1AQUA

Estrogen sulfotransferase with bound inactive cofactor pap and 17-beta estradiol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
288
structure length
281
Chain Sequence
b'EYYEVFGEFRGVLMDKRFTKYWEDVEMFLARPDDLVIATYPKSGTTWISEVVYMIYKEGDAIFNRIPYLECRNEDLINGIKQLKEKESPRIVKTHLPPKLLPASFWEKNCKMIYLCRNAKDVAVSYYYFLLMITSYPNPKSFSEFVEKFMQGQVPYGSWYDHVKAWWEKSKNSRVLFMFYEDMKEDIRREVVKLIEFLERKPSAELVDRIIQHTSFQEMKNNPSTNYTMMPEEMMNQKVSPFMRKGIIGDWKNHFPEALRERFDEHYKQQMKDCTVKFRME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of estrogen sulphotransferase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 104
structure length 281
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1aquA00
4ZCLA 2NO1A 3TVDA 1VCIA 4JLVA 3CKLA 4A0RA 1R8SA 4LBZA 3H86A 1BIFA 5GADl 1GKIA 2HT6A 2WZQA 1GOTA 5DN6D 1KI9A 3KUCA 2ZUBA 2CVFA 3P32A 3Q5EA 3CWQA 4A2WA 4EIWA 3D6TB 2PX0A 2H18A 3AP3A 4IKEA 1XTRA 1HYQA 3RANA 3EX7C 1AA9A 3ZZ0A 2RCNA 3PENA 1J7KA 2V54A 3QVUA 4A0GA 2D7DA 2IF0A 4RVCA 2F43A 2OBMA 3LW8A 4FIDA 3F3YA 4Q9KA 2AXPA 1AS3A 4NYIR 5FI0B 2J87A 2QENA 3CONA 5FTJA 1KNQA 3LWNA 2Z4RA 1BMFD 3I62A 2FPMA 5GJBA 3VHLB 2XAUA 2CE7A 1U8ZA 4L4UA 3UPUA 3DEFA 3A8TA 2BOVA 2C03A 3QKRB 3KX2A 2FE4A 4A2PA 4P31A 1L4UA 2VP9A 1HH4A 1PLLA 2QPAA 3A1VA 4C0JA 4QKQA 4HUQB 5FTNA 5LD2B 4TL8A 1MR3F 5L3VA 2R62A 3ZS9A 4BASA 2RGXA 2VSOA 1SVKA 3THYB 1RRFA 3KKNA 2OFXA 3ZLJA 3CR7A 2WM9B 3X1XA 3P4XA 4NH0A 1JQJC 2ZITA 2CEAA 3RHFA 821PA 4RSGA 4TMVA 5KSZA 1YZQA 1Q0UA 2A5YB 4KBFA 4KODA 4CYMA 2J0UB 2ASEA 4V0MA 1E0SA 1COWA 1J8MF 4JL5A 3AVPA 3PUVA 4Q1DA 4ZIRA 2CJWA 4ASUD 4UXHA 4LPSA 1KKLA 3GLHB 2FZLA 4NE2A 2XB2A 4KVGA 3SI7A 4BWYA 1Z5ZA 5TARA 4WXRA 4IOKA 1U8AA 4HDQB 2ZPTX 5AR1A 2JLUA 2IWRA 2LKDA 1UDWA 2PJRA 3B13B 5CB8A 5JSZA 1KJWA 5JCPA 3OEED 1U0HC 3T1OA 1P3JA 4LYAA 1OB2A 3L0SA 1XPRA 2F3TA 2E9SA 5FR1A 1IJEA 3TJZA 2AFHE 3WRYC 2ZE6A 2ZRJA 3AB3A 3NHBA 4I1SA 4M9SA 5EE3A 5EXTA 3AF0A 4JYBA 3EIEA 2VIIA 4G5RA 2EFGA 3K9LA 1CR4A 1MO5A 4NKRA 1H65A 1ZNYA 2ZE5A 1JAHA 1F2TB 3OIUA 4L15A 1G19A 3BFVA 4F4JA 1XF9A 1LS1A 4ZI2A 4QNRA 3U44A 3LBNA 4II7A 1OF1A 2P3SA 1T3LA 4LY6A 3SC3A 4PHGA 5JWHA 1X8LA 1WB9A 2FF7A 4PAOA 1XMJA 2J46A 1VECA 2DFTA 2H1LA 3U60B 1KMQA 1GKUB 2AKAB 2QL6A 3B1ZA 4N0EA 1IM2A 4X8MA 5IRCD 2DR3A 2ZRGA 1G3IA 1U98A 5BYKA 1OH8A 2ZJ2A 2O8BA 2ZJOA 3K1JA 3IHLA 4V02A 3KJEA 2V6IA 2ZS7A 3EG5A 5FOUA 5H68A 1TAGA 2QMHA 1SKQA 3SOPA 3FKSA 2VSFA 4LJ8A 2FOLA 1JR6A 2WWXA 5ANRB 5B64A 1ZIOA 2VHJA 4URWR 3HYRA 4QGGA 4QJ4A 4TQUS 2YV5A 2HXSA 1KI7A 1XXHE 2REBA 4GOXA 4M22A 1G4AE 1Q21A 1HT1E 1CTQA 1OXVA 1UEIA 1KGDA 1BOFA 1AM4D 3AF2A 1DVRA 2CDNA 4C0KA 1T5LA 1VMAA 3TMKA 1Z6AA 2ERYA 4LCBA 4OHWA 4JJKA 5H1YA 1R0XA 1ZYUA 5EE5B 2G9NA 2P5SA 4L9SA 5A4JA 1TQDA 1CJUC 1E98A 2HV8A 3C4JA 4KV9A 4JJZA 3WMGA 4TZ6A 5DYGA 5JJIA 1G7TA 4Q9IA 5FOVA 1HURA 2WIBA 4NMMA 3B1VA 1ZRHA 1GVNB 1GRNA 1ZC3A 2JA1A 4LHXA 4W5HA 4YDSA 1EFRA 2J0SA 1ZM7A 3P26A 3ZVLA 1HT2E 1IY1A 4JLPA 4P32A 1US8A 2W6ID 3VR4A 3Q9LA 3QXXA 1H8HD 2F9LA 3FB4A 1P73A 1WBBA 1E1RA 1XTKA 5ELXA 3TR0A 1ZNZA 4QBGB 1ESNA 2K5UA 2Q0HA 4E22A 1LNZA 4NL4H 2W6JD 1Z0IA 1EXMA 3DHWC 4DZZA 1XMIA 4W9MC 4QGHA 2V7QD 3GLHE 1RC8A 2BMDA 3Q3JB 3QKSA 1KO5A 3CZPA 1G5PA 3RVBA 1JJ7A 1IHUA 2GCNA 1RYHA 2QY9A 1J8YF 4JT4A 1X8JA 2UZIR 1IN7A 3SQXA 1NN3A 2ZE7A 2Z83A 4N3NA 4PX9A 1JECA 2YZ2A 3IDQA 4LUCA 4PHFA 4QC2A 5FUWA 1NVVQ 3GJ7A 2BDTA 1MABA 3U4QA 1UJ2A 3QXJA 3V9PA 2ZYTX 4LJ9A 2WSSD 1JALA 2KJQA 2C99A 2ZR7A 1HY3A 2ZXUA 1W0JA 5AJYA 2QP9X 3UG7A 2QBYB 2IS6A 4OQLA 1VYTA 1S8FA 1ONBA 5JECA 3C8UA 3NC0C 5AUQA 3L43A 4WXPA 3TE6A 4GL2A 3KJGA 2AD1A 5CJPA 4IOMA 2B8WA 1AZTA 1FMJA 4HZUA 4IXNA 2H16A 2W58A 1JPNA 3FHOA 2C04A 1RJ9A 3PEVA 3VR3A 2WWYA 4YMWA 1G8HA 2ZANA 3NXSA 4NPHA 1SXJB 1DOAA 4DLXA 5FTMA 1KDTA 621PA 1U0LA 4B2IA 3VMFA 2A7QA 1J70A 3HU1A 1KK0A 4HB3A 3ZQJA 4AKIA 2JLVA 4RD4A 4MRVA 1CRQA 4IVPA 3EW9A 4G01B 3N5CA 5FBQB 1CXZA 1PUIA 4JLAA 5FBWB 3R8CA 2Q9BA 3A36A 2JASA 1T6NA 4IRUB 2CE2X 4PTLA 1P9RA 2FG5A 4K8OA 1XEXA 5DO9A 3L8YA 3IPYA 4Q18A 3SN6A 4IXMA 1S9HA 2QP4A 3GLGB 4PO9A 4KVAA 4BRWA 4UNNA 2IWHA 1TQ4A 3I73A 1N6RA 3I3SR 3DZ8A 3SE0A 3A1TA 4TLBA 2WJHA 5FR2A 3IO5A 3VX4A 1KK1A 4R2IA 1XXHA 2XSZA 2C9CA 3QIAA 2QE7D 4XTRA 4N0DA 4XVRA 3I32A 4TLAA 3SYNA 4HAYA 4Q19A 2HYDA 1RRCA 3BB4A 2BM0A 1LF5A 1II8B 2MSEB 3A1UA 3EA0A 4EJSC 1YQTA 4MA4A 2WWIA 3KTAB 1YU9A 1G4UR 1YRBA 1EFHA 2EVWX 3QPWA 4Y0VA 4MUBA 1ZD8A 3SJAA 4RFSB 3K70B 1F2UB 1KDPA 4BGDA 3IQXA 4DDWA 4OKSA 4HUQA 2OZEA 2BEKA 5EZ5A 1G6HA 5G3YA 2OBLA 1CP2A 4JVLA 1DAKA 1GNQA 5JI2E 1JBKA 2VP0A 1SGWA 1ZCAA 3KDSE 1XTJA 1E2NA 1Z6GA 2IW3A 4A0HA 1TX4B 1HV8A 2GCPA 1RIFA 2QMOA 1CJTC 3MWKA 2EYUA 1XD2A 4BLSA 2QI9C 2GILA 2YOGA 4DLRA 4F91B 3CH4B 2R6CA 1E4YA 3GLHA 2VPPA 1UFQA 1AN0A 4RKEA 2IS2A 4Q7LA 5JFGA 1UKYA 4Y0AA 1W0KD 1ZU5A 2ONKA 3AVTA 5FOWA 3U3MA 121PA 1E1QA 3HR7A 5EUMA 1N6IA 4B32A 2R44A 3MFYA 4URYR 1JXOA 2IYZA 5GJVC 2QTHA 3IKJA 2IYLD 3IIMA 2XOKA 4PO8A 1NG9A 4JZKA 1KJZA 2IYSA 2OLKA 2ZYWX 3C5CA 1KI6B 2BC9A 4HLDA 4I99A 4URUR 2O8FB 4B3BA 4X8HA 2FPLA 1U8YA 3WP0A 1F2TA 1E9CA 3HPQA 3KQUA 3RNLA 3AVWA 4B3GA 3TSOA 2BJVA 4KCGA 3RSLA 3A6PC 1GNRA 