1APCA

Solution structure of apocytochrome b562
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B562
publication title Solution structure of apocytochrome b562.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1993-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1apcA00
3FOOA 3IQ5A 2YL3A 3M79A 5JP7A 3C63A 3NMJA 3ZWIA 1CGNA 2YL0A 4N6HA 4D4NA 4NC3A 1A7VA 2CCYA 4IARA 2XLVA 2J8WA 3DE8A 5JT4A 3QVYA 3DE9A 1E83A 3ZQVA 1QQ3A 2XLWA 3M4CA 1JAFA 5B3IA 1MQVA 4D4XA 1YYJA 1EKYA 4JE9A 2J9BA 4CIPA 3HNJA 4EIYA 3C62A 5JRAA 4CDYA 1YYXA 3M4BA 4CDVA 256BA 2XL6A 5JSLA 3TOMA 3QVZA 5AGFA 4WGYA 1GQAA 4U9DA 4JEAA 2YLDA 1E84A 5JVEA 1NBBA 1QPUA 4L6RA 2XL8A 4U9EA 3QW0A 2QLAA 3HNKA 3NMIA 4CDAA 4CJGA 3TOLA 5JUAA 3ZTMA 2XM4A 2XLDA 3M15A 1CPRA 2YL1A 3U8PA 2YKZA 2XLEA 1BBHA 2XLMA 2YL7A 4WGZA 5JS5A 2YLGA 1M6TA 3NMKA 4N4WA 1E85A 3HNIA 3ZQYA 5JLIA 2XM0A 3HNLA 4IAQA 4CJOA 1RCPA 1S05A 4CX9A 3QW1A 4ULVA 3L1MA 2XLOA 3FOPA 3VRCA 1LM3B 4JKVA 4ER9A 4JEBA 2YLIA 3ZTZA 1YZAA 1YZCA 2XLHA 3IQ6A 4IB4A 1APCA 1CPQA 2BC5A 1E86A 1CGOA
chains in the Genus database with same CATH superfamily
1V55C 3FXHA 2YL3A 1OCRC 3M79A 3RH3A 2Q9AA 3DJUB 2XS8A 2EIJC 3RVYA 3C63A 4MTFA 1CGME 4NTBA 1TWHA 3NKEA 3DXJF 1ORJA 3BRJA 3DM9B 4C3BA 1Q0GA 1V4AA 1WTYA 1NFOA 1YLMA 2J8WA 3NYMA 4JJFA 3DE8A 4W8KA 3KKBA 4JCHA 5B3SC 1YA7O 5JT4A 4XLNF 2NPUA 3DE9A 4OIRF 2B0JA 1Z63A 4K7BA 3V5ZA 1QQ3A 3KPHA 4YWQA 4CIHA 1XZPA 1ZYRF 2GAQA 1LVKA 1PV3A 2IBFA 1NU7D 2H7OA 2KYHA 2R7OA 2HMQA 2Y3HA 2NUPB 3G4ZA 2FAPB 1ZHTA 3EGXA 3KH2A 4RD9A 4U5EE 2X0CA 3T6JA 5B3IA 4F4BA 1MQVA 1BZ4A 2KC3A 4D4XA 1BR4A 2GFHA 4JE9A 1FFTC 3EGDB 4U5HA 2J9WA 3EPVA 4ULWA 2NUTA 2LFFA 1VMAA 1D0XA 4WJ0A 3SXZA 1SYQA 2KW3C 3Q7LA 3C62A 3DKAA 1Z5ZA 5L0DA 4W8PA 2XXAA 1LKXA 4A4AA 4CDYA 4MS2A 1OR2A 2NSGA 2Y69C 1Q0DA 3M4BA 2YWAA 3OA1A 4MVQA 4C3EA 1SZIA 2YEVA 3RF3A 1Z7Qc 2P6VA 4JC7A 4CBEA 3S84A 3UGPA 4CSAC 4U5GA 3EH1A 1BR1A 4FESA 4OD5A 4IAOA 5EHHA 2JD3A 4Q4ZF 1U0BB 2WZLA 4U9DA 1U6HA 4G78A 1A0BA 3AJMA 1E84A 3V5YA 2V3CC 1HE1A 4IRUA 2Y39A 4MTGA 5COMA 2ZXOA 4NTAA 4U5CE 1Z3IX 4AX2A 4E7SA 3LEOA 3JSEO 4XTKA 4L6RA 4U9EA 3BEHA 1QKRA 3GWNA 2G3VA 1L7CA 2H7BA 2H8AA 2WVNA 4R32A 2Y3BA 4XEVA 3VM6A 1LI7A 2B0HA 1YJGA 3ASNC 3H65A 4BEJA 2RSEB 1ZU5A 5JUAA 3LUTB 2R7UA 2Z15A 4HFFB 5L3QA 1CPRA 1G8XA 1WWPA 3TJ6A 2R03A 2OU6A 2HS5A 3IQCA 3GORA 3U8VA 5BQIA 3TK0A 2A0UA 2X51A 2AVKA 2LFDA 2KJGA 2YL7A 1J8YF 2NG1A 4XLPF 1T5OA 1YA9A 1E2XA 5E33A 1M6TA 1RMVA 5F5FA 3GODA 2QNLA 3NMKA 3RQGA 3CZ6A 2J9VA 3VYWA 2CYDA 4J7TA 2LK4A 1I4YA 5DQTA 4G7ZF 2XM0A 4OIQF 2PF4E 1RCPA 3ZC4A 4DRHB 2IXOA 3UNGC 2AP3A 2IOQA 4K0DA 3VF0A 2Y3GA 2Q9CA 3MYIA 4ULVA 4IJJA 4ZLCA 4XWJA 3VRCA 1ORYA 4PK4A 4IGGA 2R25A 4C3DA 2J9UA 4CS8A 2R7RA 4BJTA 5CI8A 4XPXA 2R02A 2QE9A 1NSGB 1GS9A 4JEBA 1UG7A 2NUPA 3FHDA 1V74B 1YZCA 3HKKA 