1AQUA

Estrogen sulfotransferase with bound inactive cofactor pap and 17-beta estradiol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
288
structure length
281
Chain Sequence
EYYEVFGEFRGVLMDKRFTKYWEDVEMFLARPDDLVIATYPKSGTTWISEVVYMIYKEGDAIFNRIPYLECRNEDLINGIKQLKEKESPRIVKTHLPPKLLPASFWEKNCKMIYLCRNAKDVAVSYYYFLLMITSYPNPKSFSEFVEKFMQGQVPYGSWYDHVKAWWEKSKNSRVLFMFYEDMKEDIRREVVKLIEFLERKPSAELVDRIIQHTSFQEMKNNPSTNYTMMPEEMMNQKVSPFMRKGIIGDWKNHFPEALRERFDEHYKQQMKDCTVKFRME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of estrogen sulphotransferase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 104
structure length 281
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 1997-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1aquA00
1TEVA 5CB8A 2QT0A 4B2PA 1JR6A 3T61A 4LJ9A 5IT5A 2VSFA 1TEXA 2CCGA 1BYUA 1ZM7A 3VR1A 5JCPA 1NIJA 4TYQA 1OSNA 2ZRJA 4OHZA 3B60A 1XMSA 1Z5ZA 1UF9A 2K5UA 2UVQA 2ZRLA 4Q4LA 4WW0A 2QE7D 4YMTA 3Q72A 2B8TA 5B30A 5KU1A 2IC5A 2OZEA 1D6JA 2P0EA 2JJ2A 3G0HA 1NN0A 4R2HA 2ZI6A 4QOSA 2QG6A 4LGMA 1KDTA 3CRVA 3KKNA 1OH8A 3RWMB 3THYA 1XP8A 2NO6A 2D7DA 1VCIA 3RS4A 2Q6TA 3IILA 1IJEA 2ZI3A 3BRWD 1MV5A 3THWA 1AJEA 1SVSA 3LBHA 4NYIR 4H1VA 3B82A 3AH8A 4HB0A 2ZSEA 4PXAA 1GP2A 3V9PA 1RFLA 3LVQE 1G18A 2V4ZA 4TT3A 1TQDA 4HB4A 3FGNA 4O0MA 1Z08A 2E87A 2TMKA 2VF7A 3C8UA 1PVOA 1DARA 1XNJA 1R6BX 2CE2X 4YONB 1RPZA 3H2YA 2F1RA 2QMHA 2HXYA 1JQLB 5JRJA 1VG1A 5DI3B 1A82A 3ZVMA 2OLKA 2GJ8A 3LBNA 2BKUA 2GF0A 4P33A 5BWMA 4RVCA 4EJSA 3KXLA 5GJBA 2OFXA 1OXVA 4L15A 3TQFA 2WWWA 2DB3A 2IUSA 4JLMA 2VHQA 1KGDA 2AX4A 2BJVA 1VIYA 2BOVA 4P32A 4TSFD 3T1VA 4DJTA 1IJFA 4QHTA 3R20A 5HZKA 4KO8A 3CRW1 1MRNA 1MRSA 2QY9A 3BH0A 1FP7A 3I72A 2FEOA 1Z63A 2JJ1D 3LD9A 2GAOA 3PITA 4NONA 4PR0A 3E70C 4EPWA 1XJCA 3AQ4A 2FU5C 3CWZA 4YXWD 3SJBA 3DDCA 1Z07A 2V6JA 3RVBA 2YKGA 2CEAA 3TVTA 1GZSA 1Q1EA 4NYJR 1KI4A 1KY2A 3HR7A 3TNFA 2VP9A 2HF9A 3FKSA 3K70D 1KI9A 1RC8A 1OIXA 2ZSDA 4LV6A 5F9FA 2EFEB 1TNDA 2WJGA 1DG3A 3MFYA 4FXPA 3RRMA 1E2KA 3HU1A 4OQNA 4ESHA 1NP6A 3U4QB 1X1RA 3BFKA 3F5FA 1ZM4A 3GJ4A 2BBOA 4P4TA 3BWDD 4A0GA 3D7MA 1J99A 3A4MA 3K0SA 4C2UA 4IVQA 3QKRB 3VX4A 4JT2A 1SXJE 2VTKA 4C0SA 2NIPA 4K46A 1II8A 2W6JD 4IDNA 2QQEA 5H68A 3LFUA 1G291 1YKSA 4CF7A 2ODBA 3LDAA 3C41J 4JVSB 5EE0A 2AKAB 1HQCA 2PT7A 4Q7KA 5M04A 3OAAD 1G8GA 4JBYA 5LPNA 3L0IB 1CEEA 3UWKA 1NG9A 4P31A 1JEEA 1Q1QA 4IOLA 5HR5A 5KHOC 3TUZC 1GILA 3BJIC 2QMEA 5FBQB 4FW9A 4F38A 1SQ5A 2ZYTX 3DM5A 3A1TA 6Q21A 2GAAA 3FFAA 4PHFA 3U4QA 1JECA 1RYFA 4DVGA 2PCJA 3AUYA 3EA5A 3TUJC 5GJWC 1CR2A 4ERNA 2WTUA 4Q19A 3QKRA 1VYUA 4DRZA 1XTRA 1TL7C 4ZO4A 4NCJA 3PV0A 1TQ2A 3EC1A 3CX8A 1P5ZB 2DY1A 1UKZA 3LLMA 5FI0B 1Z0FA 4LBWA 1KSGA 1XXHB 2REXB 2ZRKA 1KAOA 1DPFA 3DPUA 3GFTA 5FOWA 1KI6A 1U0HC 3EA0A 4LUCA 2VEDA 2I4IA 3EIQA 4LYFA 3SJCA 1DAKA 1ZYUA 1XCPA 2V8OA 4P4SB 5J5CA 2YOHA 5FBLB 3TK1A 4C0KA 4BFVA 3A1VA 4AIIA 4K81B 2CK3A 4BFYA 4PSVA 1E32A 1XD9A 3PUWA 1P2UA 2G1KA 5KNDA 2CCKA 4KFSA 1UKEA 4P0TA 1TF7A 4KU4A 3M6AA 1SXJD 2YYZA 4OJKA 4R98A 5G53C 4X8MA 2CL7X 5JI2E 1B0UA 1XXHA 1ZNWA 4RKEA 4D0LB 1F5NA 1FL9A 1O87A 3U61B 5FOUA 4O2RA 3KQLA 3R8CA 2JCSA 1QHSA 3CH5A 1EWRA 1F2UB 2YWFA 3CR8A 4JLAA 3OEEA 1GNPA 4P4SA 4WZAE 4CGZA 3A36A 4DCTA 4URVR 5GJCA 2BCJQ 1A2KC 4RD4A 2J3EA 3O8BA 5L8VA 5DSZA 4Q48A 2IA5A 1XX6A 4UXJA 4DLWA 4JL6A 3BFVA 3LV8A 3GEEA 3SOPA 5K8UA 1FTSA 3ZQ6A 3PCRB 1N6LA 1QG2A 1Z6TA 2VHCA 4ZCMA 4FIDA 3J81k 5CLQA 2FGJA 3VNVA 3B13B 4OQMA 3C5CA 4KXFB 3PENA 4NBSA 1DAEA 2EWWA 2DHRA 5E4FA 3IHWA 2XOKD 4F4IA 5HCIA 1JR3D 1G7RA 3DVLA 2LKCA 2LCFA 3IDQA 3AVTA 1GWNA 1ZUIA 1G8PA 4LYJA 1NJGA 2HYDA 1XFAA 1F2UA 4PC6A 4QGGA 3LX8A 2ZJ2A 721PA 1LS6A 1VCNA 3FE2A 4JLOA 1EX6A 2WWHA 4QBIA 4KBGA 2IYRA 1GM5A 1N6RA 2F3TA 2H57A 4O2LA 5BN3A 2BKEA 3ETLA 4ZI3A 1E2DA 1BKDR 2FSIA 3QVVA 2MMCA 4MUBA 5FL7A 2G77B 1E2GA 3CNLA 4RZXA 4YMUA 1QHXA 3BXZA 4POAA 1OYYA 2FWRA 2OV2A 3JZMA 1G64A 4G5QA 1MH1A 4YDHB 3RS5A 5L3QB 4HAVA 1FUKA 2GHIA 5TMPA 3LW7A 1E2PA 2WZQA 2R6CA 2QI9C 3VQTA 5D3QA 1FW6A 2XB4A 2XEXA 1S9HA 3MMPA 1G5PA 3QIAA 3O47A 4LX0A 2FX3A 3JVUA 2GZDA 4AKIA 1Z3IX 3AUXA 2VHUA 4QHYA 5AK0A 3ZQJA 4ZDIA 3KKMA 3A1SA 3AF0A 1C9KA 3BE4A 1YR6A 3QF4B 4BLRA 1U8ZA 4URYR 2IYSA 1G4UR 3L82B 1IXZA 4WZ6A 1DTSA 4NCIA 4NDZA 4TTQA 4C9BA 3CZPA 4E03A 5DISB 4XTCS 1C1YA 3A4LA 5A4JA 1S3GA 2ODWA 3A8TA 3CPJB 5C2JB 2JLWA 4FINA 3TAHA 4GOJA 4A82A 3FKQA 2FFBA 3GLIE 4M1SA 3JVVA 4UNRA 1CKEA 4GP6A 3RS7A 3GLHE 5CK5A 1QZXA 5TV2A 3SR0A 4GSYA 4OK6A 3DEFA 4Q02A 5E3HA 4D4JA 1I2DA 1U81A 1W44A 2A5GA 3SEAA 3QXHA 4TL6A 2V7QD 1G7SA 4IXMA 2YINC 4EPRA 2X8AA 3NHBA 3GLGA 1KY3A 2ZE5A 4IDPA 3KKOA 1NKTA 2HF8A 4LPKA 2ODEA 3P1JA 2IYWA 2G88A 3QOFA 3TLXA 4FCWA 2CLDX 1SKYB 2HYIC 2GEDA 4B3GA 1RKBA 1TQ4A 1KO1A 1L4YA 2ORWA 5HCNA 2H8KA 5AUNB 5JS7A 2YWHA 2A78A 2D2FA 2JLQA 2IUUA 3AVOA 1UBFA 1L2TA 3QQ5A 3OHMA 4LHZA 5FR1A 2P65A 1TMKA 2BWJA 3K9LA 4HEJA 4Q00A 1DS6A 2WWGA 2ZI4A 2R6GA 3FTQA 3OFND 5A0FA 3LY5A 4X8HA 2GF9A 4XD7D 5KPJA 3CPHA 2ASEA 1OXSC 3GPLA 3FPAA 1ZCBA 2QAGB 1N6PA 4ILEA 1II9A 2BVNA 5HKKA 4MGIR 2J7KA 3QI2A 2IL1A 2OESA 2GJAA 3WRYC 4LC1A 1Q22A 4JLKA 4PC2A 3THXB 