1AQ5A

High-resolution solution nmr structure of the trimeric coiled-coil domain of chicken cartilage matrix protein, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
47
structure length
47
Chain Sequence
GSHMEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of a parallel homotrimeric coiled coil.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Coiled-coil
molecule keywords CARTILAGE MATRIX PROTEIN
total genus 14
structure length 47
sequence length 47
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.30 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1aq5A00
1AQ5A
chains in the Genus database with same CATH superfamily
5AW5B 1KB9D 2P10A 3ITKA 1JY2O 3AEBC 3G4SP 3HUSC 1L4AA 5APVA 4RJTA 4UB6H 1RF1C 1SQVD 2FXPA 2N9YB 4C7NA 1A02J 1YJWP 1L0ND 4H0LD 1USEA 3A0HE 3IFMA 3CXHD 4LC1A 3L73J 5KAIH 3V2PA 2ZXEB 3CL3D 1DIPA 1FZCA 1OX3A 1FZEA 2IYOA 1NTME 2C0WA 2DW3A 5DJUB 3L72E 3G6EP 4IFDK 2WPQA 2E74C 1PP9D 4RESB 1K73Q 3AEEC 2N1TB 2HPCB 1NU1G 3CXHH 3E1RA 3MHVA 1NTZG 1ZW0A 2Q7CA 1JCCA 2R3SA 1BE3J 4WWIA 3HTKA 3VMYA 5E79H 5AVWB 1M90Q 3UIAA 1NGMB 1VQ6P 1N7SA 2Q5UA 1ZR4A 2H89C 2OYIC 1IK7A 3L70D 2IBZD 5KLVD 4HKZH 4GDOA 5AW3B 2BCCE 4R4MA 3CCVP 3IF4A 1SQBJ 5CCHD 3D71A 4ASVA 1PFIA 1FZCC 1KZUB 1WT6A 3FWLA 4D6TD 2C9LY 2MKVA 3H1JE 1SQQE 1OW7A 2LXBA 3OW2O 4IFMA 2WSCJ 4EOTA 1GL2B 2HYNA 1PL5A 2K9YA 3SWKA 1ZXGA 1LJ2A 2E75C 2QM8A 2Z5HA 2FYUD 1EC5A 1PGPA 1RHZB 3CX5D 5H2FE 1EXJA 3Q5SA 2FBWC 2HG5D 3H1HD 3OA7A 2E76B 4PD4H 2YIUC 3GHGB 3CCSP 4WY4C 2E43A 2L5GB 2SPZA 2GA1A 1JNMA 1SQBG 1BCCJ 1NOHA 1IFPA 3CX5H 1QL2A 1SQPE 2P67A 3HUSB 1IJDB 3VP8A 4ZMDA 3Q3DA 1LTJA 1OW8A 1BE3G 3H1KE 4PJ0E 3C8VA 1OWAA 1G2CA 1LNQA 1RF0C 2HR3A 3G3ZA 3L71G 1EZVD 1HH0A 2BEZF 1NTMD 3CCRP 1PPJG 3VP9A 3V2NA 2XKMA 2NPSA 2ZAEB 1DEBA 3E1IA 5APQA 5APUA 2JWAA 4GOFA 1SQBK 1X22A 2N1TC 1HTLC 4NPDA 1VQ5P 1EXIA 3L75G 1LP1A 4HB1A 4JYBA 4TLFA 3QH9A 4WY4A 1RF1A 1NO4A 2HLOA 4I1LA 4BWNA 2WITA 4NPEA 1H89A 1URQA 4Y99C 5CBNA 3I56P 3CMEP 3HD7B 4K35A 5B66H 2WT7A 1KN7A 4YPCA 5APYA 1PP9J 1PIXA 5APTA 2LXCB 3AECC 2AXTH 2WSFJ 4JBZA 3TGUJ 1KTMA 3CX5E 3L36A 1KQSO 1DH3A 1NKNA 2ZYAA 3BCCD 1MZ9A 1KILC 3H1IJ 3H32B 3H1LG 2CPBA 2V7QH 4D6TG 3B4SA 1SFCA 3L73D 4PV1D 4W80A 1VF5D 2E75B 1FOSF 4PD4I 2IPPA 2D2CB 2ITAA 2A06D 1JM0A 5CMZA 1SQVG 1KD1Q 2R5BA 4H0LB 4HH2A 3U59A 1ZR2A 1BCCG 5AVTB 1L0LE 1NHLA 1SQPJ 4NPFX 2IFNA 2KNCA 2UWJE 3Q5RA 1GTWA 1SQPK 2WMMA 5KJ7A 1AQTA 1HF9A 4DZOA 1T8ZA 1LT9B 3RK3E 1NU1K 3TNUA 3LIDA 5KJ7C 2WTYA 1YHQP 1FDMA 3SFEC 1LTSC 3I55P 1DEEG 1FZFA 1AVYA 1RF1B 2VRSA 2PP6A 1ZP0C 2KS1B 2CPSA 2R32A 2K88A 2IBZG 1SP4A 2Y0CA 3B5NA 1T3UA 1L0NE 1KB9I 2JKVA 1GK6A 3H1JJ 4DCKA 3VMZA 4N6JA 1NTZE 1SQXJ 5KLIC 1S5LE 1LTIC 5GTHH 5KAFH 4DJGA 4EDFA 1ZMEC 2B89A 2IZ1A 2AXTE 3MTUE 1FC2C 1N86A 3MZWB 2YXRB 3AE9C 3C1LA 1OMIA 3CCLP 2YMKA 5GTHE 3TGUE 1KV4A 1GU4A 3H1IG 2D2CD 2PFXA 2QVAA 2RN0A 3KXDA 1AA0A 3O6QB 3BASA 2YKOA 2ZVNB 1J2JB 5B5EH 3CCEP 3EFFK 2FXOA 4H13C 1KILA 3CD6P 1L4AD 4QMAA 2FY8A 3B5NC 1NTKG 1EDLA 1SQBD 1SFCD 4GIFA 2BCCD 2RKLA 2WSEJ 1JY2P 1M1JB 2IFMA 1PGQA 3H1KJ 1T6AA 3M9BA 1YQ4C 1LTBC 1YTZI 2W6BA 1HUCA 2E76D 5AVVB 1BE3D 2KI7B 3AE6C 4M3LA 2KOGA 1BGYE 2QSIA 4XFJA 3TDKA 2ZJSE 2OTJP 3V2QA 2M0BA 2Q3EA 2M5AA 2KP8A 2GM4A 3GF7A 1WMKA 4KT0J 2G8YA 1VQ9P 1LTGC 1JEKA 1QVFO 2E5YA 3F89A 4KJMA 2A45I 2WSCH 2Y0EA 3A0HH 1SQXD 4UB8H 3F5HA 5AVSB 1J1DB 1IK9A 5KAIE 5GTIH 1T2KD 3HE5A 2YNYA 3KDPB 1M1JC 3QWOC 1VDFA 2O01H 3L74E 4IFFA 5KTBA 1L4AB 2QJYB 4EIJA 4YXDC 3RL0B 1M1KQ 5APWA 2RH0A 2WZ7A 3W67A 4I7ZB 1XTCC 2J58A 3A7OA 2CK3H 1RE4C 2XDJA 1J1EC 4YXWH 3RGUA 1N73C 2N1TD 2QRXA 1IFJA 2GUVA 2PAJA 4BRYA 2OYHB 4H44B 1FAVA 1YITP 1S5LX 3BATA 2K9JB 3H1LD 1GW4A 1NU1E 1P84H 1VF5C 3MGNA 3LIEA 2YMYA 3L74G 2B88A 5AW2B 3RBZA 2HPCA 2Q9IA 1W2BO 3N7NA 1GDTA 2YKPA 3B5ND 5AVRB 