4MNDA 3IPMO 3UR3C 3DD7A 1OKKD 3TQOA 1OCZC 1FFHA 3OWTA 3EGDA 4K1OA 1ST6A 1Q0KA 1WATA 2A68F 2DGJA 4YJWA 4AE4A 4CS9A 5CIVA 2Q3TA 1ZU4A 3AG3C 3FOOA 1TWCA 3U9JA 4MVZA 3IQ5A 4YT4A 5JP7A 5BUOA 4LACB 1RJ9A 1TR2A 3LS1A 4JW1A 4DJ9A 4G7HF 4YT2A 3QMKA 1EI7A 2KK1A 4CSAA 1M57C 1VB5A 1A7VA 4NC3A 1EQ1A 3V5XA 2CCYA 2TMVP 2ZD9A 3ASOC 1ZHYA 1OQCA 4Q7CA 1U89A 1GM5A 2ETSA 3AG1C 2V26A 3NYJA 3ABMC 2WVOA 4I1OB 3ZQVA 2HKVA 2EILC 2OKUA 2EINC 2XLWA 3K33A 5A6AA 1S7ZA 4ANJA 3I5PA 2CW0F 1ZHWA 3U2LA 2P0NA 2PBEA 3B0UX 2VCBA 4O79A 5BQGA 2GWWA 1Z6AA 1NU9C 4MVSA 4YT5A 1AVOB 3GWLA 3S9OA 3ZSUA 2PX0A 4O6NA 3POVA 1JOGA 3N0TA 4KNVA 2DB4A 3TJ5A 4BJ6C 4EIYA 2Y3DA 1QVXA 1YYXA 3C18A 3PMRA 3VAYA 2HFIA 4CDVA 3M1CB 2CNWA 1LE2A 5JSLA 3TD7A 4PJJA 3RQFA 2J0WA 1Q0FA 3QVZA 4E18A 1SR2A 1I4ZA 1HW1A 2HJ3A 3QZCA 3T4RA 4JTAB 2IXPA 5AC5A 2YLDA 4PFPA 4YL0A 4HEAJ 2F22A 3K7DA 1DOWA 4E0HA 5KYUB 2A0BA 4EUKB 1NBBA 2DYSC 4HE8D 2XSEA 2LSEA 3DAGA 2R7XA 2C04A 3DAFA 3QW0A 3CEXA 2KSFA 4AE4B 2ICWG 3DWWA 4NY3A 1Z23A 3NMIA 4CDAA 4WABA 3ZG1A 3U3FA 3FDQA 5KYXB 1K40A 2HZ8A 4C7OA 2HSBA 4G7OF 3S28A 2YL1A 4Q5SF 2L7AA 2UUIA 3JSZA 5L0IA 5L3VA 1H9TA 3L34A 3WAQA 2YKZA 4PFOA 1RJ9B 3U9MA 2RD9A 4RBNA 4DBRA 2XLEA 5L0JA 3MFNA 3U2MA 1T01A 4I3MA 2HJMA 3HTKC 4YT8A 3DMDA 4DOZA 2G3KA 3HJCA 4EWCA 3CSKA 4DVZA 5HV9A 1OW8A 4U5BE 5A69A 1T9KA 5A6JA 4Z9HA 1S05A 5TJ5E 4CX9A 1FR0A 3K1IC 1PD0A 1YAUO 2VC9A 4BPMA 3H2VA 4I44A 2PNOA 3NRHA 1ZW2A 5IY5C 2XS1A 1I5NA 3UMIA 3I4UA 2LQGA 4IWBA 3S90A 2OQMA 1LM3B 2YVKA 1B68A 2KGOA 4JVSA 2PX3A 2WL8A 1A41A 3JRTA 3X2QC 4HFKB 2JX0A 4MW8A 3S29A 1NG1A 3JCUQ 1YZAA 3LJBA 4E0IA 2OJED 1HY5A 2L6GA 3RW0A 1D1CA 3IQ6A 5T1DB 5FZTA 1PD1A 3G4XA 1APCA 3JTLO 5A6BA 3EG9B 3V7OA 1Q0MA 3JT1A 3KYJA 3ZIBA 3U3BA 3U5SA 2W4MA 1T6IA 4J32B 1KU2A 1MNEA 3JZ0A 3AGTA 4BJ6A 4BEMJ 1L3PA 1V54C 4OIPF 1H9GA 3LS0A 3WODF 1LS1A 2XL4A 3NMJA 1RKCA 1VYKA 2E87A 1R5ID 2QTVA 2ZXWC 4BJ5C 3C7JA 2IXMA 3CQZA 4AL1A 2HMZA 4B6IA 3EHMA 1D1BA 3F47A 2IYLD 2YHSA 4IARA 2XLVA 3ZDLA 3B0VC 2L9JA 3AG2C 4MW3A 3B9QA 3IQTA 2L6HA 3K66A 2WVQA 1R4TA 3MYFA 3QVYA 5KYUA 1E83A 5D91A 2P61A 4FX5A 5DS4A 4C7OB 4U5FE 3S27A 2A1DD 4G0HA 3SXMA 1HW2A 2QUPA 3M4CA 2HSQA 3GM1A 3JYYA 3KYIA 1JPJA 1JAFA 4EBKA 5KYXA 4OIOF 4QI2A 1IW7F 1ZW3A 2Q4FA 1OCCC 3B29A 3GM3A 3LLKA 1YYJA 3PCVA 3Q6NA 3SZRA 5AC4A 1LE4A 2EPKX 3LNMB 5COFA 3ZVRA 1ZHZA 1VLSA 3NG1A 5JRAA 3GM2A 2YRFA 3EFOB 4NTFA 1TWAA 2J7PA 4QDLA 1TQGA 3RVZA 4E7ZA 1TKNA 3L0IA 1MMDA 2KNHA 1YVIA 1T6UA 3SNHA 4PJMA 2EPOA 1JMWA 1BDJB 1LI5A 2HV6A 2OOCA 3FVYA 1FNTc 3E9VA 3Q6MA 3GEEA 4WGYA 1JRAA 1AEPA 3CAXA 1GQAA 3ABLC 3MBGA 4JEAA 3U0CA 4DVYP 5GPGB 3K1IA 1TFKB 1IZMA 4BG0A 3C8GA 1H6GA 2Q9BA 3FAJA 4LDRA 3RQEA 2R7QA 3W2VA 4P9FA 4PACA 2L81A 3I5QA 2DI3A 4NCQA 2EPMX 3SXYA 3F46A 3O55A 3QTHA 2L6FA 2EIMC 4DXWA 1M2VA 3JRMO 3HNKA 1LS4A 2I15A 3RYLA 1W2WA 