2GJKA 5F98A 1ZINA 1OW3B 3P32A 5SZHB 3WBKA 3VR4A 5TY0A 1XEWX 5FOVA 4CEHA 3FWYA 4XJXA 1M6NA 1YZQA 2WPDD 2ORVA 4G3XA 3UPUA 4US2R 1E96A 3HPRA 3ASZA 2IS2A 4BFZA 2ONJA 5B58C 1H8HD 3QPUA 4DB4A 3A4NA 1NVUQ 1RJ9B 3C7KA 4ZCLA 3ADCA 2CMKA 5EQTA 3EW9A 2WIAA 1YZTA 1Z2AA 1HH4A 1U99A 5SZKB 3SJAA 3SYNA 5B2ZA 1Z22A 4DLTA 5H8WA 3KJGA 4IHQA 2PX0A 2ANBA 1G4AE 5K8TA 3AVYA 2GZHA 2X1VA 4M1KA 4A15A 2FV8A 1DG1G 1XTSA 1OV4A 2CLCX 4DKXA 2J9RA 5EXTA 2IXFA 4QFMA 1LNZA 2DFLA 2YV5A 1UM8A 2O8BB 2GXUA 1GTVA 4NE2A 4I4LA 2VYFA 1OE0A 4IVRA 1A2BA 5JZVA 2H16A 3AM1A 5EP2A 1KO5A 1N0VC 1W4BA 3ZIAD 2XITA 1TADA 3WMGA 2RH5A 2WWFA 4RD2A 2QL6A 5FH9A 4LPSA 3LLUA 1X86B 2ZAMA 4Q01A 4M1MA 1V43A 2CHVA 4YMVA 4WZBE 3L0PA 1GRNA 2ZPTX 1AS2A 2JIZD 5HZHA 5IK2D 4C3ZA 4UNSA 5KSZA 4V0ME 2ZRIA 1BYIA 1E2FA 4ITRC 4Q9HA 2C96A 3H86A 4B33A 1QVAA 3KXIA 1JB1A 2FPKA 3HP1A 3UMRA 3U44B 3AKEA 2O8BA 3I8XA 1Z0JA 2JDIA 1KTVA 3ZD6A 1E0KA 4CT4B 2DR3A 1MOZA 4CT5A 1R10A 2ZYWX 1E2LA 2BV3A 2RGXA 3IBYA 4PQYA 1IY1A 4UXIA 4JVLA 1D9ZA 2Z83A 4A36A 4C7OB 1QF9A 4TQ9A 4MGYR 2AK2A 1FNNA 4B44A 5CITA 1PV4A 2Z0MA 2JLUA 4OQXA 3KL4A 3PUZA 3ZZUA 1UAAA 5EE3A 3QXCA 2JGNA 1HURA 1FUUA 2F1JA 3QY0A 2AL7A 5LB4A 4Y0VA 5EXSA 1Q1ZA 1JBKA 3T1QA 1X8KA 1R8SA 1GNQA 4GI7A 4LYHA 4M1YA 1UDXA 3DO6A 5DO9A 5EE1A 5HE8A 3FMPB 3U44A 2B21A 2H1LA 4IOJA 3KTAB 3TUIC 1G9XA 4DBLC 2IS1A 3PG5A 1PLKA 4LHWA 2ZITA 2F1IA 4KODA 2AFIE 5FOSA 2ZS9A 3VR2A 3B1WA 1U9IC 2IHBA 5JWHA 1OKKD 2XSZD 4EPXA 4C7OA 2XJ9A 4U00A 4EFMA 3LA6A 4Q4HB 4OHVA 2G6BA 2J41A 2OG2A 3AKDA 2JLSA 4R9UC 3CB4A 4NMMA 4PX9A 4GL2A 2QE7A 4JLBA 1K5DA 1CJVC 1AA9A 2A3RA 5AJXA 5FR2A 4M22A 4MGKR 2F55A 1Q12A 1E98A 2FSFA 1S2MA 1XJ0A 3RRNA 1XD8A 1Z0DA 4B3DA 3B9QA 4BFUA 2EVWX 2OUKA 4QKQA 1E0AA 3LAWA 1ZNYA 1ZU5A 1Z28A 4HLCA 1CBUA 3X1XA 3KTAA 1GG2A 4ACAA 1W0KD 2ZRAA 1AGRA 1GUAA 3FYHA 3K9HA 3H4MA 4N1AA 5DYIA 1PZNA 5J4VA 3NEJA 3HYTA 2XZOA 3ASYA 2GCOA 3AKYA 4KVAA 1KO7A 4B32A 1OXXK 3QXJA 4AYWA 1XEFA 2GVZC 4Q4HA 3M4YA 3Q5DA 4KJZA 2WWXA 4V02A 5BXQC 2VRWA 1IXSB 5JBQA 1FFHA 1Y3AA 2EFDB 5K8LA 2HUPA 3EZ2A 2W2XA 4RCYA 2UZIR 1AGPA 4JLDA 1KKLA 2ZU0C 3DKVA 1E4VA 4Z1MA 5TB5A 1S9DA 3QPVA 2A30A 1E9DA 1KIMA 2CNWD 3KUDA 4N0EA 5H1YA 5KDDA 1LVGA 4QNRA 4XWOA 1C4OA 2ZTSA 4PHHA 3NH9A 5C4MA 2F1HA 1SVLA 3MJRA 1G8YA 4OQLA 4O25A 3E5HA 1J7KA 1SVIA 1EGAA 1Q3HA 2HLDD 2Z4SA 1M2OB 1VHTA 4MH0R 1LTQA 3CNNA 2GBLA 4B73A 3TRFA 4GFDA 2PEZA 5EUMA 3TAUA 4DUGA 2NPIA 4PQFA 1KO4A 2HJVA 2Y8EA 2GDJA 3RC8A 5FTMA 4NYJQ 3V00A 1JEDA 2QSZA 3NIBA 4ZDWA 1AKEA 4DSOA 2OSBA 4AI6A 4YQFA 3TSOA 2WSSD 1G3QA 2WV9A 2QAGC 2GEUA 4TYPA 4TYWA 4B35A 4MKFA 5KDLA 821PA 4NYMR 3NTUA 1GFIA 5K8IA 2V1UA 4TLCA 2BDTA 3T5GA 1ZNZA 1YHNA 4OK5A 2ZR7A 2XTZA 1E0JA 3O8RA 2KJQA 1S3SA 5IF9A 4DHEA 2CJWA 1I4TD 5JWOA 2G1JA 2PMDA 3NBXX 1E1QD 1W36B 1P9WA 1KK0A 1T3HA 4NHOA 1KDRA 2RHDA 2R44A 1Z29A 2B8WA 2WAXA 4JL8A 1G19A 4DSUA 5CDFE 4QBGB 3ICEA 1E9CA 1DELA 3LH5A 1IHUA 5UKDA 3WMEA 1JPJA 2BBTA 621PA 1VMAA 1NVWQ 1U98A 2IXGA 2KWIA 2MSEB 1G6HA 2W6JA 2R6AA 1VECA 2WWIA 1JNYA 4CDGA 1KO8A 4LHVA 4XVUA 4K8OA 3RWOA 4DZZA 3THWB 1D8TA 2YOFA 3OAAA 4LJ7A 3K53A 1E2MA 2ZR9A 1J90A 3Q5EA 1ELOA 2IXEA 2REOA 2QENA 5J47A 5AUPB 3H0KA 4TLDA 2W0MA 1WCV1 4HYYA 5AUOB 2PJRA 1UBEA 5LDDC 4Z8XA 3KUCA 1RRFA 2CVFA 2QRNA 1CLUA 1S4QA 2V54A 1KKMA 2QAJA 4PC1A 2FG5A 1ZAKA 4CEIB 1W2GA 4PHTA 2H17A 3NWJA 3T15A 4C4PA 4PSKA 4B43A 5LD2B 4QXAA 2VL7A 3PEVA 2PL3A 1COWD 4JJKA 4GZLA 4EJSB 3OEHA 1G16A 2EFCB 3PEYA 1K6MA 2DFKB 2DWOA 1J2JA 4DEXA 1FTNA 2IF2A 4F4JA 1WP9A 1G3RA 1VCMA 4BLTA 4Z54A 4G5GA 5CIWA 2J0SA 1R2QA 3P4XA 1T0HB 2SHKA 3T1TA 4UJ3A 4CZ2A 3C5HA 4QBHA 3EPHA 1OHHD 1X3SA 3MSXA 4QGHA 5FPTA 4DDUA 5C46F 2O5VA 4E09A 4XTRA 1E79A 3CKLA 4CEIA 1XEWY 4DEYA 4LJ4A 1P2VA 2MSCB 4ZI2A 1Z6YA 1SXJA 3LWNA 2FPLA 3R9IA 2WHXA 3BERA 2C77A 2CE7A 2QNRA 4GOKA 3MWJA 1KZGB 2BEKA 4E22A 4GNKA 3K8YA 4LK2A 1OYWA 2H92A 3M0EA 1FMLA 3CRQA 3IBGA 1Z6GA 3C4JA 4OI2A 3RHFA 2H7VA 1CR1A 4US0R 4NCNA 4UNQA 5CJ2A 4EPYA 1TF2A 2VP0A 2DFNA 5DNYB 1JALA 2GK6A 2FEMA 2RAPA 3ADKA 2OEPA 4NP6A 1CR0A 3AVXA 4XVQA 3BK7A 4TLBA 4HB3A 1UJ2A 2J46A 2QSYA 1II8B 4Q7MB 1KSJA 2DFTA 4P3YA 4B3XA 3R9WA 4US1R 4B74A 4BZPA 1ZCAA 2VA8A 3KKQA 3R9XA 1NMYA 3G5UA 1J70A 1M8PA 4BLQA 5HPYB 4PAMA 1I4DD 1XMJA 2Q21A 4Q9KA 2ATVA 2L0XA 3KX2A 5AJVB 3U3MA 1IN8A 1XBTA 5E7JA 3MLEA 1KMQA 4BEBA 2WICA 4DLSA 2IYYA 3UIEA 2EFGA 2P6UA 2V9PA 4CEJB 1AS0A 2QTVB 3MG9A 4D26A 3TJZA 4ABYA 1E2HA 4LHXA 2JLYA 1K8RA 2XNDD 3RS3A 3A6PC 2QPTA 3NDBB 5EXPA 8OHMA 2J7PD 2QP4A 5JJLA 2DWQA 2QGZA 1G1MA 3AVPA 1MABB 2WMNB 3BB3A 2GBLC 3IKJA 1YQTA 4IDQA 4RZ3A 1KI6B 1FPMA 2ZI9A 4HZUB 4KSCA 5FL3A 4D4MA 2YC4C 1XJQA 3EXAA 4Q66C 1P3JA 2PBRA 4NTZA 3U6KA 4BFTA 3AF3A 1NSFA 4R7ZA 1U0LA 2CLSA 2V6IA 4BRUA 5J40A 2FSHA 2J0UA 2OM2A 4NU0A 4XH9B 4CEJA 1Q1BA 4A2QA 1E4YA 1EFUA 2HDNB 5AJZA 2E1RA 2PT5A 4NL4H 1XPUA 3MAAC 3U2QA 1R0ZA 1MT0A 3LQRA 3UANA 1RRGA 3N70A 4D82A 5EZ5A 4M1TA 3PVSA 3RDPA 4L9WA 2REBA 1KDPA 1YZKA 4M21A 4KAXA 1JR3E 1NKSA 1U94A 3W3ZB 4EAQA 1JAHA 4B3BA 2JEOA 1MABA 2FGKA 2O0KA 2YVUA 3NBYC 1E9RA 4HZUA 3T06B 2IYQA 3OF5A 2WIBA 4D0GA 2CDNA 4JKYA 3CIOA 4HSEA 1P7CA 4URZR 4WOPA 3K1JA 1KJYA 5IRCD 