1APME

2.0 angstrom refined crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a peptide inhibitor and detergent
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-DEPENDENT PROTEIN KINASE
publication title 2.0 A refined crystal structure of the catalytic subunit of cAMP-dependent protein kinase complexed with a peptide inhibitor and detergent.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase(phosphotransferase)
total genus 108
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1993-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1apmE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1apmE02
3IDCA 4FSNA 1XR1A 1CKPA 2WTKC 2ERZE 2Y8OA 4RC4A 4DN5A 4EOLA 5M06A 2EXEA 3DNDA 4I93A 5EHOA 1UNGA 2ZM4A 4L45A 3O8TA 2LGCA 2R3HA 2PMOX 3MIYA 4YZBA 4CRLA 2FSOX 1OKZA 3FMHA 4PV0A 3VUMA 2UZBA 2WXVA 1Q8WA 3WF9A 3RM7A 4ZTSA 4FT0A 3PZEA 5G6VA 4GG5A 3T3UA 4TW9A 4EUUA 1Z9XA 3AD6A 1APME 2C3KA 3FMNA 3MH2A 3ZO2A 2PVMA 4G3EA 3TTJA 4GMYA 2ZM1A 2IO6A 4L68A 2ZV2A 4O21A 5HCYA 3SDJA 3QTXA 1XBAA 3TNHA 2ONLC 4FV9A 3K2LA 1Q97A 3FBVA 5ANJA 1J91A 1T45A 4K0YA 3CQWA 5HBHA 4R8QA 3R9NA 5D7AA 2PVNA 3WF5A 2HXQA 3CTJA 3MY0A 5FRIA 2G9XA 1TQMA 3FMLA 4A07A 1OVEA 4FT9A 2YZLA 3R73A 2EXCX 4BBFA 3JXWA 3MVJA 3GP0A 3HDMA 4IVDA 3DQXA 4JG8A 5JN2A 5KMJA 5HLNA 4X3FC 4Q9ZA 5AMNA 2B9JA 1YDSE 4DBNA 2BUJA 5AUWA 5FGKA 2G01A 1CTPE 2XUUA 3PTGA 3QRJA 4FG9A 1XH8A 2X8EA 4V04A 3NUYA 3ZU7A 2W4JA 4BDDA 4CSVA 2ITZA 1GOLA 2I40A 3G15A 5CLPA 4A9RA 4RG0A 4C38A 4O0WA 4S33A 4XG8A 3IG7A 2CGVA 3PXKA 3EN6A 2EVAA 5AAEA 3DLSA 3VBWA 3R1SA 2CPKE 3H9OA 2I0EA 2JIVA 3JY9A 2J6MA 3RPVA 1M17A 3KRJA 4I0TA 4ZLOA 4AP7A 4KRCA 3HMNA 5KKRC 4GSBA 3VULA 3PA5A 2ITPA 1OL2A 2Y4PA 2WMWA 3UZTA 1VJYA 2WO6A 5HG5A 1M2PA 4E6QA 4EKKA 3QYWA 5DR6A 5AIRA 3QTWA 3BU6A 4DFXE 5HCZA 4ZP5A 5EKOA 1KE9A 4F0IA 3Q9XA 3VBXA 3P9JA 4CFWA 3KXZA 1SVGA 2R3RA 3Q4CA 3QWJA 1Q5KA 4Y5QA 4YJPA 2WMVA 2HZNA 1F0QA 5F20A 4FIIA 4FC0A 1MQBA 4LUEA 1IR3A 4NKAA 3ZLYA 4LYNA 4F9BA 4L3PA 3TUBA 1L8TA 4O82A 3JVSA 4E4LA 5D41A 2UW5A 2R2PA 4ZJJA 3PA3A 4EZ7A 4C4HA 3WARA 3V8TA 3R8VA 3COHA 3DCVA 5BX0A 1XHAA 3AGLA 3ZO1A 3VN9A 2Y9QA 4HVGA 5CXZA 3KXXA 1A48A 4BDKA 3FSFA 5BYZA 3OW4A 2HW7A 5HU3A 2YHVA 3D15A 3MGYA 4GVJA 5CVGA 4F99A 5J8IA 3IW8A 4FUYA 3PPJA 5AR4A 3KK8A 4MCVA 4M69B 4BZNA 1CSNA 2BZHB 1JPAA 2W05A 5C4LA 3EFLA 2RIOA 4A06A 1VEBA 2VWWA 1U59A 2XJ1A 3DAKA 4N4SA 4FV8A 4QYYA 4O6LA 4EH5A 3MS9A 4JDKA 4IACA 4LRJA 4WNPA 2X4FA 4XNEA 4AA4A 2XK6A 3GNIB 4IE9A 2G2IA 4GL9A 2W1DA 3VS6A 3EKNA 4P5ZA 3ZUUA 4GT5A 5CEPA 4GJ3A 4FZ7A 1H24A 2R0UA 3UC4A 4D2VA 5HE2A 3L8XA 4ZS0A 3CY3A 4WG5A 4CT2A 4TYIA 4BCOA 2VWXA 3HA8A 4BWKA 3A2CA 3LFSA 1SNXA 4EQUA 1JAMA 4M67A 1HCKA 1QL6A 1W8CA 4M66A 4ZTQA 4K1BA 3HUCA 3MA3A 5JT2A 2R0IA 2WMBA 3E92A 4FTCA 4G6NA 2NNWB 5CU2A 4IWPA 3LFEA 2VTMA 4JAJA 2QOHA 2E9NA 3L8PA 3MIAA 3R9OA 2ZV7A 3D4QA 2VWZA 5FM2A 3R83A 4ALUA 4L43A 3EQRA 4AAAA 2YJRA 3RBWA 5JZJA 1VR2A 4V01A 3THBA 4QP3A 4QMUA 3FZ1A 4YBJA 2UW4A 3UG2A 4JL9A 2XYNA 3W18A 5J7HA 2YACA 4HVDA 5KX8A 3KQ7A 4FEUA 5AR3A 3QUPA 4WNOA 1YXXA 3UIUA 4WG3A 2CCHA 3KCKA 2W0JA 2C3JA 4JQ7A 4OBQA 4D0XA 2XM8A 3R63A 3OWPA 4O22A 3M1SA 4XV3A 4Z3VA 1U5RA 1S9JA 1SNUA 2YCFA 4CKJA 3VNTA 4M69A 4CD0A 3EQCA 4RZWA 3ZONA 2RGPA 4FV5A 3BE9A 5IQFA 2EUFB 5FP5A 4AN9A 1H01A 2WHBA 2WU7A 3PWDA 4BI2A 4TRLA 4A7CA 4YJOA 4ZIMA 3NVKI 2W1HA 3KXHA 4CYJA 2X1NA 3II5A 3QCQA 4I5PA 3FI3A 3VS4A 5DA3A 2FO0A 3FHRA 3I0QA 3C4FA 3QQLA 4GYGA 5FM3A 3C50A 4IX3A 1KE5A 4A9UA 3BV2A 3CS9A 5JFVA 5KZIA 3CPBA 3HKOA 3ZDUA 5CY3A 5E91A 2BILB 3TIYA 3CKXA 4O86A 4BHZA 3P7AA 2G15A 3E5AA 4Y46A 5F1ZA 3WZDA 4AW1A 4DFYA 3NUUA 5BYLA 2REIA 4FL3A 3W2RA 4WIHA 1KSWA 3KMMA 2BHHA 3OZ6A 5CXHA 4YNOA 2CKOA 2R64A 1ERKA 2VWBA 1UU3A 3FC2A 4JT3A 5HIBA 4CMOA 3QL8A 4DFNA 5JK3A 4CVAA 2OJIA 3L9PA 2JD5A 5AAFA 4FT7A 3P7CA 4FZAB 3QKKA 3G0FA 2ZVAA 4LM5A 3ZRLA 1KUTA 1RQQA 3ZFXA 3PRFA 4WA9A 1Q62A 4RVLA 3R1QA 3LLTA 2OIQA 4JS8A 1VYZA 3ACJA 3QD0A 4QRCA 2O2UA 4K18A 2B9FA 4GVAA 1PHKA 4II5A 4PDSA 4GYIA 4TT7A 5AP4A 4AZTA 5CU3A 2Q0BA 3CQUA 3R28A 4NCTC 4RA4A 3UO5A 3MVMA 1Q3DA 4JBVA 5C9CA 3KU2A 4BDBA 3U4UA 4E20A 4D5KA 4A9SA 4NFNA 4W4VA 4ZJIA 4IDTA 4FGRA 4A4XA 4C3PA 2FVDA 4YSJA 5HIEA 5KMLA 3EN4A 3QQGA 2XNPA 4I4EA 2PVFA 2A4LA 3ANQA 3F66A 3JUHA 4FBXA 4NJDA 5EI6A 5FG8A 5HOAA 4EWQA 5J9ZA 3TCPA 4U9AA 4QYFA 2BDFA 3LFNA 5C8MA 3R01A 3VBVA 3FYKX 4ZSGA 2ETKA 2VTOA 2G2FA 5LWNA 5IDPA 4V0GB 4ZXTA 4F65A 3K5VA 1LR4A 4E6DA 2IVTA 2HWPA 4X21A 1O6KA 3Q60A 2ZMDA 4YSMA 1R78A 1SVEA 2GQSA 3SRVB 2PZYA 3V6RA 1BL7A 4UYAA 4AZWA 4R77A 4BCGA 3ATSA 2O65A 1WVWA 4FNWA 4EBWA 2PY3A 3G9NA 2C4GA 4BDEA 2A19B 1FVVA 2HY0A 2NRYA 3GC7A 4MKCA 4YZMA 3SXSA 5LCKA 4FKGA 1M52A 2UW8A 2X9FA 3DKCA 4ZSEA 3ERKA 2V62A 2VX3A 2R3QA 2XIKA 3AC4A 3OY1A 3PUPA 3G6GA 3KK9A 2E9UA 4FKLA 5JH6A 5I9ZA 3AQVA 3FZRA 4ZJVA 5KMNA 2QKRA 4IANA 4Q5HA 4CYIA 3I1AA 4ZTMA 4ACCA 3EHAA 4QNYA 5E4HA 4XOZA 2W1ZA 4C61A 5J79A 4O38A 4FT3A 4QMPA 3PSCA 4M84A 4MX9A 1SYKA 3VUGA 4RRVA 1Q8TA 3NRMA 4UY9A 1G8AA 3UVPA 4HGLA 4WHZA 5CAQA 5EI8A 3LM0A 4YJQA 3PP0A 1OL7A 4E6CA 3QXOA 4AZFA 1FOTA 4FVRA 3NX8A 4ONAA 2IZUA 