3B0PA 2OJQA 2CGEA 4I1MA 4LLEA 1O87A 3EHNA 3IHUA 2EPNA 4YK5A 4LDQA 3ABKC 3C8ZA 4E17A 5F28E 3EG9A 3U8PA 4XPYA 5L0HA 5FCLA 4OD4A 4YN0B 2BL2A 1ZVZA 2G62A 3H2UA 1HMOA 3O39A 4KNWA 4H54A 1FMVA 5T3WA 2XLMA 3LNRA 1JR8A 2W4BA 1BR2A 1G4US 3Q7GA 1LIHA 4GEHA 3HLZA 1VOMA 5F5HA 1TFOB 3O6XA 1E85A 1MNDA 3ZQYA 5JLIA 4IAQA 4PJNA 4BJ5A 2KQ9A 2AU5A 2LIGA 5DS6A 4N6CA 2J45A 4JTCB 2R7SA 3L1MA 1K04A 2XLOA 2AWCA 2QY9A 1OCOC 4MQ9F 4PJLA 3SXKA 2WZGA 4CS7A 1HE9A 4PR9A 2CNWD 1KTMA 1VLTA 1D1AA 3R2PA 5KYYA 2PFDA 4NQFA 1OW6A 5D92A 3OEOA 4DBQA 1D0ZA 5L0GA 3KL4A 4MVOA 3WHNA 4CS8C 2EIKC 2JPUA 2P1AA 2A6EF 2WB7A 2YLIA 2ZXRA 4MVMA 3ZTZA 2FFHA 2XLHA 2VB6A 1VTMP 1M56C 3AQCA 4IB4A 2YZSA 3US6A 1PCXA 5KYWB 1YDIA 2R7VA 1FMWA 3RIPA 5COGA 5E2QA 4Z9IA 3EJNA 4JJGA 1RXQA 2UUHA 3EFOA 4RDAA 4YL3A 4CS9C 1SF8A 4JRZA 5DQZA 3A9CA 1GGQA 2R05A 3FMSA 5K0IA 3AQBA 5B1AC 3ITFA 3ZWIA 3JYHA 1CGNA 1WOLA 2YL0A 3MX3A 3W8HA 2Q00A 4N6HA 4D4NA 2H7VC 2EPLX 1JPNA 3C8GB 4YL1A 5DLJA 2D5RB 4P9TA 2OG2A 5DVWA 3W2WA 4GQHA 4KBLA 4OINF 4UDVA 3T6GB 4JCZA 2GDCA 2W45A 5KYNA 3TULA 1Y6DA 1M2VB 2NSFA 1WASA 5EK0A 1DOVA 1G4WR 4XPWA 3SYNA 2MHRA 3IEEA 2OCCC 2VCCA 2FGYA 3LLIA 3EZIA 4KC9A 4ONSA 3J06A 1YARO 4XEFA 2M4EA 3ATPA 3FAPB 1RKEB 3A11A 1A7DA 1OXBA 3UGOA 1T6QA 3AG4C 1NZEA 1EA8A 1NFNA 3GEIA 4FWVA 4Z9JA 3UMHA 3X1OA 3N2ZB 2BE5F 4EBBA 3S0XA 1QLEC 2R7WA 4XEKA 1EKYA 2J9BA 4X0RA 3PDMP 4QI0A 3SP1A 4CIPA 3LAYA 3EQLF 3HNJA 1QZXA 3SEOA 4ZLDA 5CI9A 3L8JA 4O7GA 4O6MA 5A6BD 2ASRA 2XRHA 1D0YA 2OEXA 3NYLA 3NKDA 2LP4A 4J7YA 5E3CA 2OEVA 2PP4A 1M2OA 256BA 2XL6A 3MLGA 2YQYA 3DM5A 3TOMA 4EHPA 5B1BC 5AGFA 2HUJA 5KYYB 2VASA 4EKWA 3AGUA 2VH3A 3DJNB 1QSPA 1TWGA 3AOUA 3E70C 2P7VA 4MTOA 1C17M 1J8MF 4EBJA 5A6KA 5JVEA 2A6HF 1VYIA 1OKKA 1QPUA 2MWQA 1G5ZA 1LPEA 4AK9A 2A69F 2XL8A 4JURI 5HSWA 3ECSA 3T9OA 3W8IA 2AWYA 2IXNA 3DI5A 4KI2A 2QLAA 2J46A 3LEVA 3EGXB 1XWJA 2MYSA 2Q7RA 3EZHA 1NLXA 1XZQA 3N24A 3T6BA 3TOLA 4CJGA 2I8BA 3ZTMA 1MMGA 2XLDA 2HV7A 2XM4A 3K6BA 3M15A 4J30B 5DS5A 1OW7A 3LESA 5KYWA 1C02A 2C03A 2IM8A 2WZFA 2ZXPA 4XQ1A 2NUTB 5E3AA 3GEHA 2W9YA 2D4UA 1VK5A 1N1CA 1BBHA 2J0XA 4JZAA 3O10A 3B71A 4A2NB 2R9RB 1AUEA 2R7TA 4WGZA 4AL0A 1OXKA 2XXAB 5JS5A 3K1HA 2YLGA 2LD6A 5T3TA 3RKOF 1ZZPA 4N4WA 3KMIA 3EH2A 3HNIA 2O9XA 1WN0A 2VCAA 3HNLA 3DZAA 3WG7C 4CJOA 3NDBB 3UMKA 4LLCA 3QW1A 2J7PD 4JIOA 3PHF2 4LERA 5BQHA 5L0CA 1HMDA 3GANA 3FOPA 1F1MA 1OR3A 4BJ1A 1FAPB 4DRJB 1Y4CA 3L8IA 4DRIB 2GA0A 4JKVA 1FTSA 4N06A 1UFBA 1KNYA 1A7EA 4H4KC 4JTDB 4P6IC 1MMAA 1O3UA 2DYRC 4ER9A 5L0FA 3W4YA 4MVUA 1H7IA 4O6YA 4FAPB 1ORSC 1RKEA 1SMYF 3G50A 3C8GD 4MVRA 2CDQA 2LCHA 4GYTA 4LDKA 3RFYA 4M63A 1C03A 1CPQA 2ZPAA 5EGYA 2BC5A 1K05A 3R7CA 1ZHXA 1O5HA 1CGOA 1MMNA 4U5DE 1E86A 2M64A 1WGWA
chains in the Genus database with same CATH topology