1LV7A 4ESVA 2JJ2D 4QHSA 4KV9A 4ZCIA 2V1XA 4FD2A 1JI0A 1XTQA 1YRBA 3ND8A 4B71A 3TW4A 2FMXA 4MYCA 1NIPA 3HWSA 1K5GA 2QPOA 3OIWA 3QG5A 3L0OA 2FOLA 2O0HA 1XTJA 2RCNA 4KBFA 4BRWA 4B76A 1W7AA 2AXPA 5BQ5A 2F9MA 2NOAA 3L8YA 2IYZA 1W49A 2G3YA 4Q4AB 3GLHB 3OFNA 3SYKA 5AUQA 3T12A 2D7CA 2H5EA 4DLXA 4XD7A 4C30A 3RYTC 3IHLA 4DLYA 2YHSA 1SHZA 4TT3D 4DLRA 1KI7A 5F3WB 2ZYUX 3D8BA 4F7WA 4YLGA 3X1WA 3SQXA 3TSZA 4FCVA 5BYKA 3IIMA 4DB2A 2VSOA 5KOYA 1P75A 1U90A 3VR5A 1DAMA 2GZAA 2VBCA 2IWHA 4LJYA 3P26A 4PQRA 1Z8FA 2IEZA 1CS4C 2OLJA 4TLEA 3QF7A 1CR4A 2QBYA 2QTHA 3VHLB 3KZ1E 2QZ4A 3GLIA 3PQCA 4XVRA 1ANKA 3X2SA 1D2EA 1H8ED 1QHNA 4XSHA 4TL8A 5FI1B 2OO7A 2AWOA 2J1LA 2ZU6A 3FHOA 3GLHA 4Q4AA 3RC3A 3AGQA 1YR9A 1JPNA 2HCJB 2HCBA 4FN5A 4V0OA 1FOEB 4B6FA 2Z5FA 5TVKA 1XD2A 4Q9LA 1G3IA 2OCYC 3EASA 4Q47A 5F9HA 1XMIA 4DDVA 2QP9X 4Q03A 3VX3A 4QGFA 5JLJA 1CF4A 3ZS9A 421PA 5LD2C 1XCMA 4KFTA 3WP1B 1GDDA 4UQOA 4EJSC 2NZ8A 2WWYA 4EFLA 1GIAA 3T34A 3K9GA 3FKSD 1DBSA 4E5UA 4KI0A 5FBWB 2WVJA 2VP4A 5JEDA 4LDJA 3C16C 2R2AA 1QVRA 2RGGA 1PUIA 2AWNA 3LQQA 3GP8A 1XCGB 4UXHA 5C18A 4BPBA 3Q7PA 4Q1BA 3GLGB 3ICQB 3WYAA 3X1YA 1P60A 2OHFA 2HT6A 4F92B 3OE7A 4JBWA 1FMJA 1AQUA 1CXZA 1XXHE 3QEOA 2GCNA 1CRQA 1M34E 2UKDA 4A0FA 4B3CA 5KSPA 4M9XA 1IBRA 2QEQA 3EWAA 4DDTA 4PSAA 1J8YF 1NF3A 2H18A 4NCKA 1HA3A 3P4YA 4DT1B 3FFBA 4W5JA 2NO7A 1E2NA 3K09A 2WKQA 1OH5A 2NG1A 1IXRC 1GOTA 2OT3B 2BM1A 3AF1A 4LV8B 2AHOA 3IO5A 1ZRHA 4KYIB 2FZLA 2Z43A 2ZE8A 1VIAA 4Q9IA 3B2EA 1EFCA 4KVGA 5B57C 1YZLA 3HYRA 4XWKA 3ND9A 2RGAA 3RSLA 1W46A 1N5IA 4Q1DA 1E9AA 1PUJA 2B6HA 2F7SA 4Q1AA 1SVOA 3GJXC 3TSWA 1N3BA 3BS4A 4A0RA 2KI5A 4BZQA 5FTJA 1N25A 1NMZA 3ECCA 3IGFA 3ZVRA 1Z2CA 4DT1A 4A0HA 4HLQB 3N2EA 3QKTA 4CEHB 4YDSA 2OAP1 4QM6A 1E1RA 1XZQA 2BMDA 2W0SA 5B64A 4Z8YA 4B48A 4D2IA 1W0JA 1G8FA 3V4FA 4ACBA 4MDFA 5BYJA 2CK3D 1OKKA 4I1OA 3GFOA 1VCOA 1S96A 2C9OA 2YZ2A 1IOZA 3VU9A 4V0LA 4ARZA 3BGWA 1LS1A 2ZRDA 3AVUA 1S1CA 4RJLA 4Y0AA 4AWXA 4AKHA 3B9PA 3TIFA 2C03A 1F6BA 5DH9A 3I32A 5G3ZA 4TTRA 1UBGA 4DWJA 2YWEA 4H9GA 2O8FB 1VYVA 3OZXA 1P2TA 4LBZA 4V0MA 3ZVNA 1EFHA 3AVWA 3I73A 2ZJYA 4PTLA 4CIDA 1W4RA 2A5YB 3SS8A 5CK4A 1Q3TA 3TR5A 4HDOB 2QN6A 3OEED 3SZRA 1W0KA 4PO8A 2OXRA 2VIIA 1VG0B 3LRPA 4QBFA 4JJZA 3QENA 3SC3A 1OIVA 1SZPA 4MGZR 3TQCA 5ANRB 4KHZA 2WMOB 4JLNA 1ESMA 2XXAA 3QSYA 4V0KA 4DSNA 4JLVA 1EFRA 3W9YA 4DIDA 4R2IA 2OE2A 3MJHA 1YR8A 1MO4A 2ODNA 3B85A 2QM7A 4TTPA 2ZEJA 1HY3A 1IONA 2ANCA 2CCJA 1I4LD 1EG7A 1WB9A 4BLPA 2RMKA 1VHLA 2NPFA 4D80A 4G01B 5P21A 3EPLA 2O8FA 2RKOA 5JWRA 4XSGA 2XNSA 3PUYA 5KO2A 5AR1A 3GD7A 3QE0A 3GLFB 1RW4A 1IAQA 1ZM3A 1AZTA 3H84A 1X8LA 2O8EB 2BMEA 3CONA 2PZGA 4B3FX 3CR7A 3SN6A 3EC2A 3RS0A 3AP1A 2ZQ5A 4NKRA 1LF0A 5G40A 3IUYA 2IF0A 4OI0A 2P2LA 3TKLA 1D9XA 2HLDA 5CB6A 4ASUA 1JJ7A 1MO5A 3MCAA 5HE9A 2ZVPX 1BMFD 3QNUA 5FL7D 1HT2E 1Z6XA 3SFVA 3TH5A 2XX3A 4IOMA 4EIWA 3B8HA 5C4GB 2AD1A 2JA1A 3BH7A 1DE0A 2RB4A 3VKGA 1Q57A 3W8NA 4UNPA 1FQJA 1TUIA 4OHXA 2AK3A 3THOA 4Q7LA 3Q8XB 2QROA 3CZQA 1P2SA 3GLFA 3C15C 1ESNA 3KKPA 4C0BA 2EYUA 2O8EA 2ZJBA 4PC7A 3R7WA 2J59A 2QGNA 2ZROA 4LBYA 3DZ8A 3UG6A 2FN4A 2VSXA 3UXMA 2FSGA 5JHHB 1EX7A 3L2OB 1J8MF 1GVNB 2BM0A 4DXAA 2D3WA 3AV0B 4MITA 4L16A 3K0EA 4LY6A 5HTKA 1X6VA 4OL0A 4PZZA 4D6PA 2WJHA 3KB1A 3LX5A 3IPYA 5J4HA 5EXXA 1YRAA 1AKYA 2F43B 2QMOA 1WBBA 4RFVA 2X77A 2ATXA 2MMGA 1UBCA 3K9NA 1UDWA 3NEYA 1G20E 4URWR 2WM9B 4EDHA 2ZSBA 2FA9A 1XWIA 1H65A 4FMDF 3EPKA 3PJRA 1W1WA 3ZZTA 5L3SB 5JI3E 4C0JA 1R7RA 1UEIA 3RS2A 1KSFX 3BAFA 5DN6D 2C78A 3NC1C 1G3MA 1RVDA 1WQ1R 1ZD8A 1T3SA 3DMNA 2A5FA 4JZKA 5AJWA 3VTKA 2B7BA 3NXSA 2A7QA 1M7BA 2GCOB 1OFIA 1G8HA 1NBME 2GESA 2PLRA 2Q9BA 3U3OA 1R0YA 3VAAA 5J4YA 1EK0A 3EZFA 2FJUA 2G9NA 2IX3A 3GJ7A 2OBNA 3K09C 1WF3A 1NVXQ 2F43A 1GKUB 1NLYA 3WP0A 3CRMA 4NYIQ 4M1OA 2VHJA 4TQAA 1U0JA 2BJWA 4IJMA 3H1TA 3CF6R 3QXSA 3KQKA 1PLJA 5L3SA 1GSIA 4RFSB 1Z0AA 4KSBA 1AIPA 2W6ID 2WOJA 2UZ3A 3FMFA 5KSOA 3PEWA 2VHTA 5DHFA 5HKKD 2J5XA 3QJYA 1F3OA 3NHAA 4JSYA 4DCUA 4R71A 2C95A 2GILA 1GAJA 4LJ5A 4N0DA 4WXPA 2VQSA 1ETUA 1JJVA 1Z83A 5AJYA 1E9BA 1WE2A 3Q9LA 1DAFA 3RANA 2HV8A 1LW7A 3HDTA 5FPKA 5CM9C 2IBMA 2IYLD 4JT4A 4M8NE 3VR3A 3U60B 1F60A 2OBLA 3MWKA 3FDIA 1D2NA 2ZIAA 4OBEA 1OHHA 3RABA 1WA5A 3FMOB 3IO3A 4M9ZA 1FP6A 2GVDC 2WJJA 3CLVA 4OHYA 4UJ5A 4LV5B 3EZ6A 3AB3A 4QGAA 3PUVA 1E9SA 4RD1A 1NG1A 4RFSA 2P67A 5AWFC 3B1VA 2QBYB 3FHCB 4FMBB 2NO0A 2BIFA 3WNCA 4HUQA 2QQ0A 3GCGA 1ZIOA 2WKRA 3K70B 1E3MA 2CJWB 1G5TA 1NI3A 4KFRA 2A5JA 4L8GA 4CVNA 1NBMD 4TSFA 5FBRB 2PCLA 5DYGA 1WXQA 3UMSA 1PJRA 3BIFA 3CUEF 5JRZA 4PZYA 1QHIA 5JECA 4OI4A 5G3YA 2PMKA 1ZNXA 3QUSA 3SHWA 3W3AA 2JJ1A 4HAUA 4NPHA 4FMCF 4EUNA 3SFZA 5LBIA 1AS3A 1CULC 3K0FB 3IIJA 4HAZA 3VHXA 4JL5A 4NZYA 1OLOA 2ERXA 3PEUA 3ZLJA 1DEKA 4YXWA 1NNEA 4LJ6A 4HATA 4AG6A 2C8VA 4CW7A 3AF2A 1HV8A 1GL9B 5L3RA 4XOIA 1IN7A 4BWYA 1CJTC 2P6NA 1IY0A 4KFUA 5FUWA 3ZYCA 2BCGY 3SQWA 4Z51A 3T35A 3U3RA 1YR7A 1IN5A 3EG5A 3VNUA 1GRRA 1W4CA 2QTFA 5A5GA 1KYIA 3N2IA 2A5DA 2YNMA 3T5DA 4LRWA 3AKCA 2LWIA 1CJUC 2ZYVX 3AEZA 3W5IA 2J45A 2JDID 4QL3A 5FBVB 2V3CC 3T1OA 4Q1CA 4F4CA 4ZDKA 3K0FA 4GOXA 3U7FB 4QJ5A 