3L72D 3NFQA 4GOEA 3MP7B 2A06G 1FDOA 3HTKB 3R2PA 3AEDC 4N3YB 3L70E 4OH8B 1RE3C 1N2DC 1IO4A 1BCCD 2E42A 2ZYGA 1AQ5A 1P84I 1ZV8A 3H1KG 2ZXXA 3HRNA 1NTKJ 3GLMA 1SQQG 3HE4A 3RK3B 2B87B 1A02F 2Y0DA 5CJ4A 1M8OB 2FYUE 4U3FJ 1L0LG 3KPEA 5E79E 3V2RA 4B86A 2Y9ZA 4CPGA 3CWBD 3BRTB 5KAFE 5AW8B 1G1IA 4IOIH 1GL2C 3CXHE 3MIWA 3RK2C 1LWUA 2AEFA 2BCCJ 2FFDB 1MFZA 3MUDA 1PGOA 1NAFA 1VQLP 1JTHB 1N7SD 4GT1A 1NJIQ 1PZQA 2I1JA 1KFNA 3HD7D 3V4QA 2A45H 1GU5A 1BDCA 1QL1A 1URQC 3M9HA 5KJ7D 1FOSE 1U7MA 1NTZK 1IFIA 1CI6A 1NTZD 3JC22 5CHXA 3RL0C 2JJLA 1SQVK 5AW6B 1N8RQ 2M3EA 4DOJA 1H8AA 1T2KC 3D70A 1N7LA 4W7ZA 2WPRA 3L74J 2FYUK 3TSIA 2KK7A 3MD0A 1HJBA 1M57D 3M9QA 4YTPC 2NPSB 1JY3O 5CCGC 2XNXA 2WSSH 1TU3F 3R4YA 1NTKK 2E74B 3CC7P 1FZGA 3AE8C 3MUDC 1NTKD 4AQRD 1Y9BA 4IL6E 1LWUC 2RMZA 1FJKA 3FGAD 3LW5J 3KZIE 3VMXA 1EZVI 3H25A 1GD2E 3M0DA 3L71J 5AW1B 2LR2A 3L72J 1N7SC 2BASA 2Q3IA 1UIIA 2W83C 4IL6X 1KQFB 3CCJP 1K04A 5AVQB 4MN4C 5GTIE 1NTKE 2WT7B 1KQLA 5AW4B 3H1HE 5KLVK 2Y9YA 1Q90D 1USDA 1R5SA 2NPSD 2O3JA 2QJKB 4Y99B 2KB7P 1LT9C 3H1LJ 5L8RJ 2IYPA 1VQPP 1VF5B 3EWKA 1KORA 5BVZA 1HGZA 3H1LE 1FBMA 2H7HA 1GZLA 2WPSA 3L4FA 3L73E 1SLQA 2MJZA 3CLQA 3FX0A 3H32A 1RQVA 3EFGA 4I6MC 5TJHA 1VQ7P 1SFCB 3A2AA 1S4XA 4Z1MH 3M06A 4OGQC 3L71D 4H44D 3RK2B 1MV8A 4DT0A 1HWTC 4UB8E 1H0TA 3L35A 1Q82Q 3K5BA 1LTAC 3TK1A 3IN6A 5KLIB 1BGYD 3IAOA 1L0NK 3L75J 4WBAA 3RK3C 1Q7YQ 2KNCB 3WUTA 2IBZI 1RH5B 3H1IE 2O1JA 1GL2D 1HJ0A 2H88C 2Q6QA 3CWBE 2QG4A 2OYIA 1E5WA 1LT9A 1KMIZ 1YBKA 2I8DA 4PD4D 2J59M 3WUVA 1K05A 3LW5H 5CCHA 3JCUH 1RF0A 1FE6A 2QIWA 1KILD 1SFCC 1KC8Q 4ZNCA 1R8EA 3V6IA 4L73A 2M3BA 3VOPA 5AVZB 2GUSA 1ZN5A 1ZOYC 2KSEA 2KZJA 5M1BA 2KS1A 1KILE 3SWFA 1EZVE 5AVUB 1L0NG 1VQNP 5B5EE 3RL0D 1P84E 1OVUA 1FZAA 2XV5A 3H1KD 1SQQJ 1M56D 1RY3A 2OYOA 4L76A 4AYCA 4ZKPA 5AW0B 3L70J 3S1KA 5AVXB 2L91A 3H1JG 3M0AA 4K3AA 1Z56A 2QJPB 1EDJA 3P8MC 2W6AA 3D6YA 2W8ZA 1IC2A 1NU1D 4XA4A 2IDBA 2JP3A 1S9KE 4JPZB 3T97A 2NZ2A 2QJKC 1QEXA 2XZRA 1S3JA 2V4HA 1YIJP 1NVOA 3VMAA 1N73A 1MKMA 3AEFC 1J1DC 3O6QA 4JQ0D 3B71A 3USSA 4EI2A 1AJYA 1KILB 3H1HJ 1S2EA 3C9IA 3W68A 2YIUB 4LGDE 2HODA 1S9KD 4ASWA 3S4RA 2V7QJ 1DD4A 1M1JA 3D6ZA 2R44A 1JUNA 4OWFA 1SVFA 1M7LA 1BE3E 2E74D 2OTKE 2M8RA 2R3CA 1OVVA 3M91A 1X8YA 1ZLLA 4PV1B 1NKZB 2KSJA 2B9BA 3AE3C 1AV1A 1NTZJ 1SQXE 4C7NB 3WUUA 1NU1J 1KYOI 2P1JA 3AE5C 2M5AB 4PJ0H 2H8PD 5EFWB 2QEXP 2O01N 3H1HG 3OJAB 1QLED 5KKZC 2NRGA 1X79B 1FZCB 2KLUA 4D6TJ 2PGDA 3L37A 3OAKA 1QX8A 3V4WA 2KUBA 2BEQD 3TGUG 1AVOA 2W90A 2WWWA 2LKMA 3CXHI 1L2PA 3SSUA 1L0LK 1VL2A 2N1TA 4N78D 4U3FD 1IFMA 3H6PA 2FXMA 2OQQA 1PGJA 2I1KA 4OVNF 1G1JA 4C7RA 2K3RA 3II6A 2WSFH 4PV1C 3H1ID 5CJ0A 1LTTC 4RKUJ 5H2FH 1VQMP 3G71P 4IL6H 1N7SB 3WU2E 1SS1A 1L4AC 2POHA 1Q2NA 2QJYC 2Z5IA 4OGQD 4LLHA 3S9OA 1FJPA 3SWYA 1K9MQ 2BCCG 4BRYB 1BSNA 1YTZT 2G3AA 4WY4D 5AW7B 2OYHA 1RE4A 3NXSA 2K9JA 2R5DA 2E75D 2FYUJ 3BCCE 2WQYC 4N78E 2ZT9C 3L75D 1MFTA 4U3FE 3RL0g 3RBXA 1GL2A 3CCUP 1JO5A 4EYYQ 3TF5A 1L0LJ 1NH4A 1IFNA 1LGHB 1JY3P 2YXQB 1X9VA 5CCGA 3CC4P 5DJTB 2P58A 4H13B 4C46A 4OGQB 1EDKA 3AE1C 2YO2A 1FZBA 4GODA 4O9BA 2KLVA 3U1CA 2KYVA 4H0LC 3GHGA 4I7ZC 1JOCA 4WB4A 1SQXG 2O1KA 4ZKUA 3SFDC 1SQPD 1U57A 3BCCG 2K37A 2WSEH 2WVRA 1SQBE 3HE4B 2Q1KA 4R4LA 2B87A 4TT3H 2JEEA 3HUSA 3VN0A 4H44C 1QVGO 1OFCX 1LTJB 1DD3A 4Y28J 2JO1A 2ZT9B 4JYCA 1G2CB 1NYHA 4I2LC 2JWDA 5B66E 2XNDH 3CPWO 2H43A 4H13D 1U7JA 4L74A 1BDDA 1FS0E 3L71E 1EDIA 4UB6E 2W27A 1CSBA 1LWUB 2ZT9D 3VYIA 1JY2N 2FFDA 4JF7A 2ZFCA 3GW6A 1JTHA 4AUWA 3FXDA 1IZNB 3H1JD 4KHXA 2IX7C 5KLVG 3PRJA 5AW9B 1JY3N 1LP1B 3GHGC 2P7JA 3L74D 1UIXA 1CI6B 3HD7C 4RO0A 4WY4B 4BXLA 2FKWB 3PHLA 3Q5PA 1OW6A 3P7KA 1URQB 1JCDA 3L72G 2WPVB 3N4XA 1NAYA 2P2UA 1YJ9P 3PTZA 1RQUA 2KZIA 1MUUA 3HD7A 5BU8B 5KKZB 3CCMP 3Q1MA 2JR8A 1JMBA 3EQ2A 1FU1A 1GK4A 1LT1A 1E79H 3JSVC 