3FKLA 1WBTA 2IW8A 3F9NA 5DNRA 3ZOSA 3VJOA 5AA8A 5IQGA 5FTOA 1FBNA 2F9GA 4UMUA 4O96A 4EQCA 4QTDA 4RIWB 5CF5A 4CV8A 4XBRA 4BDHA 1Q8UA 4R78A 3PIZA 5ANDA 4EH4A 2ZDUA 3KKVA 4FKQA 4WOVA 4RIYB 4AA0A 3MFSA 2DQ7X 1YI4A 3V6SA 1I09A 3VUKA 4F7SA 5CF6A 5JGAA 4PWNA 3MWUA 4QP7A 4EEVA 3ZSGA 4B6LA 5KO1A 5CSPA 3QF9A 4QTBA 4FODA 2OZOA 1PJKA 3V04A 4V0GA 5LCJA 4FZFB 3ZYAA 5AUYA 4LRKA 4IX5A 3GENA 4CZYB 4QQJA 4AGCA 4BI0A 5JRSA 4FV2A 2PUUA 4WT6A 3VQUA 2VTHA 3QQFA 5DHJA 2F4JA 3SRVA 2QR7A 2C30A 2OSCA 2BDWA 2RFEA 1NW1A 2OBJA 1UVRA 3EKKA 4MTAA 4FKTA 5HIDA 5IUHA 4IC7A 3I7BA 3VW6A 4PP9A 1REKA 2J7TA 4EJNA 2P55A 4R1YA 5AR7A 4YC3A 4M8TA 5CQWA 4CLJA 3BLRA 4MH7A 4G16A 5IUGA 2YDJA 2BR1A 5BUJA 3BE2A 3OCTA 4M0YA 4AZEA 5HE3A 2WQOA 4PDYA 1GZ8A 1NVQA 4G3CA 1GIHA 2HZ0A 4FKIA 3R8LA 2C3IB 4CG9A 1P4FA 3W32A 3FI8A 5M4UA 4BRXA 2WEIA 4CZUA 2QHMA 2CNUA 1ZARA 2AC3A 2YN8A 2W1IA 4XH6A 4ZS4A 4YP8A 3UMXA 1U54B 1YWNA 4D4RA 4BCMA 4IB0A 3NWWA 1OL1A 2WPAA 3WZUA 4C0TA 3C5IA 3TN8A 5KHXA 3OP5A 4HNFA 1OL6A 1JKTA 4RIWA 5C4KA 3UIBA 5EHLA 2XKEA 2UUEA 3R04A 4W9WA 2RFSA 3KGAA 4RIYA 4BCHA 2UZEA 2QOIA 4PQNA 1BUHA 2XIXA 4KWPA 5AM6A 4A4LA 4D55A 4Y8DA 3MH1A 1K3AA 5HE0A 2GS7A 2JAMA 2YAKA 1EH4A 1QMZA 4FYNA 4APCA 2VWYA 4E4XA 4ZK5A 2SRCA 3GC9A 2C6IA 4AN2A 3QCXA 4WNKA 1GY3A 4DGLC 3FUPA 3FYJX 4PPAA 3AMYA 1Q61A 3LJ0A 4U97A 2JDRA 3CXWA 3OEFX 3MTFA 5FTQA 4BBEA 4Y73A 4I23A 2A0CX 4IZ7A 4IAFA 3PIXA 4IVAA 2CJMA 3R21A 4P4CA 3UOLA 2CNQA 1WBNA 4GUEA 3TDVA 4O0RA 4IJPA 4HYIA 4P90A 4YO4A 4RJ5A 2QO2A 2OJFE 1NY3A 2WTIA 4ZTNA 5AUVA 2QOBA 4JNWA 4ALWA 1YI3A 2G2HA 5F94A 3P08A 2RSVA 4QYGA 3R8PA 1TQIA 3PY1A 4I3ZA 4FVPA 3CIKA 4I0SA 4LV8A 3BGZA 1HOWA 2ZMCA 3I5NA 2R3JA 2EB3A 2W4KA 4BBMA 3ORTA 3MESA 3L8VA 3QQJA 5GJFA 4C62A 4BHNA 3E8EA 2XVDA 3F3UA 3DK6A 1RJBA 3G6HA 3P0MA 2HWOA 3Q04A 4HZSA 4DFBA 1G5SA 1MQ4A 2B53A 2W7XA 3FY0A 3TV4A 2RF9A 3IW4A 4X2JA 5BVWA 3VHKA 3R9RA 5CI7A 5D10A 2CN5A 1V0BA 2C6OA 3NCGA 2BPMA 1Q8ZA 3AC3A 3IOPA 3VS5A 4Q2AA 3R7OA 1GZNA 3HRBA 2BTSA 1U54A 1YHWA 3HP5A 4IX4A 4L3JA 3WOWA 3VBTA 2VTIA 4DINA 4F0FA 5AEPA 5J7BA 4U0IA 3FZPA 3FXXA 2C5OA 5AUUA 4TYJA 4DCEA 3EZVA 2AYPA 3ZRKA 2OZAB 4FI1A 4YJRA 3GCQA 3GU4A 1R0EA 3QYZA 5A6OA 4FA2A 1OUYA 3MFRA 4PP7A 4PF4A 4QMMA 3R8UA 1H8FA 1I44A 4IXPA 4E3CA 1ZZLA 5CSHA 5KMKA 4YZCA 3KRRA 4O7WA 4RQKA 4UWBA 3DKFA 2ITWA 3PVWA 3MW1A 2PVJA 3W10A 3F61A 5HTCA 1ND4A 4JLCA 3VS2A 1GZOA 4FK3A 5EYKA 3GU7A 4ANOA 4RWIA 4TYEA 1ZY4A 2C5NA 3NPCA 1OBGA 3EMGA 5M07A 4K11A 4ZZNA 4MYGA 5C26A 3A7HA 2HZ4A 3I7CA 2OO8X 4B9DA 2YM3A 1KE6A 3W33A 4EUTA 4NZWB 4BFMA 1H28A 4IFCA 3TG1A 3TNPC 4LGGA 3BWFA 5HBJA 4ASEA 5FBNC 2X8DA 1OPJA 3IDPA 4W4YA 5DYJA 4D9TA 1GAGA 4TNDA 5HG9A 3G9LX 4BDIA 4FSTA 4EOJA 2QG7A 4C35A 5LVPA 1JKLA 3DJ7A 4OR5A 4BGQA 3C4XA 4TY1A 2PVHA 4JX3A 2P2IA 5AX9A 4EHGA 5KMMA 2ITQA 1Q99A 3TKIA 2V5QA 5LXMA 3G0EA 3KRWA 4RJ4A 3VBYA 3VF9A 5CASA 3PLSA 1PMNA 1YXSA 4TKSA 2GPHA 3RNYA 3ZCLA 5HTIA 4QMOA 4C7TA 4IWDA 1XH4A 3H4JA 4GJ2A 2YWPA 1URWA 4R7HA 3RAHA 5TO8A 3NYOA 3PG3A 4RC3A 2JBOA 4KKGA 4AT3A 4DG0E 2YWVA 3Q5IA 1U46A 3CP9A 2GTNA 3VJNA 4MNFA 4QTEA 5IG1A 1IAHA 4YHJA 4FE2A 3GCUA 4EI4A 5BNJA 3UP7A 3EWHA 4ARKA 4L8MA 3KF4A 3ZBFA 3ZZWA 2OH4A 4FSYA 3EZRA 2OZAA 5H9BA 1AD5A 1IASA 1P2AA 5JQ8A 1YHSA 2W17A 3COMA 2WELA 5J5SA 5CZIA 3WI6A 3U8WA 3R0TA 3WZKA 3R7EA 1V0PA 4F1TA 2BVAA 5IQDA 3Q4TA 4WD5A 3ZUTA 4JOAA 2GHGA 4RQVA 3DNEA 4L53A 4ASZA 2CN8A 4H36A 2OXDA 3FL4A 3QHWA 3ETAA 3F7ZA 2XK9A 5L6WL 4XMOA 3DKOA 1PKDA 4G31A 3RPRA 4JIAA 2V7OA 3V8WA 3LCKA 3LQ5A 4C02A 5LWMA 2J0LA 4KAOA 5AP6A 3W2PA 3UODA 5JEBA 5L4QA 2O5KA 3CEKA 3D5WA 5A9UA 4RJ7A 5K5NA 3V5QA 2QVSE 3U6JA 4G5JA 5BQ0A 4KKEA 1Z5MA 3KB7A 2VTRA 4GFGA 3SG9A 3KY2A 4GS6A 4OTDA 2DUVA 2FSMX 4QMSA 4J1RA 4D0WA 2W9ZB 4M68A 1PXMA 4ZAUA 2PMNX 1P4OA 3LHJA 3P78A 4I6QA 1E1VA 3QTSA 2YCRA 3QRTA 4XG2A 4BTMA 3HMIA 4QP2A 4YLLA 2XK3A 4HNIA 3DB6A 3E93A 2XS0A 4IBMA 2AC5A 4KIPA 4MHAA 3BI6A 3O8PA 4JRNA 2VTLA 3AC8A 1WVXA 4I92A 3FAAA 3UP2A 3ZSHA 1GNGA 4HW7A 2QU5A 4R5SA 5CF8A 2J9MA 1QPCA 2F7EE 3PG1A 5D11A 4XOYA 5AV2A 4UN0C 3R9DA 5DT4A 2RG5A 5B2KA 1YW2A 3PXQA 1H25A 2VNWA 4YTFA 3FKOA 5EG3A 4Z16A 5HG8A 5CSXA 2X6EA 2YIYA 5DVRA 4D4YA 4H3BA 5E92A 2GTMA 4FICA 1NA7A 5IF1A 3K5UA 5BUIA 1W84A 1WZYA 3F82A 3L9MA 4UZHA 4U8ZA 3PVUA 1GJOA 5AR8A 3WF8A 4ZLZA 2B9HA 3NYNA 3SC1A 5HNGA 5FQDC 3BBTB 4BIBA 3UZRA 3ID6C 4YLKA 5H2UA 3K3IA 2ACXA 3W8LA 1STCE 3QBNA 4KNBA 3RGFA 4CCBA 2CKPA 2UZLA 1KE7A 2XB7A 3GU6A 5M09A 2HXLA 2J4ZA 3O7LD 4WKQA 4U44A 4F7JA 4FTIA 4AACA 2R3MA 4FF8A 2YAAA 4H3PA 3BBWA 4MF1A 5DIAA 1E9HA 2FUMA 4D2TA 1FGIA 2BFYA 4WRSA 2RL5A 4ITIA 3UNZA 5DFPA 3GVUA 4CGAA 3I5ZA 1VZOA 5DWRA 2ITOA 3ODZX 5KMIA 2NO3A 3AC5A 3C5UA 4EHZA 5M4IA 1PMVA 4BCFA 3TDWA 5I9WA 4LUDA 4F9WA 5LMAA 3A7IA 5E8TA 3L9LA 4U43A 3VUDA 4G34A 4WRGA 3QC9A 2OXYA 3PSBA 3EN7A 3OHTA 4ITJA 2JDTA 4Q5EA 3VIDA 3MA6A 2Z7QA 2YCQA 5EW3A 2J0JA 3NCZA 3ORNA 1JSTA 5HE1A 3ZO3A 2A27A 3DAEA 4HPTE 1XQZA 2PL0A 4HCTA 3TNQB 3DGKA 5B7VA 5F4NA 4U42A 2UW0A 4HGSA 2R7BA 3VS0A 3GCSA 3PVGA 4F6UA 3L8SA 4YLJA 2BDJA 2VGOA 4ANBA 4MVFA 5ACKA 5CAOA 3F6XA 5TF9A 4I1ZA 4JBOA 1H0WA 3H9RA 4EZ5A 2XEYA 3D5XA 3F3WA 