F A;  1Z6A A;  1FFT C;  2PX0 A;  4JE9 A;  2Q9A A;  4K1O A;  4QDL A;  5L0F A;  1S7Z A;  3FDQ A;  3MYF A;  3S27 A;  2PF4 E;  4LLC A;  2HV6 A;  3TUL A;  4CDA A;  1ZW3 A;  1LKX A;  2QUP A;  1RCP A;  1RKE A;  2J7P D;  3NYL A;  4GEH A;  3I4U A;  3MBG A;  4W8K A;  3CSK A;  2XL8 A;  1U89 A;  1APC A;  3RQE A;  5DLJ A;  4BEM J;  3ZTZ A;  1QQ3 A;  4IJJ A;  3QMK A;  4RDA A;  3PMR A;  5JRA A;  3GEI A;  5A6A A;  2PX3 A;  3C63 A;  3JRT A;  4BPM A;  4E0H A;  2VB6 A;  2O9X A;  3U9M A;  1MMN A;  1PD0 A;  2IXO A;  5JVE A;  1H9T A;  2R7X A;  4NTA A;  2Q00 A;  5AC4 A;  2G3K A;  3MYI A;  1E86 A;  5L0J A;  3Q6M A;  3NYJ A;  4NTB A;  1LS1 A;  1BDJ B;  2XXA B;  1RXQ A;  1IZM A;  4LDK A;  5FZT A;  4DRH B;  3LES A;  4G78 A;  4ER9 A;  1SMY F;  3RYL A;  5BUO A;  4DXW A;  4BJ6 C;  5E3A A;  3LEV A;  3WAQ A;  2R7T A;  5GPG B;  3A9C A;  3OA1 A;  1MND A;  2XSE A;  4EUK B;  5L3Q A;  1A7E A;  4XLP F;  2DI3 A;  5E3C A;  3AGU A;  4CJG A;  5BQH A;  3KKB A;  2R7V A;  2H7O A;  3U2M A;  3WHN A;  4WAB A;  1M6T A;  1BR4 A;  4OIR F;  3LJB A;  4BJ5 A;  1LI7 A;  2W4M A;  3FOO A;  3K33 A;  4W8P A;  5D92 A;  3RKO F;  1YLM A;  4CS8 C;  4OIP F;  3GEE A;  4AL0 A;  2XS8 A;  1LE2 A;  2BE5 F;  2D4U A;  1XZP A;  4N4W A;  4NCQ A;  2R05 A;  1TWH A;  2KQ9 A;  3T6G B;  5A6B D;  2PP4 A;  3EG9 A;  4K0D A;  3ZDL A;  3JT1 A;  2QNL A;  1I4Z A;  1IW7 F;  1YJG A;  4YT4 A;  3B0U X;  3HNK A;  5TJ5 E;  1RKE B;  2LIG A;  1Q0M A;  4MVZ A;  1Q0K A;  4Z9J A;  3L8I A;  3ZVR A;  4PJN A;  5JUA A;  1FTS A;  1ORJ A;  5DVW A;  1E85 A;  2C03 A;  2UUI A;  3DMD A;  1D1B A;  2YEV A;  2AU5 A;  3CQZ A;  1Y6D A;  3QVY A;  1OKK A;  4C3B A;  4BJ1 A;  2QE9 A;  1J8M F;  4U9D A;  2HJ3 A;  5CI8 A;  1BR2 A;  1OW6 A;  5L0D A;  3EFO A;  4U5B E;  3U5S A;  2NSG A;  1WGW A;  3NMK A;  4PJJ A;  1T6U A;  1OXB A;  4MTO A;  2ASR A;  2NUT A;  1BZ4 A;  2L7A A;  4C3D A;  5L0H A;  1CGO A;  3AG4 C;  3VM6 A;  2IOQ A;  4A4A A;  4DBQ A;  1DOV A;  1EKY A;  1FNT c;  2CW0 F;  2EIM C;  3QZC A;  4DJ9 A;  1TQG A;  2YLG A;  1Z63 A;  1FMW A;  2H7V C;  1TWA A;  2YQY A;  3C8G D;  2XL4 A;  4Q5S F;  3SXZ A;  1G5Z A;  4CS9 C;  4XPW A;  5A69 A;  1MMA A;  2XLE A;  4YT8 A;  2J9B A;  4DRI B;  1RJ9 A;  2J7P A;  3T6J A;  1Z3I X;  3M4B A;  3ZIB A;  3EH2 A;  4Z9H A;  2M4E A;  3MLG A;  