3FOOA 3IQ5A 2YL3A 3M79A 5JP7A 3C63A 3NMJA 3ZWIA 1CGNA 2YL0A 4N6HA 4D4NA 4NC3A 1A7VA 2CCYA 4IARA 2XLVA 2J8WA 3DE8A 5JT4A 3QVYA 3DE9A 1E83A 3ZQVA 1QQ3A 2XLWA 3M4CA 1JAFA 5B3IA 1MQVA 4D4XA 1YYJA 1EKYA 4JE9A 2J9BA 4CIPA 3HNJA 4EIYA 3C62A 5JRAA 4CDYA 1YYXA 3M4BA 4CDVA 256BA 2XL6A 5JSLA 3TOMA 3QVZA 5AGFA 4WGYA 1GQAA 4U9DA 4JEAA 2YLDA 1E84A 5JVEA 1NBBA 1QPUA 4L6RA 2XL8A 4U9EA 3QW0A 2QLAA 3HNKA 3NMIA 4CDAA 4CJGA 3TOLA 5JUAA 3ZTMA 2XM4A 2XLDA 3M15A 1CPRA 2YL1A 3U8PA 2YKZA 2XLEA 1BBHA 2XLMA 2YL7A 4WGZA 5JS5A 2YLGA 1M6TA 3NMKA 4N4WA 1E85A 3HNIA 3ZQYA 5JLIA 2XM0A 3HNLA 4IAQA 4CJOA 1RCPA 1S05A 4CX9A 3QW1A 4ULVA 3L1MA 2XLOA 3FOPA 3VRCA 1LM3B 4JKVA 4ER9A 4JEBA 2YLIA 3ZTZA 1YZAA 1YZCA 2XLHA 3IQ6A 4IB4A 1APCA 1CPQA 2BC5A 1E86A 1CGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOO A;  3IQ5 A;  2YL3 A;  3M79 A;  5JP7 A;  3C63 A;  3NMJ A;  3ZWI A;  1CGN A;  2YL0 A;  4N6H A;  4D4N A;  4NC3 A;  1A7V A;  2CCY A;  4IAR A;  2XLV A;  2J8W A;  3DE8 A;  5JT4 A;  3QVY A;  3DE9 A;  1E83 A;  3ZQV A;  1QQ3 A;  2XLW A;  3M4C A;  1JAF A;  5B3I A;  1MQV A;  4D4X A;  1YYJ A;  1EKY A;  4JE9 A;  2J9B A;  4CIP A;  3HNJ A;  4EIY A;  3C62 A;  5JRA A;  4CDY A;  1YYX A;  3M4B A;  4CDV A;  256B A;  2XL6 A;  5JSL A;  3TOM A;  3QVZ A;  5AGF A;  4WGY A;  1GQA A;  4U9D A;  4JEA A;  2YLD A;  1E84 A;  5JVE A;  1NBB A;  1QPU A;  4L6R A;  2XL8 A;  4U9E A;  3QW0 A;  2QLA A;  3HNK A;  3NMI A;  4CDA A;  4CJG A;  3TOL A;  5JUA A;  3ZTM A;  2XM4 A;  2XLD A;  3M15 A;  1CPR A;  2YL1 A;  3U8P A;  2YKZ A;  2XLE A;  1BBH A;  2XLM A;  2YL7 A;  4WGZ A;  5JS5 A;  2YLG A;  1M6T A;  3NMK A;  4N4W A;  1E85 A;  3HNI A;  3ZQY A;  5JLI A;  2XM0 A;  3HNL A;  4IAQ A;  4CJO A;  1RCP A;  1S05 A;  4CX9 A;  3QW1 A;  4ULV A;  3L1M A;  2XLO A;  3FOP A;  3VRC A;  1LM3 B;  4JKV A;  4ER9 A;  4JEB A;  2YLI A;  3ZTZ A;  1YZA A;  1YZC A;  2XLH A;  3IQ6 A;  4IB4 A;  1APC A;  1CPQ A;  2BC5 A;  1E86 A;  1CGO A; 
#chains in the Genus database with same CATH topology
 1V55 C;  3FXH A;  2YL3 A;  1OCR C;  3M79 A;  3RH3 A;  2Q9A A;  3DJU B;  2XS8 A;  2EIJ C;  3RVY A;  3C63 A;  4MTF A;  1CGM E;  4NTB A;  1TWH A;  3NKE A;  3DXJ F;  1ORJ A;  3BRJ A;  3DM9 B;  4C3B A;  1Q0G A;  1V4A A;  1WTY A;  1NFO A;  1YLM A;  2J8W A;  3NYM A;  4JJF A;  3DE8 A;  4W8K A;  3KKB A;  4JCH A;  5B3S C;  1YA7 O;  5JT4 A;  4XLN F;  2NPU A;  3DE9 A;  4OIR F;  2B0J A;  1Z63 A;  4K7B A;  3V5Z A;  1QQ3 A;  3KPH A;  4YWQ A;  4CIH A;  1XZP A;  1ZYR F;  2GAQ A;  1LVK A;  1PV3 A;  2IBF A;  1NU7 D;  2H7O A;  2KYH A;  2R7O A;  2HMQ A;  2Y3H A;  2NUP B;  3G4Z A;  2FAP B;  1ZHT A;  3EGX A;  3KH2 A;  4RD9 A;  4U5E E;  2X0C A;  3T6J A;  5B3I A;  4F4B A;  1MQV A;  1BZ4 A;  2KC3 A;  4D4X A;  1BR4 A;  2GFH A;  4JE9 A;  1FFT C;  3EGD B;  4U5H A;  2J9W A;  3EPV A;  4ULW A;  2NUT A;  2LFF A;  