4LQMA 3R9HA 3RI1A 1OIQA 5FEQA 2Z60A 1O6LA 4AWIA 3EQDA 1TQPA 3LFAA 3FJQE 3UE4A 5JKGA 3PE2A 3MSSA 5DR9A 4C36A 4EK5A 3FMJA 5E8WA 5IQAA 4B99A 4QP9A 3T3VA 4MEDA 4F4PA 4F70A 2Y4IB 3QCYA 4EZ3A 3JR1A 3QTQA 4FTLA 3QTIA 4H1JA 3F2AA 5J1WA 3PXRA 5CEQA 3V51A 4QP8A 2QO9A 4TNBA 5HZNA 4U80A 3W2SA 3CE3A 3LKMA 1FPUA 3VS1A 1YXTA 4JDHA 3GCPA 2YIRA 3OBGA 4K2RA 1ZMVA 4IHPA 4YTHA 3VVHA 2F7XE 4E5BA 4X2FA 2BZKB 2C6EA 2XNOA 2JITA 3BX5A 1FMKA 3R6XA 3H3CA 4I41A 4PX6A 3DBDA 2B55A 2WFYA 2I6LA 5EHYA 3VRYA 4DC2A 5GZ9A 5IA5A 2XCKA 5ANIA 5LMKC 4H1MA 5FUTA 5H8BA 4EOSA 3A7FA 4DT8A 4S30A 3ELJA 2CHLA 4U3ZA 1ZOGA 3NMUF 2QLQA 4QTCA 1DS5A 3EH9A 3SQQA 3U9NA 5HICA 4QMNA 2ITYA 3ORLA 5D1JA 5TKDA 4OTIA 4C2VA 4LFIA 5GJGA 2OXXA 4QPMA 2B4SB 4FTMA 4KD1A 1W0XC 4ZY6A 3VUIA 1H27A 1Y6BA 2FGIA 3EFWA 3HV3A 4FTQA 4HCVA 4FV4A 3TZ8A 3NYXA 2ZM3A 4I22A 5AV4A 3AT4A 4O6EA 3QZFA 3DLZA 4FTRA 4KSQA 4MQ2A 4AS0A 4DTBA 1M7NA 3EFKA 2OW3A 5BVFA 3O51A 2J90A 3BGPA 3UQFA 4C3RA 4S32A 3F3VA 1R1WA 4DTKA 2XYUA 3IW7A 1YOLA 2J5EA 3GC8A 4JAIA 4O91A 4ACHA 3R7VA 4F9YA 4KIQA 2PSQA 3DV3A 4N0SA 3C4CA 2UZTA 4XX9A 1KE8A 3LW0A 4B8MA 3CPCA 2PE1A 4UMTA 4PTCA 3DKGA 1OIYA 1RW8A 2WTVA 4MXYA 3N4UA 2Z7LA 1JBPE 4FK6A 3G2FA 3DBEA 4D28A 5CZHA 2YIWA 3GU8A 2OWBA 2IVVA 5DPVA 3SOAA 1W83A 3IK3A 4PDOA 1ZAOA 5CI6A 2F2CB 5HBEA 5T6KA 1ZYJA 2Y0AA 3IKAA 3BGQA 1PXOA 4O0YA 3WE8A 3M2WA 3QTUA 4RMZA 4WBOA 4LOOA 1K9AA 4EYMA 2R3PA 2QURA 3LCTA 1PF8A 2J0IA 3TNIA 3TM0A 3QLGA 4WNMA 3NNUA 3TI1A 4FOBA 2CGXA 3DU8A 4AT4A 4YZDA 5KNJA 3TV7A 3H0YA 2UVYA 3EQBA 4M14A 4GKIA 5FXQA 3KXGA 2OJ9A 3RAIA 2X2MA 2WEVA 4XS2A 3LJ2A 2DS1A 2XF0A 4BF2A 2JEDA 3W2CA 1JOWB 2GNHA 5ANGA 3LXPA 1JQHA 5HX8A 3EIDA 3PPKA 4DFLA 3ZM9A 3C4EA 4RFZA 1FINA 5DT0A 3R7IA 2BKZA 2R4BA 3NNVA 3A99A 3U51A 4EK3A 4DGGA 5A4EA 2ZB1A 4WO5A 5ANEA 2IVSA 4NM7A 4UZDA 3WE4A 4B8LA 2VTPA 3HRFA 4BCJA 4DEEA 2VTQA 4R6VA 1NVSA 5BVKA 2YA9A 3KF7A 4FSQA 1O6YA 1PRYA 3BU5A 4FL2A 3D5VA 5EDRA 4BWXA 4EBVA 4X3JA 1OKYA 3BKBA 5AUTA 3UIXA 2B52A 3EB0A 4E5WA 2GHLA 1TVOA 2PHKA 4APPA 5H3QA 1IAJA 3R8MA 3IQ7A 3N9XA 2YFXA 3T9IA 3EJ1A 4E7WA 2QOLA 5HHWA 3PYYA 5BVOA 4U7ZA 3FI4A 1M7QA 2ITNA 2W99B 1Q3WA 2ZAZA 2W4OA 4K6ZA 3C7QA 4ZY5A 2XCHA 3DXQA 3FDNA 2R3IA 4RZVA 1JLUE 5C1QB 3RWQA 3RWPA 5L2QA 3QGYA 1ZMWA 3ZUVA 3ROYA 1Y57A 1OPLA 3OCGA 4O81A 1OUKA 1MUOA 4BDCA 3I0OA 4BGHA 5IEXA 2R9SA 2OIDA 5AFVA 3PSDA 4ANMA 5D7VA 4IM0A 4OTQA 3U6HA 4G3DA 3NW5A 2OJGA 5I9YA 5KZ0A 3SX9A 4DGOA 5L2IA 2VTJA 2YLEA 2GS6A 5BUEA 3RHXA 4FIEA 4J97A 4H3QA 1WAKA 1VYWA 1ZXEA 2A1AB 4UB7A 3RTPA 3IW6A 5A4LA 5DG5A 4TYHB 3V5WA 3A62A 4EH6A 3O50A 4JG7A 3E63A 4YHTA 1QPJA 2OFUA 2VNYA 4RLLA 3U4WA 3DXNA 2R3LA 3QD4A 3S95A 2P3GX 2YM8A 3FE3A 3H0ZA 1J7IA 3PP1A 3LQ8A 1SMHA 4EOIA 2YIXA 3ENMA 4I5MA 5CU4A 3MJ2A 3ORPA 1J7LA 3NVMB 5FTGA 2CCIA 3LCSA 3FQEA 3Q2JA 3N51A 4WSYA 5M4FA 4PUZA 5AAGA 4O0XA 2B9IA 5C27A 3SW4A 5IA4A 4IMYA 3S2PA 1O9UA 3OY3A 4AGUA 4W8DA 4GU9A 1IA9A 4U5JA 1PY5A 5EYDA 3EOCA 4MXOA 4HGTA 3RINA 2VUWA 5CEMA 3AMBA 2VZ6A 2ITUA 2JFMA 3DY7A 3UVRA 5DBXA 4O7YA 4EOOA 2O64A 3V3VA 3VWAA 3EQPA 2QD9A 4F09A 4N70A 4O1PA 5EYCA 1XBBA 4GG7A 3UPXA 1PXIA 3KXNA 3QRKA 4QMVA 2B1PA 4DLIA 3RMFA 5FDPA 4C34A 5DEWA 3IPHA 4RWKA 4BC6A 4IQ6A 3RNIA 1BYGA 3UO4A 4BGGA 3HVCA 4XUFA 3BELA 4AQCA 2E2BA 3TJCA 4GUBA 3OW3A 3TEIA 2C5YA 2H34A 2JAVA 2PVKA 2XNNA 3PA4A 4F0GA 3VBQA 2V0DA 3TWJA 4JRVA 4J71A 5CQUA 3UQCA 4AW5A 4U79A 4X2GA 4JDJA 5HO6A 4OTPA 1YOJA 3UNJA 4EORA 4PNKA 4Y83A 4FKSA 1Y8YA 2O3PA 3G90X 4RJ8A 4ID7A 2E9VA 3A61A 4TYHA 5KCVA 4XJ0A 2ZYBA 4CFFA 1YWRA 4MWIA 4OTGA 5CANA 3ATTA 2ITVA 3OWKA 2JDVA 4F7NA 3U6IA 3NUXA 5AX3A 4F9AA 3A4PA 3E64A 2QODA 4YZNA 4ZLYA 4DE4A 4JDIA 3A7GA 3HEGA 5A54A 4D2SA 4E4NA 3CR0A 4I20A 3SGCA 4RGJA 2IJMA 1OZ1A 4FTNA 1UKIA 3DS6A 1WBWA 4MQ1A 5A4CA 2GNIA 4DCAA 4TZRA 4FKJA 4HCUA 4QOXA 2PPQA 4C33A 2R3KA 2X2KA 5A4QA 4YHFA 2PUIA 1BMKA 3PRIA 2X2LA 3VC4A 5M4CA 1XKKA 1BLXA 5D12A 2ZJWA 3AT2A 3UVQA 5B0XA 3ZS5A 5C8NA 2QLUA 3MB7A 2R3FA 2YZAA 2WU6A 4NL0A 3CJFA 5I0BA 4TWNA 4CFUA 5JFXA 4UBAA 3MY5A 2QO7A 3ZHPC 3DAJA 3PE1A 2H8HA 4BN1A 5CWZA 3HZTA 4M97A 5HCXA 4E4MA 4O7NA 2GNLA 4PTEA 1UWJA 4QP4A 3OOMA 2XK4A 3BHYA 3A7JA 3FMKA 4M15A 5H8EA 5CYIA 4A9TA 1UKHA 3QALE 3MFUA 4O2ZA 3IGGA 3ZLXA 1AQ1A 2I7QA 3GU5A 3IGOA 1XJDA 4R3PA 5DRBA 1W7HA 4NIFA 4ENYA 3PZHA 5KHWA 4FKUA 4QMXA 3ZZEA 4JG6A 4XP0A 5IQHA 2E9PA 4XBUA 2YJSA 4CTCA 2P4IA 4D4SA 5B2MA 3OTVA 2JDOA 5HD4A 4A9YA 3Q52A 3ACKA 5J9YA 4FKRA 3ORXA 5K4JA 5HQ0A 3S3IA 4FG8A 3UOHA 2X6DA 3B8RA 3GCVA 4Z7GA 2F7ZE 4O2PA 3BYVA 3P7BA 3REPA 2WTKB 2XNMA 4IWOA 3ZXZA 4DFUA 4IZ5A 1XH7A 4AFEA 3Q3BA 4BWPA 1MP8A 2BMCA 2HIWA 4DTAA 3NYVA 1GIIA 5GHVA 5JGDA 3BEGA 4G17A 5JMSA 5IQIA 4C58A 4EYJA 3ALNA 1FVRA 4UALA 4DGNA 1XH9A 2FB8A 3HDNA 4ASDA 2C3LA 4FX3A 3SAYA 4BL1A 3RM6A 1UU7A 1UU8A 1ZOHA 4OLIA 4RX9A 3BYSA 4O84A 4FSZA 4RFYA 3VQHA 4NM0A 3LFDA 2V7AA 2H96A 4G1WA 4AFJA 4OAUC 4XV1A 2WTWA 4FIFA 1H08A 3UDBA 3V01A 4AE6A 4BR3A 3QCSA 3O17A 3UYTA 4DH5A 3HECA 1B6CB 1Q8YA 4U40A 4UYNA 2KTYA 4H58A 4RX5A 4XV9A 5IQEA 3VAPA 1BX6A 4GV1A 5AP2A 5L6OA 3MY1A 2WMTA 2BAQA 1LEWA 2ITTA 2PE0A 3O8UA 5E1SA 2IZRA 2WMXA 2VD5A 2WKMA 5AR5A 