4QFMA 1W2GA 5A5GA 2P2LA 4D6PA 1N3BA 1VTKA 4NU0A 1SXJE 2WJGA 3CBQA 5K8TA 1P2SA 3Q85A 2GJ8A 2J45A 2ZVQX 4JMPA 1FPMA 5L3QB 2J3EA 3ZD7A 1W46A 1QDEA 3FPAA 3HJNA 1IXSB 4IVRA 3EZ9A 2D2FA 2DFNA 2GJSA 2IC5A 2W0MA 2YNMA 2ZQ5A 3T06B 2V8OA 3U7GA 2VP2A 3I92A 1OKKD 2C2HA 2A2ZA 2HF8A 2A5GA 4DHEA 2F43B 2D7CA 5GVSA 1P60A 3K09C 3ASZA 5FL3A 2EW1A 5FUXA 4WW0A 2QPOA 1Z0JA 3GLGE 1G17A 2OFWA 3ZJYA 2WSMA 3VR1A 4XH9B 3RC8A 4L9WA 1Y3AA 1BS1A 3PJRA 5SZKB 2YJTD 4F38A 4B3FX 3LH5A 1U90A 1W49A 2GETA 1Z0KA 2VLIA 1K6MA 1W5SA 1A7JA 5CYPA 5DSZA 5DI9A 2GESA 3PCRB 1XPUA 4V0OA 1GRRA 1VCNA 3M1IA 1X8KA 3KKOA 1YE8A 5DH9A 4MKIA 3T35A 4QJ5A 4XWKA 1Q3TA 4YXWA 5KSPA 4B6EA 1A1VA 3F0TA 5C18A 2GEVA 3L2OB 3KB1A 2W2TA 4RZUA 1JXMA 4ILEA 5LDDC 4R9UC 2IXFA 3GEHA 4BLPA 4MQBA 4ZIRB 1NLZA 2CJWB 1CR0A 2ZYVX 2AWNA 2RHMA 4M21A 1CU1A 4DCVA 3PITA 4FN5A 1KDRA 2JAQA 2DPXA 3FMPB 4I81A 1XWIA 4PO1A 3AVYA 4KAXA 4DVGA 3FHTA 1E0JA 2Q6TA 3E5HA 1E9FA 4D25A 1Z6YA 4M2LA 1GKYA 5FOSA 4ZV4A 2VHQA 4GMDA 4C0QC 1UF9A 4Z8XA 6Q21A 4Z1MA 3BIFA 2D2EA 4PC2A 4HAZA 5C1BA 4DUGD 5KPJA 4TT3D 3TUJC 4DKXA 4CEJA 2G0NA 1IONA 3CR8A 1M1YE 2VSXA 3EIQA 4OYHA 2ZYUX 4GNKA 3G82C 2ERXA 2WJYA 3CPEA 3AP2A 2ZS8A 5F9HA 1G8YA 5J40A 4ZCIA 4Q02A 5EP1A 3U3KA 3ADDA 1FMLA 2GK7A 1Q1QA 4NYMR 4C0BA 5FPYA 1OPXA 1ZM3A 3CNLA 2GBLA 3TAHA 3DKPA 2VQSA 3KKMA 1NSFA 2ODNA 3L0OA 4G3XA 5G3ZA 3GLIB 3U7FB 4PFSA 1X1SA 1GZSA 4Q4AB 4C0LA 4ARZA 4DCTA 5JS7A 5AK0A 4WIAA 3O47A 1NJGA 2LKCA 2F1IA 3FMFA 4E09A 1KNXA 3NDBB 1SXJA 4WA7A 1W48A 2FU5C 3UWOA 2JLYA 3LV8A 2OFOA 4WOPA 2QU8A 221PA 2BM1A 3BAFA 1Z6TA 2F1RA 4PC1A 4UJ3A 5HTKA 5B2ZA 4JKIA 4CRWB 1P61B 1NIPA 1QHSA 2DWOA 2ZIAA 3I8SA 1XJQA 3RRMA 3CLVA 1S1CA 4A2QA 1DS6A 3A58B 3GJ4A 3OFNA 4V03A 4QGFA 4LJ7A 1G41A 4QRHA 4WZBE 4JS0A 3TR5A 1VYVA 3R20A 2GK6A 1QVRA 2YYZA 3DL0A 3RRZA 2QGNA 1W47A 2XNDA 3GLGA 5J4HA 3QXHA 2REXB 3O8CA 3TBKA 5FL7A 1L2TA 1J2JA 4LC1A 1D5CA 721PA 3VKGA 1IQPA 1TU3A 4YXWD 4Z8YA 2J41A 4OQMA 4TLDA 4JLMA 4PSAA 3SJBA 4Q1AA 1XD9A 3CRVA 4QBFA 1PVOA 1R5NA 4JL8A 2C98A 2E87A 3UMSA 4HAXA 3BB3A 1II8A 1B0UA 1XBTA 4IOLA 4Q7KA 4OHVA 3C16C 3LLMA 5FUYA 4U5XA 1PJRA 3KTAA 3ICQB 1OYWA 2RHDA 2ZM5A 5EE9A 5FTLA 4U02A 2IXEA 1VHLA 4J0QA 4RFSA 5JHHB 3AUXA 1F2UA 1R2QA 1EX7A 1NI3A 2FSGA 3HWSA 4ITRC 1N5JA 2N1BA 3ZIAD 1Z06A 5FBVB 3QKSB 2R6FA 2BBOA 5K8LA 4L16A 2PBRA 3N2IA 1ZM2A 2LWIA 1D9ZA 3RABA 1Z83A 4KFSA 4EAQA 1GWNA 3TUIC 2OLJA 5A0FA 4MYHA 3AVOA 4CT5A 2DFKB 4P4TA 3U4QB 3FKQA 3R9XA 2KBEA 1NNEA 2IA5A 5HKKD 1NF3A 3BS4A 1KK2A 2ZS9A 3K9NA 4ZPXA 2V1UA 3IHWA 4OQFA 3FTQA 1OFTA 2OCAA 2OV2A 4BLTA 1DO2A 3H1TA 3B7GA 4OQNA 3TKLA 4BLQA 2WMNB 4P4UA 3T1TA 2AKYA 3BFXA 1I2DA 4FMDF 5CLLA 3TAUA 4I1VA 5D3MB 1SKYB 4PZLA 2ZR9A 3GP8A 2RGNA 2RMKA 3K0AB 2O8EB 4KFRA 2G0TA 4HZUB 2XEXA 2ZJAA 1E3MA 1RJ9B 1F48A 4ESHA 1NMYA 2CK3D 3KJIA 4LHWA 1KI6A 2O8FA 3PFIA 2GVZC 1G3QA 2JDIA 4OHZA 4EFMA 2PZGA 4TYQA 4WVFA 5K8UA 2I1VB 1JPJA 2DB3A 4P0TA 4BLRA 3GLIE 2FV8A 1AIPA 1G9XA 5G41A 4CVNA 4G5GA 2YWEA 3VTKA 2XGJA 1SHZA 5IK2A 4LV8B 4Q4HB 2RGBA 2WICA 1TEXA 1KIMA 1QHHB 4D2IA 2CL7X 4DSUA 2BIFA 3FWYA 1XU4A 4YMUA 1XEXB 4MRNA 1CEEA 1SHKA 2NO0A 2B8TA 3ZQ6A 3LW7A 5JWRA 2IL1A 5L3QA 3GPLA 3FFBA 2OEPA 3I1FA 2QT1A 3RS2A 2OCYC 1F60A 4NYJR 1CRPA 3RWMB 3MGCA 1XXHB 5BN3A 2FX3A 2CNWA 2WOJA 1O3YA 4GRAA 2AD5A 3MJHA 1ZVQA 3UXMA 1GAJA 1BKDR 5KTYA 521PA 1JAIA 2AX4A 4QHSA 2VF8A 4ZKDA 2IBMA 3S1AA 3ZZUA 1XFAA 2DYKA 3H0KA 2PEYA 2JIZD 4GOJA 3THOA 4LV6A 3VNVA 4V0LA 3ZH9B 4TMTA 5E3HA 1MOZA 4Q47A 3MG9A 1VG0B 3RRYA 4TL6A 5EP4A 4BFSA 4B35A 3K70D 1ZU4A 2HLDA 4AI6A 1L4YA 1BYUA 2NTYC 3B60A 3LA6A 2Q3HA 3EPLA 3SBEA 3ND8A 1Q20A 1YR8A 3BH0A 1Q12A 3Q7QA 3BJIC 4OI2A 4EKDA 4JLOA 1AGRA 1PUJA 5CDFE 4A8JB 4MKHA 2ODBA 1XEWX 1UDXA 1XD2B 2G77B 3OEHD 4WZ6A 3UIEA 3Q8XB 4TYNA 1ZD1A 3W3ZB 3SFVA 4B44A 4C2TA 3VU9B 3LD9A 5UKDA 4PZZA 5CITA 3ZZTA 1W36B 2Z5FA 4BFUA 1GL6A 1YR7A 2ZRHA 4MRPA 4UJ5A 1NBME 2QQ0A 2ZUCA 3K70C 1IY0A 5LPNA 4D81A 1ODFA 3P20A 4GBMA 3EA5A 1FP6A 4MGIR 3UKDA 4Q9JA 4O25A 2B92A 2BVNA 5KDOA 1N25A 4XWAA 4MRSA 3IIJA 4JBWA 3QENA 2GKSA 3FVQA 4OHXA 3AV0B 2Z43A 4DDTA 3HYTA 2ATXA 3QOFA 1XX6A 1SKYE 4DBLC 1E6CA 4P33A 4AY2A 1Q1BA 3WBKA 2KWIA 1GDDA 1T3SA 4QNMA 4TL7A 4C0AC 2QN6A 2PZFA 1AGPA 3KJHA 5AUNB 2ZRAA 4Q9LA 1XD8A 5DI3A 4F4IA 2VH5R 2F9MA 2X19A 3DKVA 2GXAA 4PQRA 2ZRCA 2O0HA 5CLQA 2J7PA 1TU4A 3OF5A 4TSFD 1E2KA 1EESA 1KSJA 3AF3A 2WJJA 2GRJA 3QBVA 3QPVA 5J4YA 3E1SA 4ESVA 1LS6A 2ECKA 1FFHA 1RZ3A 3EC1A 2ZI9A 3LY5A 2WKQA 2OHFA 4FMCB 4GOKA 4XVUA 3KQKA 1NLFA 2FZ4A 4Q9HA 4AURA 1AK2A 3IEUA 1G20E 4TTPA 1PLKA 3I72A 3GLIA 3KZ1E 3ADCA 5CIQA 4XD7A 4Q4AA 3VKHA 1GFIA 3WYFA 1Z07A 2AK2A 2YWGA 3MRSA 3Q7PA 5B58C 2WOOA 2MSDB 4MUAA 4E07A 3GJ3A 3ICEA 4GP6A 3CH5A 3GFTA 4HAVA 3W34A 4AG6A 1O87A 2PLFA 3K0EA 4JLDA 1XEWY 2ZRLA 4Z54A 4IDPA 2VRWA 2F1JA 3JZMA 3AVQA 4NCNA 3REGA 2IX3A 4TYYA 3JVVA 4NBSA 3GEIA 3X1YA 1L7VC 3IBGA 3TRFA 1KKMA 4N1AA 4AKEA 3MD0A 3X1DA 2AL7A 2VBCA 2ZSFA 4MYCA 3RRNA 1FQJA 1U2RA 3PG5A 3VNUA 3I8XA 2OG2A 3BK7A 1E2EA 1GM5A 1UKZA 4BZQA 4H1VA 2PT5A 2D62A 3AEZA 4CW7A 4ACAA 4C2UA 4CIDA 4P4SB 1DPFA 5DLQC 3B6EA 2OM2A 3I5YA 3UMFA 2WWHA 2O0JA 2YKGA 2P5TB 5GJWC 