3OIVA 4HAYA 3AVVA 4RZUA 4OI1A 1NVVR 4O3MA 2NGRA 3S1AB 3CWQA 3MD0A 1N6KA 5EP3A 2KBFA 1OXUA 2EYQA 3GFPA 3WY9A 1TU4A 4KCGA 1OT3A 4URUR 4MYHA 2R6DA 2FPMA 1T9HA 4DCNA 2F6RA 2AFHE 2X2FA 3KJIA 4ZV4A 4QM7A 4U02A 2ZAOA 1XZPA 2D74A 1NLFA 2JATA 4A4DA 1P6XA 4Q4JA 1F2TA 1NJFA 1E99A 3TE6A 3W5JA 1U2RA 5GADl 1GRQA 3ADBA 4MRNA 1SXJB 3WXMA 4X8OA 3VKWA 1NRJB 3S1AA 5CYOA 3CX6A 5H70A 3JZAA 4TMTA 2G0NA 2PZFA 4M0LA 3QBVA 2NO1A 1T0JB 1MR3F 2OXCA 1WMSA 5L3VA 4KITB 1XPOA 1TPZA 2GEVA 3QVUA 4MKGA 3KDSE 1G41A 3KQNA 5FOXA 2ZRCA 1KK1A 1YVDA 4RD0A 3DL0A 3LXRA 3NDPA 3I4LA 3NC0C 5CM8B 5IDVA 1DAGA 4UNNA 2DYKA 1ZIPA 3AP2A 3AVQA 5CJPA 3SJZA 1ZUNB 2ZREA 2B92A 3KQUA 1W5SA 221PA 2VP6A 2BBSA 4IDOA 4RY2A 1L4UA 1T91A 3BH6A 2CHQA 2GRJA 1A1VA 1Q20A 2QT1A 3GEIA 121PA 4F91B 1HEIA 1P72A 4W7SA 2NMVA 3LW8A 2IYUA 1FNMA 4P4UA 5FPYA 4EKDA 2OCBA 1KOFA 4QJ3A 4TZ6A 2R62A 1KI3A 3KB2A 4TL7A 4OYHA 4A2PA 3ONWA 4YC7A 2VLIA 3AF4A 1HUQA 4GZMA 3B7GA 3DMDA 4MYUA 4Z1MD 3SBDA 4V0NA 3NH6A 2WJYA 3GJ8A 1KNQA 4OHWA 1RE0A 1HQYE 1QG4A 4M9QA 4PC3A 1P9NA 2Q3FA 2XTNA 2O8DB 4DC9A 1SKQA 1II0A 2ZSFA 5JHGB 4YMWA 3X1ZA 3PR1A 2ZJOA 2XOKA 1E9FA 1JR3A 1MO6A 2VO1A 1CTQA 4U5XA 1H8EA 3ZVLA 4F93B 2XAUA 2BEJA 1ZBDA 3B78A 1S0UA 3IPXA 3LXXA 1XDBA 4DUGD 3PUXA 1LFDB 4XWAA 1SVMA 4B6EA 5KPDA 4U7DA 1DO0A 2ZI5A 4QRHA 5J4KA 2EW1A 1R8QA 4C0QC 2J0UB 4DIEA 1MO3A 1M7HA 4FI3C 4GPTA 5CIQA 4TMKA 1OB2A 4RD3A 2P3SA 1ZM9A 4PANA 5DI3A 4C0LA 2J0VA 2IT1A 5SZIA 4G5SA 5KUTA 4DDWA 5FTLA 1OH6A 2O8DA 2IWRA 2G0TA 2R65A 2EFHB 2W83A 4Q1EA 4A8JB 2XB2A 3IEVA 1T8TA 1ZVQA 3BB4A 2ZRPA 4WA7A 4A6XA 2ZRGA 4WVFA 1L8QA 1KK2A 2ERYA 4AD8A 3EIHA 2AD5A 2NO9A 5FFMA 1XEXB 1HE8B 2FE4A 4A2WA 1F48A 4PO1A 1R0XA 1Q44A 4AY2A 4I1VA 2VP5A 2C9CA 5DIFA 2JASA 1A4RA 2DPXA 4MYTA 3FB4A 4BLOA 5EJEA 3NKVA 1YZNA 4JVMA 3V4RA 3A1UA 4PHGA 5EP1A 4BGDA 4L5BA 1DAHA 2HXSA 4M1WA 4MRVA 3K70C 2HEIA 4A8JA 3UK6A 1SGWA 3L0SA 4BE7B 3KJEA 4ZIRB 3N5CA 3BB1A 4C0AC 2I1QA 4HUTA 2P6RA 4RSGA 1MKYA 3U7EB 4BZXA 1W36D 1BH2A 2VH5R 2N42A 1RYHA 2P5TB 3CNOA 3IQWA 1CU1A 4C0HA 1XEXA 2V7QA 4BEJA 3KXKA 4D4KA 4II7A 5GVRA 2ZSAA 1EESA 5FOTA 2JLVA 4D25A 3O8CA 2Q9AA 1FZQA 4G1UC 4RKFA 1OIWA 2NZJA 3X1DA 2QPAA 3OESA 1G7TA 1T6NA 2QP3A 1KJZA 3F3YA 4HDQB 3WHLA 4GRAA 3DZDA 2C9YA 3SI7A 4LBVA 4LCBA 1XF9A 1AQYA 3OEHD 2ZM5A 1O3YA 4A1FA 4X8LA 4GMXA 2KB0A 2ZUDA 1T4GA 2RGCA 5FPHA 1ZMXA 2IUTA 4MUAA 3C14C 1BIFA 4ZKEA 3ZDQA 4BLSA 3I5XA 1OF1A 5CYPA 3GLIB 1KDOA 1ODFA 1CJKC 2QM8A 1ZU4A 5DGXA 1G3UA 4ZIRA 3I5YA 1W36C 4WXRA 4HLDA 3NBFA 3UMFA 4LWZA 3U3JA 4HAXA 4W9MC 3B6EA 5LB2A 5J4LA 2C5LA 1AZSC 4JBXA 2OAQ1 1XD2B 4IEEA 3W6NA 1VDZA 3GJ6A 4IW3B 3F8TA 4PFSA 3CF0A 1S8FA 1E79D 2IYTA 1G6OA 4G5RA 5EUQB 4A6PA 4BECA 1D2MA 2X2EA 4IKEA 3K0CA 1Z06A 4HI0E 3GQBA 3A58B 1LY1A 2QUZA 3CPEA 3CH4B 3TGPA 2CL0X 3IIKA 4TMVA 4M2LA 1N2CE 4WAUA 3QXXA 4GBMA 4G0NA 1ZD1A 4EFNA 3I61A 1YJ5A 3UKDA 4JIMA 1OFTA 2DCUA 4D81A 1XTKA 3CF2A 4MRSA 3VR6A 1CRPA 3W6PA 2ZETA 2WPDA 3I1FA 3EAQA 4DCSA 4A92A 3QPWA 4I1UA 4MRRA 4M4SA 1XMVA 1H8HA 3W90A 2ZE6A 4JSTA 1QHHB 3GMTA 1TF5A 4TYNA 4KYUA 2YC2C 3NG1A 2ZJAA 3EARA 2JLZA 1SXJC 1QBKC 4OJQA 4EPVA 1GKYA 3HU3A 1ZW6A 1OPXA 3GEHA 2VPPA 4QNMA 1RRPA 1W5TA 2IHYA 5DLQC 1R4AA 2QU8A 1UPTA 2A2ZA 4RD6A 3U7GA 1N5KA 1QHGA 2XJ4A 4PPQA 1TX4B 4G5OA 3ZZ0A 5EZ6B 2WSMA 2CBZA 3AP3A 2DBYA 5BN5A 1AK2A 4KLZA 1ONBA 3W8RA 2WOOA 3OIYA 1TTTA 3BFXA 2EU8A 1YE8A 2OBMA 3ZIAA 1N6NA 4AKGA 1IM2A 4EPTA 2BBWA 1U8YA 1EXMA 4B2IA 1QHHA 1BMFA 4TMWA 1E2QA 1TAGA 4C2TA 3M1IA 4BFXA 1M74A 2RGNA 3CW2A 3UWOA 2J0QA 521PA 4B47A 3QKUA 2ZRBA 2CXXA 1HYQA 1NN1A 2X19A 2JIZA 4PZLA 3VKHA 4NH0A 5DHAA 4AURA 5IK2A 4W5HA 4B75A 2OFOA 5G41A 5IHPA 3EZ9A 2KBEA 4IFEA 1B23P 2CL6X 4Q1FA 1UEJA 1WDTA 2GWHA 3BC1A 3L8ZA 1P61B 2ZE7A 2GK7A 2Z6VA 4I81A 1JAIA 3B1YA 1U8AA 4TN1A 4AKEA 3DOFA 2WKPA 4MKIA 2XGJA 3Q7QA 4RZ2A 4A9AA 4W5WA 2PEYA 1ZC4A 4IDHA 1ZJ6A 4OKSA 1E2EA 2GNOA 5TXGA 4TYYA 1U9IA 1G21E 4LC0A 3MWYW 1NL3A 4BUJA 3VU9B 2N1BA 2PJZA 4ARZB 3D6TB 1G17A 5SZJA 2R8RA 1NY5A 1G5RA 4J0QA 5D3MB 5L3QA 1P62B 3U5ZB 1G7CA 1X8JA 3IEUA 1KZ7B 2EWVA 3E2IA 2FH5B 2OCPA 2PZEA 2V55B 2BC9A 4DLZA 1HE1C 2AKYA 2ZUCA 3GJ0A 2QORA 5C1BA 2WJIA 2W58A 5DN6A 2PH1A 4LYAA 1JQJC 4OK3A 1WBDA 4ZPXA 3QF4A 4FMDB 5JFGA 1EWQA 1IY2A 3FMIA 2O8CB 2ZANA 1UADA 4KLNA 2XSZA 3ZH9B 2XXAB 3LBIA 3RSOA 2GJ9A 2FNAA 5TARA 4TZ0A 4DSTA 1A7JA 2PX3A 3L43A 2JAQA 2OCAA 1OXTA 4N3NA 4EQ6B 3QBTA 4IFBA 4PO9A 3MWLA 4A8JC 4I1SA 1E2JA 1TU3A 1M7GA 3CM0A 1VG8A 5D3MA 5DE3A 4GDFA 4H1UA 3BOSA 4URXR 4HZIA 5JJIA 5FUYA 2MSDB 4QJ4A 4JS0A 4M53A 2IEYA 4GMDA 2J87A 5DI9A 3HR8A 2FZ4A 1VKJA 2W6IA 4B34A 2AR7A 2ORIA 4PPFA 3WNBA 1QRAA 2NTYC 4RCZA 5CLLA 1XRJA 3ADDA 2QRZA 4TLAA 2O8CA 4NCHA 1OH7A 2ZXUA 3I3SR 3WHKA 4DLVA 4FCTA 1VYTA 5GJVC 1Z47A 3KFVA 1AM4D 3F0TA 5E7IA 1PLLA 1GL7A 4EQ6A 1IN4A 1UKYA 3EWSA 5FUVA 3HU2A 4QG7A 1DVRA 2O0JA 2C98A 4AYTA 1KAGA 1R5OA 4D4LA 4L4UA 1KHTA 1QDEA 3G82C 1KSHA 1RZ3A 3WBJA 3UG7A 1US8B 4IOKA 3TMKA 3I62A 1KI8A 2CNWA 1HTWA 1P9RA 2ZS8A 4FWIB 2KSQA 3R7WB 3GLGE 1Z0KA 2QAGA 5JEEA 2QA5A 1ZM2A 3K0CC 4HDCA 4AK9A 3MUFA 2JLRA 2GETA 2I1VB 1T5LA 4HAWA 4JLPA 3THXA 4S2EA 3RNLA 1P4SA 4IVPA 1OJLA 3BBPA 1W4AA 