1JWHA 3QUEA 4L6QA 1GIJA 5EKNA 1H1QA 4X3FB 3UGCA 4R7IA 3HV6A 5HVJA 3CLYA 2YCSA 4PMPA 5IA2A 5KBRA 4X2NA 1OITA 2GS2A 4EH8A 4NFMA 2VX1A 4FKVA 3R02A 4CQGA 2C5VA 2W06A 5LARA 4DH7A 3VO3A 3MVHA 3OXIA 4F7LA 2VGPA 5DN3A 3OTUA 5FDXA 5IEVA 3KC3A 4W4WA 4FT5A 1ZMUA 3POZA 3VF8A 5A46A 4CLIA 2VO0A 4EONA 3NIEA 4E73A 4EOPA 3F5GA 3F5UA 2HK5A 3MH0A 5HG7A 3FLSA 5AV1A 4FEXA 4QQCA 3FEGA 1P5EA 3M11A 5CU0A 3SW7A 3HNGA 3ZEWA 2ESMA 5KKRB 3F5XA 3KREA 4M13A 3UIMA 3NS9A 1G8SA 5K9IA 2PYWA 2OJJA 4QQ5A 5DT3A 1JKKA 1XH5A 2VO7A 3EYHA 3QFVA 3TNWA 3ULZA 1BL6A 5L2WA 3EL7A 1SVHA 2JBPA 3FL5A 4EK4A 5JGBA 2WIHA 4L00A 4ANNA 1UNLA 3ZMMA 4YGAA 4ACGA 4AOIA 4EK6A 3VUHA 3GQLA 4KBKA 1WVYA 2GFCA 3L1SA 1J1CA 4ANQA 3CGOA 3HV5A 2V55A 3TKHA 2PZPA 4FEVA 3PY3A 3PJCA 2ONLA 4MXAA 3RKBA 3SVVA 3GBZA 5CAUA 5FXSA 4LMNA 5IPJA 2YLFA 2C6LA 2YM6A 2J0MB 3COIA 2W96B 3OOGA 2C68A 3PIYA 3BWJA 4KS8A 2VTSA 3D94A 2QU6A 4F6SA 4LI5A 2C6MA 3QA8A 2O8YA 3QRIA 5AP1A 2O0UA 3ZH8A 3E87A 2BCJA 2J5FA 1ZLTA 2BAKA 3UOKA 3F88A 3OT3A 2C6KA 3HUBA 3QKMA 4X3FA 2BZIB 2UVXA 3OVVA 5E8UA 5IH6A 3W16A 2YEXA 3FZTA 2PZ5A 3MPAA 2JKKA 3FWQA 3D2KA 3LJ1A 2BALA 2XKDA 4ZMFA 4U81A 4GK3A 5IUIA 5TE0A 1YOMA 3TIZA 4ANSA 4F08A 1OKWA 5AV0A 4AZVA 3BIZA 4F1OA 3I81A 3Q4UA 4DYMA 3TTIA 3E8CA 1OECA 2JLDA 2RFNA 3KN5A 4PPBA 4PL4A 4X6QC 3ZFMA 3GUBA 5IZFA 2VTNA 3UPZA 3DFCB 5I9XA 3QX2A 4U6RA 5AV3A 3CD3A 5CNOA 3PY0A 3H30A 5B2LA 3CTHA 1PYXA 4ZOGA 3OWLA 5IA3A 4EHVA 5EDPA 2G1TA 2OI4X 4IAZA 3I6WA 3H9FA 4GT3A 2C5XA 2ZDTA 3OC1A 4NM5A 3SG8A 3LMIA 5DE2A 4G9CA 1PXNA 5C01A 4V05A 3ODYX 4P2KA 4NWMA 3QKLA 4O7TA 2XK7A 4CFMA 3RP9A 3DOGA 4O0SA 5JZNA 3TACA 3HRCA 2UV2A 2VN9A 3R22A 3TUDA 3WIGA 4FV7A 1JSUA 3R1NA 2R3GA 3RHKA 5IH5A 2R5TA 3R30A 3PXYA 2XH5A 2QG5A 3QXPA 3QZGA 3QTZA 4IAYA 3Q6UA 4J7BA 3NAYA 3GFEA 4FNYA 4X6RA 1OL5A 4LGDA 1YXVA 3E3PA 1OM1A 5A14A 2PK9A 4BCKA 3IDBA 4DA5A 4I5CA 4ITHA 4RX7A 3GC0A 1UV5A 2WB8A 3KMUA 1YWVA 1H4LA 4J95A 3V8SA 5HEZA 4IFGA 5BVDA 2BRHA 2GFSA 3FPMA 3MDYA 2GQRA 2QHNA 3ZFYA 4GK4A 4FKWA 4NK9A 5T68A 4E6AA 4TL0A 3R1YA 5HNIX 3AD5A 3ZXTA 3QQKA 4BVUA 5GJDA 5C8KA 4OT5A 4GKHA 4DBXA 3BLQA 5GIPE 4UMPA 2WD1A 3MH3A 4UEUA 3D83A 4HPUE 3AGMA 5M57A 1BI8A 1U4DA 3E62A 3Q9YA 1XBCA 3MV5A 4J53A 2HCKA 4FTKA 2WMUA 2X9EA 5DGZA 4IAIA 4EC8A 1ATPE 3HL7A 5E8XA 1F3MC 5KMOA 4G3FA 2BZJA 3IW5A 2X4ZA 3D9VA 2E9OA 4DT9A 2XNEA 3BHUA 3IONA 5CEKA 3BHHA 3ULIA 2BAJA 4MBJA 1M2RA 1YHVA 4KUJA 5K0XA 2X39A 3BHVA 3RK5A 4AOTA 4CTBA 2CNVA 2BRNA 3OXTA 4CKIA 4Z55A 5C03A 1ZYSA 5CNNA 4C4JA 3TJDA 2C6TA 3HV7A 1IG1A 4FKPA 2KULA 5CS6A 4HVHA 3DJ6A 4M3QA 1LPUA 3D14A 3JVRA 4IAKA 3D7ZA 3Q32A 4IIRA 5AP0A 3H10A 2F2UA 2B54A 1OKVA 4FNZA 1DI9A 3NR9A 4K9YA 4OTRA 2Z2WA 3T9TA 5DH3A 3UOJA 1ZY5A 4PL3A 5M08A 2XKFA 5JFSA 4G5PA 2VU3A 4CFXA 4LRMA 1MRYA 2FYSA 4RA5A 2OFVA 4FG7A 5IKWA 4RIOA 4CCUA 4QPSA 4I6FA 2QOQA 4IC8A 4CRSA 5EM6A 2JDSA 3C13A 4KS7A 4MXCA 4N6ZA 4Q9SA 4YBKA 4KINA 1JNKA 4GIHA 5A6NA 5BVNA 3D7TB 4FTTA 4GIIA 3WYYA 2PTKA 5DLSA 1B39A 4E26A 4KB8A 3UG1A 2XIYA 5J95A 3RAWA 5ICPA 2WTDA 1J3HA 1JVPP 4A4OA 4PY1A 5HVKA 4YTCA 2BTRA 3A8WA 3R7UA 3RPYA 3AOXA 3NGAA 4RPVA 2C1BA 4MD9E 4BDGA 4DG3E 2VV9A 4WUNA 2AUHA 4FR4A 4IWQA 4TTHB 4RWLA 1YQJA 4X7QA 4XLVA 3MYGA 2P2HA 4HYHA 1Y91A 3SXFA 3LCDA 1R0PA 4EC9A 4EH3A 1WBPA 5L6PA 2QQ7A 2QOKA 5HO8A 3DBCA 5M53A 2JIIA 5CSVA 3DFAA 3GI3A 3LOKA 4Y95A 3UBDA 4AGWA 4TWOA 4BCQA 3N4TA 5F95A 4JQEA 4MXXA 3C0HA 2BRBA 4PTGA 4QP6A 5LQFA 4CMUA 1LP4A 3BU3A 3Q53A 4N57A 3WILA 2O63A 4S34A 3LM5A 4FV3A 2NP8A 1YDRE 2DWBA 5IDNA 3JPVA 3W55A 1U5QA 3BQRA 3QLFA 5TT7A 4QMZA 3Q4ZA 2IN6A 1M14A 1X8BA 3MB6A 3MJ1A 4RLKA 3CCNA 3RPOA 2GMXA 3P5KA 3AT3A 2FH9A 2YM7A 4GK2A 3VHEA 4CT1A 4IEBA 4KIOA 1Z57A 3GFWA 4ZY4A 2QOCA 3HGKA 4CKRA 1KV2A 2ZV9A 5CEOA 5HU9A 5AM7A 5JSMA 2UZOA 4ZZMA 3W1FA 1J1BA 4H05A 4KRDA 3LPBA 1H1WA 5IISA 4EH2A 4IDVA 4R1VA 3VS3A 3PLAE 2PZIA 3R7GA 4UXLA 4BTFA 4IZYA 3C0GA 3LFCA 4NCTA 5AUZA 3EQGA 3FLQA 1H1PA 4I24A 4I6BA 3R00A 2QOOA 4B7TA 4CFNA 4XG9A 1OIRA 3B2TA 4BDFA 1NVRA 3D7TA 2H9VA 4C4EA 5ITAA 4FL1A 3O7LB 4EOQA 2X7FA 1H0VA 4ACDA 3PWYA 3QTRA 5LVOA 3CKWA 1SZMA 4AW2A 4PMMA 4G6LA 3LQ3A 3ZSIA 4QQTA 2QONA 2IW6A 4I0RA 1Q4LA 2WGJA 1PXJA 4Y85A 4FTUA 4RIXB 3QHRA 4C8BA 2IW9A 4FUXA 3D5UA 5AP3A 2GCDA 1WMKA 2VTAA 3FLWA 3WZEA 2PUNA 2WOUA 2WQBA 3AMAA 1LEZA 4PDPA 3EYGA 3PJ2A 4OTHA 4CNHA 4YU2A 4E5AX 3KRXA 1WBVA 5F9EA 3NUNA 2QNJA 2ZOQA 3MI9A 4ENXA 3PVBA 4PRJA 5EQEA 2CLXA 2YIQA 3ZDIA 2GDOA 4O7SA 1PXLA 3RZFA 1WBOA 2CMWA 5LJJA 4KSPA 5ETAA 1NXKA 5LVNA 3RCDA 2OKRA 2WMQA 2YDIA 5AJQA 3SD0A 2PMLX 4EOKA 2UZNA 4NKSA 4AF3A 4C37A 2EU9A 3CTQA 1PW2A 4PMSA 3ZEPA 2PULA 4XG6A 3EFJA 4Y72A 4ACMA 3P1AA 5J1VA 2P0CA 2JKMA 3GEQA 1H1RA 4M7IA 3ZLWA 4ORKA 4C2WA 2I0VA 2CDZA 2C6DA 1WBSA 3G33A 3S4QA 4OW8A 3BLHA 2HW6A 4BYJA 3V5JA 3UMWA 5IMXA 3FLZA 3LLAA 2UVZA 4NSTA 5DRDA 4IAAA 2B7AA 2WZJA 1AGWA 2OH0E 4MD7E 5EFQA 2W9FB 3HYHA 3U9CA 5LVMA 4OAVB 1A06A 3VUTA 1M2QA 4G9RA 4AX8A 3OWJA 2GQGA 3OFMA 3LXNA 3LIJA 2X8IA 3PJ3A 4AN3A 3IOKA 3AD4A 5I5ZA 2OGVA 3I60A 4ASXA 4BDJA 2ZB0A 4ZEGA 3B8QA 2UW9A 4IZAA 3KXMA 4IM2A 4JR3A 1YI6A 5HLWA 4HYSA 2VWIA 1UA2A 1YXUA 2XRUA 4XV2A 3FQHA 2QKWB 4YPSA 