1LVK A;  3FOP A;  1KNY A;  2P1A A;  3SYN A;  2AWC A;  4JEB A;  5KYY B;  4MW8 A;  3EJN A;  1JPJ A;  4DOZ A;  2YL7 A;  2OEV A;  3NG1 A;  2X51 A;  4EWC A;  2CYD A;  4MVU A;  4QI2 A;  3LS0 A;  4ULV A;  3EZH A;  3JYH A;  3GAN A;  3N0T A;  4U5F E;  1VLT A;  3ZSU A;  4AX2 A;  3B71 A;  4XEK A;  4IGG A;  4YK5 A;  4AL1 A;  4CIH A;  3C7J A;  5KYW B;  3EG9 B;  4X0R A;  3EGD A;  4IWB A;  2R7O A;  3QW1 A;  2R7U A;  3S29 A;  3SP1 A;  3W4Y A;  1LS4 A;  3JTL O;  2GDC A;  2CCY A;  3EHN A;  3GOD A;  5F28 E;  2H7B A;  5EK0 A;  2KGO A;  1OXK A;  1MMG A;  2M64 A;  4WGZ A;  3H65 A;  1ST6 A;  2KSF A;  4ULW A;  1BBH A;  1MQV A;  2LQG A;  1GGQ A;  4G7O F;  1HE9 A;  4U9E A;  5B1A C;  1O3U A;  3OEO A;  2ZXR A;  2XLO A;  5JLI A;  1DOW A;  3K1H A;  4EBB A;  1T9K A;  2Q9C A;  1Q0G A;  2HZ8 A;  3ASO C;  2NUT B;  1EQ1 A;  1GQA A;  2J46 A;  1HMO A;  2EPN A;  1HW1 A;  3N24 A;  2G62 A;  1H9G A;  2KW3 C;  3B29 A;  3O39 A;  4G0H A;  2OQM A;  4CSA A;  2GAQ A;  1SZI A;  1XWJ A;  3U8P A;  1AUE A;  4XTK A;  1XZQ A;  2XM4 A;  3EPV A;  4QI0 A;  2GFH A;  2GWW A;  3R2P A;  1R4T A;  5A6B A;  2MYS A;  5KYU A;  1T6I A;  3E70 C;  4EBK A;  2LD6 A;  4Q4Z F;  2EPK X;  2J0X A;  4UDV A;  2R7W A;  4IAO A;  4MTF A;  3LUT B;  3H2V A;  1RJ9 B;  3B0P A;  3G50 A;  3ITF A;  3TJ5 A;  2HKV A;  4RD9 A;  1JOG A;  4E18 A;  2W4B A;  3RIP A;  2A0U A;  3RVZ A;  4F4B A;  2FFH A;  1OR2 A;  2NSF A;  1QVX A;  3JSZ A;  4FWV A;  4PFO A;  4CX9 A;  4A2N B;  3EQL F;  2A0B A;  4LER A;  3TK0 A;  1C03 A;  3ECS A;  3UGP A;  3K6B A;  2E87 A;  4KI2 A;  2XLD A;  3BRJ A;  1ZHT A;  2A6E F;  3F47 A;  4MVQ A;  3SNH A;  2H8A A;  1YYJ A;  2IYL D;  3ZC4 A;  4CS7 A;  2HSB A;  3UMH A;  4YWQ A;  1NU9 C;  1Z23 A;  2PBE A;  4JVS A;  1NZE A;  1QLE C;  2AP3 A;  1WAS A;  1FMV A;  2Y3G A;  4EHP A;  4PAC A;  3KYI A;  3EGX A;  1YDI A;  2P6V A;  3W8H A;  3Q6N A;  3HKK A;  5IY5 C;  2DB4 A;  5L0I A;  1E2X A;  3H2U A;  3BEH A;  1SF8 A;  4D4N A;  1Z7Q c;  3C8G A;  4E7Z A;  4U5C E;  3QW0 A;  4XLN F;  1BR1 A;  2P7V A;  2PFD A;  2TMV P;  3I5P A;  5A6J A;  1CPR A;  4PJM A;  1V54 C;  3C8Z A;  4U5G A;  3G4Z A;  4DVZ A;  2B0J A;  2ZXW C;  5COG A;  5E2Q A;  1A7D A;  4KBL A;  3B9Q A;  3SXK A;  3O10 A;  1Q0D A;  3LAY A;  4P9T A;  4I44 A;  3IEE A;  2HFI A;  4JJG A;  2AWY A;  