1VMA A;  1D0X A;  4WJ0 A;  3SXZ A;  1SYQ A;  2KW3 C;  3Q7L A;  3C62 A;  3DKA A;  1Z5Z A;  5L0D A;  4W8P A;  2XXA A;  1LKX A;  4A4A A;  4CDY A;  4MS2 A;  1OR2 A;  2NSG A;  2Y69 C;  1Q0D A;  3M4B A;  2YWA A;  3OA1 A;  4MVQ A;  4C3E A;  1SZI A;  2YEV A;  3RF3 A;  1Z7Q c;  2P6V A;  4JC7 A;  4CBE A;  3S84 A;  3UGP A;  4CSA C;  4U5G A;  3EH1 A;  1BR1 A;  4FES A;  4OD5 A;  4IAO A;  5EHH A;  2JD3 A;  4Q4Z F;  1U0B B;  2WZL A;  4U9D A;  1U6H A;  4G78 A;  1A0B A;  3AJM A;  1E84 A;  3V5Y A;  2V3C C;  1HE1 A;  4IRU A;  2Y39 A;  4MTG A;  5COM A;  2ZXO A;  4NTA A;  4U5C E;  1Z3I X;  4AX2 A;  4E7S A;  3LEO A;  3JSE O;  4XTK A;  4L6R A;  4U9E A;  3BEH A;  1QKR A;  3GWN A;  2G3V A;  1L7C A;  2H7B A;  2H8A A;  2WVN A;  4R32 A;  2Y3B A;  4XEV A;  3VM6 A;  1LI7 A;  2B0H A;  1YJG A;  3ASN C;  3H65 A;  4BEJ A;  2RSE B;  1ZU5 A;  5JUA A;  3LUT B;  2R7U A;  2Z15 A;  4HFF B;  5L3Q A;  1CPR A;  1G8X A;  1WWP A;  3TJ6 A;  2R03 A;  2OU6 A;  2HS5 A;  3IQC A;  3GOR A;  3U8V A;  5BQI A;  3TK0 A;  2A0U A;  2X51 A;  2AVK A;  2LFD A;  2KJG A;  2YL7 A;  1J8Y F;  2NG1 A;  4XLP F;  1T5O A;  1YA9 A;  1E2X A;  5E33 A;  1M6T A;  1RMV A;  5F5F A;  3GOD A;  2QNL A;  3NMK A;  3RQG A;  3CZ6 A;  2J9V A;  3VYW A;  2CYD A;  4J7T A;  2LK4 A;  1I4Y A;  5DQT A;  4G7Z F;  2XM0 A;  4OIQ F;  2PF4 E;  1RCP A;  3ZC4 A;  4DRH B;  2IXO A;  3UNG C;  2AP3 A;  2IOQ A;  4K0D A;  3VF0 A;  2Y3G A;  2Q9C A;  3MYI A;  4ULV A;  4IJJ A;  4ZLC A;  4XWJ A;  3VRC A;  1ORY A;  4PK4 A;  4IGG A;  2R25 A;  4C3D A;  2J9U A;  4CS8 A;  2R7R A;  4BJT A;  5CI8 A;  4XPX A;  2R02 A;  2QE9 A;  1NSG B;  1GS9 A;  4JEB A;  1UG7 A;  2NUP A;  3FHD A;  1V74 B;  1YZC A;  3HKK A;  4MND A;  3IPM O;  3UR3 C;  3DD7 A;  1OKK D;  3TQO A;  1OCZ C;  1FFH A;  3OWT A;  3EGD A;  4K1O A;  1ST6 A;  1Q0K A;  1WAT A;  2A68 F;  2DGJ A;  4YJW A;  4AE4 A;  4CS9 A;  5CIV A;  2Q3T A;  1ZU4 A;  3AG3 C;  3FOO A;  1TWC A;  3U9J A;  4MVZ A;  3IQ5 A;  4YT4 A;  5JP7 A;  5BUO A;  4LAC B;  1RJ9 A;  1TR2 A;  3LS1 A;  4JW1 A;  4DJ9 A;  4G7H F;  4YT2 A;  3QMK A;  1EI7 A;  2KK1 A;  4CSA A;  1M57 C;  1VB5 A;  1A7V A;  4NC3 A;  1EQ1 A;  3V5X A;  2CCY A;  2TMV P;  2ZD9 A;  3ASO C;  1ZHY A;  1OQC A;  4Q7C A;  1U89 A;  1GM5 A;  2ETS A;  3AG1 C;  2V26 A;  3NYJ A;  3ABM C;  2WVO A;  4I1O B;  3ZQV A;  2HKV A;  2EIL C;  2OKU A;  2EIN C;  2XLW A;  3K33 A;  5A6A A;  1S7Z A;  4ANJ A;  3I5P A;  2CW0 F;  1ZHW A;  3U2L A;  2P0N A;  2PBE A;  3B0U X;  2VCB A;  4O79 A;  5BQG A;  2GWW A;  1Z6A A;  1NU9 C;  4MVS A;  4YT5 A;  1AVO B;  3GWL A;  3S9O A;  3ZSU A;  2PX0 A;  4O6N A;  3POV A;  1JOG A;  3N0T A;  4KNV A;  2DB4 A;  3TJ5 A;  4BJ6 C;  4EIY A;  2Y3D A;  1QVX A;  1YYX A;  3C18 A;  3PMR A;  3VAY A;  2HFI A;  4CDV A;  3M1C B;  2CNW A;  1LE2 A;  5JSL A;  3TD7 A;  4PJJ A;  3RQF A;  2J0W A;  1Q0F A;  3QVZ A;  4E18 A;  1SR2 A;  1I4Z A;  1HW1 A;  2HJ3 A;  3QZC A;  3T4R A;  4JTA B;  2IXP A;  5AC5 A;  2YLD A;  4PFP A;  4YL0 A;  4HEA J;  2F22 A;  3K7D A;  1DOW A;  4E0H A;  5KYU B;  2A0B A;  4EUK B;  1NBB A;  2DYS C;  4HE8 D;  2XSE A;  2LSE A;  3DAG A;  2R7X A;  2C04 A;  3DAF A;  3QW0 A;  3CEX A;  2KSF A;  4AE4 B;  2ICW G;  3DWW A;  4NY3 A;  1Z23 A;  3NMI A;  4CDA A;  4WAB A;  3ZG1 A;  3U3F A;  3FDQ A;  5KYX B;  1K40 A;  2HZ8 A;  4C7O A;  2HSB A;  4G7O F;  3S28 A;  2YL1 A;  4Q5S F;  2L7A A;  2UUI A;  3JSZ A;  5L0I A;  5L3V A;  1H9T A;  3L34 A;  3WAQ A;  2YKZ A;  4PFO A;  1RJ9 B;  3U9M A;  2RD9 A;  4RBN A;  4DBR A;  2XLE A;  5L0J A;  3MFN A;  3U2M A;  1T01 A;  4I3M A;  2HJM A;  3HTK C;  4YT8 A;  3DMD A;  4DOZ A;  2G3K A;  3HJC A;  4EWC A;  3CSK A;  4DVZ A;  5HV9 A;  1OW8 A;  4U5B E;  5A69 A;  1T9K A;  5A6J A;  4Z9H A;  1S05 A;  5TJ5 E;  4CX9 A;  1FR0 A;  3K1I C;  1PD0 A;  1YAU O;  2VC9 A;  4BPM A;  3H2V A;  4I44 A;  2PNO A;  3NRH A;  1ZW2 A;  5IY5 C;  2XS1 A;  1I5N A;  3UMI A;  3I4U A;  2LQG A;  4IWB A;  3S90 A;  2OQM A;  1LM3 B;  2YVK A;  1B68 A;  2KGO A;  4JVS A;  2PX3 A;  2WL8 A;  1A41 A;  3JRT A;  3X2Q C;  4HFK B;  2JX0 A;  4MW8 A;  3S29 A;  1NG1 A;  3JCU Q;  1YZA A;  3LJB A;  4E0I A;  2OJE D;  1HY5 A;  2L6G A;  3RW0 A;  1D1C A;  3IQ6 A;  5T1D B;  5FZT A;  1PD1 A;  3G4X A;  1APC A;  3JTL O;  5A6B A;  3EG9 B;  3V7O A;  1Q0M A;  3JT1 A;  3KYJ A;  3ZIB A;  3U3B A;  3U5S A;  2W4M A;  1T6I A;  4J32 B;  1KU2 A;  1MNE A;  3JZ0 A;  3AGT A;  4BJ6 A;  4BEM J;  1L3P A;  1V54 C;  4OIP F;  1H9G A;  3LS0 A;  3WOD F;  1LS1 A;  2XL4 A;  3NMJ A;  1RKC A;  1VYK A;  2E87 A;  1R5I D;  2QTV A;  2ZXW C;  4BJ5 C;  3C7J A;  2IXM A;  3CQZ A;  4AL1 A;  2HMZ A;  4B6I A;  3EHM A;  1D1B A;  3F47 A;  2IYL D;  2YHS A;  4IAR A;  2XLV A;  3ZDL A;  3B0V C;  2L9J A;  3AG2 C;  4MW3 A;  3B9Q A;  3IQT A;  2L6H A;  3K66 A;  2WVQ A;  1R4T A;  3MYF A;  3QVY A;  5KYU A;  1E83 A;  5D91 A;  2P61 A;  4FX5 A;  5DS4 A;  4C7O B;  4U5F E;  3S27 A;  2A1D D;  4G0H A;  3SXM A;  1HW2 A;  2QUP A;  3M4C A;  2HSQ A;  3GM1 A;  3JYY A;  3KYI A;  1JPJ A;  1JAF A;  4EBK A;  5KYX A;  4OIO F;  4QI2 A;  1IW7 F;  1ZW3 A;  2Q4F A;  1OCC C;  3B29 A;  3GM3 A;  3LLK A;  1YYJ A;  3PCV A;  3Q6N A;  3SZR A;  5AC4 A;  1LE4 A;  2EPK X;  3LNM B;  5COF A;  3ZVR A;  1ZHZ A;  1VLS A;  3NG1 A;  5JRA A;  3GM2 A;  2YRF A;  3EFO B;  4NTF A;  1TWA A;  2J7P A;  4QDL A;  1TQG A;  3RVZ A;  4E7Z A;  1TKN A;  3L0I A;  1MMD A;  2KNH A;  1YVI A;  1T6U A;  3SNH A;  4PJM A;  2EPO A;  1JMW A;  1BDJ B;  1LI5 A;  2HV6 A;  2OOC A;  3FVY A;  1FNT c;  3E9V A;  3Q6M A;  3GEE A;  4WGY A;  1JRA A;  1AEP A;  3CAX A;  1GQA A;  3ABL C;  3MBG A;  4JEA A;  3U0C A;  4DVY P;  5GPG B;  3K1I A;  1TFK B;  1IZM A;  4BG0 A;  3C8G A;  1H6G A;  2Q9B A;  3FAJ A;  4LDR A;  3RQE A;  2R7Q A;  3W2V A;  4P9F A;  4PAC A;  2L81 A;  3I5Q A;  2DI3 A;  4NCQ A;  2EPM X;  3SXY A;  3F46 A;  3O55 A;  3QTH A;  2L6F A;  2EIM C;  4DXW A;  1M2V A;  3JRM O;  3HNK A;  1LS4 A;  2I15 A;  3RYL A;  1W2W A;  3B0P A;  2OJQ A;  2CGE A;  4I1M A;  4LLE A;  1O87 A;  3EHN A;  3IHU A;  2EPN A;  4YK5 A;  4LDQ A;  3ABK C;  3C8Z A;  4E17 A;  5F28 E;  3EG9 A;  3U8P A;  4XPY A;  5L0H A;  5FCL A;  4OD4 A;  4YN0 B;  2BL2 A;  1ZVZ A;  2G62 A;  3H2U A;  1HMO A;  3O39 A;  4KNW A;  4H54 A;  1FMV A;  5T3W A;  2XLM A;  3LNR A;  1JR8 A;  2W4B A;  1BR2 A;  1G4U S;  3Q7G A;  1LIH A;  4GEH A;  3HLZ A;  1VOM A;  5F5H A;  1TFO B;  3O6X A;  1E85 A;  1MND A;  3ZQY A;  5JLI A;  4IAQ A;  4PJN A;  4BJ5 A;  2KQ9 A;  2AU5 A;  2LIG A;  5DS6 A;  4N6C A;  2J45 A;  4JTC B;  2R7S A;  3L1M A;  1K04 A;  2XLO A;  2AWC A;  2QY9 A;  1OCO C;  4MQ9 F;  4PJL A;  3SXK A;  2WZG A;  4CS7 A;  1HE9 A;  4PR9 A;  2CNW D;  1KTM A;  1VLT A;  1D1A A;  3R2P A;  5KYY A;  2PFD A;  4NQF A;  1OW6 A;  5D92 A;  3OEO A;  4DBQ A;  1D0Z A;  5L0G A;  3KL4 A;  4MVO A;  3WHN A;  4CS8 C;  2EIK C;  2JPU A;  2P1A A;  2A6E F;  2WB7 A;  2YLI A;  2ZXR A;  4MVM A;  3ZTZ A;  2FFH A;  2XLH A;  2VB6 A;  1VTM P;  1M56 C;  3AQC A;  4IB4 A;  2YZS A;  3US6 A;  1PCX A;  5KYW B;  1YDI A;  2R7V A;  1FMW A;  3RIP A;  5COG A;  5E2Q A;  4Z9I A;  3EJN A;  4JJG A;  1RXQ A;  2UUH A;  3EFO A;  4RDA A;  4YL3 A;  4CS9 C;  1SF8 A;  4JRZ A;  5DQZ A;  3A9C A;  1GGQ A;  2R05 A;  3FMS A;  5K0I A;  3AQB A;  5B1A C;  3ITF A;  3ZWI A;  3JYH A;  1CGN A;  1WOL A;  2YL0 A;  3MX3 A;  3W8H A;  2Q00 A;  4N6H A;  4D4N A;  2H7V C;  2EPL X;  1JPN A;  3C8G B;  4YL1 A;  5DLJ A;  2D5R B;  4P9T A;  2OG2 A;  5DVW A;  3W2W A;  4GQH A;  4KBL A;  4OIN F;  4UDV A;  3T6G B;  4JCZ A;  2GDC A;  2W45 A;  5KYN A;  3TUL A;  1Y6D A;  1M2V B;  2NSF A;  1WAS A;  5EK0 A;  1DOV A;  1G4W R;  4XPW A;  3SYN A;  2MHR A;  3IEE A;  2OCC C;  2VCC A;  2FGY A;  3LLI A;  3EZI A;  4KC9 A;  4ONS A;  3J06 A;  1YAR O;  4XEF A;  2M4E A;  3ATP A;  3FAP B;  1RKE B;  3A11 A;  1A7D A;  1OXB A;  3UGO A;  1T6Q A;  3AG4 C;  1NZE A;  1EA8 A;  1NFN A;  3GEI A;  4FWV A;  4Z9J A;  3UMH A;  3X1O A;  3N2Z B;  2BE5 F;  4EBB A;  3S0X A;  1QLE C;  2R7W A;  4XEK A;  1EKY A;  2J9B A;  4X0R A;  3PDM P;  4QI0 A;  3SP1 A;  4CIP A;  3LAY A;  3EQL F;  3HNJ A;  1QZX A;  3SEO A;  4ZLD A;  5CI9 A;  3L8J A;  4O7G A;  4O6M A;  5A6B D;  2ASR A;  2XRH A;  1D0Y A;  2OEX A;  3NYL A;  3NKD A;  2LP4 A;  4J7Y A;  5E3C A;  2OEV A;  2PP4 A;  1M2O A;  256B A;  2XL6 A;  3MLG A;  2YQY A;  3DM5 A;  3TOM A;  4EHP A;  5B1B C;  5AGF A;  2HUJ A;  5KYY B;  2VAS A;  4EKW A;  3AGU A;  2VH3 A;  3DJN B;  1QSP A;  1TWG A;  3AOU A;  3E70 C;  2P7V