1COWD 3T1QA 3RDPA 3AP1A 3SYLA 4LZZA 1N6OA 1G7SA 2X1VA 4LYHA 2A30A 1CJMA 2GZAA 2G1KA 4JBYA 2RGCA 1LTQA 1QHIA 4GP7A 3VR6A 3SU8A 2WJIA 1OH6A 1KMHA 4HLCA 4CGZA 3AVXA 1YKSA 5CDFA 4DB2A 1M7BA 1K8RA 1QRAA 4JL6A 2IXGA 1WF3A 1H8EA 4B75A 2YINC 3LBIA 4B71A 4C3ZA 4LJYA 4Q1EA 4P3YA 5E4FA 1DELA 4HB4A 2IYUA 2GJKA 3I61A 5F2EA 4M9XA 4CEJB 4QOSA 3PXGA 3THWB 2QM8A 4CZ2A 4OJQA 1NBMA 1KI4A 3W6PA 2ZJZA 2ZAMA 3GFOA 4V0NA 5KSOA 2OILA 1DAEA 1KAOA 4NHOA 1XMSA 3MWJA 3D8BA 5BQ5A 3SQWA 1HA3A 1ZM4A 4DLVA 5KOYA 1T91A 3L0IB 1Z28A 2IYXA 2IF2A 2BJWA 4RD6A 3WNBA 3HDTA 4LRWA 4BRUA 2H17A 4A15A 2GZDA 2J7PD 3EZ7A 3KFXA 2BBSA 1G3RA 4JBXA 3T61A 2JGNA 2KI5A 1WXQA 4JIMA 1E2LA 1R0WA 3DMDA 3AH8A 1RW4A 5D3MA 5EXSA 5JHGB 4LBYA 3GJXC 4D0LB 4JVSB 2ZI3A 1F5NA 2EWWA 3MUFA 2NO7A 4IFEA 3K0AA 2O8EA 1TF7A 3OE7A 4BFVA 4S35A 2OCPA 4EPRA 4ARZB 3UG6A 3GJ0A 1W7AA 1CULC 2IEZA 1DAHA 1CBUA 2XTZA 2ZRPA 2ZRIA 2R6AA 4JLNA 1E2GA 1UEJA 5J5CA 4RCYA 4ZDIA 2JLXA 3FKSD 2G6BA 1HE8B 4U7DA 3NIBA 2G83A 3CZQA 1KOFA 1N2CE 4RZ3A 1KK3A 3E70C 2H7VA 1MKYA 1S0UA 3QQ5A 2GXSA 2XITA 4FD2A 4A82A 2JLWA 1RRGA 1R10A 4Q4HA 3AVUA 2YVUA 1XNJA 4TN1A 1QHHA 1X86B 1QG2A 2WPDA 1G8PA 2EQBA 2QT0A 1KHTA 5KDDA 1KSHA 3E2IA 5BYJA 2IYRA 2IHYA 1A5TA 4Q48A 4FWTA 5TB5A 2CLCX 5E95A 2QRNA 1VPLA 1E9SA 3LFUA 3QKTA 4XSGA 2V55B 1E32A 1NY6A 3W8NA 1VCMA 4B74A 1G64A 1LV7A 1GSIA 2IYYA 1KZ7B 1VG8A 3ADBA 3ZVMA 5H8WA 1EGAA 2IT1A 2WHXA 3CPHA 1YZUA 4IDNA 4U00A 2EFCB 1QVAA 4HB2A 1EFRD 2X77A 2YWHA 3ZDQA 4KYIB 3LO5A 4O2LA 3REFA 2OE2A 3RS5A 3JVUA 1N5KA 1E1RD 1UBGA 2QTVB 4EDHA 1NRJB 4EPTA 1HE1C 4X8OA 4D80A 2FGJA 4B3XA 1Z63A 3B1YA 4IEIA 2GNOA 2WKRA 1QG4A 3TW8B 3WNCA 2R8RA 1JB1A 1G8FA 1WQ1R 2BBTA 3AKCA 2GJAA 4QGAA 3AGPA 2DBYA 2GTPA 2NGRA 2JLZA 1TNDA 3CF2A 3MLEA 4Q5IA 4A8JA 2FH5B 2IUSA 3A4LA 2D06A 4HUTA 1LFDB 3TQFA 5FH9A 2GWHA 3VU9A 2O0KA 2FMXA 2XZLA 2W0SA 1E2DA 2XJ9A 2GAOA 5JBQA 4RY2A 4B2PA 4YMTA 3U6KA 1Q1ZA 3QXSA 4KBGA 1W0JD 1WBDA 1FW6A 5KPDA 2CL6X 5JI3E 2MMGA 3LAWA 3PVSA 4DWJA 5F98A 2R6DA 2ZSAA 5KU1A 4NP6A 3ZD6A 1VG1A 1YRAA 1ZNXA 2KB0A 2W2VA 5JZVA 2D3WA 1G3UA 3FMIA 2C5LA 1OYYA 2VHTA 1VIYA 1M7GA 2ZU6A 1NVXQ 4LC0A 421PA 5BXQC 3GJ5A 5DHAA 4KITB 3CRQA 4B2LA 1WMSA 3CF0A 2R65A 1G16A 3U5ZB 1EFCA 5KHOC 4KSCA 4K46A 1FL9A 4M1SA 1XDBA 4CEIB 3CIOA 3KKQA 4BFWA 4DLZA 5FOXA 4RFVA 5EQTA 3ONWA 4GT1A 4GZLA 4MGKR 4Q1CA 1DBSA 1V5WA 4IJMA 4PC6A 3ZGXA 1CR1A 1AJEA 3TSZA 4DSTA 1KO4A 4B6FA 4LBVA 2QTFA 3D3QA 4NYIQ 4PQYA 5FOTA 3A1SA 3QG5A 4XVQA 5KSYA 4B73A 1RE0A 2IYTA 1P2UA 3B9QA 3KFVA 4AYXA 4AYWA 5JCZA 2QP3A 2VTKA 4HEJA 1J99A 2CCKA 3FYHA 3AGQA 4LJAA 2IYQA 2QRZA 1MO4A 1FOEB 1NKSA 1UADA 2ZR0A 3I5XA 2AHOA 1P9WA 3F8TA 1FX0A 3U3OA 4BEBA 4MDFA 1D2MA 2XSZD 3B9PA 1C4OA 3F5FA 3UATA 3HP1A 3S1AB 1N0WA 3QEJA 4KFUA 4HB0A 2NO9A 1ZP6A 4A6XA 3BBPA 1OXUA 4D4MA 1GUAA 1Q3HA 1E4VA 2V3CC 3CX8A 1VG9B 3GCGA 4D4JA 2P6UA 2J7KA 4HLUA 2RGDA 1NY5A 3NBYC 4A4DA 5KNBA 2ZREA 4MITA 1FZQA 4C0HA 3PQCA 3GMTA 2J59A 2QORA 2BMJA 3TUZC 4M1WA 3QNUA 3AKYA 3ND9A 2HJVA 5M04A 2F6RA 3WBJA 2VF7A 3V4RA 4LDJA 2IUUA 3TGPA 2PMKA 2ZI7A 4GI7A 4XWOA 4ZI3A 4ZDKA 1JQLB 4P4SA 1TUIA 3N2EA 1W1WA 2C9YA 3TK1A 2CXXA 4DJTA 1D2EA 3PEYA 4D0GA 1NKTA 3QI2A 1RRPA 1N6HA 3OIVA 4GSYA 5FBRB 2GVDC 4BZPA 5JRJA 4UXIA 3OAAA 1KI3A 3NVAA 1GILA 5LD2C 1G3MA 3K0FB 3PUYA 5AJZA 2CLSA 3VR2A 1E1QD 4US2R 3CX6A 2NPFA 5AWFC 1CJKC 2GAAA 2GJ9A 4JLBA 4NTZA 4RD0A 4OK5A 2ZRDA 2QROA 1OB5A 2XOKD 1R7RA 5L3SB 1F3OA 1R6BX 2OAP1 4BQSA 1FUUA 3BGWA 3WYAA 1OXXK 1ZCBA 2N46A 2ZRNA 3FMOB 3QXCA 5B30A 3THWA 4MGYR 1EWRA 3KQNA 4LI0A 1HQYE 5DI3B 4HSEA 5FBLB 4LHVA 3T15A 4DB4A 5J47A 3SDZA 3NEYA 4B48A 4LYFA 1W36C 4PSVA 2ZRKA 3K0SA 1UBFA 1LY1A 2EFEB 2HYIC 1FTSA 2IK8A 3A1WA 3D7MA 5JEEA 2ZVPX 8OHMA 1GIAA 4LV5B 1EX6A 1W4AA 4NZYA 4UXJA 4PXAA 5EXXA 2OSBA 4DEYA 1MO3A 5JRZA 2Z4SA 4EFNA 4DEXA 2GXUA 2QG6A 4WAUA 3SR0A 3PR1A 4PSKA 2FA9A 4EQ6A 2MSCB 2G3YA 4EPXA 1U94A 5HCNA 2OESA 1CF4A 1WA5A 1VYUA 3DMNA 4Q7MB 3TVTA 4C7OA 4G1UC 1CR2A 1KO1A 4JVMA 5CIWA 3NC1C 2ZAOA 3W90A 4FCVA 1NVVR 4D4KA 4ZCMA 3FDIA 4BEJA 4M9QA 1OH5A 2NZJA 4OL0A 1N0VC 4B47A 1E2QA 4M1TA 2FFQA 3IILA 1AZSC 1XEFA 1ZUIA 3GFPA 1YHNA 2NZ8A 2TMKA 4BFYA 4EPVA 4DT1A 3C15C 2XZPA 4MH0R 1YZLA 2VL7A 3SJCA 4AD8A 4E03A 2PEZA 1E79A 1ZM9A 1XZQA 1AKYA 2EWVA 2BMFA 1KJYA 3QE0A 5SZIA 2JJ2A 2JLSA 3R9WA 2WVJA 5SZHB 2FSFA 1QHYA 5SZJA 3A4MA 4H9GA 5BWMA 3AM1A 1X1RA 5EJEA 5F9FA 3VX3A 1NLYA 4URVR 2Z0MA 5JWOA 4W5WA 5DN6A 4DXAA 1DO0A 3T1VA 1XCGB 5CK5A 3CB4A 1GL7A 1KI1A 2FPKA 4ON9A 5C46F 1S4QA 1VHTA 2FEOA 4IFBA 4HLUC 2QMEA 1Q22A 3EZ2A 4NCKA 2UKDA 1KMHB 4TMZA 3A4NA 5C4MA 3UMRA 1HUQA 2ZI4A 3BOSA 3SS8A 2QGZA 4RD2A 3RLFA 3TW4A 4GFDA 1KO8A 4LSGA 4A36A 5F3WB 1IN4A 2WV9A 1OLOA 1QHXA 1N6LA 1S3SA 3LXRA 2W2XA 3U2QA 1G5TA 1IAQA 1LF0A 3A37A 3R7WB 1IXZA 4Z1MD 2XZOA 4DLWA 1OIXA 1WDTA 2V6JA 1P2VA 4URZR 2AR7A 2OT3B 4TQAA 4LWZA 1RKBA 1DG1G 2GZHA 2JLQA 2KBFA 4QHTA 4UNQA 2VYFA 3DM5A 2VP5A 2JJ1A 4G5OA 5J4VA 2SHKA 5IHPA 3CRRA 1BH2A 5IT5A 2PX3A 5EE0A 2IUTA 1I4LD 3RS0A 2Q21A 3QG1A 3C7KA 4ASUA 5CYOA 2ZI5A 4TQ9A 1E96A 3WYGA 3AF4A 5EUQB 1KY2A 2ZEJA 5LB4A 1E2MA 1LB1B 1E2FA 5KYKA 1XJCA 1M34E 3DOFA 1FNNA 1MRSA 3PUZA 