1NBMA 2ONKA 2Q9CA 4HLUA 3ZJYA 4NYMQ 1LF5A 2E9SA 1KK3A 1NN3A 1XU4A 2WJVA 3CBQA 2FDCA 2GA8A 1S1MA 2GTPA 1NMXA 1FX0B 2CVHA 3B1XA 1US8A 4AYXA 4LHYA 3A1WA 3IQXA 1GL6A 2RGBA 2WSSA 4MQBA 2XZPA 2RGEA 2W2VA 1ZD9A 2DWPA 3I8SA 1KI1A 4FMCB 4TWZA 1N0UA 1OFHA 1RJ9A 4V03A 4LOAA 1HT1E 1SKYE 1SULA 2IK8A 3OE7D 1CJMA 2IW3A 3O8DA 1GKIA 1EFTA 3E1SA 4TMZA 3SBEA 5JMTA 5KNCA 1E94E 3U7HB 2W2TA 1NVVQ 1E1QA 3DM9B 4GT1A 2C2HA 4BQSA 3HPQA 1CP2A 1ZP6A 3ZGXA 2R9VA 1I2MA 2N46A 2OILA 1E6CA 4BFSA 1FX0A 2BMFA 1DO2A 1X1SA 2FFHA 4BASA 2QMUA 4PAQA 1UFQA 4UKDA 4JYCA 5E7MA 5KYKA 1RRCA 3TBKA 1ZUHA 4PPNA 2A9KA 1YU9A 3KJHA 3TVDA 2C99A 3CO5A 3RAPR 5GVSA 1KI2A 2RGNC 5FTNA 2AN9A 2Z4RA 3GJ3A 4LI0A 3OIUA 1E9EA 2ZJ5A 3A37A 3BORA 1IN6A 4AC9A 1V5WA 3DOEA 4HB2A 1TQ6A 2WBLC 3WYGA 3ZS8A 3LNCA 2ZJ8A 3TW8B 2IS6A 2GXAA 3MRSA 4FWTA 3CRRA 4IXNA 2ZVQX 5JS8A 2YWGA 1BOFA 3EX7C 1DADA 2VP2A 4Q5IA 1KMHB 1NSTA 4GP7A 3NBZC 3VFDA 1E1RD 1XTIA 3TR0A 2EQBA 3WRXC 4MKHA 1W0JD 2W00A 3P27A 2ZS7A 3PFIA 1T3LA 2YOGA 3NVAA 1IQPA 3D3QA 1Q0UA 2ZI7A 4LJAA 4Q21A 1COWA 3D31A 1E2IA 4WBSA 1VPLA 4JLJA 4Q9JA 2Q3MA 4ON9A 2GXSA 1ZC3A 1L7VC 2PLFA 4WIAA 5KTYA 2FF7A 4HUQB 1W48A 2BHRA 2F9LA 4S35A 1NLZA 4CYMA 2FFAA 3SHFA 1XPRA 3BD9A 1FQKA 1Z0IA 4MDEA 1Q21A 2O52A 1Y63A 4TQUS 3SDZA 5EP4A 1N0WA 3GLFE 2ECKA 2WAYA 3CX7A 1A5TA 1W47A 4MRPA 1N5LA 5CDFA 3K0AB 3QKSB 1E0SA 3QEJA 2F3RA 4LSGA 1KMHA 1DAIA 1NY6A 3SYLA 3DKPA 3ZD7A 3LO5A 1VG9B 3REGA 2BMJA 5EE5B 2D62A 2XTMA 1N5JA 4MA4A 4JYBA 1EFRD 1DOAA 2OFWA 5FPSA 2Q0HA 4TMXA 1CIPA 1SVKA 1WRBA 2GCPA 3PIRA 5KDOA 4M9SA 3FOZA 4DCVA 3EIEA 2JJ8A 1N6OA 3RRZA 4B2LA 1T8UA 5TDHA 2G83A 3SE0A 2NQ2C 1GNRA 1SVWA 2CHGA 2P5SA 4BFWA 1T5IA 1NN5A 3K0AA 3QKSA 5EE9A 5JSZB 2B7CA 4ZKDA 1SHKA 4D0NA 4LJ8A 2ZRHA 3SU8A 1D5CA 2I3BA 3VMFA 3R8FA 4I99A 4L9SA 3I92A 3KFXA 1BO6A 2KE5A 2ZR0A 4E07A 1Z6AA 3SNHA 1GITA 3W6OA 3WNDA 2ZUBA 4IRUB 2ZRNA 3PXGA 4ASUD 1OFUX 1R5NA 4JKIA 3U3KA 1RIFA 2ZJZA 1N6HA 1M1YE 4XIGS 2D4HA 2JLXA 1AN0A 1KNXA 2HJGA 3WYFA 3FHTA 5JCZA 5FUXA 1P73A 2RGDA 3UATA 2VF8A 3EZ7A 4Q7JB 1JXOA 1QHYA 5BW8A 3B1ZA 4YMSA 4PPGA 3HJNA 3RRYA 3W34A 1R0WA 2GKSA 1W2HA 5KNBA 4QC2A 1YZUA 4JMPA 5BN4A 4Q4JB 5E95A 1F2TB 4LZZA 3MGCA 3Q85A 2XNDA 1UKVY 3RLFA 5JSZA 2IYVA 4IEIA 2Q3HA 2FFQA 2ZRFA 1KJWA 2J7PA 3AGPA 3EPJA 4OQFA 2D06A 3GJ5A 4Q18A 1YZGA 3QG1A 2YJTD 5JJKA 5FTKA 1R5BA 4HLUC 2RHMA 4PAOA 2GJSA 2IS4A 3WMFA 3B5JA 1XB2A 3LVRE 1BS1A 3FVQA 2C04A 1LB1B 2ZRMA 4DLUA 4AG5A 2GXQA 2IYXA 1JXMA 3U6BA 2D2EA 3REFA 4CRWB 1E69A 3DHWC 3KQHA 2XZLA 5KSYA 5ELXA 1OB5A 1TUEA 3Q3JB 1N6IA 5F2EA 2LKDA 2R6FA 4ZDJA 3THYB 1VTKA 2AXNA 3P20A 4TL9A 4JVNA 2HT1A
chains in the Genus database with same CATH superfamily
3EGEA 3T5PA 1I4WA 2V7EA 4B2PA 3D4LA 4LJ9A 2VSFA 4GF5A 4DQDA 1L4EA 2X4DA 3VR1A 5JCPA 2EX0A 1Y6JA 1YS4A 3T1YB 4O4JF 1NIJA 3DAHA 1ZN7A 2ZRJA 1T13A 2FN3A 3N58A 4R0NA 4OHZA 1Z5ZA 3C3DA 4F21A 3Q7TA 5CLFA 3KELA 4YJFA 1PFQA 4BGVA 1QIEA 3B6JA 1ISSA 2QE7D 2JA2A 2B8TA 4W7HA 5KU1A 5CHEA 5ULLA 3D5QA 1FVXA 3IRUA 3ZCRA 5BURA 1AKQA 3CCFA 1CS0B 4L3VA 1C9JA 1WDLA 2BTOA 5D84A 4WASA 2HA3A 1YOBA 5F9MA 3P94A 5ITVA 1KH1A 4A10A 1IG0A 1NN0A 3L0ZA 1JL3A 1QFJA 1AHHA 4XQCA 4M7OA 4L5YA 5B4TA 1Y8CA 3FN4A 2QG6A 4NBUA 1CB7A 5ED4A 4LGMA 2K2WA 1OH8A 1Q0RA 3AONB 4DRYA 5CA1B 1V47A 3AEQB 2WZCA 3M5CA 2G1PA 2JGDA 2Y4NA 3DAPA 3A28A 5BSHA 2P9EA 3IILA 4QAJA 2DBQA 4IIUA 2H1CA 4ZAYA 5C0OE 3RVJA 3BYZA 4DW8A 4YMGA 1SVSA 3NM5A 2LNDA 5IH3A 4A8HA 3K9BA 4YDQA 4D97A 4MWSA 3OUTA 2ATEA 2FPWA 2HK8A 3BICA 4L5AA 5AVJA 3D02A 4C22A 3D0KA 1TD9A 4B7UA 1GP2A 4QU8A 1B14A 2X41A 1Z75A 3T52A 4MX8A 1PR4A 3RREA 2X14A 1SJ9A 3TMAA 3LVQE 1JE1A 3REOA 1QIIA 3KQSA 1DCKA 4XRGA 4C6RA 2QK4A 3D0RA 2E7ZA 4HB4A 1KDYA 4ZGGA 2PGDA 2VF7A 1BAPA 3BJZA 1Z4KA 4LYEA 1R6BX 4YONB 4PN7A 3H4IA 2F1RA 2IVFA 2QMHA 3JX9A 1I6LA 1F1BA 2WIKA 2JJQA 5LL6P 3CG0A 4P33A 3VBCA 4KGDA 1Y9ZA 2R66A 3H65A 1CYDA 5EJ9A 1GTRA 3TQFA 1N8SA 1U0NA 3LMKA 2IUSA 2JEZA 5A5EA 4HN2A 1X92A 1IZ9A 1AMOA 1JQ3A 3DOUA 2AX4A 2BJVA 1IXKA 3EGXA 1YA4A 2QTTA 3VRHA 3PDHA 4DJTA 1PL0A 2UYQA 3GIWA 3WLMA 3EFOA 3R20A 5HZKA 4FZRA 4G8DA 1RLJA 2HPHA 1I7PA 3BX1A 1MRSA 4LVOA 1XN1A 3I72A 2ECFA 2FEOA 3D7NA 3LD9A 2GAOA 3LQ2A 1FFGA 1E5QA 4GQAA 3SK0A 3X2FA 3COVA 3KBOA 1ZNQO 4CTJA 4OXQA 1RBZA 3O21A 1ZK1A 3TUZC 3FLAA 2CZQA 1Q7BA 2F67A 5DM1A 3AQ4A 5F12A 3WLIA 3RYCB 3WGLA 4F3RA 1PG2A 2VF2A 2AMVA 3RVDA 3MWDA 3HDQA 1Z07A 2RKBA 4JAVC 1NAIA 2V6MA 2XMBA 3TVTA 1XSEA 3EGVA 4MLPA 4ZJZA 3A06A 5AVOA 2QVZX 3R3XA 2PXXA 1P39A 3FKSA 1UWCA 5BSMA 1OIXA 1Y34E 4H18A 3FUUA 5C51B 2ZSDA 1N0IA 3JARB 3HY3A 3JR3A 4FXPA 5F9FA 4BQIA 1E2KA 4OQNA 4X91A 3GLQA 2HWUA 1X1RA 3A6FA 1FTGA 3DW3X 5FYQA 1EUCA 2YNMD 2D54A 3EMBA 3ZK8A 1ZR4A 2R8PA 1TMOA 1AF4A 2OV6A 3BWDD 3D7MA 3H05A 4HLNA 4WDRA 3WMWA 4A0GA 4QOGA 4IVQA 5DT9A 3VX4A 1SXJE 1TCUA 3IXMA 4K46A 2QY6A 3EYAA 1BQ4A 2Y71A 4J0IA 3Q8WA 2W6JD 4QDXA 4EA7A 5H68A 1P1BA 4WN3A 1EE1A 3H5LA 4LDRA 1YKSA 1JBEA 2ZIGA 3LDAA 4OQDA 4EFKA 5HRUA 2QTNA 4JB8A 4JVSB 4DWWA 2AKAB 1HQCA 2Z5LA 2PT7A 3LSYA 4TGLA 3L0IB 1JFSA 3UWKA 3CKMA 3ZNPA 2H2GA 4UM7A 1J20A 1U8FO 4V0RA 1KYZA 3VNSA 5ISMA 3FGOA 4BNTA 5K6RA 1PWZA 4FW9A 4Z9FA 