4U7JA 1T3JA 1SQQK 3CC2P 1SQQD 2FFDC 1IFDA 3PP5A 2QA4P 2HFED 5K5GB 1PP9G 1BSHA 1VPCA 3CI9A 2OGUA 4PD4E 3A3YB 1Q86Q 1GMJA 1L0LD 3I5CA 5APXA 3CWBG 1RE3A 3FWNA 1W2EA 2FYZA 3CWBJ 4W7YA 3KZIH 1VQOP 5TISH 1KFMA 1P84D 2A06E 1AFOA 3NTNA 3PJSK 1SQVE 3L70G 2IZ0A 4A7PA 1VQ4P 3RK2D 3CMAP 3A0BH 1OVRA 1URQD 3NMDA 3U1AA 1Q81Q 3V5BA 1R5LA 1L0NJ 1W5CE 1PP9E 2NPSC 1S1CX 2O01J 5CCHC 2PRRA 3TGUD 2QM7A 3RK3D 1Y47A 3TNUB 1BGYJ 2FYNB 3B8EB 3GG2A 4U3FG 1S5LH 3CCQP 3M0DC 5CBOA 1GW3A 1WRGA 2FYUG 2QE7H 1H88A 2A45G 1ZRTD 1CW5A 3P32A 1X0TA 1YI2P 4D6TE 3JCUE 2K1AA 2ZYDA 5CCGD 1JB0J 1H0TB 1YJNP 3B5NB 1HVVA 2D2CC 1OZHA 2QJPC 3AEGC 1HBWA 1KB9E 2IBZE 5KLVE 2YO3A 2OYIB 3TYYA 2KXPB 5AVYB 2Z4EA 2E5TA 4XE5B 3WMM0 1ZRTE 3G9RA 5KLVJ 1KYOE 3ZDMA 3A0BE 3WU2H 1JMMA 1BCCE 1NTMJ 1CZQA 2AEMA 4WVZA 1KYOH 3E7KA 3PLNA 2ZVOB 4GKGA 1EZVG 3ABVC 2JDIH 1NTMG 4L75A 1VQKP 1OXZA 1PPJD 1PV3A 3P8CE 3BVHA 1DX7A 3AE7C 1K8AQ 3PH0A 1YQ3C 1SQXK 3BCCJ 2C9NY 2YKQA 1OIPA 1Y8AA 3KHUA 5C39A 1KYOD 1SQPG 2E76C 2W6JH 1XTGB 2N9BA 3FXEA 1YYCA 3KQGA 3KYQA 4HJGH 2OTLP 2KIKA 2AEJA 3VTPC 4HYTB 3AE2C 1SQVJ 5APSA 5BU5A 1HGVA 2C0XA 3T97B 1KQGB 1PPJE 1NTMK 3P8CD 2J5UA 3O8ZA 1FDIA 2AXCA 1LTJC 3AEAC 1KB9H 1BGYG 1J1EB 3IR9A 1S72P 1N73B 1VQ8P 1EQ7A 3GF3A 1D7MA 3BRVB 1NWQA 2OYHC 3CX5I 3L75E 3A5TA 1QGKB 2HODB 3AE4C 2FYNC 3GMAA 2XU6A 5TISE 3HE5B 2OARA 3L73G 3Q2YA
chains in the Genus database with same CATH topology
5AW5B 1JY2O 3HUSC 1L4AA 5APVA 1RF1C 4C7NA 1A02J 3IFMA 4LC1A 3V2PA 2ZXEB 3CL3D 1FZCA 1FZEA 2C0WA 4IFDK 2WPQA 4RESB 2N1TB 2HPCB 2Q7CA 1JCCA 3HTKA 3VMYA 5AVWB 3UIAA 1N7SA 2Q5UA 1ZR4A 2OYIC 5AW3B 5CCHD 1PFIA 1FZCC 1KZUB 1WT6A 2C9LY 4IFMA 4EOTA 1GL2B 2HYNA 2QM8A 2Z5HA 2HG5D 3OA7A 3GHGB 4WY4C 2E43A 2L5GB 1JNMA 1NOHA 1QL2A 3HUSB 2P67A 3VP8A 1IJDB 1LTJA 1OWAA 1G2CA 1RF0C 3G3ZA 1HH0A 3VP9A 3V2NA 2XKMA 2NPSA 1DEBA 3E1IA 5APQA 5APUA 1SQBK 2N1TC 1HTLC 1RF1A 4JYBA 4WY4A 1NO4A 2HLOA 4I1LA 2WITA 1H89A 1URQA 4Y99C 3HD7B 2WT7A 5APYA 5APTA 3L36A 1DH3A 1NKNA 1MZ9A 1KILC 3H32B 2CPBA 1SFCA 4W80A 2IPPA 5CMZA 2R5BA 4HH2A 3U59A 5AVTB 1NHLA 1GTWA 2IFNA 1SQPK 5KJ7A 4DZOA 1T8ZA 1LT9B 1NU1K 3TNUA 3LIDA 5KJ7C 2WTYA 1FDMA 1LTSC 2VRSA 2PP6A 2CPSA 2R32A 3B5NA 3NTNA 1SP4A 1ZR2A 1T3UA 1GK6A 3VMZA 4N6JA 1LTIC 3MTUE 1N86A 1GU4A 3BASA 2YKOA 1J2JB 1KILA 1L4AD 3B5NC 1SFCD 4GIFA 3M9BA 1JY2P 1M1JB 2IFMA 1LTBC 1YTZI 2W6BA 1HUCA 5AVVB 4M3LA 2KOGA 3V2QA 2KP8A 2GM4A 1LTGC 4DOJA 2A45I 2WSCH 5AVSB 1J1DB 1IK9A 1T2KD 3HE5A 2YNYA 3KDPB 1M1JC 1VDFA 2O01H 5KTBA 4IFFA 1L4AB 4EIJA 3RL0B 5APWA 2WZ7A 1XTCC 2J58A 3A7OA 1RE4C 2XDJA 1J1EC 1N73C 2N1TD 1IFJA 2GUVA 2PAJA 2OYHB 1FAVA 3BATA 1GW4A 3MGNA 3LIEA 2YMYA 2Q9IA 5AW2B 2HPCA 3N7NA 1GDTA 2YKPA 3B5ND 5AVRB 3NFQA 3R2PA 3HTKB 4N3YB 4OH8B 1RE3C 1N2DC 1IO4A 2E42A 1ZV8A 3HRNA 3HE4A 3RK3B 1A02F 5CJ4A 3KPEA 3V2RA 3BRTB 5AW8B 1G1IA 1GL2C 3MIWA 3RK2C 1LWUA 2FFDB 1MFZA 3MUDA 1NAFA 1JTHB 1N7SD 4GT1A 3HD7D 2I1JA 1KFNA 3V4QA 2A45H 1GU5A 1QL1A 1URQC 3M9HA 5KJ7D 1FOSE 1NTZK 1IFIA 1CI6A 5CHXA 3RL0C 2JJLA 1SQVK 5AW6B 1H8AA 1T2KC 1N7LA 4W7ZA 2WPRA 2FYUK 3TSIA 3MD0A 1HJBA 3M9QA 5CCGC 2NPSB 1JY3O 2XNXA 1NTKK 1FZGA 4AQRD 1LWUC 1FJKA 3VMXA 1GD2E 3M0DA 5AW1B 1N7SC 2BASA 2Q3IA 5AVQB 2WT7B 1KQLA 5AW4B 5KLVK 2NPSD 4Y99B 2KB7P 1LT9C 5BVZA 1HGZA 2H7HA 1FBMA 1GZLA 2WPSA 3L4FA 1SLQA 2MJZA 3CLQA 3H32A 4I6MC 3EFGA 1SFCB 3A2AA 3M06A 3RK2B 1MV8A 1HWTC 3L35A 1LTAC 3TK1A 3RK3C 1L0NK 4WBAA 2O1JA 1GL2D 2OYIA 1E5WA 1LT9A 2J59M 5CCHA 3LW5H 1RF0A 1KILD 1SFCC 3VOPA 2M3BA 5AVZB 2GUSA 1ZN5A 3SWFA 5AVUB 3RL0D 1FZAA 2XV5A 1RY3A 4AYCA 4ZKPA 5AW0B 5AVXB 3M0AA 1Z56A 3P8MC 2W6AA 1IC2A 4XA4A 1S9KE 3T97A 2XZRA 1N73A 1J1DC 1KILB 3C9IA 4LGDE 1S9KD 2HODA 1M1JA 1JUNA 1SVFA 1M7LA 3M91A 2R3CA 2M8RA 1X8YA 1ZLLA 1NKZB 2KSJA 4C7NB 2P1JA 2H8PD 3OJAB 1X79B 1FZCB 3L37A 3OAKA 3V4WA 2WWWA 2LKMA 