A;  4MTO A;  1C17 M;  1J8M F;  4EBJ A;  5A6K A;  5JVE A;  2A6H F;  1VYI A;  1OKK A;  1QPU A;  2MWQ A;  1G5Z A;  1LPE A;  4AK9 A;  2A69 F;  2XL8 A;  4JUR I;  5HSW A;  3ECS A;  3T9O A;  3W8I A;  2AWY A;  2IXN A;  3DI5 A;  4KI2 A;  2QLA A;  2J46 A;  3LEV A;  3EGX B;  1XWJ A;  2MYS A;  2Q7R A;  3EZH A;  1NLX A;  1XZQ A;  3N24 A;  3T6B A;  3TOL A;  4CJG A;  2I8B A;  3ZTM A;  1MMG A;  2XLD A;  2HV7 A;  2XM4 A;  3K6B A;  3M15 A;  4J30 B;  5DS5 A;  1OW7 A;  3LES A;  5KYW A;  1C02 A;  2C03 A;  2IM8 A;  2WZF A;  2ZXP A;  4XQ1 A;  2NUT B;  5E3A A;  3GEH A;  2W9Y A;  2D4U A;  1VK5 A;  1N1C A;  1BBH A;  2J0X A;  4JZA A;  3O10 A;  3B71 A;  4A2N B;  2R9R B;  1AUE A;  2R7T A;  4WGZ A;  4AL0 A;  1OXK A;  2XXA B;  5JS5 A;  3K1H A;  2YLG A;  2LD6 A;  5T3T A;  3RKO F;  1ZZP A;  4N4W A;  3KMI A;  3EH2 A;  3HNI A;  2O9X A;  1WN0 A;  2VCA A;  3HNL A;  3DZA A;  3WG7 C;  4CJO A;  3NDB B;  3UMK A;  4LLC A;  3QW1 A;  2J7P D;  4JIO A;  3PHF 2;  4LER A;  5BQH A;  5L0C A;  1HMD A;  3GAN A;  3FOP A;  1F1M A;  1OR3 A;  4BJ1 A;  1FAP B;  4DRJ B;  1Y4C A;  3L8I A;  4DRI B;  2GA0 A;  4JKV A;  1FTS A;  4N06 A;  1UFB A;  1KNY A;  1A7E A;  4H4K C;  4JTD B;  4P6I C;  1MMA A;  1O3U A;  2DYR C;  4ER9 A;  5L0F A;  3W4Y A;  4MVU A;  1H7I A;  4O6Y A;  4FAP B;  1ORS C;  1RKE A;  1SMY F;  3G50 A;  3C8G D;  4MVR A;  2CDQ A;  2LCH A;  4GYT A;  4LDK A;  3RFY A;  4M63 A;  1C03 A;  1CPQ A;  2ZPA A;  5EGY A;  2BC5 A;  1K05 A;  3R7C A;  1ZHX A;  1O5H A;  1CGO A;  1MMN A;  4U5D E;  1E86 A;  2M64 A;  1WGW A; 
#chains in the Genus database with same CATH homology
 3FOO A;  3IQ5 A;  2YL3 A;  3M79 A;  5JP7 A;  3C63 A;  3NMJ A;  3ZWI A;  1CGN A;  2YL0 A;  4N6H A;  4D4N A;  4NC3 A;  1A7V A;  2CCY A;  4IAR A;  2XLV A;  2J8W A;  3DE8 A;  5JT4 A;  3QVY A;  3DE9 A;  1E83 A;  3ZQV A;  1QQ3 A;  2XLW A;  3M4C A;  1JAF A;  5B3I A;  1MQV A;  4D4X A;  1YYJ A;  1EKY A;  4JE9 A;  2J9B A;  4CIP A;  3HNJ A;  4EIY A;  3C62 A;  5JRA A;  4CDY A;  1YYX A;  3M4B A;  4CDV A;  256B A;  2XL6 A;  5JSL A;  3TOM A;  3QVZ A;  5AGF A;  4WGY A;  1GQA A;  4U9D A;  4JEA A;  2YLD A;  1E84 A;  5JVE A;  1NBB A;  1QPU A;  4L6R A;  2XL8 A;  4U9E A;  3QW0 A;  2QLA A;  3HNK A;  3NMI A;  4CDA A;  4CJG A;  3TOL A;  5JUA A;  3ZTM A;  2XM4 A;  2XLD A;  3M15 A;  1CPR A;  2YL1 A;  3U8P A;  2YKZ A;  2XLE A;  1BBH A;  2XLM A;  2YL7 A;  4WGZ A;  5JS5 A;  2YLG A;  1M6T A;  3NMK A;  4N4W A;  1E85 A;  3HNI A;  3ZQY A;  5JLI A;  2XM0 A;  3HNL A;  4IAQ A;  4CJO A;  1RCP A;  1S05 A;  4CX9 A;  3QW1 A;  4ULV A;  3L1M A;  2XLO A;  3FOP A;  3VRC A;  1LM3 B;  4JKV A;  4ER9 A;  4JEB A;  2YLI A;  3ZTZ A;  1YZA A;  1YZC A;  2XLH A;  3IQ6 A;  4IB4 A;  1APC A;  1CPQ A;  2BC5 A;  1E86 A;  1CGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...