5M44A 4RIXA 2Z02A 5FXRA 4FMQA 3P79A 4IB5A 4WSQA 2UZDA 1YVJA 3LE6A 5EQPA 3BHTA 4EQMA 4GCJA 3ITZA 4XG3A 4O7ZA 4WUAA 4NT4A 1FGKA 3NIZA 4BCPA 4DGMA 4PMTA 4GT4A 1ZYLA 3KULB 1V1KA 4UWCA 3HMOA 2B0QA 4FSUA 1R3CA 5IH4A 5D9HA 5HORA 3QZIA 3TXOA 4FEWA 1PMUA 2YDKA 4IADA 2BHEA 2JIUA 3DTCA 3Q96A 5DEYA 4XLIA 4PNIA 3T8OA 5CALA 3MN3A 4ZSAA 4GU6A 2H6DA 4L46A 3OF0A 5CVFA 4G3GA 3C4WA 3LFBA 4RC2A 4FKOA 3NZ0A 4D2PA 4HVSA 5AA9A 4C3FA 4O7RA 3K54A 5ETIA 4MAOA 1ZRZA 1ZYCA 3M42A 5AP5A 3OCSA 4I21A 1H07A 3TZMA 4YC8A 4YNEA 5DI1A 2X0GA 2ITXA 2WMAA 3UNKA 4QT1A 4LOQA 4W4XA 4OGRA 3UC3A 4UMRA 5EM8A 3DPKA 4RVKA 4ZTLA 1G3NA 5EOLA 2ZV8A 3DDQA 4TWCA 1CMKE 5IU2A 5EK7A 4BCNA 1ZZ2A 3BRBA 3TZ7A 3TV6A 2Z7RA 3ORKA 4AG8A 4L44A 4MD8E 2F57A 4DEBA 3DZOA 2Y6MA 4D1ZA 3SLSA 4NH1A 5L8LA 3BYUA 5HX6A 3O0GA 1REJA 3DJ5A 4E8AA 3QWKA 2J51A 3NUSA 3V5LA 3B2WA 4F9CA 5AWMA 5CEIA 1CKIA 4FSRA 4ALVA 3FZSA 4L3LA 4NEUA 4L7FA 4MK0A 4YPDA 2QOFA 4ERKA 3I6UA 5CAPA 5JQ5A 4R7BA 3PXFA 4F1MA 3PFQA 4JI9A 5ETCA 5KUPA 5IQBA 4KABA 3KULA 3OD6X 4MXZA 4AXAA 3E88A 4IX6A 4QMLA 3ZBXA 3KN6A 5BYYA 3WBLA 4AUAA 3NNWA 4TXCA 5J5TA 1IA8A 4YZ9A 4QYEA 1ZOEA 2ETMA 1H00A 3A4OX 5ETFA 4DEIA 5HTBA 4FNXA 1XO2B 4BCIA 5E8ZA 4BIDA 4D2WA 3EQIA 5BPYA 4EWHA 3EL8A 3KMWA 2PU8A 1Q24A 5H8GA 5E7RA 3QZHA 4R3CA 4ERWA 1CDKA 2OIBA 4JX7A 3WF7A 1JSVA 2XNBA 2BRGA 2XK8A 3NSZA 3W8QA 4JJRA 5I3RA 5K3YA 3DBFA 3EN9A 4IM3A 5EYMA 5IQCA 2FA2A 2HELA 3QC4A 2RG6A 5HGIA 4B0GA 1Y8GA 5EOBA 2VO3A 3NW7A 1H26A 1QCFA 4QNAA 5LMBA 3ZO4A 1NT2A 1GZKA 4USFA 2GSFA 3AG9A 4NIFB 3FMEA 3BCEA 4LV5A 5I9VA 2XA4A 4K33A 3W2OA 3WYXA 2VAGA 2QC6A 5FD2A 5CX9A 3LVPA 3DK3A 4FIGA 3MTLA 4J99A 4O0UA 3RJCA 4DFZE 2BRMA 4K77A 3IO7A 2C1AA 4NUSA 4O27B 5K5XA 5GZ8A 4TPTA 4ZSJA 3RK9A 1OPKA 2IG7A 3F3TA 4S2ZA 4S31A 4D1XA 3ANRA 3IS5A 3FLYA 3MVLA 3KFAA 4ZSLA 5AUXA 4U45A 2IPXA 3I4BA 3E7OA 4HGEA 4YJUA 4QMYA 2XM9A 3KRLA 4QP1A 4H39A 3HX4A 4DH3A 3EN5A 1PXPA 4LOPA 2GNGA 3MPTA 3O96A 5AR2A 3UO6A 3RALA 4USEA 2JKQA 4IW0A 4F63A 3C51A 3F3ZA 4LG4A 4RBLA 4W8EA 2PUPA 5E9EA 3E7VA 3CJGA 3Q2MA 4L67A 4LMUA 4OUCA 2UW6A 3D2IA 3A8XA 2PZRA 1QPDA 1F5QA 4EJ7A 4EK8A 4KA3A 2CGUA 2P33A 4IVCA 3ZLSA 3GGFA 4R3RA 4AW0A 1R39A 3CY2A 3TUCA 3QQUA 4J98A 5FP6A 1IEPA 4BI1A 3BPRA 4HOKA 4FV0A 5GINE 4FIJA 3FI2A 4ZMEA 2W1GA 5CENA 3FXZA 3TT0A 1K2PA 3S00A 1KOAA 3UQGA 2XNGA 3I79A 5EW8A 5TOZA 4AA5A 4J96A 4I6HA 3AXWA 1OI9A 2WOTA 1MRVA 2JC6A 4NTSA 3DZQA 5LOHA 3HV4A 2VRXA 4XRLA 1DI8A 2JKOA 4FGBA 4CFVA 2HENA 1SM2A 3DT1A 4J8NA 4OBPA 4X2KA 2W1EA 2EB2A 4O1OA 3QD2B 3UZPA 3NAXA 3A60A 4DLJA 2IZTA 2CSNA 3O71A 4DEHA 5JRQA 3C1XA 1PYEA 2BIYA 2Y4IC 3RPSA 4BZDA 4YR8A 1OBDA 4JIKA 4RT7A 4O7LA 5K4IA 4CV9A 1B38A 3C4ZA 2IVUA 3KVXA 4UX9A 2Y7JA 2VTTA 3ORIA 2OU7A 1DM2A 3QUDA 3KL8A 3HMMA 4DAWA 3TKUA 1WFCA 4JXFA 4DF3A 2X81A 2RFDA 3D0EA 4AU8A 5FLFA 4ANLA 3E3BX 4Z7HA 3BV3A 3V5PA 4UV0A 5FWKK 4JR7A 4EOMA 3HMPA 4L42A 2UZVA 2WQEA 5CVHA 3WZJA 3HP2A 3WIKA 4N6YA 2Q83A 3CQEA 3CD8A 5ACBC 4GFOA 3OUKA 3HA6A 4NJ3A 2BROA 4D58A 4F6WA 2QCSA 3FMDA 4ZTRA 4I94A 4RVMA 4K8AA 3CGFA 4CXAA 3LMHA 2YABA 4D4VA 3SXRA 1XH6A 2I0HA 4BKYA 1FVTA 3PJ8A 5I3OA 2GU8A 2PVYA 1P14A 5T3QA 3TL8A 4DITA 2WMSA 3MBLA 4FOCA 2R3NA 3VW8A 1XWSA 2GHMA 3SV0A 4DHFA 2ERKA 4J52A 3UYSA 4BYIA 4C4FA 4WBBB 1ZYDA 2WTJA 3ORMA 3Q9ZA 5I9UA 3OUNB 3V5TA 4FV1A 2YERA 1FQ1B 2WQMA 3R2YA 5EM7A 1W98A 4FEQA 3R2BA 4GEOA 4NTTA 4D5HA 4DEGA 1MRUA 4YJTA 4GFMA 4ZZOA 4HZRA 2CKEA 5BMSA 3WF6A 3P4KA 4AZSA 1OIUA 4HJOA 4NYEA 5A4TA 3OBJA 5CT0A 5FBOA 3NDMA 4J8MA 5K0KA 4FIHA 4RJ3A 3ROCA 5DMZA 5IMEA 1E1XA 4FSWA 2CLQA 3FY2A 2OK1A 2XEZA 3F69A 5L3AA 2Z7SA 4O0VA 2LAVA 2RKUA 1KOBA 4L9IA 5ANOA 2BFXA 3GQIA 4YJVA 1IRKA 5HNBA 3SOCA 2ETRA 4LGHA 3FMMA 4FSMA 3ALOA 3DQWA 3HAMA 4RX8A 1TKIA 5M55A 4D9UA 5G1XA 5LVLA 5EM5A 3QRUA 4UWYA 1FMOE 2C0TA 2NRUA 1URCA 4D2RA 5L2TA 2R7IA 2QI8A 1YKRA 4RJ6A 4KBAA 3G51A 3BQCA 5ANKA 4XHKB 3NUAA 3ZM4A 5L2SA 4DEAA 2W5HA 2J50A 3DBQA 1CM8A 2J0KA 3FZOA 5HI2A 2PMIA 5GIOE 4QMTA 2UZUE 1T46A 5HESA 4BDAA 2W1CA 5FEDA 5AP7A 3SHEA 5JFWA 3ZRMA 2X7OA 3R8ZA 5E8SA 4CG8A 3KA0A 3K3JA 4EHEA 4YJSA 4LL5A 5I4NA 1WCCA 5CAVA 1KWPA 3QGWA 2UW7A 5IA0A 4BIEA 4JBPA 2W5AA 3ORZA 3KVWA 3FLNC 4TWPA 3FQSA 4L7SA 4P5QA 5EQYA 2YM4A 2J2IB 3DK7A 2W1FA 3MFTA 1A9UA 3DB8A 3R7YA 4OTFA 1DAYA 2IZSA 4USDA 3AC1A 4GRBA 5EH0A 3UTOA 4C57A 2PVRA 3SA0A 3IECA 3RVGA 5HO7A 2R3OA 4JVGA 2XRWA 4C59A 3NNXA 4HVIA 3FC1X 2JFLA 2BIKB 3CC6A 4QTAA 4YC6A 2XBJA 3N4VA 2VWVA 4NW6A 2FSTX 4DH8A 3BZ3A 3OG7A 2V22A 2BKKA 2Q0NA 4BTKA 3F7WA 3FHIA 3KEXA 3OROA 4ZTHA 3OEZA 4FZDB 1UWHA 4M0ZA 5CTPA 3UJGA 4KIKB 4AE9A 2GNFA 4QMQA 4AT5A 4BZOA 1HCLA 1W82A 2UZWE 4RSSA 4MNEB 3GOPA 3U87A 1PMEA 4JBQA 2XBAA 3O23A 1Q41A 4XRJA 3OMVA 1PXKA 3O2MA 4FTJA 4FZ6A 4XG4A 1RE8A 4WG4A 3RK7A 3PDTA 5L8JA 1CKJA 2PE2A 3OS3A 4IJ9A 4MWHA 1PKGA 3Q5ZA 4TN6A 4TYGA 5HD7A 5LMKA 2OF2A 2XKCA 3F2NA 3FV8A 2PVLA 1UNHA 3DDPA 1BKXA 2C69A 2YISA 5A3XA 2I0YA 4RVTA 4CZTA 3OCBA 3L9NA 3FXWA 3EQHA 5E8VA 3COKA 2XIRA 3FPQA 3VRZA 2XIZA 2YM5A 1OMWA 1DAWA 3NLBA 4Y5HA 4I4FA 5DR2A 5BMMA 5TR6A 4QPAA 2HOGA 2WMRA 4EH7A 5CT7A 1L3RE 1LUFA 3GXLA 4HYUA 3RAKA 4CEGA 4U3YA 4F64A 3QA0A 5KE0A 2JGZA 3TZ9A 3C9WA 5CSWA 2C0OA 3LMGA 5J9LA 4IVBA 4OT6A 4B4LA 4XEYA 4DEDA 2VX0A 3P23A 3QQHA 4C4IA 4OTWA 4BICA 4YUQA 5KBQA 3U54A 2HZIA 2XJ0A 3LXLA 5AADA 4FTAA 3G5DA 4LL0A 3GT8A 4Z9LA 4CMTA 2OICA 2WTCA 5CU6A 1RDQE 1QPEA 3R71A 5J87A 5HLPA 2VWUA 3C0IA 3FKNA 3Q9WA 3JY0A 5M51A 2XP2A 4BKZA 3LAUA 4M12A 2A2AA 3JYAA 2CGWA 4UMQA 1ZWSA 3RZBA 3QAME 3ZTXA 5E90A 4OBOA 4RWJA 3ET7A 4KIKA 3QD3A 2C0IA 1UU9A 3QU0A 4AGDA 2C47A 2NPQA 3PPZA 5E1EA 4X0MA 4YO6A 4BY9E 2GNJA 3FSKA 3Q6WA 1J7UA 3LXKA 4MNEA 5EDQA 4YTIA 5HKMA 3F5PA 5GZAA 3DA6A 4QMWA 3BEAA 3EQFA 3E8NA 4FTOA 4MBIA 4NU1A 4DG2E 4BTJA 3F2RA 4YMJA 4L52A 4BKJA 5HVYA 4QD6A 5L8KA 2Z8CA 4PL5A 2F49A 4O83A 1YDTE 5DOSA 1OGUA 2WQNA 4EL9A 2Y6OA 2WIPA 4YJNA 3RCJA 3U55A 4RFMA 4E1ZA 4KBCA 4U41A 3PXZA 5BVEA 4UXQA 4EH9A 4XYFA 5IEYA 2EWAA 2X7GA 4E93A 4BB4A 3OXZA 4D1SA 4EKLA 3NEWA 3BYOA 3LFQA 1BI7A 2PWLA 1KV1A 4QO9A 3LZBA 4IB1A 2IWIA 2WAJA 4XP2A 3LFFA 5AIKA 3JS2A 2CKQA 1YRPA 4C4GA 4L01A 4W9XA 2DYLA 3MPMA 4CQEA 3VS7A 4GW8A 2UW3A 3ENHA 4NM3A 2W5BA 3CBLA 2I1MA 3PJ1A 5M56A 3E8DA 3AC2A 1OB3A 2VO6A 3LCOA 1Y6AA 5GNKA 2YITA 3GB2A 3GOKA 3OT8A 3POOA 4IB3A 4XG7A 5IA1A 2FSLX 2OLCA 4NW5A 4O7VA 2OF4A 1H1SA 5CF4A 4R5YA 4O0TA 3ZC5A 4KKHA 3P86A 4FV6A 3SKCA 4XP3A 3W2QA 3BYMA 4QYHA 3QX4A 2EXMA 4FVQA 4PPCA 1JKSA 4P7EA 3ZC6A 2XZSA 3DXPA 5E8YA 5EW9A 2WNTA 1V0OA 2HYYA 3S1HA 3HLLA 4JQ8A 4I5HA 2QR8A 2XMYA 4FYOA 2OG8A 2HY81 4XCUA 5EI2A 3HAVA 4G6OA 5FEEA 4GH2A 1S9IA 4DH1A 4YURA 4MBLA 4G2FA 3CSVA 3KCFA 4MF0A 2XJ2A 2HAKA 3S0OA 4IH8A 3NUPA 4AOJA 3NW6A 3DTWA
chains in the Genus database with same CATH superfamily
3IDCA 4FSNA 1XR1A 1CKPA 2WTKC 2ERZE 2Y8OA 4RC4A 4DN5A 4EOLA 5M06A 2EXEA 3DNDA 4I93A 5EHOA 1UNGA 2ZM4A 4L45A 3O8TA 2LGCA 2R3HA 2PMOX 3MIYA 4YZBA 4CRLA 2FSOX 1OKZA 3FMHA 4PV0A 3VUMA 2UZBA 2WXVA 1Q8WA 3WF9A 3RM7A 4ZTSA 4FT0A 3PZEA 5G6VA 4GG5A 3T3UA 4TW9A 4EUUA 1Z9XA 3AD6A 1APME 2C3KA 3FMNA 3MH2A 3ZO2A 2PVMA 4G3EA 3TTJA 4GMYA 2ZM1A 2IO6A 4L68A 2ZV2A 4O21A 5HCYA 3SDJA 3QTXA 1XBAA 3TNHA 2ONLC 4FV9A 3K2LA 1Q97A 3FBVA 5ANJA 1J91A 1T45A 4K0YA 3CQWA 5HBHA 4R8QA 3R9NA 5D7AA 2PVNA 3WF5A 2HXQA 3CTJA 3MY0A 5FRIA 2G9XA 1TQMA 3FMLA 4A07A 1OVEA 4FT9A 2YZLA 3R73A 2EXCX 4BBFA 3JXWA 3MVJA 3GP0A 3HDMA 4IVDA 3DQXA 4JG8A 5JN2A 5KMJA 5HLNA 4X3FC 4Q9ZA 5AMNA 2B9JA 1YDSE 4DBNA 2BUJA 5AUWA 5FGKA 2G01A 1CTPE 2XUUA 3PTGA 3QRJA 4FG9A 1XH8A 2X8EA 4V04A 3NUYA 3ZU7A 2W4JA 4BDDA 4CSVA 2ITZA 1GOLA 2I40A 3G15A 5CLPA 4A9RA 4RG0A 4C38A 4O0WA 4S33A 4XG8A 3IG7A 2CGVA 3PXKA 3EN6A 2EVAA 5AAEA 3DLSA 3VBWA 3R1SA 2CPKE 3H9OA 2I0EA 2JIVA 3JY9A 2J6MA 3RPVA 1M17A 3KRJA 4I0TA 4ZLOA 4AP7A 4KRCA 3HMNA 5KKRC 4GSBA 3VULA 3PA5A 2ITPA 1OL2A 2Y4PA 2WMWA 3UZTA 1VJYA 2WO6A 5HG5A 1M2PA 4E6QA 4EKKA 3QYWA 5DR6A 5AIRA 3QTWA 3BU6A 2XANA 4DFXE 5HCZA 4ZP5A 5EKOA 1KE9A 4F0IA 3Q9XA 3VBXA 3P9JA 4CFWA 3KXZA 1SVGA 2R3RA 3Q4CA 3QWJA 1Q5KA 4Y5QA 4YJPA 2WMVA 2HZNA 1F0QA 5F20A 4FIIA 4FC0A 1MQBA 4LUEA 1IR3A 4NKAA 3ZLYA 4LYNA 4F9BA 4L3PA 3TUBA 1L8TA 4O82A 3JVSA 4E4LA 3UDSA 5D41A 2UW5A 2R2PA 4ZJJA 3PA3A 4EZ7A 4C4HA 3WARA 3V8TA 3R8VA 3COHA 3DCVA 5BX0A 1XHAA 3AGLA 3ZO1A 3VN9A 2Y9QA 4HVGA 5CXZA 3KXXA 1A48A 4BDKA 3FSFA 5BYZA 3OW4A 2HW7A 5HU3A 2YHVA 3D15A 3MGYA 4GVJA 5CVGA 4F99A 5J8IA 3IW8A 4FUYA 3PPJA 5AR4A 3KK8A 4MCVA 4M69B 4BZNA 1XMLA 1CSNA 4LDTA 2BZHB 1JPAA 2W05A 5C4LA 3EFLA 2RIOA 4A06A 1VEBA 2VWWA 1U59A 2XJ1A 3DAKA 4N4SA 4FV8A 4QYYA 4O6LA 4EH5A 3MS9A 4JDKA 4IACA 4LRJA 4WNPA 2X4FA 4XNEA 4AA4A 2XK6A 3GNIB 4IE9A 2G2IA 4GL9A 2W1DA 3NFFB 3VS6A 3EKNA 4P5ZA 3ZUUA 4GT5A 5CEPA 4GJ3A 4FZ7A 1H24A 2R0UA 3UC4A 4D2VA 5HE2A 3L8XA 4ZS0A 3CY3A 4WG5A 4CT2A 4TYIA 4BCOA 2VWXA 3HA8A 4BWKA 3A2CA 5BV3A 3LFSA 1SNXA 4EQUA 2XAMA 1JAMA 4M67A 1HCKA 1QL6A 1W8CA 4M66A 4ZTQA 4K1BA 3HUCA 3MA3A 5JT2A 2R0IA 2WMBA 3E92A 4FTCA 4G6NA 2NNWB 4BJJB 5CU2A 4IWPA 3LFEA 2VTMA 4JAJA 2QOHA 2E9NA 3L8PA 3MIAA 3R9OA 2ZV7A 4QEBA 3D4QA 2VWZA 5FM2A 3R83A 4ALUA 4L43A 3EQRA 4AAAA 2YJRA 3RBWA 5JZJA 1VR2A 4V01A 3THBA 4QP3A 4QMUA 3FZ1A 4YBJA 2UW4A 3UG2A 4JL9A 2XYNA 3W18A 5J7HA 2YACA 4HVDA 5KX8A 3KQ7A 4FEUA 5AR3A 3QUPA 2IEWA 4WNOA 1YXXA 3UIUA 4WG3A 2CCHA 3KCKA 2W0JA 2C3JA 4JQ7A 4OBQA 4D0XA 2XM8A 3R63A 3OWPA 4O22A 3M1SA 4XV3A 4Z3VA 1U5RA 1S9JA 1SNUA 2YCFA 4CKJA 3VNTA 4M69A 4CD0A 3EQCA 4RZWA 3ZONA 2RGPA 4FV5A 3BE9A 5IQFA 2EUFB 5FP5A 4AN9A 1H01A 2WHBA 2WU7A 3PWDA 4BI2A 4TRLA 4A7CA 4YJOA 4ZIMA 3NVKI 2W1HA 3KXHA 4CYJA 2X1NA 3II5A 3QCQA 4I5PA 3FI3A 3VS4A 5DA3A 2FO0A 3FHRA 3I0QA 3C4FA 3QQLA 4GYGA 4O4BB 5FM3A 3C50A 4IX3A 1KE5A 4A9UA 3BV2A 3CS9A 3PUFC 5JFVA 5KZIA 3CPBA 3HKOA 3ZDUA 5CY3A 5E91A 2BILB 3TIYA 3CKXA 4O86A 4BHZA 2X0QA 3P7AA 2G15A 3E5AA 4Y46A 5F1ZA 3WZDA 4AW1A 4DFYA 3NUUA 5BYLA 2REIA 4FL3A 4BJJA 3W2RA 4WIHA 1KSWA 3KMMA 2BHHA 3OZ6A 5CXHA 4YNOA 2CKOA 2R64A 1ERKA 2VWBA 1UU3A 3FC2A 4JT3A 5HIBA 4CMOA 3QL8A 4DFNA 5JK3A 4CVAA 2OJIA 3L9PA 2JD5A 5AAFA 4FT7A 3P7CA 4FZAB 3QKKA 3G0FA 2ZVAA 4LM5A 3ZRLA 1KUTA 1RQQA 3ZFXA 3PRFA 4WA9A 1Q62A 4RVLA 3R1QA 3LLTA 2OIQA 4JS8A 1VYZA 3ACJA 3QD0A 4QRCA 2O2UA 4K18A 2B9FA 4GVAA 1PHKA 4II5A 4PDSA 4GYIA 4TT7A 5AP4A 4AZTA 5CU3A 2Q0BA 3CQUA 3R28A 4NCTC 