5EAIA 3GG9A 4L0MA 5BUSA 4IG4A 3U4QA 2I2FA 3GAZA 3KPVA 1U6KA 3FFAA 4R1NA 1J22A 3PNPA 3OP1A 4ZC8A 4OHCA 1CR2A 4ERNA 4KQKA 4Q19A 4FKBA 1WPQA 1XTRA 1JHUA 1MVOA 3PV0A 4JU9A 2B30A 4IDAA 1PX2A 2DY1A 4HH3C 5FI0B 3VGJA 1Z0FA 3NBQA 1L5FA 3Q6NA 1IEQA 2REXB 2YJNA 1KAOA 2X0JA 1JSXA 3DPUA 3GFTA 2G4CA 3HUUA 4BVJA 3DWFA 1U0HC 1ZIXA 5IDWA 1BKSB 1P8AA 1E6KA 1QH8A 3TO5A 2I4IA 3RJMA 5DOVA 3EIQA 5H4GA 4J7XA 1B8UA 1H3NA 3OE1A 3E9DA 1JMYA 1ZYUA 4LSZA 5EERA 1G66A 1JFLA 4P4SB 1Z4JA 4D4IA 5J5CA 2UUBB 5F1YA 3EGDB 1TZMA 1UPCA 4W9NC 5DNEA 3VZRA 3WGIA 5KIAA 3VZCA 5BMVB 3P0EA 3E81A 3F67A 3KSZO 3PKIA 3UZUA 1KY4A 2ARKA 2PKYX 3T9EA 3EW7A 4YXFA 4J7CA 4KU4A 1UC5B 4TUYA 4KAJA 5E1MA 5HDBB 4F5WA 4Y2PA 3I4FA 3P0JA 3Q3CA 1ZCJA 5ALSA 2XW6A 4X8MA 4W5OA 1DKLA 2WHEA 4ML3A 4JB3A 4JROA 3E9YA 4RKEA 4D0LB 2YFKA 1QQ5A 1JLKA 4O2AB 1J8FA 4EI8A 4MVJG 5KTSA 4O2RA 1TKBA 1NP7A 4HVAA 4COKA 3KQLA 3R8CA 1LLQA 4KOAA 4LHSA 2NZVG 2C4WA 1HDYA 3WLNA 2FPOA 2CF5A 3K1ZA 3OEEA 5CD9A 4MP3A 4WZAE 5K20A 3IP3A 4TXNA 4I6EA 2E4XA 1T9KA 1LPSA 1YIOA 2J3EA 4ZT4A 1QOZA 1IK6A 1U7PA 3HU5A 3ONDA 2JBAA 2IA5A 1MB0A 3DBHB 2MU1A 4IS3A 3PT9A 2HQSA 1TFRA 1DC5A 3RYHB 2GWRA 3LV8A 1C8VB 1FTSA 3O4VA 3PCRB 1N6LA 2ZAIA 2VHCA 4EL0A 2B4KA 4FIDA 1ZUWA 4K1LA 3STYA 2YUIA 4NBSA 4BMDA 1UOEA 1XI2A 1WPGA 4XI9A 3PRHA 1JR3D 3HNOA 2EBHX 2PA0A 4K5QA 5HKBA 2LKCA 2LCFA 4M9CA 1Q0LA 2TRSB 2B36A 4JBLA 3AVTA 5TF4A 3TNLA 1FMFA 1SU6A 1UAYA 1NRWA 1J21A 4KN6A 4Y9UA 1SUSA 3HG7A 4HEHA 4J16C 1F0PA 4LYJA 4CCYA 2QUJA 4EO9A 721PA 3T9DA 1AQIA 3H42B 2WWHA 4ZU1X 4ZOLA 1VJ5A 2O1SA 4QBIA 1D2CA 2ZBEA 3I9MA 4KBGA 4M9RA 2IYRA 1JQAA 4LTNA 2QX8A 3V6MA 5AJTA 5K4GA 5BN3A 2PUHA 5D6NA 3ETLA 3Q9UA 5C3MA 1OCEA 1V4NA 2P4HX 4CM4B 1C7EA 4LISA 4MUBA 5C81A 4QYSA 1G8JA 1G8MA 2H06A 2YZNA 2FWJA 5E7QA 2GPWA 4BBPA 4E5NA 4X54A 4YMUA 2ZUTA 1OJ7A 2EX1A 8ATCA 2FWRA 2AOWA 1NQ5A 1W34A 1G64A 2OV2A 1MH1A 4G5QA 5LQKA 1IBKB 1TFUA 2GHIA 2IHJA 3M4NA 2JIPA 1ODTC 2WD7A 3TXXA 1YNSA 2XEXA 3QIAA 2CFIA 1VL5A 5KNBH 2PL9A 3GZ4A 3I2FA 3JVUA 4NC9A 5EMKA 1Z3IX 3HXTA 4HMPA 3AUXA 4NBWA 1KAQA 3DDSA 1Y42X 4R8RA 3TL6A 1X0VA 3SXUB 3TSAA 3P71T 3A1SA 2OUIA 2B98A 4C05A 4KMRA 1YR6A 1YC2A 3JSXA 3W9UA 4BLRA 4D57A 4KQ9A 2MWMA 2HCTA 3E8MA 5J2UB 3TTYA 4NDZA 2C2BA 4IDCA 3CZPA 4NNPA 4E03A 2BFCB 2QZZA 3I0NA 3D3JA 3R75A 2Q62A 5A4JA 1GA4A 3IESA 1S3GA 4IUYA 3A8TA 4X0EA 1SO8A 3D1LA 5J23A 2R48A 4H0NA 2Y05A 3HB0A 3R3UA 4FINA 4GI1A 4X20A 4ZVPA 3F5QA 2JLWA 2C20A 2FFBA 3B1FA 4IEFB 4KRGA 3H97A 1E92A 3DTNA 3RS7A 5D51S 4CTKA 3SR0A 4QSMA 4HNAA 2FRXA 2W8BA 3KS9A 4GSYA 4OK6A 3TPCA 4X95A 5A02A 4Q02A 3F9CA 4NATA 3HHPA 3PEEA 2DT8A 4R6XA 3V7FA 4D4JA 4CXMA 3D1JA 3NBKA 4TL6A 5T8KC 1L7DA 2FZWA 2V7QD 4O4HF 4LE1A 4TWJA 1U1GA 3JWGA 3OH8A 2HIAA 3S5UA 2ZE5A 1YFZA 2I03A 1SD5A 3TZCA 2GEJA 1YUBA 1XWWA 3M5DA 2INGX 4RVGA 3ZV3A 1V3QE 1RM4A 2FFRA 5IULC 3R3VA 5JQWA 2F48A 5HQ3B 3DE2X 2GEDA 2QUAA 5FJJA 1EHYA 1TD1A 4WK6A 1VLLA 1KO1A 1ZKMA 3HCAA 3PUKA 4R1TA 3S40A 5AUNB 5AW0A 3C5VA 3WQRA 5JS7A 2D2FA 4LG1A 3B7WA 3GGGA 1QKIA 2QJWA 3PD0A 2G72A 4HEA6 1B16A 5LUBA 5JNRA 4TZKA 5HIIA 1SXPA 1KU6A 1LH0A 3A9SA 3OHMA 4LHZA 5AKGA 2GEKA 3TS1A 5CURA 3ZDYB 4X3CA 2BWJA 3K9LA 4ZOLF 1UANA 1DS6A 3FTQA 3OFND 5DN9A 4ILKA 4NR0A 4X8HA 2IU0A 2C5HA 5KPJA 3CPHA 1S2OA 1DQZA 4FNAA 4HH1A 4YJ3F 3NAGA 4AJ2A 3ZZ1A 2OCDA 2RI0A 2TECE 1ZCBA 2YWDA 3E1KA 3O4FA 4HNRA 4R6WA 3RFCA 3QOXA 1FTYA 3QI2A 1XK6A 3JU3A 2Q99A 3BD7A 4K6FA 4MB0A 3B6MA 4EHNA 3WRYC 4LC1A 4JLKA 4Q3KA 4C20A 1I5EA 2AN5A 1TW2A 3MCTA 4UM8B 3ZHYA 4JX9A 2PLNA 3ZE8A 3P32A 5EWJA 3WBKA 3SQDA 2VSYA 1HSZA 4YV0A 4RM3A 3HGMA 5IASA 1X38A 3LUJA 3V6LA 1PV1A 3LGXA 2JZNA 4NJOA 1O08A 3D6NB 5TPWB 3RTGA 4AFNA 4RW0A 3VR6D 2ACWA 1KFBB 3S0JA 3CUWA 3EZXA 3L7LA 5BP7A 5T4FA 2ZAYA 1PG0A 3OT4A 3WRVA 1FDWA 4G3XA 5ALGA 4US2R 4X66B 3G2HA 2Q6LA 3NTQA 1DWQA 4FOSA 1JLHA 1NFFA 4R3NA 2ONJA 2NP6A 5KX5F 1AD2A 1IXYA 2LDXA 3FAKA 4DB4A 3A4NA 2JIBA 1T1JA 4YHBA 3ADCA 2CMKA 1JYFA 2CLLB 1YZTA 1Z2AA 1WEHA 1HH4A 2WIAA 4HNHA 4J07A 2AI3A 3VVBA 1IPEA 1Z22A 4IHQA 2PX0A 3V4PB 5K8TA 3COPA 1G2IA 1YOVA 2ORYA 1B6GA 1RXYA 1WLYA 1YMUA 2B35A 1TYZA 2PD3A 4M1KA 1XTSA 4D45A 1OV4A 1TLFA 4IO0A 1A7AA 4QATA 5TGZA 3E15A 2ZB2A 1AKTA 2BFFB 1PN3A 2H9AA 3KWMA 1VB5A 4JKOA 4OH1A 1RHQA 3MINB 3N8NA 4F8YA 1E6LA 2VJAA 2VYFA 5KSWB 4EGFA 3GJSA 5BOSB 3ONVA 1JF8A 4S1OA 2BFAA 5ADHA 4I1RA 2HBYA 2V5AA 2K4MA 1W4BA 1N0VC 1WXHA 4RTQA 2HPAA 4H7FA 3ZCQA 3JQAA 3ZIAD 2Z2KA 1TADA 3VSAA 1QFMA 1AH2A 2QL6A 4BNMA 4HTAA 3F2IA 3S5JA 4LPSA 4ALNA 3LLUA 4IR7A 4N0QA 3S2UA 5AW5A 3OQNA 2J09A 4NEHB 1RHRA 3Q2KA 4LWOA 1BDBA 1AS2A 2HMAA 4II3A 4GUAA 4KYTA 4J0JA 1NSYA 4JR0A 3VC1A 2HH9A 2YTZA 3DEHA 1LPOA 1XXLA 4V0ME 4HY3A 5CPFA 2AR0A 4F84A 4ITRC 1VPVA 4Q9HA 5ECWA 1SCQA 4B33A 3KQVA 1XA4A 1IJKA 4ALKA 1DQPA 3PGA1 4LS3A 2FPKA 3K70B 4PCUA 3UMRA 2AYXA 5F7OA 2O8BA 4NOKA 5DM60 3I8XA 2OO3A 3Q7SA 4N03A 1L5HA 4FS8A 4YCMA 4RVHA 1C4WA 2IY9A 2R00A 1U65A 3ZD6A 1C5KA 3D8HA 1NJ6A 1K68A 4NZNA 2GF2A 2JHGA 3KXDA 3T9BA 1E2LA 1K7FB 4YECA 4B6RA 3G85A 4E12A 1IEWA 1YVPA 1K9VF 3S99A 2WAAA 4TQ9A 3D4PA 1H1LA 1XROA 2EX4A 4MGYR 3TDMA 4PG7A 1G60A 2LDBA 4OQXA 1YJAA 4TTIA 2GHTA 5MN5A 4KZPA 