1Q44A 2ATVA 3OEEA 3QSYA 4TMWA 1SXJD 1N5LA 1KTVA 1T8TA 2FSHA 4TLCA 3TSWA 4KI0A 2ZRBA 4CEIA 4CT4B 4RZ2A 3OZXA 2D74A 2AK3A 3B85A 3H4MA 5EP3A 3OFND 4PR0A 2GBLC 4C0SA 1CS4C 4NDZA 1A2BA 1S96A 3EWAA 3VAAA 3AUYA 1Z0AA 3L82B 3L8ZA 4URXR 1IY2A 3B82A 1MO6A 1Y63A 4M8NE 3IBYA 2PH1A 3O8DA 4TTRA 3TIFA 1VDZA 5FFMA 2XNDD 3K53A 4CDGA 3Q72A 1KY3A 5FL7D 2BBWA 4KSBA 4UNRA 1P72A 1ESMA 1SXJC 3BH7A 3CO5A 1CKEA 1T5IA 3JZAA 2WIAA 2UZ3A 1ZMXA 2UVQA 3C5HA 3C14C 1E0AA 2ZU0C 4DDVA 4CF7A 2NPIA 1T9HA 3EWSA 4GZMA 4LX0A 4YONB 4R71A 1I4TD 4S2EA 3UK6A 3NDPA 1N5IA 2FN4A 4D26A 2P0EA 2IYWA 2A5DA 3QEOA 4A1FA 1DAGA 2VHUA 1YZTA 1ELOA 2I1QA 4TMKA 1S3GA 4YMSA 5KO2A 1T8UA 3NH9A 2RKOA 2ONJA 1BO6A 2ZE8A 3EZFA 1S9DA 1OT3A 2QSYA 3DOEA 4JSTA 1N0UA 4US1R 1ZINA 3H84A 2FJUA 5E7JA 3M0EA 4IVQA 1TTTA 4IHQA 1OXSC 3WHLA 1Z29A 4BZXA 3AKEA 3EASA 4AIIA 5HZKA 1OFHA 4TZ0A 4IDOA 2QA5A 4H1UA 3M4YA 3K0CA 4US0R 4TMXA 3T5GA 4A0FA 4FCWA 4M1MA 3VKWA 3WMFA 2OO7A 3I4LA 1DG3A 4FMBB 4XJXA 1NMXA 3CW2A 5CJ2A 2JJ1D 5C4GB 1YZNA 2ZI6A 3DZDA 3LVQE 3CRW1 3B5JA 2GDJA 3K0FA 3LLUA 4YLGA 1ZUHA 1G7RA 2PCJA 1R5OA 4MKFA 5DE3A 4DIDA 2QMUA 2BWJA 2W6IA 1H8HA 2OCBA 1YR6A 4AK9A 3PV0A 1SVSA 4I1OA 3G5UA 4HDOB 1AS0A 1D8TA 4MYTA 1K5GA 1OH7A 3ZS8A 2J9RA 4PAMA 5L3SA 3QJYA 1QBKC 3MJRA 2EFHB 2W6JA 4RD3A 1FTNA 4LBWA 2Q3MA 5DHFA 3QF7A 4MKGA 2V7QA 2JATA 1CJVC 2JDID 1SZPA 1E9RA 1ZD9A 2FSIA 1E2JA 2EYQA 3LVRE 2GHIA 2ZJ8A 1CIPA 4FWIB 3QY0A 1TL7C 2A5FA 1D9XA 1G291 1P6XA 2Q9CA 4Q7JB 2RH5A 4QM6A 3BFKA 4OHYA 1TQ2A 4AKHA 2OBNA 4IDHA 4JT2A 4KYUA 1FUKA 4PPQA 4DSNA 5IK2D 4GMXA 1QHGA 4ZKEA 4NCIA 1NN5A 4LJ5A 1ZBDA 2RGNC 4Q1FA 4OK3A 1S1MA 2WTUA 2XX3A 3CF6R 2C9OA 1E9EA 2VO1A 1Z22A 1YZKA 4PANA 2WSSA 1SQ5A 1X6VA 3CM0A 2QAGB 5TVKA 2BCGY 4ZO4A 4DLSA 1U9IA 3WXMA 4DIEA 1AQUA 1KI2A 1L8QA 3RS4A 1LW7A 4EUNA 4KLNA 4XOIA 4XTCS 3LRPA 1FX0B 1DADA 4LK2A 5GVRA 4QG7A 1Z08A 4DCUA 2CNWD 2VHCA 1G7CA 2ZJ5A 5AUPB 3GLFE 3BERA 3X1ZA 2R2AA 4Z51A 4QBIA 3OESA 1FP7A 4XSHA 2NG1A 1J90A 4ABYA 3DPUA 5JMTA 5TXGA 1UKEA 3CUEF 3OIWA 3KUDA 2B7CA 3QF4B 1T4GA 3SHWA 3M6AA 4IEEA 3B2EA 1UPTA 5HE8A 4AYTA 3ZVRA 5P21A 1KSFX 1S2MA 4JLJA 4DLYA 1YR9A 1GG2A 4I4LA 1Z2CA 2GXQA 3ADKA 2W00A 4FI3C 2OXRA 2IHBA 1M2OB 2N42A 5TDHA 1NIJA 2HLDD 5EXPA 1MRNA 4BFXA 4CEHB 4W7SA 1XTIA 2HXYA 2EU8A 5DNYB 2F55A 4EJSA 3LQQA 2HUPA 1P2TA 4M53A 2CMKA 3EZ6A 4F92B 3CWZA 2ZTSA 4D4LA 1D2NA 5L8VA 1DAIA 1IN6A 1DAMA 3VQTA 3U3JA 4YQFA 2ZSEA 3EPJA 2WBLC 1P9NA 3W6NA 2RGGA 2FGKA 3THXA 2BKEA 1P75A 4JKYA 2QE7A 3WNDA 3ETLA 1XCPA 4PQFA 2HJGA 1XTSA 3P4YA 4DLUA 2QAJA 2QEQA 4L8GA 4TLEA 1IN8A 3TLXA 4B3DA 3FE2A 2BV3A 2BCJQ 4V0KA 2RAPA 3CNOA 2GCOA 2O8CA 3NH6A 3LX5A 4PPFA 3GJ8A 1NJFA 2J5XA 5D3QA 4MGZR 1UM8A 1FNMA 3B78A 4ACBA 4B76A 1ZW6A 4TL9A 3R7WA 3PEWA 5FUVA 4QXAA 4NYMQ 2HEIA 4NCHA 2ORVA 5AJXA 3R8FA 4B3CA 1NSTA 4OJKA 5IDVA 3K9GA 2C77A 2VEDA 4PZYA 1NN0A 1Z8FA 4HZIA 5CM9C 3LNCA 3K0CC 5KNDA 2HDNB 5C2JB 4FXPA 1E99A 3NEJA 2WWWA 3UWKA 4R2HA 2G1JA 1IXRC 3X2SA 1N6PA 2WMOB 4Q03A 5HCIA 1N6KA 4C30A 2XTMA 4Q21A 1N6NA 2ZETA 3BB1A 4EQ6B 3AQ4A 4QHYA 2AXNA 2PJZA 3BRWD 4C7OB 1W0KA 1C9KA 1PZNA 1Z2AA 4XD7D 4KJZA 1A82A 2ZJBA 1JI0A 4M1YA 1K5DA 1OIVA 3QPUA 2B6HA 1VKJA 2CCGA 1E9BA 3BORA 4DT1B 1JNYA 2NMVA 1E2IA 4Q4LA 2HF9A 4M9ZA 2Q3FA 4M1KA 3O8BA 3QUSA 1TQ6A 1E9DA 3VFDA 2IEYA 3K09A 4ZDJA 2QPTA 3KB2A 1I4DD 3GLFA 3W5JA 1U9IC 4DRZA 3IEVA 1YZGA 2ZRMA 1M74A 2F1HA 2ZSDA 1DARA 1KYIA 1WP9A 3AKDA 3DVLA 2FNAA 2NOAA 2V1XA 2ZUDA 2ZRFA 4PPGA 3BD9A 5HE9A 5TY0A 4F93B 2XXAB 3BWDD 2DFLA 2AN9A 2I3BA 2PLRA 1OE0A 1UKVY 1W4RA 3L0PA 3VHXA 4Q1BA 1OKKA 5FPTA 1XP8A 3VR5A 2FFBA 4EPWA 4R7ZA 3RAPR 1HQCA 3HU2A 5CB6A 1XB2A 1EFUA 4HATA 5KUTA 2J0QA 1IJFA 4AWXA 1D6JA 3Q5DA 5B57C 2GF0A 3J81k 4MRRA 2PL3A 3T5DA 4UQOA 2QNRA 4D0NA 1RPZA 1GITA 3V4FA 1U0JA 2OXCA 2DWQA 4FINA 4KXFB 2BKUA 3NBXX 3O8RA 4A9AA 1KO7A 1TMKA 1XZPA 2X2FA 3RS7A 1G6OA 2XTNA 3BH6A 3FGNA 1GP2A 1M8PA 2MMCA 1H8ED 2GA8A 3G0HA 2I4IA 4RCZA 2D4HA 2YOHA 3ZYCA 1MT0A 4NONA 1VIAA 5FI1B 1SVMA 1YVDA 3QKRA 4LOAA 2JEOA 3KL4A 4G5SA 2WKPA 3W5IA 4B33A 2P6NA 1NBMD 1KSGA 3EXAA 2KE5A 2VA8A 4LYJA 2J1LA 5BN4A 4RJLA 1G8GA 4FCTA 3U7EB 4EFLA 2E1RA 5FPKA 5JJLA 1E2PA 2JJ8A 3THYA 4OI4A 2AWOA 4ERNA 3N70A 1W2HA 1RYFA 4PHTA 2HT1A 4Q01A 1II0A 2IS4A 1Z0FA 2EFDB 1JEEA 1TF5A 4LJ4A 3FHCB 1A4RA 3IUYA 5DISB 5DGXA 1Z47A 2J0UA 2BMEA 1R0YA 2XNSA 4W5JA 2REOA 3GD7A 4JLKA 3OE7D 4JYCA 2OAQ1 4I1UA 1TPZA 5HZHA 5FTKA 3GJ6A 4HYYA 3SFZA 4FMCF 1UBEA 2QUZA 5G53C 2C95A 3SNHA 1AS2A 1HEIA 2WAYA 2RB4A 2XB4A 1ANKA 3B1WA 4R98A 4ZDWA 2VP6A 1R4AA 2O8DB 1NVWQ 1YJ5A 1P4SA 3NBZC 4AG5A 2DWPA 4NYJQ 4Q4JB 3LXXA 4TTQA 5KDLA 4DUGA 1ETUA 1SULA 3P1JA 4TT3A 3SHFA 1R0ZA 4F7WA 5HR5A 1CLUA 1LVGA 1OIWA 3NKVA 5CK4A 4TYWA 2WPDD 4G5QA 4IDQA 2V9PA 4HLQB 3EARA 5IF9A 4FMDB 4C4PA 3U61B 4YDHB 5TMPA 1NP6A 1JR3E 2QAGA 2V4ZA 3KXKA 2CHVA 1A2KC 3HU3A 1E0KA 4PAQA 5L3RA 4B34A 5BN5A 3W3AA 4M4SA 3SJZA 2LCFA 1JEDA 3RSOA 4BECA 1UBCA 1U81A 3K9HA 4HDCA 4QM7A 2O5VA 3NG1A 3QVVA 4RD1A 1ZUNB 2QZ4A 5GJCA 4HI0E 3NHAA 3MSXA 3MWLA 3WHKA 3TH5A 2H57A 3BE4A 1E69A 4O3MA 3CX7A 3QF4A 1II9A 3KXLA 5AJVB 2XJ4A 2WJVA 4OBEA 1NN1A 1GRQA 4TYPA 1MV5A 4AKGA 