4RA4A 3UO5A 3MVMA 1Q3DA 4JBVA 5C9CA 3KU2A 4BDBA 3U4UA 4E20A 4D5KA 4DHIB 4A9SA 4NFNA 4W4VA 4ZJIA 4IDTA 4FGRA 4A4XA 4C3PA 2FVDA 4YSJA 5HIEA 5KMLA 3EN4A 3QQGA 2XNPA 4I4EA 2PVFA 2A4LA 3ANQA 3F66A 3JUHA 4FBXA 4NJDA 5EI6A 5FG8A 5HOAA 4EWQA 5J9ZA 3TCPA 4U9AA 4QYFA 2BDFA 3LFNA 5C8MA 3R01A 3VBVA 3FYKX 4ZSGA 2ETKA 2VTOA 2G2FA 5LWNA 5IDPA 4V0GB 4ZXTA 4F65A 3K5VA 3UDTA 1LR4A 4E6DA 2IVTA 2HWPA 4X21A 1O6KA 3Q60A 2ZMDA 4YSMA 1R78A 1SVEA 2GQSA 3SRVB 2PZYA 3V6RA 1BL7A 4UYAA 4AZWA 4R77A 4BCGA 3ATSA 2O65A 1WVWA 4FNWA 4EBWA 2PY3A 3G9NA 2C4GA 4BDEA 2A19B 1FVVA 2HY0A 2NRYA 3GC7A 4MKCA 4YZMA 3SXSA 5LCKA 4FKGA 1M52A 2UW8A 2X9FA 3DKCA 4ZSEA 3ERKA 2V62A 2VX3A 2R3QA 2XIKA 3AC4A 3OY1A 4AXDA 3PUPA 3G6GA 3KK9A 2E9UA 4FKLA 5JH6A 5I9ZA 3AQVA 3FZRA 4ZJVA 5KMNA 2QKRA 4IANA 4Q5HA 4CYIA 3I1AA 4ZTMA 4ACCA 3EHAA 4QNYA 5E4HA 4XOZA 2W1ZA 4C61A 5J79A 4O38A 4FT3A 4QMPA 3PSCA 4M84A 4MX9A 1SYKA 3VUGA 4RRVA 1Q8TA 3NRMA 4UY9A 1G8AA 3UVPA 4HGLA 4WHZA 5CAQA 5EI8A 3LM0A 4YJQA 3PP0A 1OL7A 4E6CA 3QXOA 4AZFA 1FOTA 4FVRA 3NX8A 4ONAA 2IZUA 3FKLA 1WBTA 2IW8A 3F9NA 5DNRA 3ZOSA 3VJOA 5AA8A 5IQGA 5FTOA 1FBNA 2F9GA 4UMUA 4O96A 4EQCA 4QTDA 4RIWB 5CF5A 4CV8A 4XBRA 4BDHA 1Q8UA 4R78A 3PIZA 5ANDA 4EH4A 2ZDUA 3KKVA 1OGYA 4FKQA 4WOVA 4RIYB 4AA0A 3MFSA 2DQ7X 1YI4A 3V6SA 1I09A 3VUKA 4F7SA 5CF6A 5JGAA 4PWNA 3MWUA 4QP7A 4EEVA 3ZSGA 4B6LA 5KO1A 5CSPA 3QF9A 4QTBA 4FODA 2OZOA 1PJKA 3V04A 4V0GA 5LCJA 4FZFB 3ZYAA 5AUYA 4LRKA 4IX5A 3GENA 4CZYB 4QQJA 4AGCA 4BI0A 5JRSA 4FV2A 2PUUA 4WT6A 3VQUA 2VTHA 3QQFA 5DHJA 2F4JA 3SRVA 2QR7A 2C30A 2OSCA 2BDWA 2RFEA 1NW1A 2OBJA 1UVRA 3EKKA 4MTAA 4FKTA 5HIDA 5IUHA 4IC7A 3W0MA 3I7BA 3VW6A 4PP9A 1REKA 2J7TA 4EJNA 2P55A 4R1YA 5AR7A 4YC3A 4M8TA 5CQWA 4CLJA 3BLRA 4MH7A 4G16A 5IUGA 2YDJA 2BR1A 5BUJA 3BE2A 3OCTA 4M0YA 4AZEA 5HE3A 2WQOA 4PDYA 1GZ8A 1NVQA 4G3CA 1GIHA 2HZ0A 4FKIA 3R8LA 2C3IB 4CG9A 1P4FA 3W32A 3FI8A 5M4UA 4BRXA 2WEIA 4CZUA 2QHMA 2CNUA 1ZARA 2AC3A 2YN8A 2W1IA 4XH6A 4ZS4A 4YP8A 3UMXA 1U54B 1YWNA 4D4RA 4BCMA 4IB0A 3NWWA 1OL1A 2WPAA 3WZUA 4C0TA 3C5IA 3TN8A 5KHXA 3OP5A 4HNFA 1OL6A 1JKTA 4RIWA 5C4KA 3UIBA 5EHLA 2XKEA 2UUEA 3R04A 4W9WA 2RFSA 3KGAA 4RIYA 3W0RA 4BCHA 2UZEA 2QOIA 4PQNA 1BUHA 2XIXA 4KWPA 5AM6A 4A4LA 4D55A 4Y8DA 3MH1A 1K3AA 5HE0A 2GS7A 2JAMA 2YAKA 1EH4A 1QMZA 4FYNA 4APCA 2VWYA 4E4XA 4ZK5A 2SRCA 3GC9A 2C6IA 4AN2A 3QCXA 4WNKA 1GY3A 4DGLC 3FUPA 3FYJX 4I6LA 4PPAA 3AMYA 1Q61A 3LJ0A 4U97A 2JDRA 3CXWA 3OEFX 3MTFA 5FTQA 4BBEA 4Y73A 4I23A 2A0CX 4IZ7A 4IAFA 3PIXA 4IVAA 2CJMA 3R21A 4P4CA 3UOLA 2CNQA 1WBNA 4GUEA 3TDVA 4O0RA 4IJPA 4HYIA 4P90A 4YO4A 4RJ5A 2QO2A 2OJFE 1NY3A 2WTIA 4ZTNA 5AUVA 2QOBA 4JNWA 4ALWA 1YI3A 2G2HA 5F94A 3P08A 2RSVA 4QYGA 3R8PA 1TQIA 3PY1A 4I3ZA 4FVPA 3CIKA 4I0SA 4LV8A 3BGZA 1HOWA 2ZMCA 3I5NA 2R3JA 2EB3A 2W4KA 4BBMA 3ORTA 3MESA 3L8VA 3QQJA 5GJFA 4C62A 4BHNA 3E8EA 2XVDA 3F3UA 3DK6A 1RJBA 3G6HA 3P0MA 2HWOA 3Q04A 4HZSA 4DFBA 1G5SA 1MQ4A 2B53A 2W7XA 3FY0A 3TV4A 2RF9A 3IW4A 4X2JA 5BVWA 3VHKA 3R9RA 5CI7A 5D10A 2CN5A 1V0BA 2C6OA 3NCGA 2BPMA 1Q8ZA 3AC3A 3IOPA 3VS5A 4Q2AA 3R7OA 1GZNA 3HRBA 2BTSA 1U54A 1YHWA 3HP5A 4IX4A 4L3JA 3WOWA 3VBTA 2VTIA 4DINA 4F0FA 5AEPA 5J7BA 4U0IA 3FZPA 3FXXA 2C5OA 5AUUA 4TYJA 4DCEA 3EZVA 2AYPA 3ZRKA 2OZAB 4FI1A 4YJRA 3GCQA 3GU4A 1R0EA 3QYZA 5A6OA 4FA2A 1OUYA 3MFRA 4PP7A 4PF4A 4QMMA 3R8UA 1H8FA 1I44A 4IXPA 4E3CA 1ZZLA 5CSHA 5KMKA 4YZCA 3KRRA 4O7WA 4RQKA 4UWBA 3DKFA 2ITWA 3PVWA 3MW1A 2PVJA 3W10A 3F61A 5HTCA 1ND4A 4JLCA 3VS2A 1GZOA 4FK3A 5EYKA 3GU7A 4ANOA 4RWIA 4TYEA 1ZY4A 2C5NA 3NPCA 1OBGA 3EMGA 5M07A 4K11A 4ZZNA 4MYGA 5C26A 3A7HA 2HZ4A 3I7CA 2OO8X 4B9DA 2YM3A 1KE6A 3W33A 4EUTA 4NZWB 4BFMA 1H28A 4IFCA 3TG1A 3TNPC 4LGGA 3BWFA 5HBJA 4ASEA 5FBNC 2X8DA 1OPJA 3IDPA 4W4YA 5DYJA 4D9TA 1GAGA 4TNDA 5HG9A 3G9LX 4BDIA 4FSTA 4EOJA 2QG7A 4C35A 5LVPA 1JKLA 3DJ7A 4OR5A 4BGQA 3C4XA 4TY1A 2PVHA 4JX3A 2P2IA 5AX9A 4EHGA 5KMMA 2ITQA 1Q99A 3TKIA 2V5QA 5LXMA 3G0EA 3KRWA 4RJ4A 3VBYA 3VF9A 5CASA 3PLSA 4AXEA 1PMNA 1YXSA 4TKSA 2GPHA 3RNYA 3ZCLA 5HTIA 4QMOA 4C7TA 4IWDA 1XH4A 3H4JA 4GJ2A 2YWPA 1URWA 4R7HA 3RAHA 5TO8A 3NYOA 3PG3A 4RC3A 2JBOA 4KKGA 4AT3A 4DG0E 2YWVA 3Q5IA 1U46A 3CP9A 2GTNA 3VJNA 4MNFA 4QTEA 5IG1A 1IAHA 4YHJA 4FE2A 3GCUA 4EI4A 5BNJA 3UP7A 3EWHA 4ARKA 4L8MA 3KF4A 3ZBFA 3ZZWA 2OH4A 4FSYA 3EZRA 2OZAA 5H9BA 1AD5A 1IASA 1P2AA 5JQ8A 1YHSA 2W17A 3COMA 2WELA 5J5SA 5CZIA 3WI6A 3U8WA 3R0TA 3WZKA 3R7EA 1V0PA 4F1TA 2BVAA 5IQDA 3Q4TA 4WD5A 3ZUTA 4JOAA 2GHGA 4RQVA 3DNEA 4L53A 4ASZA 2CN8A 4H36A 2OXDA 3FL4A 3QHWA 3ETAA 3F7ZA 2XK9A 5L6WL 4XMOA 3DKOA 1PKDA 4G31A 3RPRA 4JIAA 2V7OA 3V8WA 3LCKA 3LQ5A 4C02A 5LWMA 2J0LA 4KAOA 5AP6A 3W2PA 3UODA 5JEBA 5L4QA 2O5KA 3CEKA 3D5WA 5A9UA 4RJ7A 5K5NA 3V5QA 2QVSE 3U6JA 4G5JA 5BQ0A 4KKEA 1Z5MA 3KB7A 2VTRA 4GFGA 3SG9A 3KY2A 4GS6A 4OTDA 2DUVA 2FSMX 4QMSA 4J1RA 4D0WA 2W9ZB 4M68A 1PXMA 4ZAUA 2PMNX 1P4OA 3LHJA 3P78A 4I6QA 1E1VA 3BLAA 3QTSA 2YCRA 3QRTA 4XG2A 4BTMA 3HMIA 4QP2A 4YLLA 2XK3A 4HNIA 3DB6A 3E93A 2XS0A 4IBMA 2AC5A 4KIPA 4MHAA 3BI6A 3O8PA 4JRNA 2VTLA 3AC8A 1WVXA 4I92A 3FAAA 3UP2A 3ZSHA 1GNGA 4HW7A 2QU5A 4R5SA 5CF8A 2J9MA 1QPCA 2F7EE 3PG1A 5D11A 