5EE3A 4B85A 1FUUA 1RRMA 2G28A 1ND6A 5LB4A 3UJHA 3WNQA 4C6TA 4OEHA 3QU7A 5JVDA 1K6EA 3UK0A 2CZGA 1ML4A 5C8YF 4KQCA 5HF5A 5JO9A 4EG7A 2ZYDA 3R41A 2QN9A 4JC4A 4GI7A 4WFJA 1C0EA 1W29A 5HE8A 3CZMA 2B21A 4LXYA 2CLKB 4P2GA 2JGMA 4XQGA 2PKCA 1CQIB 4DBLC 6GPBA 3EK2A 1PLKA 2OBBA 3O92A 3DF7A 4LMBA 5FOSA 1BKYA 2AFIE 4TZ0A 2RK4A 3VR2A 3B1WA 3DBRB 1XRLA 3H5NA 5JUWA 3ZR4B 4UAGA 4JT9A 4Q4HB 4OHVA 2G6BA 3OTQA 3F98A 1EINA 4ENPA 1D07A 1K5DA 1M1YA 1QWOA 2ZDGA 5A06A 2I8LA 2P6PA 2IRWA 3ESZA 1G1AA 4XARA 2FR1A 4X1OA 1IULA 1EVKA 1T1SA 1PJTA 2GMWA 4M0KA 2QR3A 4B3DA 3OQ6A 2JGFA 3J7TA 4YV1A 4IIHA 2RBGA 1E0AA 3IBSA 1NDQA 3C45A 3O94A 4YO7A 5K0FA 1CBUA 3X1XA 1L5LA 4W8HA 1W0KD 2ZRAA 2XBMA 5D5HA 1XWFA 2H08A 4YRMA 3FYHA 3NT4A 4IHAA 3RYFA 4FGKA 4N1AA 4XYGA 5DYIA 4AT1A 3NEJA 4FZ3A 5ITZB 4BKMA 1IU9A 2GCOA 1C14A 4AYWA 3L7DA 4DYDA 3D8SA 3HB4X 5LWHA 3R4VA 4E32A 3W7VA 1NUUA 1GGNA 4R7GA 3OFVA 1OWNA 3R6WA 1NR1A 2V03A 2B34A 5EXEA 2UZIR 3A4IA 2M1XA 4ZAZA 2DULA 4LZJA 3UH0A 4GVPA 5KTPA 3C3MA 4XGIA 1YB4A 4RY0A 4EMTA 3TGWA 3AW8A 5CDTA 4N0EA 4HX9A 4W5QA 2WT8A 2GHQA 5KDDA 2AV6A 2BL4A 4LWPA 3SLRA 2RHOA 2KHZA 5AJUA 3OPQA 4C0WA 5E0KB 1X13A 5C4MA 2HK6A 1NPTO 5F5NA 2X40A 1AKWA 1G8YA 2R3SA 3A3KA 5AVXA 1W4LA 4GLJA 4NRDA 1Z13A 4B3MB 1TIBA 1W30A 1YIAA 2PZBA 3BQMB 2HLDD 1Q3HA 2Z4SA 4NMXB 1M2OB 4KQJA 1NXVA 4MH0R 4COOA 1IPHA 3O1IC 1PS9A 1ADJA 1VPEA 2J9XB 3FCOA 3FG9A 4NHEA 4GFDA 2PEZA 2PD4A 3THSA 3TRFA 4EGSA 5CB4A 2DXIA 4J1NA 3NAZA 2O2XA 2OP1A 1T36A 1P0FA 4BP1A 4NYJQ 1Y5LA 1JEDA 2B2XA 2DBVO 3AZQA 3U81A 3NDJA 4EAAA 4UTRA 4ZDWA 3NDIA 1LPBB 4X1YA 3TSOA 4DM3A 5JH7A 4K6MA 2V7VA 3O38A 2WSSD 3ENNA 1G3QA 2WV9A 2PMEA 1R88A 2GEUA 4TYPA 5F76A 3RS4A 4CKBB 2BMAA 2JFYA 2GRUA 5EOVA 5KDLA 4E51A 4EWLA 2JNWA 2V1UA 5CNJA 3I37X 4OK5A 3T5GA 3TLEA 3L06A 3HADA 4K05A 4F7DA 2XZDA 1L9XA 3DPIA 5M3BA 1E0JA 3F3SA 3OOEA 1PHRA 2DTXA 4OO3A 1EFKA 1BC5A 1X7GA 1N2ZA 1WHSB 2P8JA 2Y1LA 3CU5A 2CJWA 2AZTA 3MNFA 2G1JA 3QLUC 4XB6B 1CJSA 3NBXX 4OOFA 5F7JA 4M7WA 1M1NB 3GK3A 2OD2A 3UQZA 5HXAA 3VPXA 2QTMA 4L7VA 4MVXA 4R2WA 1KDRA 1JA1A 2A58A 4BVGA 4WA8A 3AX6A 1R3DA 2B8WA 1T6BY 2WAXA 4I9NA 2ON6A 2YVLA 2NAFA 4JL8A 4BX0A 1EP1B 2I2XB 3ICEA 4AJKA 3ETNA 1M9NA 2FQQA 2WJPA 2YFHA 3SEZA 5IUNC 3WMEA 4UM5A 4IUBS 1QQ6A 1AUXA 2MTBA 3IOMA 5EFZA 4DM4A 3I6ZA 5D8DA 1U98A 3IAXA 4J8PA 3IVAA 5A9SA 2NADA 5HUQA 5KVAA 1SUFA 4YCJA 1U2QA 2WWIA 3ML1A 1I10A 4UUQA 2QJFA 1JJAA 2C58A 1TGVA 2V59A 3EVAA 4YS6A 4RETA 2NO4A 1SBHA 1H4VB 4K9RA 4YR7A 1P5FA 5HKOA 5BVHA 3DE4X 3THWB 4DZZA 3RS8A 3FZQA 3ED5A 3OAAA 4LJ7A 1A97A 1JDJA 2WU4A 2XKBA 2YXBA 2ZR9A 3Q5EA 4IZ6A 5EEGA 4BGUA 4DHEA 1QO9A 2REOA 2BEWA 3DUFA 3K73O 3UGTA 5A4FS 3QKIA 5LLTA 5DW3A 1JVSA 1DTWB 3BSYA 3H3XA 1B2LA 2DFPA 2NSLA 3I0ZA 4FHZA 2PJRA 2FRDC 1J2UA 3P0RA 4J0GA 1UDRA 3II6X 3D7KA 4P1ZA 1RRFA 4M8SA 2CVFA 4RORA 1SC3A 5ECYA 3QU5A 2W2OA 1S4QA 2V54A 1KKMA 1XRPA 2QAJA 2R8YA 1PUXA 3GZNA 1C9MA 3LZ6A 4BP3A 1WZNA 1AKRA 4KTTE 4CEIB 1ISRA 2PZ8A 3HN7A 1QUFA 3MPUA 3EPPA 4NLLA 4BX9A 5EJ6A 4DA7A 1QO0A 4DG5A 1WXGA 2CXOA 4PSKA 1AV7A 3MTBA 3VKHA 1HDZA 2PL3A 2PPVA 2VQDA 3NW9A 3PEVA 4JJKA 2O07A 3VZBA 1AHPA 1K6MA 2DFKB 2DWOA 1D4ZA 4DEXA 1FUIA 3ZYZA 2FW0A 1YBFA 3ISJA 3L0CA 1P91A 1YHZA 3MFQA 3RU7A 4MW6A 3M6VA 2J0SA 4D99A 2Q6OA 3Q2OA 4YP7A 2PTGA 1K88A 3HKEA 1X7DA 3VR3D 2BRUA 3LUAA 1Z56C 4MV5A 4OFXA 5JW6A 3C5HA 1CX9B 3IFSA 5CCEA 4DDUA 1X3SA 5C46F 5FPTA 1N2SA 3BTVA 4JELA 2O5VA 4FSXA 4PWYA 4OKIA 1I5RA 3FYSA 3CKLA 1PZFA 5JNSA 3LKVA 4N6OA 3MHTA 1Z6YA 2N9UA 2ECQA 5A3SA 2LCIA 5LZ7A 4LE2A 4W82A 3R9IA 2C77A 1KE2A 4NG5A 5CH5A 4BLVA 3R9XB 2C5EA 2XUDA 2MIIA 2WQ7A 2CV1A 4E22A 3GN1A 4GNKA 4OP3A 3VMMA 1GLNA 2WABA 3KKEA 5IVPA 2Z30A 1OYWA 3KQTA 1O6GA 4TV9B 4X24A 2VWHA 1DEOA 1PEKE 3C4JA 4OI2A 3PQ2A 5U4XA 3RHFA 2MYPA 3N7UA 5HF6A 2XT0A 4NH4A 4US0R 3SQMA 4NCNA 4HPXB 4I9HA 3WOVA 4EPYA 1G59A 1YDMA 2VP0A 4REQB 4HGRA 5EWLB 3SMVA 1UJNA 4JI0B 2J8ZA 4OQPA 4AO6A 1NFQA 1RYDA 4Y2HA 5A7FA 5LXTB 3F4KA 3GMSA 4OA8A 2YRXA 2OEPA 2R4UA 3AVXA 3DBVO 4TLBA 4UM9D 1O54A 2D1SA 1UJ2A 3HDVA 2VZ0A 3GT0A 4V3BA 4I7EA 2I71A 2ZR8A 1II8B 1RQ7A 3MJFA 1OBOA 4Q7MB 3D8UA 3DFIA 2LVBA 4BNDB 2WF5A 4BZPA 5E1OA 4GNRA 4AQ7A 1XQWA 4BUZA 5ETJA 3B3GA 2HNKA 1J70A 3PFHA 5AVZA 1GRVA 5EC8A 3N2GA 3REQA 2Q5EA 4D6XA 1LLFA 1QG6A 1T2VA 4ROSA 4MR7B 3CN9A 4PAMA 1GU1A 4G4SP 4Q9KA 5AJVB 4XFKA 2ZUSA 4JYAB 2GO7A 5AM0A 4XXHA 1BD4A 4BEBA 1DBVO 1KMQA 2A4MA 3UW3A 1UBMS 4DLSA 1YCHA 5F21A 2P6UA 3U3DA 2QTVB 4WZAB 5F52A 3ANLA 2X86A 3TJZA 3NEAA 3R24A 4ABYA 4LF6B 3PX2A 3LHDA 4OSOA 1JWAB 1EP3B 3KCNA 4UOQA 1YHYA 4RLHA 2JLYA 3RS3A 2PUWA 1UDCA 2IOQA 1PAUA 1JJFA 3ONFA 4BU1A 3NQ41 4W5TA 4DV2B 2D13A 5GQSA 1SEVA 2C2YA 2C2MA 4EYOA 2DWQA 1TLTA 1G1MA 2ZBGA 5KNCH 1TUBB 4IL5A 4HVTA 3JASA 3K0HA 2WMNB 1U3DA 3BB3A 3IKJA 5LMCA 2CZCA 1QPZA 2OQ2A 3DLTA 3N8GA 5L45A 1R3UA 1X14A 3HYNA 1YONA 3VYVA 3U6KA 4GYKA 1H4QA 5AVVA 4KPYA 2D0IA 3R7FA 5AVWA 2BUCA 4UD6A 2CKDA 3RRJA 1QVWA 2FSHA 4NU0A 1Q1BA 3KE9A 1BCSA 4I19A 5DMXA 4A2QA 5AJZA 2PT5A 1TYBE 4Q05A 4RHYA 3T5TA 1KS2A 2YIJA 3LQRA 2HM7A 3PJFA 2ACEA 2F9FA 3WFIA 5IF3A 4ZEOA 3U31A 3V7YA 1OUMA 3PVSA 4AP6A 1DQNA 5CVDA 3RDPA 2FN8A 3QNWA 2REBA 4UAUA 3A05A 4ZVOA 5BV8A 5LU9A 3OC0A 1JR3E 4FR0A 2B2CA 2C2OA 3FNHA 4B3BA 2CHFA 4P9NA 4TS4A 4O8CA 2QRUA 2QRKA 4NV3A 3T06B 1GKLA 4GW3A 4X6UA 1O0CA 3PTZA 1T5OA 1PJLA 4CETA 4OYYA 2VJMA 2CJFA 3FYUC 1Y9JA 5KHOC 1YF3A 1J1IA 1KJYA 2AQKA 2IKQA 2VJBA 2QVCA 3FVTA 1CY7A 3EIWA 3M4XA 1PZHA 1TZKA 1V5EA 3QBDA 1A9OA 3GO4A 1BCRB 2V1XA 3HKBA 4M0DA 2M6LA 2GKGA 4EJ2A 4FD2A 1YRBA 2V58A 3BDIA 3O2JA 1E3EA 4B71A 4QOFA 4QAQA 3OG9A 2FMXA 3ZWMA 5EZYA 3OIWA 4MHSA 2F8LA 3GUYA 3D0QA 3L0OA 3HN6A 1W94A 4MR9A 2RCNA 3AXTA 5JS2A 3ZQUA 4PBRA 1HNXB 2ZB8A 1E63A 2RAFA 2RHWA 2F17A 2F9MA 3LPLA 1LBTA 1XAGA 5IEBA 3GFFA 4MI9A 4PINA 4QEDA 3R0JA 3M9LA 3RTAA 5CDYA 2BJHA 4Q4AB 2YY7A 3DVAB 3OZCA 3VHRA 5AUQA 4K6OA 2PV0A 2H5EA 4DLXA 1X9IA 1K2WA 2JRCA 1J09A 4FYYA 4KEAA 1VJ0A 1WDKA 2YHSA 4M0PA 4C30A 5LVAA 1NV8A 1HDRA 1NW3A 1KF0A 2XCOA 5SYMA 2WA2A 2Z58A 2ZYUX 3D8BA 3G79A 1Y6ZA 3N2KA 3QMVA 4H08A 2HJHA 4RGYA 4DB2A 4L4XA 3SF0A 2EP5A 3IBCA 4D3SA 1XVAA 3VR5A 4IJQA 8MHTA 2I62A 4HMQA 3PQFA 1Z8FA 4QARA 3NM4A 3MC1A 3PXEA 1CR4A 3AV3A 5JAQA 1SZDA 4EGQA 1CUDA 2OY0A 4HQLA 4MR8A 1GFWA 3GUUA 4ZV9A 2YZKA 3JQGA 1ANKA 5T7BA 1GEEA 5DU2A 1H8ED 3H8JA 4BNNA 4TL8A 2OO7A 3RC3A 2ZU6A 2O2HA 3PGMA 4ND2A 4JITA 4OGGA 4FVTA 1JPNA 1LKZA 2IDKA 4FN5A 4O2BB 2Z5FA 4ZVUA 3AILA 4UVEA 4Q82A 4LRUA 2WTXA 3EASA 2OCYC 2IYFA 2C5SA 1WPXA 3VX3A 4QGFA 4ZO7A 1ZK4A 3ZS9A 1CF4A 4PYMA 3RV4A 4ZOEA 1N4AA 1PGOA 5LD2C 5AHOA 3F1LA 3ABOB 2AMYA 1D4OA 2DJ5A 1FUEA 1RPNA 4W1RA 1GDDA 3U1BA 3FWKA 3JALB 5MFZA 2AKEA 2NZ8A 1A9TA 2BMVA 5FWAA 5K9ZA 4QDTA 3CNQS 2YV1A 3B2NA 1FY2A 3EXHC 3BK1A 3ECSA 3GRYA 3BMNA 3L92A 3CXUA 5IJAA 4BWGA 3BWMA 5IM5A 5B1YA 3UBTA 3FKSD 2C1XA 4GC9A 1YNOA 2PRIA 4OKNA 4U2BA 3ZQKA 5JAMA 4LDJA 2K2QB 1UMBA 4FJ1A 2Q1YA 5EVJA 1T5BA 1FVHA 1Q0ZA 5PGMA 3X1MA 4AXBA 2RGGA 2AWNA 3LQQA 4FJ0A 3ZX4A 4B2YA 1XCGB 4ED9A 1I4OA 3VSEA 1QYXA 1QYCA 5F2KA 3JQBA 5TR9A 3ZDFA 2C5BA 4EO7A 3DHEA 5DNVA 2X15A 3TI9A 2OHFA 3HK2A 3KZXA 1TIPA 2O20A 4HR7A 1FMJA 1AQUA 1CXZA 1XXHE 2YN4A 2GCNA 4AM8A 2UKDA 2X0IA 2Z2JA 2FN9A 2ZBFA 3K32A 3P9YA 4N49A 2QEQA 3G9QA 4DDTA 1KQGA 4DIMA 3LHSA 4PSAA 2H18A 5IKMA 1XMOB 4BJ1A 3LECA 4NCKA 3EN0A 4M76B 3ZX5A 3UUWA 3A10A 1F0NA 4C08A 1E2NA 1A8PA 3WICA 4MVJM 1NXSA 1CUEA 3QU4A 4FOPA 2B4AA 2BM1A 3UV7A 3O8OB 3IO5A 2FZLA 1NVFA 1YR1A 4ZOBA 2V74B 3KOWA 3FY4A 4KVGA 3LC0A 5B57C 3HYRA 4HNVA 3ND9A 5EJ2A 3CJTA 3CBGA 2WU0A 4PAWA 1GT91 2E4YA 3PQ3A 2HLPA 2JAUA 2P41A 4KKVA 1PUJA 3FNFA 2F7SA 4OGKA 4P08A 3GJXC 2BDEA 4QQRA 4UEWA 1JILA 2GPYA 5TPZA 4QUBA 3UCFA 3F6CA 5LOVB 2A0XA 2AR9A 2JCYA 2F62A 3ECCA 1V6AA 4DT1A 4A0HA 1MJNA 4INAA 3OI7A 5ELMA 4CEHB 2NZ2A 1TT5A 5HQTA 3R76A 1NMQA 3F7TA 5B64A 5JSQA 1TTHA 1W0JA 1YJQA 4N8DA 3V4FA 4GMKA 1JLRA 5BYJA 1OKKA 2WI8A 5JR3A 1YS1X 1I7LA 2ENUA 3HC7A 4PICA 3TZLA 1N57A 1YB2A 1UJBA 3P5SA 4V0LA 1RI1A 4LVUA 3SZOA 1HE3A 2ZRDA 2BFEB 5CVTA 4RJLA 3AVUA 2XF2A 4BWFB 4WZBA 1J0CA 3B9PA 4UDXX 2I6SA 1DXOA 5DH9A 4DWJA 3A4TA 5CCDA 3HNRA 5TC4A 2FMUA 1EA5A 5JATA 2AQIA 2FK8A 3PNLA 3K05A 3GH3A 1FDRA 3AVWA 5KQLA 4KQIA 4PTLA 2OO5C 3RQIA 5F7XA 3WE7A 2A5YB 4RJ2A 3VKUA 4I3HA 1Q3TA 2P5YA 1R6XA 1ORTA 4HDOB 4INPA 4WEOA 3GL9A 2GK3A 3JWIA 3OEED 4XD2A 1VG0B 2BDUA 1N9GA 3V4ZA 2IPOA 1OIVA 1JQBA 4JOBA 1JHZA 1H0SA 1Q7TA 3Q2IA 1ESMA 1ZSYA 1RXVA 4V0KA 1EUYA 4TM8A 1Y89A 2R60A 3FNGA 3MJHA 2VBFA 4WNAB 3B85A 3EDCA 1NASA 4FP9A 3HXOA 3KALA 2Q49A 1Q3KA 3DYVA 2XRZA 2BKLA 3H1AA 4LJKA 4R5HA 4ZK2A 4XUEA 2ANCA 4GMFA 4L8FA 4NJMB 5HFAA 1EG7A 1WB9A 4WXMA 2FEWB 4RQBA 5EIBD 2RMKA 4D80A 1OILA 2G5CA 4GI3A 2JVIA 4XSGA 4QGSA 3PUYA 1WHTA 2DMRA 1P1JA 1L0BA 1WAMA 3GD7A 3QE0A 4S0ZA 3M9WA 5AR1A 3RFFA 3H84A 3CH7A 4Y1RA 3HABA 3DDNA 3Q10A 4H7DA 1Q16A 4KR0A 1U4OA 3AEXA 3MMXA 3RS0A 2ZQ5A 1LF0A 2IF0A 4CIYA 2E4AA 4WCFC 3I9V6 1JDSA 3TKLA 4UW9A 4DV3B 1O94C 3KVVA 4ASUA 5CB6A 1BQEA 1MQ8B 1V45E 3PU6A 3QNUA 1EEHA 1NBHA 1VJCA 4HRXA 1J39A 3B3JA 4LF9B 1Z4NA 2E89A 2FN7A 5B36A 1XZMA 3HXQA 3DH0A 2JA1A 1HDEA 2J6HA 4U2GA 4WX2B 1P0PA 1I33A 1Q57A 1RPJA 2C2XA 2YWBA 1YRLA 4FYXA 2PBLA 3BWBA 3ZBUA 1YU6A 1BDIA 3THOA 4ARCA 1L5OA 3L7OA 4B3HA 2HWKA 1O8BA 1ESNA 3LZDA 2PXAA 3QWHA 4EKGA 3UOWA 4RTNA 4C0BA 1G5IA 3IS3A 2ZROA 4LBYA 1NLMA 5KOJB 2IIVA 3K4HA 4NICA 5JHHB 2C4NA 4DXDA 1Z0ZA 3P2KA 1JLLA 5IZCC 2V96A 3HJGA 1GVNB 1Y1LA 4DXAA 2F4NA 1CUVA 2Y27A 2VJDA 5JPCA 2JB9A 3K0EA 4KMOA 1CF9A 4Q9AA 1X6VA 4PZZA 2OZKA 4D6PA 4ETNA 1V1JA 2BKVA 5BNTA 5CA0B 4EZEA 2NZUG 1GSOA 4S1PA 1NBAA 3K9WA 4P8RA 1FRQA 1NJ8A 4YRSA 2OGZA 1XZFA 5FRDA 2MMGA 3RARA 5AVTA 1NW4A 1CJBA 4H16A 3SSMA 3H3JA 2FA9A 2XCIA 3PJRA 3EPKA 4TKMA 1FBNA 3H1EA 3TM4A 1GQFA 5L3SB 5JAIA 2PGLA 4BWVA 1UEIA 5DCUA 1UPXA 3G2MA 1Q14A 1CQPA 4WJKB 2C78A 4GH5A 3R6DA 2NVUB 1G3MA 4HQ6A 1WQ1R 2HA5A 4FDTA 4ARVA 3BF7A 3R5KA 3C6ZA 4XDZA 3G7UA 3RAFC 1EUDB 3PLRA 4JZKA 3D64A 1P81A 3NXSA 3BGDA 5K0TA 1M7BA 5MN4A 2E4VA 1G8HA 3K2QA 2IV3A 2GESA 2Q5LA 3K8OE 2F90A 1DNPA 2JH9A 3UMMA 2OOKA 3K1AA 3H5WA 3VPDA 3TMYA 1H23A 5E2BA 1A5BB 1F7VA 2OBNA 3R5HA 3SCZA 2H2WA 3NIGB 1T9ZA 1UBOS 4LSMA 1Z37A 4K9NA 4HFJA 1ODIA 3ELDA 4HDRA 4NYIQ 1RYNA 4L2IA 2AMJA 1RTTA 3AINA 5BNWA 5GOTA 3AXSA 2VPTA 3H7IA 7ADHA 5FNVB 3LI2A 4JLUA 3A70A 4OJMX