2W83A 3DM9B 2FWRA 4IW3B 2L0XA 3T34A 2ANCA 4F4CA 2PZEA 4G0NA 4BPBA 1QZXA 4LPKA 1WCV1 1MH1A 1DEKA 4CEHA 2ANBA 2H92A 2B7BA 1IOZA 3W6OA 2DY1A 2YC2C 1EWQA 1QF9A 1WRBA 3W8RA 4RKFA 4DCNA 4KHZA 1HTWA 2IYVA 4UNPA 1PLJA 1BYIA 3EIHA 5FPHA 3SBDA 4E5UA 2FEMA 3HPRA 4A92A 4MYUA 3NTUA 1UAAA 3IIKA 1EK0A 1W4BA 1Q1EA 2C78A 1EFTA 2C96A 2WAXA 5J4LA 1W36D 2DHRA 1ZAKA 2IS1A 1Q57A 2R9VA 4GPTA 4HAWA 2YHSA 2CBZA 2QQEA 4HAUA 2R6GA 2WWGA 3AVVA 1Z6XA 1P5ZB 3SEAA 4O2RA 3QBTA 5CM8B 3WRXC 4BUJA 5JJKA 5DYIA 5JS8A 3P27A 3PEUA 4LGMA 3LBHA 4A8JC 4UNSA 2OUKA 1T0HB 5JSZB 1W44A 2ORWA 3CRMA 3ZIAA 1E2HA 4XIGS 2YOFA 2ZROA 1NMZA 3TNFA 2Y8EA 4M0LA 3D31A 5K8IA 3U3RA 1GNPA 5JLJA 4QBHA 1XCMA 2ZSBA 3TQCA 1XJ0A 3QKUA 2RGAA 4BLOA 2RGEA 1OW3B 3HR8A 3MMPA 3X1WA 5HPYB 4LHYA 2AFIE 5BW8A 3C41J 2FDCA 4WZAE 4D82A 1RVDA 4JSYA 3WMEA 4PC7A 4Q00A 3WY9A 5HKKA 1RFLA 3SYKA 4JVNA 3KXIA 4AC9A 1E94E 4BFZA 3R9IA 1OHHA 1OJLA 2B21A 2ORIA 2Q9AA 3BXZA 3U44B 1VCOA 2NO6A 4LJ6A 2A5JA 1TEVA 2QM7A 1DE0A 3DDCA 1AKEA 5E7IA 3RC3A 2QBYA 1G1MA 5EP2A 4DC9A 1B23P 5FPSA 4YMVA 5J4KA 1F6BA 4DDUA 1TUEA 3MAAC 3ZVNA 4M1OA 2H5EA 2O8BB 4KLZA 2CK3A 2F7SA 3IGFA 4C9BA 2KSQA 2CLDX 2Z6VA 3WP1B 1JR3A 1G5RA 4TWZA 3FOZA 3CPJB 2A3RA 3U6BA 2P6RA 4PHHA 5LBIA 1OFIA 3B8HA 4WBSA 4QJ3A 1KZGB 2P65A 2QAGC 4FW9A 4A6PA 1EG7A 2GEUA 3ASYA 3PUWA 4UKDA 4EJSB 1SVOA 2C8VA 2J0VA 1XPOA 2FFAA 1W5TA 1SVWA 1G21E 3H2YA 1W4CA 1Z0DA 1ZC4A 3EAQA 1KI8A 2XXAA 3RYTC 5JEDA 2BHRA 3K8YA 3UANA 3EPHA 3LX8A 3CNNA 4KU4A 4PC3A 1GTVA 1KAGA 1G18A 3NBFA 3PUXA 4EPYA 1P7CA 3W9YA 4DCSA 1M6NA 3THXB 4BE7B 3RS3A 1JJVA 1X3SA 5EZ6B 3IPXA 3OIYA 2PCLA 1OSNA 1FQKA 2NQ2C 4KFTA 4OQXA 3KQLA 2CHQA 3OAAD 1ZIPA 3NWJA 1KDOA 2PMDA 5AUOB 1BMFA 1IBRA 2GCOB 2O8CB 2ODEA 4DLTA 1US8B 3DO6A 2A78A 2JIZA 5KNCA 1WE2A 2VP4A 4POAA 2HCJB 1NG1A 1ZNWA 1NL3A 2F3RA 3MWYW 4LHZA 5E7MA 4BFTA 2JLRA 1T0JB 1M7HA 1IN5A 3ECCA 3LDAA 4V0ME 2G88A 3LQRA 2ZJYA 3IO3A 1DAFA 3MCAA 2X2EA 1C1YA 1U99A 2X8AA 2HCBA 3IQWA 2CHGA 3FFAA 1V43A 3RWOA 1OV4A 4NCJA 3EC2A 4IOJA 2YC4C 1Z3IX 2P67A 2CCJA 4X8LA 5TV2A 3OEHA 2BEJA 1OFUX 1AQYA 1MABB 1ZJ6A 1R5BA 2YWFA 4KO8A 4RZXA 1E9AA 2FFHA 3GQBA 4B43A 1XMVA 1DTSA 3AF1A 1QHNA 3PIRA 3SZRA 4L5BA 1SVIA 1OHHD 2CL0X 2GF9A 1P62B 1SVLA 2JCSA 2ODWA 1NVUQ 1R8QA 2NIPA 5DIFA 3KQHA 1TADA 4GDFA 5LB2A 1OXTA 4OK6A 4O0MA 2DCUA 1T3HA 4PPNA 2O8DA 3KKPA 1XTQA 5AJWA 5H70A 3B1XA 4QL3A 2PT7A 2QSZA 4Q4JA 3T12A 5G40A 3V00A 1XRJA 3U7HB 4OI1A 4MDEA 1I2MA 1JR3D 4OI0A 2O52A 3BC1A 1GL9B 3GEEA 4K81B 3GLFB 2GEDA 3EPKA 3OHMA 1E79D 1PV4A 2A9KA 2CVHA 2WWFA 1TF2A 2JJ2D 4TSFA 4YC7A 4DSOA 5EE1A 4Q66C 2H8KA
chains in the Genus database with same CATH superfamily
2NO1A 2AEEA 1QAMA 3TVDA 4A8PA 1NUQA 4FQ7A 4WCFB 2P3QA 3CKLA 5LCXA 3LDGA 4LBZA 1QV7A 2B3DA 1EHYA 1BIFA 1VKZA 4EK9A 1OX4A 5LXTA 1KI9A 1I3OA 4GRDA 3VYWA 4A2WA 2TRSB 3D6TB 3U9TA 1HYQA 1SBQA 2IE0A 4J7XA 2OAEA 1CCWA 2VT2A 3HY6A 2IW1A 2V54A 4GR9A 4A26A 1DIGA 3I6MA 4B3RB 1VZ2A 2JKVA 3F6EX 3TTXA 4CCWA 4FIDA 1GCUA 3F3YA 4MA5A 3H0EA 1AS3A 5FI0B 5HRCA 5C52B 2JIPA 2E89A 2EJCA 1KNQA 2I2WA 1IM8A 4MTCA 3I62A 3QLJA 3NUZA 3VHLB 2BCEA 2BM8A 2PGOA 1PP4A 2HUNA 5AI5A 1U8ZA 2QNIA 3E81A 3PU6A 4MVXA 4A2PA 3DEYX 1E3LA 1ZGJA 2VP9A 4P31A 3CKKA 3A1VA 3DFFA 4QKQA 4HUQB 4JODA 5FA8A 2BEWA 5TQVA 2PGAA 4X3PA 1Z9BA 2GS9A 3PNOA 3MT8A 5ENVA 4XYEA 1FNCA 3FD8A 4TVOA 3ZS9A 5L3VA 1I1QB 1EXWA 1RRFA 2FHPA 2OFXA 3KKNA 4AG3A 3ZLJA 2J9GA 5TQJA 2WM9B 4X6XA 2JGLA 2VK8A 1ZA1A 2OCIA 3COSA 1WTAA 2ZITA 4JD5A 4XWYA 2W98A 4D9NA 1NLMA 2X9VA 4J0HA 2H06A 2VJCA 1WMBA 5HS6A 1YRHA 4CYMA 2Y0DA 4KODA 7GPBA 3BMCA 2QYSA 3W04A 1COWA 4MV3A 4GOOD 1R6VA 1U3DA 4UXHA 3LSTA 4ZYZA 3QPBA 1KKLA 3PQ3A 3GLHB 3ZVKA 1UM9B 3MXTA 4IL5A 3SI7A 4BWYA 3QVJA 2XXJA 4WXRA 2PX6A 4HDQB 1U7PA 5AR1A 1XQXA 1FFWA 2WHEA 1BXRA 5CCDA 3KWMA 1X19A 2LKDA 3NV7A 4D8VA 2JLUA 3B13B 1OLSA 1FC0A 5CB8A 3KFLA 1RC0A 5JCPA 4OAOA 1UH5A 4I08A 1JIXA 1RZVA 3GCZA 4LYAA 2O9JA 5L7TA 1J0DA 3L0SA 3NRBA 3WLEA 1PX0A 3CLTC 3ZEIA 2XD9A 2WYHA 1IJEA 2R79A 4NJEA 3L0YA 4BKUA 1SEPA 1Z68A 3BE8A 4AWBA 2ZE6A 3OPYA 3U7QB 5MN5A 5TSDA 3FPCA 2JBAA 3AF0A 1O5OA 1KJ8A 2JIRA 3LHDA 4JYBA 5CXQA 3EIEA 5LQRA 3JYPA 1QPBA 1CR4A 4GLBA 1MTZA 3DB2A 4NKRA 4QJBA 4RC9A 5HIKA 5EXDA 4L15A 5EKSA 5BNTA 5I48A 4QO8A 2H2IA 4QEZA 5HG0A 3DD1A 3NBMA 2G36A 1WTCA 3T7TA 4WX2B 1F8YA 2GM4A 3HO8A 3IP6A 3M33A 4OMUA 1G5IA 3Q7SA 5FF9A 4II7A 4AIRA 1S01A 1VJCA 3TRDA 1EE1A 3N58A 1OF1A 2CNBA 4LY6A 1WB9A 1V5FA 3EXIB 4BL5A 3WLPA 5DVZA 4PAOA 4PTYA 4BWGA 3L7JA 1GSHA 2ZYAA 1JWLA 1RAAA 1YDHA 2H1LA 3DT9A 1GKUB 3MHTA 3B1ZA 1Q83A 3K96A 2DR3A 4D98A 1L7OA 2Z6QA 1NE2A 2ZRGA 1U98A 3HBLA 5DYTA 3DW1X 1EEXB 5BYKA 1R27A 2C4WA 3VR6H 1SIWA 3TJRA 3VO9A 3K1JA 3O1JC 3FKJA 5IBCA 1BDJA 3D5TA 4EKNB 4IDDA 5G4KA 4A10A 2FZCA 2HJWA 2WUEA 3FKSA 3SOPA 1VPTA 2Q8NA 3H9EO 4NZZA 2NSLA 4EKEA 3W1WA 1DRJA 1V8BA 1V9CA 4JK3A 5EYPA 5CW1A 1O0SA 3WQSB 4TQUS 4KNYA 1NBEA 2BTOA 2YV5A 2AOWA 4UU8A 3TLKA 1C9JA 1A9QA 4QU8A 3FUCA 4L3WA 1HT1E 3N86A 4Q3NA 2ZPAA 5FADA 1DVRA 2ZDHA 3SYTA 5J5VA 4Y2GA 2WM2A 2XCOA 1CZLA 1GG8A 1Z6AA 4LCBA 4OBWA 1JV2B 4CUKA 3KEMA 2P7IA 1ZYUA 5EE5B 2VNAA 1TEHA 1BGWA 1P3DA 1TQDA 1CJUC 