1L0LK 2N1TA 4N78D 3H6PA 1IFMA 2FXMA 2I1KA 1G1JA 4C7RA 3II6A 5CJ0A 2WSFH 1LTTC 1N7SB 1L4AC 2POHA 2Z5IA 4LLHA 1FJPA 3SWYA 1YTZT 2OYHA 4WY4D 5AW7B 1RE4A 3NXSA 2R5DA 4N78E 1FZFA 1JO5A 1GL2A 1NH4A 1IFNA 1LGHB 1JY3P 5CCGA 1X9VA 4C46A 3U1CA 4O9BA 2YO2A 1FZBA 2KLVA 2KYVA 3GHGA 1JOCA 4WB4A 2O1KA 4ZKUA 1FOSF 3RK2D 3HE4B 2WSEH 3VN0A 2JEEA 3HUSA 1LTJB 4JYCA 1G2CB 4I2LC 2H43A 2W27A 1CSBA 1LWUB 3VYIA 1JY2N 2FFDA 4JF7A 2ZFCA 1JTHA 4AUWA 4KHXA 2IX7C 5AW9B 1JY3N 3GHGC 1RF1B 2P7JA 4WY4B 3HD7C 1CI6B 1AQ5A 2FKWB 3P7KA 1URQB 1JCDA 3N4XA 2P2UA 5BU8B 1MUUA 3HD7A 3EQ2A 1FU1A 1GK4A 1T3JA 1SQQK 2FFDC 1IFDA 3PP5A 2HFED 1VPCA 3CI9A 3A3YB 3I5CA 5APXA 4W7YA 1RE3A 1W2EA 2FYZA 1KFMA 1AFOA 1URQD 3NMDA 3U1AA 3V5BA 5CCHC 2NPSC 2QM7A 3RK3D 3TNUB 3B8EB 3M0DC 1GW3A 1WRGA 1H88A 1CW5A 2A45G 3P32A 5CCGD 3B5NB 1HVVA 1HBWA 2YO3A 2OYIB 3TYYA 5AVYB 2Z4EA 4XE5B 3WMM0 1JMMA 1CZQA 4GKGA 1OXZA 3P8CE 1DX7A 3BVHA 1SQXK 2C9NY 2YKQA 3KQGA 1XTGB 2N9BA 1YYCA 3KYQA 3VTPC 4HYTB 5APSA 5BU5A 1HGVA 2C0XA 3P8CD 4B86A 1NTMK 3O8ZA 3IR9A 1LTJC 1J1EB 1N73B 1EQ7A 1NWQA 3BRVB 2OYHC 3A5TA 2HODB 2XU6A 3HE5B 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQ5 A; 
#chains in the Genus database with same CATH topology
 5AW5 B;  1KB9 D;  2P10 A;  3ITK A;  1JY2 O;  3AEB C;  3G4S P;  3HUS C;  1L4A A;  5APV A;  4RJT A;  4UB6 H;  1RF1 C;  1SQV D;  2FXP A;  2N9Y B;  4C7N A;  1A02 J;  1YJW P;  1L0N D;  4H0L D;  1USE A;  3A0H E;  3IFM A;  3CXH D;  4LC1 A;  3L73 J;  5KAI H;  3V2P A;  2ZXE B;  3CL3 D;  1DIP A;  1FZC A;  1OX3 A;  1FZE A;  2IYO A;  1NTM E;  2C0W A;  2DW3 A;  5DJU B;  3L72 E;  3G6E P;  4IFD K;  2WPQ A;  2E74 C;  1PP9 D;  4RES B;  1K73 Q;  3AEE C;  2N1T B;  2HPC B;  1NU1 G;  3CXH H;  3E1R A;  3MHV A;  1NTZ G;  1ZW0 A;  2Q7C A;  1JCC A;  2R3S A;  1BE3 J;  4WWI A;  3HTK A;  3VMY A;  5E79 H;  5AVW B;  1M90 Q;  3UIA A;  1NGM B;  1VQ6 P;  1N7S A;  2Q5U A;  1ZR4 A;  2H89 C;  2OYI C;  1IK7 A;  3L70 D;  2IBZ D;  5KLV D;  4HKZ H;  4GDO A;  5AW3 B;  2BCC E;  4R4M A;  3CCV P;  3IF4 A;  1SQB J;  5CCH D;  3D71 A;  4ASV A;  1PFI A;  1FZC C;  1KZU B;  1WT6 A;  3FWL A;  4D6T D;  2C9L Y;  2MKV A;  3H1J E;  1SQQ E;  1OW7 A;  2LXB A;  3OW2 O;  4IFM A;  2WSC J;  4EOT A;  1GL2 B;  2HYN A;  1PL5 A;  2K9Y A;  3SWK A;  1ZXG A;  1LJ2 A;  2E75 C;  2QM8 A;  2Z5H A;  2FYU D;  1EC5 A;  1PGP A;  1RHZ B;  3CX5 D;  5H2F E;  1EXJ A;  3Q5S A;  2FBW C;  2HG5 D;  3H1H D;  3OA7 A;  2E76 B;  4PD4 H;  2YIU C;  3GHG B;  3CCS P;  4WY4 C;  2E43 A;  2L5G B;  2SPZ A;  2GA1 A;  1JNM A;  1SQB G;  1BCC J;  1NOH A;  1IFP A;  3CX5 H;  1QL2 A;  1SQP E;  2P67 A;  3HUS B;  1IJD B;  3VP8 A;  4ZMD A;  3Q3D A;  1LTJ A;  1OW8 A;  1BE3 G;  3H1K E;  4PJ0 E;  3C8V A;  1OWA A;  1G2C A;  1LNQ A;  1RF0 C;  2HR3 A;  3G3Z A;  3L71 G;  1EZV D;  1HH0 A;  2BEZ F;  1NTM D;  3CCR P;  1PPJ G;  3VP9 A;  3V2N A;  2XKM A;  2NPS A;  2ZAE B;  1DEB A;  3E1I A;  5APQ A;  5APU A;  2JWA A;  4GOF A;  1SQB K;  1X22 A;  2N1T C;  1HTL C;  4NPD A;  1VQ5 P;  1EXI A;  3L75 G;  1LP1 A;  4HB1 A;  4JYB A;  4TLF A;  3QH9 A;  4WY4 A;  1RF1 A;  1NO4 A;  2HLO A;  4I1L A;  4BWN A;  2WIT A;  4NPE A;  1H89 A;  1URQ A;  4Y99 C;  5CBN A;  3I56 P;  3CME P;  3HD7 B;  4K35 A;  5B66 H;  2WT7 A;  1KN7 A;  4YPC A;  5APY A;  1PP9 J;  1PIX A;  5APT A;  2LXC B;  3AEC C;  2AXT H;  2WSF J;  4JBZ A;  3TGU J;  1KTM A;  3CX5 E;  3L36 A;  1KQS O;  1DH3 A;  1NKN A;  2ZYA A;  3BCC D;  1MZ9 A;  1KIL C;  3H1I J;  3H32 B;  3H1L G;  2CPB A;  2V7Q H;  4D6T G;  3B4S A;  1SFC A;  3L73 D;  4PV1 D;  4W80 A;  1VF5 D;  2E75 B;  1FOS F;  4PD4 I;  2IPP A;  2D2C B;  2ITA A;  2A06 D;  1JM0 A;  5CMZ A;  1SQV G;  1KD1 Q;  2R5B A;  4H0L B;  4HH2 A;  3U59 A;  1ZR2 A;  1BCC G;  5AVT B;  1L0L E;  1NHL A;  1SQP J;  4NPF X;  2IFN A;  2KNC A;  2UWJ E;  3Q5R A;  1GTW A;  1SQP K;  2WMM A;  5KJ7 A;  1AQT A;  1HF9 A;  4DZO A;  1T8Z A;  1LT9 B;  3RK3 E;  1NU1 K;  3TNU A;  3LID A;  5KJ7 C;  2WTY A;  1YHQ P;  1FDM A;  3SFE C;  1LTS C;  3I55 P;  1DEE G;  1FZF A;  1AVY A;  1RF1 B;  2VRS A;  2PP6 A;  1ZP0 C;  2KS1 B;  2CPS A;  2R32 A;  2K88 A;  2IBZ G;  1SP4 A;  2Y0C A;  3B5N A;  1T3U A;  1L0N E;  1KB9 I;  2JKV A;  1GK6 A;  3H1J J;  4DCK A;  3VMZ A;  4N6J A;  1NTZ E;  1SQX J;  5KLI C;  1S5L E;  1LTI C;  5GTH H;  5KAF H;  4DJG A;  4EDF A;  1ZME C;  2B89 A;  2IZ1 A;  2AXT E;  3MTU E;  1FC2 C;  1N86 A;  3MZW B;  2YXR B;  3AE9 C;  3C1L A;  1OMI A;  3CCL P;  2YMK A;  5GTH E;  3TGU E;  1KV4 A;  1GU4 A;  3H1I G;  2D2C D;  2PFX A;  2QVA A;  2RN0 A;  3KXD A;  1AA0 A;  3O6Q B;  3BAS A;  2YKO A;  2ZVN B;  1J2J B;  5B5E H;  3CCE P;  3EFF K;  2FXO A;  4H13 C;  1KIL A;  3CD6 P;  1L4A D;  4QMA A;  2FY8 A;  3B5N C;  1NTK G;  1EDL A;  1SQB D;  1SFC D;  4GIF A;  2BCC D;  2RKL A;  2WSE J;  1JY2 P;  1M1J B;  2IFM A;  1PGQ A;  3H1K J;  1T6A A;  3M9B A;  1YQ4 C;  1LTB C;  1YTZ I;  2W6B A;  1HUC A;  2E76 D;  5AVV B;  1BE3 D;  2KI7 B;  3AE6 C;  4M3L A;  2KOG A;  1BGY E;  2QSI A;  4XFJ A;  3TDK A;  2ZJS E;  2OTJ P;  3V2Q A;  2M0B A;  2Q3E A;  2M5A A;  2KP8 A;  2GM4 A;  3GF7 A;  1WMK A;  4KT0 J;  2G8Y A;  1VQ9 P;  1LTG C;  1JEK A;  1QVF O;  2E5Y A;  3F89 A;  4KJM A;  2A45 I;  2WSC H;  2Y0E A;  3A0H H;  1SQX D;  4UB8 H;  3F5H A;  5AVS B;  1J1D B;  1IK9 A;  5KAI E;  5GTI H;  1T2K D;  3HE5 A;  2YNY A;  3KDP B;  1M1J C;  3QWO C;  1VDF A;  2O01 H;  3L74 E;  4IFF A;  5KTB A;  1L4A B;  2QJY B;  4EIJ A;  4YXD C;  3RL0 B;  1M1K Q;  5APW A;  2RH0 A;  2WZ7 A;  3W67 A;  4I7Z B;  1XTC C;  2J58 A;  3A7O A;  2CK3 H;  1RE4 C;  2XDJ A;  1J1E C;  4YXW H;  3RGU A;  1N73 C;  2N1T D;  2QRX A;  1IFJ A;  2GUV A;  2PAJ A;  4BRY A;  2OYH B;  4H44 B;  1FAV A;  1YIT P;  1S5L X;  3BAT A;  2K9J B;  3H1L D;  1GW4 A;  1NU1 E;  1P84 H;  1VF5 C;  3MGN A;  3LIE A;  2YMY A;  3L74 G;  2B88 A;  5AW2 B;  3RBZ A;  2HPC A;  2Q9I A;  1W2B O;  3N7N A;  1GDT A;  2YKP A;  3B5N D;  5AVR B;  3L72 D;  3NFQ A;  4GOE A;  3MP7 B;  2A06 G;  1FDO A;  3HTK B;  3R2P A;  3AED C;  4N3Y B;  3L70 E;  4OH8 B;  1RE3 C;  1N2D C;  1IO4 A;  1BCC D;  2E42 A;  2ZYG A;  1AQ5 A;  1P84 I;  1ZV8 A;  3H1K G;  2ZXX A;  3HRN A;  1NTK J;  3GLM A;  1SQQ G;  3HE4 A;  3RK3 B;  2B87 B;  1A02 F;  2Y0D A;  5CJ4 A;  1M8O B;  2FYU E;  4U3F J;  1L0L G;  3KPE A;  5E79 E;  3V2R A;  4B86 A;  2Y9Z A;  4CPG A;  3CWB D;  3BRT B;  5KAF E;  5AW8 B;  1G1I A;  4IOI H;  1GL2 C;  3CXH E;  3MIW A;  3RK2 C;  1LWU A;  2AEF A;  2BCC J;  2FFD B;  1MFZ A;  3MUD A;  1PGO A;  1NAF A;  1VQL P;  1JTH B;  1N7S D;  4GT1 A;  1NJI Q;  1PZQ A;  2I1J A;  1KFN A;  3HD7 D;  3V4Q A;  2A45 H;  1GU5 A;  1BDC A;  1QL1 A;  1URQ C;  3M9H A;  5KJ7 D;  1FOS E;  1U7M A;  1NTZ K;  1IFI A;  1CI6 A;  1NTZ D;  3JC2 2;  5CHX A;  3RL0 C;  2JJL A;  1SQV K;  5AW6 B;  1N8R Q;  2M3E A;  4DOJ A;  1H8A A;  1T2K C;  3D70 A;  1N7L A;  4W7Z A;  2WPR A;  3L74 J;  2FYU K;  3TSI A;  2KK7 A;  3MD0 A;  1HJB A;  1M57 D;  3M9Q A;  4YTP C;  2NPS B;  1JY3 O;  5CCG C;  2XNX A;  2WSS H;  1TU3 F;  3R4Y A;  1NTK K;  2E74 B;  3CC7 P;  1FZG A;  3AE8 C;  3MUD C;  1NTK D;  4AQR D;  1Y9B A;  4IL6 E;  1LWU C;  2RMZ A;  1FJK A;  3FGA D;  3LW5 J;  3KZI E;  3VMX A;  1EZV I;  3H25 A;  1GD2 E;  3M0D A;  3L71 J;  5AW1 B;  2LR2 A;  3L72 J;  1N7S C;  2BAS A;  2Q3I A;  1UII A;  2W83 C;  4IL6 X;  1KQF B;  3CCJ P;  1K04 A;  5AVQ B;  4MN4 C;  5GTI E;  1NTK E;  2WT7 B;  1KQL A;  5AW4 B;  3H1H E;  5KLV K;  2Y9Y A;  1Q90 D;  1USD A;  1R5S A;  2NPS D;  2O3J A;  2QJK B;  4Y99 B;  2KB7 P;  1LT9 C;  3H1L J;  5L8R J;  2IYP A;  1VQP P;  1VF5 B;  3EWK A;  1KOR A;  5BVZ A;  1HGZ A;  3H1L E;  1FBM A;  2H7H