2XLW A;  5AGF A;  1I4Y A;  2IBF A;  4MND A;  1G4U S;  1T01 A;  3JRM O;  5JSL A;  1O87 A;  3OWT A;  1CGN A;  3IQT A;  4OD4 A;  3UR3 C;  1QSP A;  1M56 C;  3V5Y A;  2ZXP A;  2DYR C;  2HS5 A;  2OKU A;  3HLZ A;  4JKV A;  4NQF A;  3JCU Q;  3L34 A;  5JP7 A;  3GWN A;  4AK9 A;  4ANJ A;  1FFH A;  5KYX A;  1ORY A;  3U2L A;  3M1C B;  4AE4 A;  2VCC A;  3AG1 C;  2ICW G;  3DJU B;  3T4R A;  1YA9 A;  3RW0 A;  2L6H A;  2YWA A;  3US6 A;  3I5Q A;  2VC9 A;  4DVY P;  3TOL A;  4NY3 A;  2IXN A;  4JJF A;  1D1C A;  3EH1 A;  3GM2 A;  3LLK A;  1ORS C;  1ZZP A;  2G3V A;  1OCZ C;  2L9J A;  3U9J A;  1SR2 A;  5T1D B;  1E84 A;  1OCC C;  1JPN A;  1ZU5 A;  3ASN C;  1A41 A;  3FHD A;  4JIO A;  1UFB A;  4OD5 A;  5COM A;  1EA8 A;  2D5R B;  5CI9 A;  3S84 A;  4MQ9 F;  2P61 A;  3LEO A;  4OIN F;  3MX3 A;  4U5H A;  2JPU A;  2NUP A;  3ZG1 A;  4MVO A;  5L0C A;  4DBR A;  1OCR C;  2I8B A;  1VYK A;  3EGX B;  3FAJ A;  4XEF A;  3AG3 C;  4MVS A;  4YT2 A;  3HNJ A;  4RBN A;  4C7O A;  2XLH A;  2XRH A;  4KNV A;  1TR2 A;  2LSE A;  2EPO A; 
#chains in the Genus database with same CATH homology
 3C63 A;  1YZA A;  2XLO A;  4WGY A;  5JS5 A;  5JVE A;  2XM0 A;  2XL6 A;  3L1M A;  4JEA A;  4NC3 A;  1GQA A;  3C62 A;  4CIP A;  5JLI A;  1E86 A;  3M79 A;  4CJO A;  3NMI A;  3U8P A;  1JAF A;  3IQ5 A;  2XM4 A;  4ER9 A;  3ZWI A;  1YYX A;  2QLA A;  4CDV A;  2J8W A;  2YL3 A;  4D4X A;  4CJG A;  4IAR A;  3ZTM A;  2YLI A;  1M6T A;  3QVZ A;  3FOO A;  2YLD A;  4CX9 A;  4N4W A;  3DE8 A;  4EIY A;  2XLD A;  2XLM A;  256B A;  3NMJ A;  3VRC A;  3HNK A;  1YYJ A;  1LM3 B;  3M4C A;  4L6R A;  5JUA A;  3HNI A;  1E85 A;  3ZQV A;  3QVY A;  4D4N A;  1E83 A;  4U9D A;  3QW0 A;  3HNL A;  1NBB A;  3NMK A;  1CPR A;  1S05 A;  1CGO A;  1EKY A;  3DE9 A;  2YLG A;  2XLW A;  5AGF A;  5B3I A;  5JSL A;  1CGN A;  5JT4 A;  2XLE A;  2J9B A;  5JP7 A;  4JKV A;  3ZQY A;  4IAQ A;  3M4B A;  3M15 A;  3FOP A;  3TOM A;  4CDY A;  1YZC A;  4JEB A;  2YKZ A;  2YL7 A;  2BC5 A;  4JE9 A;  4ULV A;  3TOL A;  4IB4 A;  2XLV A;  4CDA A;  4N6H A;  1RCP A;  3QW1 A;  1E84 A;  1A7V A;  2CCY A;  2XL8 A;  2YL0 A;  1APC A;  4WGZ A;  2YL1 A;  3ZTZ A;  1QQ3 A;  3IQ6 A;  1BBH A;  1MQV A;  3HNJ A;  1CPQ A;  2XLH A;  5JRA A;  4U9E A;  1QPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...