2HV8A 3JPYA 5EQJB 2C0QA 2OO3A 3C4JA 3JD2A 5A7HA 4P83A 2HGZA 4JJZA 3T7SA 5GM2A 3UC5A 4CTOA 1UMCA 2RHHA 3DBIA 2QJWA 4XARA 5JJIA 1HURA 2YN4A 3ZY3A 4NMMA 1ODLA 2OQIA 4TN5A 1GVNB 4MO9A 2P79A 3BWYA 3KT6A 4JA0A 3V8QA 2D5BA 4RHEA 4WKPA 4LX8A 2JA1A 1C3LA 3D5EA 3OF3A 2QM0A 1EFRA 4PZ0A 5AVXA 3P26A 1I6KA 2R8ZA 2O07A 2QVCA 5JVDA 1IY1A 2WW8A 3JSAA 2Q5JA 1I01A 1BFKA 3NOXA 2NXWA 2ATCA 3Q9LA 3QXXA 4PRLA 3M6IA 3RTGA 1WZNA 3D2CA 3EDCA 3MPOA 1WBBA 3JD3A 1S8AA 3TR0A 5DNUA 1XVLA 3P0FA 4L2IB 3RKSA 4ECEA 4BO5A 1ESNA 2K5UA 4D1YA 3UMCA 3JQPA 4JWTA 2HIHA 4E22A 3LZDA 1C8BA 2RHTA 3WZ2A 1XMIA 5BV7A 3ESCA 5AKHA 5BYAA 1WY5A 4KO1S 2I3DA 2BMDA 1KR5A 3LUJA 3Q3JB 3CZPA 3QKSA 4R2KA 5I9TA 3RGWS 1JJ7A 4DIUA 4GM0A 2QM3A 1C3OA 2QY9A 1J8YF 1WL8A 2VT3A 1X8JA 4JT4A 2Q99A 1ODKA 4WLFA 4GP9A 3QI7A 5IJ9B 1NT4A 3VNQA 1MOPA 2C84A 3JVIA 4PHFA 5AW3A 4HS9A 1NVVQ 3UPTA 4M89A 4MIOA 1W4ZA 3DE6X 3SM9A 4PNEA 3QXJA 4PR3A 2ZYTX 1O5TA 4ZT2A 3NHMA 2G71A 2FN7A 1HFKA 1PFGA 3CSDA 3PR2B 2WSSD 2NV0A 2HCFA 3FJYA 3AERB 3OC6A 1HY3A 2FR8A 3REOA 1T5OA 4D99A 1ZWKA 4YAFA 2W8BA 2YY5A 3K8OE 3R6GA 1U0EA 5TGZA 2O3RA 2HBQA 1CG6A 4KJXA 5AJYA 3SZMA 3UG7A 4BQFA 3H7IA 5AFSA 1VBKA 3QVGB 1U1IA 4OLFA 5JECA 3UMGA 1I6WA 1Z5GA 2XGMA 1JTVA 3EGDA 3L43A 3TKAA 3W79A 4EA7A 4BGIA 1H2EA 4HGPA 4RJIA 3AIMA 2C3YA 4M0KA 4R1TA 3KJGA 5CJPA 1PS0A 4MINA 2VXBA 3VVBA 2B8WA 1AZTA 3AIIA 3LTEA 4FKZA 4M46A 3E7WA 4DCPA 1HWYA 4BNWA 3I6IA 4TV9A 4BLVA 1RJ9A 1BXZA 2IIBA 1HFEL 1LD3A 4YMWA 3IV6A 1L5GB 1B73A 4RA6B 2ZANA 2ZP1A 1V6AA 3EQ9A 4Z49A 4Y2PA 4WY2A 1HDRA 1KDTA 2X0KA 1VZ3A 2O3TA 5DWVA 2PUBA 3Q87B 3VNBA 1J2UA 1UJBA 5A4KA 3O0TA 3HJRA 2JLVA 4AO7A 1TKBA 4CQJA 2FUNB 1VKNA 4IVPA 3EW9A 2NQTA 3RK1A 3JYNA 2NTVA 2VPIA 1UZLA 1PUIA 2O57A 2WIGA 3JWJA 4BQQA 4ZOAA 3H9CA 2Q9BA 4KQ9A 3AF6A 4EVSA 1E3TA 3LXUX 2YJZA 2ZWPA 4CKEB 2CDAA 5DO9A 4RF2A 2QP4A 3ZOZA 4F6CA 4YT5A 3I73A 3N0XA 4CLOB 3HB4X 2W2KA 3DZ8A 4KQCA 2C42A 2JFGA 3INNA 4TLBA 2G4LA 2WJHA 3KT0A 4OF4A 4PYRA 3IO5A 4P7JA 3VO8A 3VX4A 4A03A 1KK1A 1QIMA 2XSZA 3NWPA 4YBZA 4F9EA 1XTBA 5CXUA 4ENQA 1CQWA 3HKEA 1ENYA 1SUCA 2C94A 3SYNA 3HXLA 4Q19A 2HYDA 2ZUWA 1YACA 4PFQA 3PP8A 1OZFA 2BM0A 4KV7A 3EA0A 1SVNA 4FILA 3JASB 4RPLA 1YQTA 3ACCA 3ZPXA 4ER7A 4LQLA 4PLYA 2BJHA 3KTAB 4D0SA 2YV3A 1F8XA 4G0ZA 2IY9A 4Y0VA 2HK7A 2VXYA 4J7CA 4MUBA 5TPZA 3K70B 3DOOA 1XHLA 3CLUD 3D4LA 1KDPA 3GT7A 2DKFA 2QLMA 4L5CA 1DRVA 3WDMA 1QDLB 2Y92A 5BWNA 3GEPA 4DDMA 5G3YA 1GG5A 1X92A 2P27A 4XEHA 4RY0A 2PWPA 8ATCA 1GPYA 1SH7A 2A0YA 2GPSA 3DBVO 3R2JA 3UK1A 1Q7RA 2H2FA 3B5EA 1JBKA 3HBAA 3R1IA 4JUBA 4QYWA 1H3FA 2F48A 1ZCAA 4TWBA 3GT0A 4X0EA 4P3XA 3I2YX 2IW3A 1O4WA 1TX4B 3K94A 5K3FB 3E9MA 3N7AA 1HEYA 1XD2A 3O8QB 1EZZA 4HNSA 2QI9C 2YHAA 4N5NA 1U5CA 3UT5B 4BTLA 4EELA 1FS4A 4DLRA 3CH4B 1E4YA 4RKEA 4BNVA 1AN0A 1MNQA 4Q7LA 5JFGA 3TLGB 3HBFA 1ECBA 2LZ0A 5BQOA 2SICE 1GV0A 2UYYA 4P5DA 1LSSA 1KJNA 1NONA 2AXEA 4BC0A 4J1SA 4B32A 4ZVOA 2JZCA 3JWIA 2IYEA 3RC1A 1M1YB 3IKJA 2Z2YA 5BV8A 2XOKA 4PO8A 3RRJA 2ZULA 5H0IA 4ANFA 2OLKA 3JWEA 1WMFA 1KI6B 2ECOA 2IP2A 1B8VA 3D1LA 3O4GA 3U4CA 4X71A 4DNOA 2FRDA 2J08A 3RUPA 5JH7A 1EXVA 2QRVB 5IMBA 1YOVA 1URPA 4P92A 3AVWA 4U8HA 1KEVA 2BFCB 3G0CA 3VM6A 1IZ7A 3RSLA 4YYEA 2JCXA 4KKVA 5LP6F 1IBMB 5BQ3A 3A6PC 3OTGA 1FFXB 1QORA 1GTZA 3QBJA 1JFTA 1VTKA 2DFVA 2Z3VA 3FR8A 1K3UB 4K88A 5T3UA 3FWNA 4HYTA 3FZYA 1V8FA 3Q85A 7REQA 4XGIA 2QMYA 1JIIA 1B93A 2J45A 4JMPA 5IAEA 3IULA 1FPMA 1K7EB 2D1RA 5L3QB 4DRXA 1W46A 3O93A 1IXSB 2J5QA 3ZE9A 4O2AB 2W0MA 2ZQ5A 3U17A 3TOZA 5LA6B 2XOXA 4FXOA 2XRZA 4N8EA 4KQWA 4MR8B 2BR5A 2C2HA 1SUFA 2ZB7A 3BE5A 1M2VA 1W581 1YD7A 2A5GA 4RHYA 3W4JA 4M8KA 3L7BA 4WLUA 1PU2A 3ASZA 5JAZA 3J7AC 5DCWA 1LCIA 3D4OA 2EW1A 4OSOA 2V9ZA 3SBXA 3ZJUA 5FB3A 4WECA 4WW0A 5FUXA 3GLGE 3OUTA 1G17A 2OFWA 4QIHA 4YRMA 2Q2VA 1C9NA 1Q0HA 1YOBA 3VNRA 4XYGA 2LCQA 3VR1A 3ZJYA 5H3LA 4KIFA 4XH9B 1NNLA 3RC8A 1V7QA 3IAAA 3PJRA 1L0BA 5TEWA 4OLHA 3DEKA 3LH5A 1QH1A 2VLIA 3MEQA 1K6MA 1PKXA 5DSZA 3RPEA 2GESA 3GPCA 3PCRB 4C4YA 3M1IA 3EJ6A 1FTQA 1VLZA 2ZIFA 5KS2A 4XCVA 1Z34A 1YDWA 3BRCA 3BWVA 2AN1A 5DPMA 4L4RA 1KRHA 1YJQA 2AJDA 3KR1A 4BVFA 1Y3FE 2I9PA 4AQDA 4DWWA 1U63A 4P82A 3F7TA 1YBMA 3A3NA 4IEFB 1U8EA 4O4JB 3TZQA 1TCBA 2VNJA 1I2ZA 1PFYA 4B46A 1FB5A 4ILEA 3DEZA 2PKQP 4BN0A 1IOWA 1XVIA 4MQBA 2XUDA 3CE9A 2ZYVX 4NOKA 2QRJA 2ZUFA 4X1IB 1M73E 1GT6A 1SCDA 3EZYA 3FUUA 2Y0BA 1CQIA 5AKYA 4DCVA 3PITA 4N7RA 3U56A 1PZMA 2AIRA 1MVNA 4FN5A 5TQ0B 5REQB 4AF8A 3HCDA 3ST7A 4BO1A 4K3UA 1J0AA 5HQ3A 1KY4A 2E3JA 2CYAA 3RC7A 1GKLA 1CQJB 2SBTA 3TEJA 1L8LA 3PVZA 2C2ZA 1MTOA 1J21A 4KTTE 3BYZA 4I4TF 1XROA 3CS3A 3ELYA 3SEFA 3DFZA 2WV7A 3DXYA 5DYYA 3BJZA 4ZV4A 3OLXA 2VHQA 4Q1VA 1SB8A 4DJDC 3J80A 1V0JA 4RHTA 3U1VA 4DJEC 4LZPA 4Z1MA 2RH8A 3LX6A 2L69A 1DBVO 3RM3A 2VP3A 1XU7A 1T2FA 4HAZA 5BY2A 5C1BA 3FPSA 3MOSA 5JNUA 2C7QA 4TT3D 1IONA 4FYWA 2VSXA 2A9VA 1L5MA 3AEKA 3EIQA 3PL1A 4YB8A 1ZH6A 1Q0TA 1N4DA 2QMZA 3CUVA 2ZYUX 3L79A 2ZQZA 4XOUA 4E2XA 4I50F 2WJYA 1A9RA 2ADOA 2X40A 4N5HX 4B6JA 4DADA 1TW3A 1LDGA 2JGIA 1ADCA 5F9HA 3E8SA 3L5KA 4S1NA 5J40A 1XDGA 4Q02A 3HRKA 1FMLA 1M66A 3T7KA 3JXEA 2GPNA 3OD5A 1SBYA 