A;  1GZL A;  2WPS A;  3L4F A;  3L73 E;  1SLQ A;  2MJZ A;  3CLQ A;  3FX0 A;  3H32 A;  1RQV A;  3EFG A;  4I6M C;  5TJH A;  1VQ7 P;  1SFC B;  3A2A A;  1S4X A;  4Z1M H;  3M06 A;  4OGQ C;  3L71 D;  4H44 D;  3RK2 B;  1MV8 A;  4DT0 A;  1HWT C;  4UB8 E;  1H0T A;  3L35 A;  1Q82 Q;  3K5B A;  1LTA C;  3TK1 A;  3IN6 A;  5KLI B;  1BGY D;  3IAO A;  1L0N K;  3L75 J;  4WBA A;  3RK3 C;  1Q7Y Q;  2KNC B;  3WUT A;  2IBZ I;  1RH5 B;  3H1I E;  2O1J A;  1GL2 D;  1HJ0 A;  2H88 C;  2Q6Q A;  3CWB E;  2QG4 A;  2OYI A;  1E5W A;  1LT9 A;  1KMI Z;  1YBK A;  2I8D A;  4PD4 D;  2J59 M;  3WUV A;  1K05 A;  3LW5 H;  5CCH A;  3JCU H;  1RF0 A;  1FE6 A;  2QIW A;  1KIL D;  1SFC C;  1KC8 Q;  4ZNC A;  1R8E A;  3V6I A;  4L73 A;  2M3B A;  3VOP A;  5AVZ B;  2GUS A;  1ZN5 A;  1ZOY C;  2KSE A;  2KZJ A;  5M1B A;  2KS1 A;  1KIL E;  3SWF A;  1EZV E;  5AVU B;  1L0N G;  1VQN P;  5B5E E;  3RL0 D;  1P84 E;  1OVU A;  1FZA A;  2XV5 A;  3H1K D;  1SQQ J;  1M56 D;  1RY3 A;  2OYO A;  4L76 A;  4AYC A;  4ZKP A;  5AW0 B;  3L70 J;  3S1K A;  5AVX B;  2L91 A;  3H1J G;  3M0A A;  4K3A A;  1Z56 A;  2QJP B;  1EDJ A;  3P8M C;  2W6A A;  3D6Y A;  2W8Z A;  1IC2 A;  1NU1 D;  4XA4 A;  2IDB A;  2JP3 A;  1S9K E;  4JPZ B;  3T97 A;  2NZ2 A;  2QJK C;  1QEX A;  2XZR A;  1S3J A;  2V4H A;  1YIJ P;  1NVO A;  3VMA A;  1N73 A;  1MKM A;  3AEF C;  1J1D C;  3O6Q A;  4JQ0 D;  3B71 A;  3USS A;  4EI2 A;  1AJY A;  1KIL B;  3H1H J;  1S2E A;  3C9I A;  3W68 A;  2YIU B;  4LGD E;  2HOD A;  1S9K D;  4ASW A;  3S4R A;  2V7Q J;  1DD4 A;  1M1J A;  3D6Z A;  2R44 A;  1JUN A;  4OWF A;  1SVF A;  1M7L A;  1BE3 E;  2E74 D;  2OTK E;  2M8R A;  2R3C A;  1OVV A;  3M91 A;  1X8Y A;  1ZLL A;  4PV1 B;  1NKZ B;  2KSJ A;  2B9B A;  3AE3 C;  1AV1 A;  1NTZ J;  1SQX E;  4C7N B;  3WUU A;  1NU1 J;  1KYO I;  2P1J A;  3AE5 C;  2M5A B;  4PJ0 H;  2H8P D;  5EFW B;  2QEX P;  2O01 N;  3H1H G;  3OJA B;  1QLE D;  5KKZ C;  2NRG A;  1X79 B;  1FZC B;  2KLU A;  4D6T J;  2PGD A;  3L37 A;  3OAK A;  1QX8 A;  3V4W A;  2KUB A;  2BEQ D;  3TGU G;  1AVO A;  2W90 A;  2WWW A;  2LKM A;  3CXH I;  1L2P A;  3SSU A;  1L0L K;  1VL2 A;  2N1T A;  4N78 D;  4U3F D;  1IFM A;  3H6P A;  2FXM A;  2OQQ A;  1PGJ A;  2I1K A;  4OVN F;  1G1J A;  4C7R A;  2K3R A;  3II6 A;  2WSF H;  4PV1 C;  3H1I D;  5CJ0 A;  1LTT C;  4RKU J;  5H2F H;  1VQM P;  3G71 P;  4IL6 H;  1N7S B;  3WU2 E;  1SS1 A;  1L4A C;  2POH A;  1Q2N A;  2QJY C;  2Z5I A;  4OGQ D;  4LLH A;  3S9O A;  1FJP A;  3SWY A;  1K9M Q;  2BCC G;  4BRY B;  1BSN A;  1YTZ T;  2G3A A;  4WY4 D;  5AW7 B;  2OYH A;  1RE4 A;  3NXS A;  2K9J A;  2R5D A;  2E75 D;  2FYU J;  3BCC E;  2WQY C;  4N78 E;  2ZT9 C;  3L75 D;  1MFT A;  4U3F E;  3RL0 g;  3RBX A;  1GL2 A;  3CCU P;  1JO5 A;  4EYY Q;  3TF5 A;  1L0L J;  1NH4 A;  1IFN A;  1LGH B;  1JY3 P;  2YXQ B;  1X9V A;  5CCG A;  3CC4 P;  5DJT B;  2P58 A;  4H13 B;  4C46 A;  4OGQ B;  1EDK A;  3AE1 C;  2YO2 A;  1FZB A;  4GOD A;  4O9B A;  2KLV A;  3U1C A;  2KYV A;  4H0L C;  3GHG A;  4I7Z C;  1JOC A;  4WB4 A;  1SQX G;  2O1K A;  4ZKU A;  3SFD C;  1SQP D;  1U57 A;  3BCC G;  2K37 A;  2WSE H;  2WVR A;  1SQB E;  3HE4 B;  2Q1K A;  4R4L A;  2B87 A;  4TT3 H;  2JEE A;  3HUS A;  3VN0 A;  4H44 C;  1QVG O;  1OFC X;  1LTJ B;  1DD3 A;  4Y28 J;  2JO1 A;  2ZT9 B;  4JYC A;  1G2C B;  1NYH A;  4I2L C;  2JWD A;  5B66 E;  2XND H;  3CPW O;  2H43 A;  4H13 D;  1U7J A;  4L74 A;  1BDD A;  1FS0 E;  3L71 E;  1EDI A;  4UB6 E;  2W27 A;  1CSB A;  1LWU B;  2ZT9 D;  3VYI A;  1JY2 N;  2FFD A;  4JF7 A;  2ZFC A;  3GW6 A;  1JTH A;  4AUW A;  3FXD A;  1IZN B;  3H1J D;  4KHX A;  2IX7 C;  5KLV G;  3PRJ A;  5AW9 B;  1JY3 N;  1LP1 B;  3GHG C;  2P7J A;  3L74 D;  1UIX A;  1CI6 B;  3HD7 C;  4RO0 A;  4WY4 B;  4BXL A;  2FKW B;  3PHL A;  3Q5P A;  1OW6 A;  3P7K A;  1URQ B;  1JCD A;  3L72 G;  