4XOYA 5AV2A 4UN0C 3R9DA 5DT4A 2RG5A 5B2KA 1YW2A 3PXQA 1H25A 2VNWA 4YTFA 3FKOA 5EG3A 2ZFYA 4Z16A 5HG8A 5CSXA 2X6EA 2YIYA 5DVRA 4D4YA 4H3BA 5E92A 2GTMA 4FICA 1NA7A 5IF1A 3K5UA 5BUIA 1W84A 1WZYA 3F82A 3L9MA 4UZHA 4U8ZA 3PVUA 1GJOA 5AR8A 3WF8A 4ZLZA 2B9HA 3NYNA 3SC1A 5HNGA 5FQDC 3BBTB 4BIBA 3UZRA 3ID6C 4YLKA 5H2UA 3K3IA 2ACXA 3W8LA 1STCE 3QBNA 4KNBA 3RGFA 4CCBA 2CKPA 2UZLA 1KE7A 2XB7A 3GU6A 5M09A 2HXLA 2J4ZA 3O7LD 4WKQA 4U44A 4F7JA 4FTIA 4AACA 2R3MA 4FF8A 2YAAA 4H3PA 3BBWA 4MF1A 5DIAA 1E9HA 2FUMA 4D2TA 1FGIA 2BFYA 4WRSA 2RL5A 4ITIA 3UNZA 5DFPA 3GVUA 4CGAA 3I5ZA 1VZOA 5DWRA 2ITOA 3ODZX 5KMIA 2NO3A 3AC5A 3C5UA 4EHZA 5M4IA 1PMVA 4BCFA 3TDWA 5I9WA 2IF8A 4LUDA 4F9WA 5LMAA 3A7IA 5E8TA 3L9LA 4U43A 3VUDA 4G34A 4WRGA 3QC9A 2OXYA 3PSBA 3EN7A 3OHTA 4ITJA 2JDTA 4Q5EA 3VIDA 3MA6A 2Z7QA 2YCQA 5EW3A 2J0JA 3NCZA 3ORNA 1JSTA 5HE1A 3ZO3A 2A27A 3DAEA 4HPTE 1XQZA 2PL0A 4HCTA 3TNQB 3DGKA 5B7VA 5F4NA 4U42A 2UW0A 4HGSA 2R7BA 3VS0A 3GCSA 3PVGA 4F6UA 3L8SA 4YLJA 2BDJA 2VGOA 4ANBA 4MVFA 5ACKA 5CAOA 3F6XA 5TF9A 4I1ZA 4JBOA 1H0WA 3H9RA 4EZ5A 2XEYA 3D5XA 3F3WA 4LQMA 3R9HA 3RI1A 1OIQA 5FEQA 2Z60A 1O6LA 4AWIA 3EQDA 1TQPA 3LFAA 3FJQE 3UE4A 5JKGA 3PE2A 3MSSA 5DR9A 4C36A 4EK5A 3FMJA 5E8WA 5IQAA 4B99A 4QP9A 3T3VA 4MEDA 4F4PA 4F70A 2Y4IB 3QCYA 4EZ3A 3JR1A 3QTQA 4FTLA 3QTIA 4H1JA 3F2AA 5J1WA 3PXRA 5CEQA 3V51A 4QP8A 2QO9A 4TNBA 5HZNA 4U80A 3W2SA 3CE3A 3LKMA 1FPUA 3VS1A 1YXTA 4JDHA 3GCPA 2YIRA 3OBGA 4K2RA 1ZMVA 4IHPA 4YTHA 3VVHA 2F7XE 4E5BA 4X2FA 2BZKB 2C6EA 2XNOA 2JITA 3BX5A 1FMKA 3R6XA 3H3CA 4I41A 4O4FA 3DBDA 4PX6A 2B55A 2WFYA 2I6LA 5EHYA 3VRYA 4DC2A 5GZ9A 5IA5A 2XCKA 5ANIA 5LMKC 4H1MA 5FUTA 5H8BA 4EOSA 3A7FA 4AAYA 4S30A 3ELJA 4DT8A 2CHLA 4U3ZA 1ZOGA 3NMUF 1W2CA 2QLQA 4QTCA 1DS5A 3EH9A 3SQQA 3U9NA 5HICA 4QMNA 2ITYA 3ORLA 5D1JA 5TKDA 4OTIA 4C2VA 4LFIA 5GJGA 2OXXA 4QPMA 2B4SB 4FTMA 4KD1A 1W0XC 4ZY6A 3VUIA 1H27A 1Y6BA 2FGIA 3EFWA 3HV3A 4FTQA 4HCVA 4FV4A 3TZ8A 3NYXA 2ZM3A 4I22A 5AV4A 3AT4A 4O6EA 3QZFA 3DLZA 4FTRA 4KSQA 4MQ2A 4AS0A 4DTBA 1M7NA 3EFKA 2OW3A 5BVFA 3O51A 2J90A 3AKKA 3BGPA 3UQFA 4C3RA 4S32A 3F3VA 1R1WA 4DTKA 2XYUA 3IW7A 1YOLA 2J5EA 3GC8A 4JAIA 4O91A 4ACHA 3R7VA 4F9YA 4KIQA 2PSQA 3DV3A 4N0SA 3C4CA 2UZTA 4XX9A 1KE8A 3LW0A 4B8MA 3CPCA 2PE1A 4UMTA 4PTCA 3DKGA 1OIYA 1RW8A 2WTVA 4MXYA 3N4UA 2Z7LA 1JBPE 4FK6A 3G2FA 3DBEA 4D28A 5CZHA 2YIWA 3GU8A 2OWBA 2IVVA 5DPVA 3SOAA 1W83A 3IK3A 4PDOA 1ZAOA 5CI6A 2F2CB 5HBEA 5T6KA 1ZYJA 2Y0AA 3IKAA 3BGQA 1PXOA 4O0YA 3WE8A 3M2WA 3QTUA 4RMZA 4WBOA 4LOOA 1K9AA 4EYMA 2R3PA 2QURA 3LCTA 1PF8A 2J0IA 1W2DA 3TNIA 3TM0A 3QLGA 4WNMA 3NNUA 3TI1A 4FOBA 2CGXA 3DU8A 4AT4A 4YZDA 5KNJA 3TV7A 3H0YA 2UVYA 3EQBA 4M14A 4GKIA 5FXQA 3KXGA 2OJ9A 3RAIA 2X2MA 2WEVA 4XS2A 3LJ2A 2DS1A 2XF0A 4BF2A 2JEDA 3W2CA 1JOWB 2GNHA 5ANGA 3LXPA 1JQHA 5HX8A 3EIDA 3PPKA 4DFLA 3ZM9A 3C4EA 4RFZA 1FINA 5DT0A 3R7IA 2BKZA 2R4BA 3NNVA 3A99A 3U51A 4EK3A 4DHJA 4DGGA 5A4EA 2ZB1A 4WO5A 5ANEA 2IVSA 4NM7A 4UZDA 3WE4A 4B8LA 2VTPA 3HRFA 4BCJA 4DEEA 2VTQA 4R6VA 1NVSA 5BVKA 2YA9A 3KF7A 4FSQA 1O6YA 1PRYA 3BU5A 4FL2A 3D5VA 5EDRA 4BWXA 4EBVA 4X3JA 1OKYA 3BKBA 5AUTA 3UIXA 2B52A 3EB0A 4E5WA 2GHLA 1TVOA 2PHKA 4APPA 5H3QA 1IAJA 3R8MA 3IQ7A 3N9XA 2YFXA 3T9IA 3EJ1A 4E7WA 2QOLA 5HHWA 3PYYA 5BVOA 4U7ZA 3FI4A 1M7QA 2ITNA 2W99B 1Q3WA 2ZAZA 2W4OA 4K6ZA 3C7QA 4ZY5A 2XCHA 3DXQA 3FDNA 2R3IA 4RZVA 1JLUE 5C1QB 3RWQA 3RWPA 5L2QA 3QGYA 1ZMWA 3ZUVA 3ROYA 1Y57A 1OPLA 3OCGA 4O81A 1OUKA 1MUOA 4BDCA 3I0OA 4BGHA 5IEXA 2R9SA 2OIDA 5AFVA 3PSDA 4ANMA 5D7VA 4IM0A 4OTQA 3U6HA 4G3DA 3NW5A 2OJGA 5I9YA 5KZ0A 3SX9A 4DGOA 5L2IA 2VTJA 2YLEA 2GS6A 5BUEA 3RHXA 4FIEA 4J97A 4QDEA 4H3QA 1WAKA 1VYWA 1ZXEA 2A1AB 4UB7A 3RTPA 3IW6A 5A4LA 5DG5A 4TYHB 4LV7A 3V5WA 3A62A 4EH6A 3O50A 4JG7A 3E63A 4YHTA 1QPJA 2OFUA 2VNYA 4RLLA 3U4WA 3DXNA 2R3LA 3QD4A 3S95A 2P3GX 2YM8A 3FE3A 3H0ZA 3TMOA 1J7IA 3PP1A 3LQ8A 1SMHA 4EOIA 2YIXA 3ENMA 4I5MA 5CU4A 3MJ2A 3ORPA 1J7LA 3NVMB 5FTGA 2CCIA 3LCSA 3FQEA 3Q2JA 3N51A 4WSYA 5M4FA 4PUZA 5AAGA 4O0XA 2B9IA 5C27A 3SW4A 5IA4A 4IMYA 3S2PA 1O9UA 3OY3A 4AGUA 4W8DA 4GU9A 1IA9A 4U5JA 1PY5A 5EYDA 3EOCA 4MXOA 4HGTA 3RINA 2VUWA 5CEMA 3AMBA 2VZ6A 2ITUA 2JFMA 3DY7A 3UVRA 5DBXA 4O7YA 4EOOA 2O64A 3V3VA 3VWAA 3EQPA 2QD9A 4F09A 4N70A 4O1PA 5EYCA 1XBBA 4GG7A 3UPXA 1PXIA 4AQKA 3KXNA 3QRKA 4QMVA 2B1PA 4DLIA 3RMFA 5FDPA 4C34A 5DEWA 3IPHA 4RWKA 4BC6A 4IQ6A 3RNIA 1BYGA 3BL7A 3UO4A 4DHZA 4BGGA 3HVCA 4XUFA 3BELA 4AQCA 2E2BA 3TJCA 4GUBA 3OW3A 3TEIA 2C5YA 2H34A 2JAVA 2PVKA 2XNNA 3PA4A 4F0GA 3VBQA 2V0DA 3TWJA 4JRVA 4J71A 5CQUA 3UQCA 4AW5A 4U79A 4X2GA 4JDJA 5HO6A 4OTPA 1YOJA 3UNJA 4EORA 4PNKA 4Y83A 4FKSA 1Y8YA 2O3PA 3G90X 4RJ8A 4ID7A 2E9VA 3A61A 4TYHA 5KCVA 4XJ0A 2ZYBA 4CFFA 2A98A 1YWRA 4MWIA 4OTGA 5CANA 1XMMA 3ATTA 2ITVA 3OWKA 2JDVA 4F7NA 3U6IA 3O5AA 3W0OA 3NUXA 5AX3A 4F9AA 3A4PA 3E64A 2QODA 4YZNA 4ZLYA 4DE4A 4JDIA 3A7GA 3HEGA 5A54A 4D2SA 4E4NA 3CR0A 4I20A 3SGCA 4RGJA 2IJMA 1OZ1A 4FTNA 1UKIA 3DS6A 1WBWA 4MQ1A 5A4CA 2GNIA 4DCAA 3TYKA 4TZRA 4FKJA 4HCUA 4QOXA 2PPQA 4C33A 2R3KA 2X2KA 5A4QA 4YHFA 2PUIA 1BMKA 3PRIA 2NYAA 2X2LA 3VC4A 5M4CA 1XKKA 1BLXA 5D12