4KIJA 4MROA 1F14A 1OPXA 1GN8A 2NYVA 3KSRA 2R2GA 4JYPA 1DU4A 2BF4A 4IRMA 3ZE8A 4DA4A 1EHCA 4PE5B 1SRQA 3ES9A 4QPDA 1H6DA 3TAHA 1VIVA 4G3XA 2ODNA 2VNHA 3PXXA 4MOWA 4XAQA 2GZ1A 5T4HA 1VB3A 2ZIXB 1U8FO 2D2IA 3CE6A 3LRTA 3H16A 1X1SA 4RVSA 1B8UA 2K87A 4C0LA 1SBTA 4DCTA 1TVKB 3DBLB 3UICA 4PNPA 1X7ZA 1Y80A 2HPAA 3R3YA 2CUZA 1JI3A 4R2WA 2LKCA 4E09A 2NUTB 1Q0PA 5KYWA 5DBGA 2X14A 2P5YA 2GBPA 2PS0A 4WOPA 5TMEA 5I7OA 1CUZA 4CIAA 2JLYA 2Q3BA 3BAFA 1KVRA 3N0VA 2HL6A 1NVGA 2GVNA 2W7TA 1GY8A 1FRFS 2B1GA 3GFSA 4JR0A 2WYIA 4AJIA 4CMHA 1QHSA 1NIPA 3S2YA 2ICAA 3B53X 1XJQA 2QVXX 3C3JA 3CLVA 4QPNA 4A2QA 1RI2A 4NABA 1P4AA 1ZVMA 3A58B 4V03A 4XR9A 5MN4A 1LA2A 4DC0A 4WZBE 1CYDA 3BWBA 4ZVQA 1QB7A 3JQFA 3LECA 3M5CA 4PYOA 4RM3A 3K5HA 3R20A 4HFJA 5K3SA 3TR5A 3V9AA 3DL0A 4JJ8A 3NHUA 1BGXT 2BGNA 4YASA 3GLGA 4FCCA 4ZQCB 1NULA 1GUYA 3A6EA 3H3JA 2RI6A 4GU5A 1D5CA 3A1EA 3VKGA 3F8SA 1RHJA 2JFZA 4RE5A 1TU3A 1DQZA 1L8AA 2VVTA 1HL7A 3NYRA 1JTEA 1Y5NA 4DMMA 4TLDA 4EL5A 4YLYA 3AY0A 1SA0A 1P8AA 1XD9A 3CRVA 3NOOA 4LKOA 4QDJA 4QBFA 1R5NA 2PTHA 3P9ZA 3UMSA 4J9VA 1TOAA 4HAXA 4MPJA 3BB3A 1B0UA 1XBTA 2OHIA 4Q7KA 4MB0A 5FUYA 3EGXB 3U3ZA 2XA1A 4DR2B 1RR6A 3L18A 4F6RB 1Q2UA 5JSFA 2IXEA 4J0QA 4B3SB 1DBRA 1RI4A 3WVNA 1G8SA 3E84A 3PUKA 1M2GA 1PGQA 1R2QA 1NI3A 2FSGA 2V5VA 3GGJA 1Z06A 3OY7A 2PAFA 5EZYB 1J0CA 2VDMB 3PDWA 4L16A 5SY6A 3MGAA 3R44A 1GYRA 1UT8A 1RYYA 4B4KA 1FBNA 1D9ZA 1HE2A 1F9EA 1SBZA 1P4HA 1ZX1A 3FUXA 3ORHA 4KYTA 4L74A 4TRMA 3TE7A 3TUIC 4EGAA 3DJYA 4HQOA 2OLJA 1PT9A 5IVKA 2VDUE 5A0FA 5H02A 2DBVO 3M8KA 4V1CB 3ZXSA 4CT5A 4U8GA 3EQ8A 3U4QB 4L8WB 5JCJD 1BE0A 4ADSG 1XMXA 4F9TA 5LM3A 1KK2A 2C4UA 4L9RA 4NCAA 1IJBA 3HCFA 4ZT3A 4BLTA 4CV3A 3H1TA 3B7GA 1CQZA 2SNIE 4AMUA 1R74A 2O2EA 3ANYB 2JCGA 3IQDB 4NU8X 4IO0A 5CLLA 4RPGA 1JL3A 2WJ4A 3PNBA 4I1VA 1SKYB 5D3MB 2XDWA 4ISCA 2CMHA 2XNJA 2RGNA 1JLLA 3HJGA 3DD5A 4L4SA 4KWIA 3V1YA 1KZ6A 2NSHA 2X6RA 4I3GA 4KFRA 5CFZA 1HDXA 2XEXA 3LKVA 5KTKA 4QOFA 1E3MA 1M0SA 3FTDA 4RESA 1NMYA 2CK3D 1W9HA 1Y82A 1GFZA 4EFMA 2C5FA 2VYND 4BU0A 2PZGA 5KQMA 4L1KA 4WVFA 5K8UA 1O94C 2A7XA 4F7DA 1NASA 1JPJA 5LZ8A 2DB3A 3GLIE 4ZO6A 4BLRA 4EMBA 1K89A 2FV8A 1OWLA 3W8DA 1HMYA 1ZOOA 1C41A 2I6TA 3PE6A 2W6CX 4JY7A 4NATA 4NCXA 3C8ZA 3HXQA 1K7YA 2XCSB 2RGBA 2WICA 5TX7A 1FTYA 1KIMA 4JB0A 4WFJA 3WK5A 1TJYA 2I6SA 4CL3A 5BNIA 1FYDA 1XU4A 3MUEA 5LQSA 4JYZA 1XEXB 4MRNA 2WFLA 5IDXA 1UK8A 1SMKA 2B8TA 5F21A 1WZ2A 2IL1A 3IQHX 3VOTA 1UWLA 2EF1A 2O2DA 3I1FA 3B6IA 1W94A 3IA7A 5DV9A 1MT3A 3CLSC 1F60A 2IVZA 3UW3A 5JNTA 4UPDA 1FLDA 4NYJR 3INGA 3STWA 2Q62A 3DQPA 5GGXA 3SC6A 4E1AA 3RWMB 1X38A 1XXHB 4IV8A 2JLBA 4KXXA 4E5DA 1EBUA 2JGKA 2WOJA 4PBSA 1LX7A 3HE3A 4FOLA 4N3CA 1P5RA 2R4QA 3E1GA 2AD5A 3KEGA 4GRAA 4PYQA 4Y3UA 5IBRA 4EMUA 1HRKA 3CB2A 1EK2A 3MCZA 2ZSHA 3FBWA 5GONF 4Z4GA 3QVMA 3BUSA 3GMSA 4WZBA 4ZCPA 5JC8A 2IBMA 3S1AA 4C05A 1X1QA 1E7MA 3VA7A 3PGA1 2DYKA 3H0KA 2PEYA 2JBWA 2YIDA 2FLKA 3OM0A 4J49A 5KNCD 3PC6A 4ABTA 4CE6A 4KXUA 4V0LA 3TIGA 3HG7A 1UC8A 3ZH9B 1ZMRA 1OAOA 4QQNA 2ARKA 3EUAA 3RRYA 1TA0A 3JQFC 4D3SA 3B9BA 3PYLA 4HFMA 1N0IA 4IXTA 3RVJA 1PG0A 1X7YB 5BNFA 2DERA 1HXHA 2O7RA 3K70D 5KEIA 1EJ6A 2ZJ7A 2WT4A 4JJGA 4XDYA 4JENA 1BYUA 1UJ5A 3ZW7A 1V16B 3WWEA 2NV6A 2Y6UA 3TSYA 1JEYB 1WDMA 2OC9A 4HNRA 3KPYA 1THMA 5A9SA 1JG1A 2OD7A 1MVLA 1JGTA 2D1QA 1HDOA 1OZGA 5FAXA 4RTKA 2FSVA 2XB8A 1PUJA 4RJ2A 4GO1A 5IAAA 1D6NA 2JG3A 1ZG3A 1Y6FA 2CNLA 4WZZA 1ZCZA 2Q3CA 2PFKA 3HXTA 1JQEA 3KR2A 1NVTA 3NHLA 3QYPA 2YZMA 5HILA 2Z9CA 3Q8XB 4P8RA 4IJWA 4C2TA 1UAYA 4D5EA 3W2HA 4PZZA 5CITA 3C1UA 2R48A 2XKBA 4NF2A 2CNKA 5ALPA 3ZZTA 1GL6A 5AVRA 3WRVA 1QLJA 1QX3A 2O2YA 5L3ZA 4D45A 3L7DA 1YHZA 2CXOA 3DO8A 4Y2HA 1L9KA 2OK7A 4YHHB 1DRKA 2XGOA 4B7CA 4REOA 3NGMA 4QEDA 1D4FA 3EA5A 2I2XB 2OZLA 3MA0A 1MIOA 3Q1LA 4FBLA 3UKDA 3FG9A 2IEGA 1NJ2A 1N2XA 1N25A 5AT1A 5AXDA 4CMKA 4LJKA 1EP3B 3QENA 2YBDA 4OP2A 3HUFA 4D57A 5KIAA 1WJGA 2HF2A 4KQMA 3I2IA 1D6MA 5BMVF 4ZQGA 4KQEA 2XBUA 3TD2A 1RVV1 1QGZA 1SIOA 4NBLA 1XF1A 4E5KA 1E6CA 4IIYA 4P33A 1Q1BA 2FEKA 3WBKA 3V4OA 3ELWA 1NDHA 4AXBA 4M1QA 4QNMA 5AVZA 1JKJB 5AVJA 1X2EA 3IUSA 3PFGA 3T0GA 1L8XA 3R3XA 1KPIA 1FJXA 2IUEA 3GVIA 3EZNA 2ZRAA 2EX4A 1XD8A 2R84A 4MVJI 2VH5R 2F9MA 4OXRA 2NACA 4B4WA 4F4IA 1U0OC 2Z09A 2J7PA 2IKSA 2R1VA 3INRA 1KSJA 3AF3A 4IIVA 3SY8A 1W5BA 3UAOA 4FPXA 1L5SA 2F3SA 2ECKA 3F98A 3G8CA 2XDQB 1YQEA 4MV9A 1UP4A 5H4HA 4BCBA 5C3UA 3FJOA 5FFFA 2ZI9A 4FMCB 3PC3A 1M34A 1RWKA 2OHFA 4GOKA 1Y3IA 2VHEA 3T95A 1QQAA 2OZPA 1NLFA 3WLNA 2XUGA 4AURA 3BRWA 4MVYA 1G20E 2VJKA 4NAUA 1K8QA 1N2CB 1SC3A 3GT4A 3I72A 2Q5HA 2D1TA 3F6SA 3GLIA 2PGXA 3HEBA 4INOA 1Z5UA 3GGDA 3WYFA 1RZRD 1Z07A 3IAUA 4LF7B 3BQMB 3NEAA 1DXHA 3Q7PA 3S29A 2MSDB 3MGBA 5HA5A 4E07A 3G5MA 5ITWA 1XLUA 1QOPB 1PJ4A 5K0SA 4GPD1 4RACA 4HAVA 3W34A 1MJ5A 4OM7A 1O87A 1QIDA 4D9FA 3Q9SA 4JLDA 4NE9A 1VA4A 4DUZB 1CY4A 4IDPA 4U2DA 2EWMA 2VRWA 2F1JA 1ZHHA 3G6WA 3SR4A 2XUOA 3AVQA 5FI3A 1GTRA 3RYCA 2IXAA 3ZY5A 2QLNA 3WG9A 3JVVA 3GEIA 3UHFA 1LK7A 4LQDA 4G9EA 2O4UX 4D44A 1O97C 2E4WA 3PI6A 4PAGA 4FFWA 4N1AA 1BCSA 4PS0A 4Q15A 3KYDA 4AKEA 3MD0A 4LNUB 1O9HA 1SBCA 4YJ2B 4MYCA 