2WPV B;  3N4X A;  1NAY A;  2P2U A;  1YJ9 P;  3PTZ A;  1RQU A;  2KZI A;  1MUU A;  3HD7 A;  5BU8 B;  5KKZ B;  3CCM P;  3Q1M A;  2JR8 A;  1JMB A;  3EQ2 A;  1FU1 A;  1GK4 A;  1LT1 A;  1E79 H;  3JSV C;  4U7J A;  1T3J A;  1SQQ K;  3CC2 P;  1SQQ D;  2FFD C;  1IFD A;  3PP5 A;  2QA4 P;  2HFE D;  5K5G B;  1PP9 G;  1BSH A;  1VPC A;  3CI9 A;  2OGU A;  4PD4 E;  3A3Y B;  1Q86 Q;  1GMJ A;  1L0L D;  3I5C A;  5APX A;  3CWB G;  1RE3 A;  3FWN A;  1W2E A;  2FYZ A;  3CWB J;  4W7Y A;  3KZI H;  1VQO P;  5TIS H;  1KFM A;  1P84 D;  2A06 E;  1AFO A;  3NTN A;  3PJS K;  1SQV E;  3L70 G;  2IZ0 A;  4A7P A;  1VQ4 P;  3RK2 D;  3CMA P;  3A0B H;  1OVR A;  1URQ D;  3NMD A;  3U1A A;  1Q81 Q;  3V5B A;  1R5L A;  1L0N J;  1W5C E;  1PP9 E;  2NPS C;  1S1C X;  2O01 J;  5CCH C;  2PRR A;  3TGU D;  2QM7 A;  3RK3 D;  1Y47 A;  3TNU B;  1BGY J;  2FYN B;  3B8E B;  3GG2 A;  4U3F G;  1S5L H;  3CCQ P;  3M0D C;  5CBO A;  1GW3 A;  1WRG A;  2FYU G;  2QE7 H;  1H88 A;  2A45 G;  1ZRT D;  1CW5 A;  3P32 A;  1X0T A;  1YI2 P;  4D6T E;  3JCU E;  2K1A A;  2ZYD A;  5CCG D;  1JB0 J;  1H0T B;  1YJN P;  3B5N B;  1HVV A;  2D2C C;  1OZH A;  2QJP C;  3AEG C;  1HBW A;  1KB9 E;  2IBZ E;  5KLV E;  2YO3 A;  2OYI B;  3TYY A;  2KXP B;  5AVY B;  2Z4E A;  2E5T A;  4XE5 B;  3WMM 0;  1ZRT E;  3G9R A;  5KLV J;  1KYO E;  3ZDM A;  3A0B E;  3WU2 H;  1JMM A;  1BCC E;  1NTM J;  1CZQ A;  2AEM A;  4WVZ A;  1KYO H;  3E7K A;  3PLN A;  2ZVO B;  4GKG A;  1EZV G;  3ABV C;  2JDI H;  1NTM G;  4L75 A;  1VQK P;  1OXZ A;  1PPJ D;  1PV3 A;  3P8C E;  3BVH A;  1DX7 A;  3AE7 C;  1K8A Q;  3PH0 A;  1YQ3 C;  1SQX K;  3BCC J;  2C9N Y;  2YKQ A;  1OIP A;  1Y8A A;  3KHU A;  5C39 A;  1KYO D;  1SQP G;  2E76 C;  2W6J H;  1XTG B;  2N9B A;  3FXE A;  1YYC A;  3KQG A;  3KYQ A;  4HJG H;  2OTL P;  2KIK A;  2AEJ A;  3VTP C;  4HYT B;  3AE2 C;  1SQV J;  5APS A;  5BU5 A;  1HGV A;  2C0X A;  3T97 B;  1KQG B;  1PPJ E;  1NTM K;  3P8C D;  2J5U A;  3O8Z A;  1FDI A;  2AXC A;  1LTJ C;  3AEA C;  1KB9 H;  1BGY G;  1J1E B;  3IR9 A;  1S72 P;  1N73 B;  1VQ8 P;  1EQ7 A;  3GF3 A;  1D7M A;  3BRV B;  1NWQ A;  2OYH C;  3CX5 I;  3L75 E;  3A5T A;  1QGK B;  2HOD B;  3AE4 C;  2FYN C;  3GMA A;  2XU6 A;  5TIS E;  3HE5 B;  2OAR A;  3L73 G;  3Q2Y A; 
#chains in the Genus database with same CATH homology
 5AW5 B;  1JY2 O;  3HUS C;  1L4A A;  5APV A;  1RF1 C;  4C7N A;  1A02 J;  3IFM A;  4LC1 A;  3V2P A;  2ZXE B;  3CL3 D;  1FZC A;  1FZE A;  2C0W A;  4IFD K;  2WPQ A;  4RES B;  2N1T B;  2HPC B;  2Q7C A;  1JCC A;  3HTK A;  3VMY A;  5AVW B;  3UIA A;  1N7S A;  2Q5U A;  1ZR4 A;  2OYI C;  5AW3 B;  5CCH D;  1PFI A;  1FZC C;  1KZU B;  1WT6 A;  2C9L Y;  4IFM A;  4EOT A;  1GL2 B;  2HYN A;  2QM8 A;  2Z5H A;  2HG5 D;  3OA7 A;  3GHG B;  4WY4 C;  2E43 A;  2L5G B;  1JNM A;  1NOH A;  1QL2 A;  3HUS B;  2P67 A;  3VP8 A;  1IJD B;  1LTJ A;  1OWA A;  1G2C A;  1RF0 C;  3G3Z A;  1HH0 A;  3VP9 A;  3V2N A;  2XKM A;  2NPS A;  1DEB A;  3E1I A;  5APQ A;  5APU A;  1SQB K;  2N1T C;  1HTL C;  1RF1 A;  4JYB A;  4WY4 A;  1NO4 A;  2HLO A;  4I1L A;  2WIT A;  1H89 A;  1URQ A;  4Y99 C;  3HD7 B;  2WT7 A;  5APY A;  5APT A;  3L36 A;  1DH3 A;  1NKN A;  1MZ9 A;  1KIL C;  3H32 B;  2CPB A;  1SFC A;  4W80 A;  2IPP A;  5CMZ A;  2R5B A;  4HH2 A;  3U59 A;  5AVT B;  1NHL A;  1GTW A;  2IFN A;  1SQP K;  5KJ7 A;  4DZO A;  1T8Z A;  1LT9 B;  1NU1 K;  3TNU A;  3LID A;  5KJ7 C;  2WTY A;  1FDM A;  1LTS C;  2VRS A;  2PP6 A;  2CPS A;  2R32 A;  3B5N A;  3NTN A;  1SP4 A;  1ZR2 A;  1T3U A;  1GK6 A;  3VMZ A;  4N6J A;  1LTI C;  3MTU E;  1N86 A;  1GU4 A;  3BAS A;  2YKO A;  1J2J B;  1KIL A;  1L4A D;  3B5N C;  1SFC D;  4GIF A;  3M9B A;  1JY2 P;  1M1J B;  2IFM A;  1LTB C;  1YTZ I;  2W6B A;  1HUC A;  5AVV B;  4M3L A;  2KOG A;  3V2Q A;  2KP8 A;  2GM4 A;  1LTG C;  4DOJ A;  2A45 I;  2WSC H;  5AVS B;  1J1D B;  1IK9 A;  1T2K D;  3HE5 A;  2YNY A;  3KDP B;  1M1J C;  1VDF A;  2O01 H;  5KTB A;  4IFF A;  1L4A B;  4EIJ A;  3RL0 B;  5APW A;  2WZ7 A;  1XTC C;  2J58 A;  3A7O A;  1RE4 C;  2XDJ A;  1J1E C;  1N73 C;  2N1T D;  1IFJ A;  2GUV A;  2PAJ A;  2OYH B;  1FAV A;  3BAT A;  1GW4 A;  3MGN A;  3LIE A;  2YMY A;  2Q9I A;  5AW2 B;  2HPC A;  3N7N A;  1GDT A;  2YKP A;  3B5N D;  5AVR B;  3NFQ A;  3R2P A;  3HTK B;  4N3Y B;  4OH8 B;  1RE3 C;  1N2D C;  1IO4 A;  2E42 A;  1ZV8 A;  3HRN A;  3HE4 A;  3RK3 B;  1A02 F;  5CJ4 A;  3KPE A;  3V2R A;  3BRT B;  5AW8 B;  1G1I A;  1GL2 C;  3MIW A;  3RK2 C;  1LWU A;  2FFD B;  1MFZ A;  3MUD A;  1NAF A;  1JTH B;  1N7S D;  4GT1 A;  3HD7 D;  2I1J A;  1KFN A;  3V4Q A;  2A45 H;  1GU5 A;  1QL1 A;  1URQ C;  3M9H A;  5KJ7 D;  1FOS E;  1NTZ K;  1IFI A;  1CI6 A;  5CHX A;  3RL0 C;  2JJL A;  1SQV K;  5AW6 B;  1H8A A;  1T2K C;  1N7L A;  4W7Z A;  2WPR A;  2FYU K;  3TSI A;  3MD0 A;  1HJB A;  3M9Q A;  5CCG C;  2NPS B;  1JY3 O;  2XNX A;  1NTK K;  1FZG A;  4AQR D;  1LWU C;  1FJK A;  3VMX A;  1GD2 E;  3M0D A;  5AW1 B;  1N7S C;  2BAS A;  2Q3I A;  5AVQ B;  2WT7 B;  1KQL A;  5AW4 B;  5KLV K;  2NPS D;  4Y99 B;  2KB7 P;  1LT9 C;  5BVZ A;  1HGZ A;  2H7H A;  1FBM A;  1GZL A;  2WPS A;  3L4F A;  1SLQ A;  2MJZ A;  3CLQ A;  3H32 A;  4I6M C;  3EFG A;  1SFC B;  3A2A A;  3M06 A;  3RK2 B;  1MV8 A;  1HWT C;  3L35 A;  1LTA C;  3TK1 A;  3RK3 C;  1L0N K;  4WBA A;  2O1J A;  1GL2 D;  2OYI A;  1E5W A;  1LT9 A;  2J59 M;  5CCH A;  3LW5 H;  1RF0 A;  1KIL D;  1SFC C;  3VOP A;  2M3B A;  5AVZ B;  2GUS A;  1ZN5 A;  3SWF A;  5AVU B;  3RL0 D;  1FZA A;  2XV5 A;  1RY3 A;  4AYC A;  4ZKP A;  5AW0 B;  5AVX B;  3M0A A;  1Z56 A;  3P8M C;  2W6A A;  1IC2 A;  4XA4 A;  1S9K E;  3T97 A;  2XZR A;  1N73 A;  1J1D C;  1KIL B;  3C9I A;  4LGD E;  1S9K D;  2HOD A;  1M1J A;  1JUN A;  1SVF A;  1M7L A;  3M91 A;  2R3C A;  2M8R A;  1X8Y A;  1ZLL A;  1NKZ B;  2KSJ A;  4C7N B;  2P1J A;  2H8P D;  3OJA B;  1X79 B;  1FZC B;  3L37 A;  3OAK A;  3V4W A;  2WWW A;  2LKM A;  1L0L K;  2N1T A;  4N78 D;  3H6P A;  1IFM A;  2FXM A;  2I1K A;  1G1J A;  4C7R A;  3II6 A;  5CJ0 A;  2WSF H;  1LTT C;  1N7S B;  1L4A C;  2POH A;  2Z5I A;  4LLH A;  1FJP A;  3SWY A;  1YTZ T;  2OYH A;  4WY4 D;  5AW7 B;  1RE4 A;  3NXS A;  2R5D A;  4N78 E;  1FZF A;  1JO5 A;  1GL2 A;  1NH4 A;  1IFN A;  1LGH B;  1JY3 P;  5CCG A;  1X9V A;  4C46 A;  3U1C A;  4O9B A;  2YO2 A;  1FZB A;  2KLV A;  2KYV A;  3GHG A;  1JOC A;  4WB4 A;  2O1K A;  4ZKU A;  1FOS F;  3RK2 D;  3HE4 B;  2WSE H;  3VN0 A;  2JEE A;  3HUS A;  1LTJ B;  4JYC A;  1G2C B;  4I2L C;  2H43 A;  2W27 A;  1CSB A;  1LWU B;  3VYI A;  1JY2 N;  2FFD A;  4JF7 A;  2ZFC A;  1JTH A;  4AUW A;  4KHX A;  2IX7 C;  5AW9 B;  1JY3 N;  3GHG C;  1RF1 B;  2P7J A;  4WY4 B;  3HD7 C;  1CI6 B;  1AQ5 A;  2FKW B;  3P7K A;  1URQ B;  1JCD A;  3N4X A;  2P2U A;  5BU8 B;  1MUU A;  3HD7 A;  3EQ2 A;  1FU1 A;  1GK4 A;  1T3J A;  1SQQ K;  2FFD C;  1IFD A;  3PP5 A;  2HFE D;  1VPC A;  3CI9 A;  3A3Y B;  3I5C A;  5APX A;  4W7Y A;  1RE3 A;  1W2E A;  2FYZ A;  1KFM A;  1AFO A;  1URQ D;  3NMD A;  3U1A A;  3V5B A;  5CCH C;  2NPS C;  2QM7 A;  3RK3 D;  3TNU B;  3B8E B;  3M0D C;  1GW3 A;  1WRG A;  1H88 A;  1CW5 A;  2A45 G;  3P32 A;  5CCG D;  3B5N B;  1HVV A;  1HBW A;  2YO3 A;  2OYI B;  3TYY A;  5AVY B;  2Z4E A;  4XE5 B;  3WMM 0;  1JMM A;  1CZQ A;  4GKG A;  1OXZ A;  3P8C E;  1DX7 A;  3BVH A;  1SQX K;  2C9N Y;  2YKQ A;  3KQG A;  1XTG B;  2N9B A;  1YYC A;  3KYQ A;  3VTP C;  4HYT B;  5APS A;  5BU5 A;  1HGV A;  2C0X A;  3P8C D;  4B86 A;  1NTM K;  3O8Z A;  3IR9 A;  1LTJ C;  1J1E B;  1N73 B;  1EQ7 A;  1NWQ A;  3BRV B;  2OYH C;  3A5T A;  2HOD B;  2XU6 A;  3HE5 B;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...