3QK7A 5LOVB 5GTDA 1BU5A 3V3TA 4Y7CA 2H1SA 4GPZA 2O14A 3GIDA 3C3MA 1DWQA 3HNOA 4QVIA 1I13A 2XE8A 3QA9A 4RZSA 1GM5A 1SQ0A 2IHKA 3BQNB 1PGPA 4C87A 3ANTA 3ROZA 1E77A 1XCJA 1KBQA 4G0YA 4CIDA 4PN3A 2X23A 1DPFA 4DQVA 2W37A 3B6EA 3I5YA 4CM7A 3UMFA 3GZJA 1DIOB 5D7BA 5C51B 1K6JA 2P5TB 2ZBQA 2HN9A 5GJWC 1I32A 2COKA 2I29A 1EJBA 3BMQA 4U39A 1I94B 3RKRA 1G7SA 1T4CB 2BL4A 1XL1A 2WYWA 5EKXA 1WSDA 2PT9A 4LYHA 5ERYA 2A30A 1SO8A 2GZAA 1A4IA 2G1KA 1OAOC 4MUMA 4UBIA 3W7AA 4O2BA 4Q3OA 1NVKA 2GN4A 4HDKB 3VR6A 2H4YA 3I1JA 3PTLA 5IS2A 5KJEA 5EJ7A 4RTPA 3PX3A 1DXOA 4YEDA 3AVXA 1V37A 1YKSA 3P0IA 4D46A 1OPRA 3B3AA 3GB9A 4CI0B 1O2DA 1GGNA 4X9XA 1B6SA 1CK4A 3OIGA 2IXGA 3ZI7A 3UW1A 2FDRA 3GVXA 5BVGB 1QX4A 4Y9DA 3I2KA 3URKA 1LLQA 2IDJA 2PS1A 4B71A 4C3ZA 2DBQA 3W2GA 4P3YA 4U9UA 1SCUB 5HS4A 5I3ZA 2GJKA 2JGAA 2RGWA 2QN1A 1EVKA 3O95A 2FB9A 2JK1A 1AXGA 2J30A 3GRCA 3R5XA 4M9XA 4QOSA 4CEJB 4XVCA 1DLJA 2AE1A 4I4IA 1NKVA 4GLOA 2FKNA 2P8SA 2ZAMA 3GFOA 3OM1A 4MCHA 4WKBA 4DARA 2OILA 1DAEA 2I7CA 2YQZA 5CH3A 3D8BA 3DBRB 4M0FA 1HA3A 2O3SA 1ZM4A 4OJYA 4LE0A 1Y5MA 4CKBB 3L0IB 4JQOA 2CDRA 2HWXA 4N6OA 1YL7A 2EKZA 3DF7A 3WV5A 3BAZA 3FVVA 4HDAA 4BRUA 3NW9A 2O5CA 2H17A 2C82A 2H08A 3GPBA 3KFXA 4DILA 5EG5A 4Z7NB 3ZCTA 4D92A 5ERXA 4A0GA 1XDZA 4JC4A 2WHQA 5EIAA 1E2LA 3W2IA 1RW4A 5EXSA 1KDZA 2JGRA 1P2FA 2QRGA 2IDMA 4FW8A 3GJXC 3LGSA 4OX9B 2IELA 4G97A 1F5NA 2EWWA 3ROGA 2NO7A 3ZYZA 1V95A 3EQ2A 3K0AA 3BWCA 3OE7A 4BFVA 1YR2A 4V0RA 3M82A 1XZEA 1P7PA 2O8EA 2LP4Y 1WW8A 1EI9A 1S7CA 2VCHA 4UAJA 5L53A 3ZK8A 1DAHA 1CBUA 2XTZA 1HF3A 4UM5A 5I7UA 1QP7A 2ZRIA 1D2RA 1UZAA 3LPCA 3H9QA 3AFGA 1WXGA 2WSBA 5AKEA 5IABA 5J5CA 4U2KA 4RGQA 4BNTA 4PYKA 2DPHA 2G6BA 3I9V6 3M9LA 2G83A 3CZQA 1KOFA 4A6EA 2GA9A 1KK3A 3KTFA 4UCFA 5AM3A 3NEPX 2H7VA 1S0UA 3D6FA 2GXSA 3DAHA 2OVFA 4A82A 3AG5A 1RRGA 2HKIA 1FQOA 2PKYX 3LQ4A 4WFIA 4W5OA 1G20A 1IG0A 2PXAA 5J2TB 1B8PA 2CF5A 1RE1A 3DWFA 3CUYA 4LG1A 5AJHA 1VIDA 1KHTA 1SHTX 2ORED 3QTBA 3F5MA 5BYJA 3HXPA 4LCEA 3IVXA 5CDGA 2P0AA 1OVGA 2XUPA 2WILA 4MS1A 4X66B 2QRNA 1VPLA 2G7MC 1MORA 4BIIA 4OQEA 2NXJA 4XSGA 1FTGA 3AINA 3V5NA 3W8NA 2HO4A 3KWLA 1GCIA 4E51A 2BEVA 1LV7A 3BE6A 2IYYA 4NBRA 1VG8A 4LVCA 3C7TA 5H8WA 3CPHA 1L3IA 3VGJA 1STOA 2X7JA 3G1WA 3S1LA 4ES6A 1SQ6A 3LTNC 1T2EA 2JRLA 4YO8A 1B43A 2X77A 3PXBA 3G6KA 4Z7JA 5KYVA 5JASA 2HRRA 2PBZA 3A9TA 4IUDS 3EG9A 3JVUA 4MKZA 1HX7A 1LDEA 4NNOA 4BGUA 1MPTA 1VRWA 2QTVB 3GUCA 3P8ZA 4BPRA 3K1TA 2XWQA 1WV0A 4EDHA 1HE1C 2JVKA 5BR1A 2FGJA 5IUJC 3IA2A 2ADFA 2Y0EA 1ULTA 3I04M 4IWYA 4RH0A 3V80A 3ZDYB 4QUHA 5JT1A 1I7DA 3WNCA 4BMCA 4N6NA 3UXYA 3ZWVA 4EQZA 4IGEA 2FPWA 3MTGA 3S3TA 1Z88A 1JB1A 1W96A 4AROA 1L4LA 3AKCA 2A57A 5B4VA 1U65A 4H7PA 2G9RA 3HDQA 3WRXA 2GTPA 5CFOA 3R9XB 2JLZA 1XNGA 2DBZA 1DCKA 3EYWA 3MLEA 2N3ZA 4Q5IA 4A8JA 4CM8A 4WADA 3H2IA 3A4LA 3JZDA 4HUTA 2DETA 3FWZA 2FWNA 1GZ4A 3DTVA 4XPZA 2BDEA 1RWVA 2W0SA 4P84A 3KU1A 3UAZA 2O05A 5LR6A 5CA1B 4PG6A 4RY2A 2DWUA 3Q7TA 2Z08A 3ROKA 1W93A 3AR8A 4KBGA 1W0JD 3GRRA 1PEDA 2FMUA 3ZJ5A 4ZV7A 3R7DA 4ONEA 5IWCA 2CL6X 5JI3E 2LRHA 3LAWA 4FYJA 5KVAA 1Y9EA 1ABEA 1YRAA 4PGMA 3QEAZ 2D3WA 2GD1O 2JANA 2MYPA 3O73A 4DCGA 3CH7A 3V8PA 1YU6A 2JHGA 5KTSA 3FCSB 1VIYA 3ZI0A 4EG6A 1M7GA 4M8IA 2V45A 5JCXA 4CT0A 4EAAA 1CF2O 3PFHA 4NJOA 3ABIA 1WKCA 421PA 4IV5A 3CRQA 3NPMA 4PX3A 3RV3A 5IDWA 2VAXA 3PSHA 4J1TC 2R65A 3N2YA 1G16A 1A8PA 2PPLA 3CISA 4Y1EA 5LLSA 4YRZA 3S70A 4B80A 4DEVA 4KR0A 1FL9A 3FYUA 4JLSA 3RJZA 2YXPX 3TRJA 1RM5A 2PX8A 4JA2A 4I55B 3V42A 2PVCA 3BA1A 4MLDA 3RHTA 3VDNB 4GT1A 1ISRA 2BGJA 2NT4A 1Z26A 4Y9UA 1RQPA 3OWXA 3FMVA 2E5FA 4IV0A 3BEDA 4RQUA 5K6RA 3L1IA 5U1PA 1KO4A 1UINA 2X5OA 3TSZA 5KSYA 3D3QA 1RXCA 3U39A 3QG5A 4YCAA 4QOGA 3EAGA 1QS0B 2DH6A 5KKNB 1P2UA 2VF4X 4AYXA 4AYWA 2QP3A 4UBOA 2CCKA 1ISSA 4AMGA 4YRSA 5BN3B 1KERA 3LDUA 2C1ZA 4F3CA 5KYXA 2RK4A 4QUAA 3I28A 2ZR0A 2AHOA 1P9WA 4Y6SA 4NICA 4FOTA 4CFYA 5ELMA 4MDFA 1C4OA 3F5FA 2ZJ0A 2FG6C 1GAXA 5HMLA 3FH0A 1RT9A 2IOQA 2WIDA 4LEIA 1HYHA 2NO9A 1L3CA 1LK5A 4JP2A 1K06A 1WV1A 3HU5A 3QLTA 3TLAA 1G5QA 3CEHA 1TKAA 3LX4A 1Q3HA 1KVUA 2WAMA 4R9SA 3CX8A 4D4MA 1M6HA 4Z4HA 4D4JA 3OOHA 4HLUA 3IL2A 2RGDA 3IR5A 5ALSA 4AVYA 4HVTA 5KC9A 1FZQA 1PX2A 3FLAA 3GV0A 4FYIA 4DPMA 5JCOC 4LFCB 3WKEA 4YRFA 3L1UA 3N7TA 3GMTA 3H11B 2FQYA 4HDSB 4WT7A 3IPRA 2IYFA 3NB0A 2WU8A 4NHEA 4O59O 1P1JA 3AKYA 3LU1A 3QNUA 1TM3E 1BKSB 2KLBA 4OH1A 3WK6A 1UK9A 3EXHB 4AY6A 4E31A 1FNDA 3RHSA 3ND6A 1N5MA 1THGA 2EDCA 2ROQA 1QKJA 3I9FA 4QELA 2WFAA 5IBPA 4BNLA 4ZEMA 2MSLA 3AJRA 4MAFA 5JDIC 4ZDKA 4K9PA 3DHEA 3ETCA 2YMMA 4L57A 3VPGA 1T9AA 2SCUA 1X13A 3Q0IA 3WDKA 1J5EB 1FFGA 3T1NA 1T8YA 2B36A 4BMDA 4S0XA 3E4CA 1FUEA 4WESB 4X5OA 4CMEC 5KWVA 1BE8A 4G86A 3PEYA 2C1XA 4Z0HO 1RRPA 3OIVA 4GSYA 2V0GA 1EDOA 2EGUA 2GVDC 3V4PB 4BZPA 5AVSA 4UXIA 2CFTA 2VDQB 3RTAA 5JRJA 1RHRA 4KW7A 3M6FA 4BNYA 1GGHA 3JV7A 5CDSA 2W11A 3W4IA 4US2R 1Q74A 2J3JA 5ALGA 3ZHUA 2R7MA 1TMYA 2GJ9A 4JLBA 2FZGA 4RD0A 4UCXA 3D8UA 2X86A 1V7CA 1RBMA 1UBKS 3KALA 3N3AC 1L5NA 3WSTA 4BJ1A 3G13A 1F3OA 1ZPDA 2OAP1 3EVDA 2PAAA 3H2KA 3KUKA 5CVJA 3HSKA 3WGMA 4BQSA 4FB5A 3DWEX 3IUQA 2N46A 5CVDA 4K28A