1AQWA

Glutathione s-transferase in complex with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1aqwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aqwA01
5DDLA 2RM5A 3ZIVA 3WGXA 1H75A 3UL3A 1BX9A 3A2XA 3FEUA 3U5RE 3IK9A 3M1GA 1GSSA 5IMCA 4K7NA 4POBA 1K3YA 3ME8A 2WB9A 4WF4A 1SL0B 5AIVA 4DSSA 4XRDA 4BVXB 5ECRB 3HJPA 2CVKA 2J23A 3WD6A 3G7IA 4Q5RA 3UVHA 1QUWA 2CT6A 4MZWA 3CSHA 3FHKA 4OFTA 2WRTA 3I6AA 1T8EB 4KDYA 3KMNA 22GSA 3ZMKA 1GH2A 1J9BA 1K0CA 5GAND 1G6WA 3TJJA 6GSSA 4BL7B 3CTGA 2EC4A 2FGXA 4RI7A 5HQPA 1B9XC 2GZYA 3EYTA 5H5SA 3GYKA 2C3NA 5CRGA 2GT5A 1AXDA 3H1NA 5ECMB 2DJ0A 4KF9A 1SENA 2LTKA 3KD0A 4Q5NA 4G0KA 3C8EA 4O5RA 1NW2A 1EGOA 1WWJA 4OCFA 3FR3A 1LU4A 4ILFA 3WT1A 2KP2A 3RPPA 4LL4B 1K3LA 5AGYA 3TOUA 3ME7A 2GQKA 1Z7RA 2FCHA 3SBCA 1GTIA 2CZ3A 1CQGA 5DCGA 5A4UA 4YH2A 1QMVA 4O32A 2IL3A 2FWFA 2VM2A 2PPTA 1N8JA 2DJKA 3FR6A 4PXOA 5D8IA 1X5EA 1AUCA 1R5PA 2TRCP 5JWQB 3Q6OA 1EV4A 4YAVA 3APSA 2E2GA 1GULA 3D22A 4D73B 13GSA 4TR1B 2NBSA 2E0QA 3GX8A 3GFKA 3HJMA 3FR9A 4BVYB 1YF0A 3WGEA 4EUYA 2H76A 2FY6A 3IDVA 2GSTA 2DSAA 4QQ7A 1GTBA 2JSZA 3A2VA 3DEXA 3H4KA 1EZKA 4MJAA 4YAPA 1XWKA 3RDWA 4TXOB 1JLVA 1Z3EA 3IAS2 4KSMA 1SD9A 4ML1A 2YJ7A 4ML6A 1F6MC 4HUAA 1THOA 4L5LA 2IN3A 5LCZA 5DAKB 3HVSA 4KCAA 4NXIA 5JCWA 3EMXA 3CMIA 5DJMA 4NMUA 1B4QA 4K1FA 3TOTA 3IR4A 4IQ1A 2H19A 4TKYA 5HR0A 3EMPA 2GS3A 3L9SA 1Z5YE 3GKMA 4WXTA 3UAPA 5F07A 2OA7A 4HI7A 3K8NA 2X8GA 3D4MA 9GSSA 1ERWA 4ZL7A 3IK7A 4D73A 5FT3A 4L0WA 4TR1A 1SKRB 2B5EA 1GTAA 1N2AA 2JACA 5ENUA 4CHSA 4FQUA 3F63A 5D9TA 5A4WA 4ZXGA 3TKSC 3DIEA 2FWHA 4L5OA 4G9HA 2GSRA 2CVBA 3TCOA 1JHBA 2HYXA 2XPDA 4LA1A 1ERTA 4MZBA 5EL8A 2C3QA 2IIYA 5IMFA 4KH7A 1T1VA 4EDZA 3CSIA 3H93A 3TRQA 4TXOA 1XVWA 1M7TA 1ZZYA 3C7MA 3HA9A 2VCWA 2KP1A 2GSQA 1B48A 20GSA 2LJKA 1O6JA 2X8HA 2F8AA 5DAKA 5AN1A 1XWAA 1V98A 1QQ2A 2AJQB 2YV7A 4WR4A 5INYA 1UA5A 3N9JA 4G10A 5H5QA 3LORA 1SU9A 2E2MA 4NHZA 1AC1A 2LRCA 2XHFA 1J0FA 4WEYA 4V2LA 3F8UA 5ELAA 4OMVA 2I81A 5HFKA 1O81A 1XCCA 2FNOA 1ML6A 5CRHA 4GLTA 1H4OA 2HRFA 4I8BA 2DIYA 2J9HA 2MBTA 4RQXA 5CP1A 1ON4A 1OAZA 2C8UA 3D6IA 1AW9A 1EP8A 2HZFA 1PA3A 3KMOA 2LS5A 2DJJA 3IXRA 2B6MA 5IMDA 1UN2A 2KOKA 2C0DA 3HVVA 1QXHA 4JRRA 3TKPA 1F3AA 4KDXA 4JR6A 3QDNA 1DE2A 1PRXA 3NOFA 2QGVA 4USSA 3APOA 2DC5A 1WP0A 1NHYA 3LYKA 1YF1A 4K6XA 3TJFA 1I5GA 2YCDA 2M46A 1SL2B 4KAEA 3Q18A 2D2ZA 2O85A 1Z6MA 2YWIA 2L4CA 2YWNA 1TK0B 2F51A 4QL7A 4KDUA 5KN0A 2HRNA 1SKWB 4O7HA 1WE0A 1SL1B 3KM6A 3VWXA 4POMA 2YZHA 5H5RA 4G2EA 4TN8A 1UVZA 3VFIA 3HVXA 3ERWA 4ZL8A 3L78A 2HI7A 2V2GA 2ZUPA 3DXBA 2MBSA 2UZ8A 3TJGA 4YQVA 4HJMA 5GAPD 3GUSA 2YANA 4QL9A 1EV9A 4GWRA 2P0GA 2H1DA 1O8WA 2L6CA 2PUKC 3QR6A 4ZBBA 1ZCPA 4TW5A 2P5RA 4E8HA 3RHBA 4TXVA 2FUG2 3HZ4A 1W89A 3C71A 2VLUA 3QCPA 2MMOA 2VLVA 2VOCA 2X8CA 1V57A 2H0HA 3KH7A 5IIZA 4NAXA 4NWYA 4PNGA 5IM9A 2QKEA 1M9BA 4IP6A 1YQ1A 2YPMA 5C00A 2GSSA 1R4WA 3UMAA 3A3TA 11GSA 4AGSA 4EXJA 4JR4A 1K0NA 2Z9SA 1URMA 3C1SA 3GKXA 1MDJA 4EL1A 2LRTA 1SYXA 1K3OA 3VI7A 3LXZA 2C80A 1MD4A 2BMXA 4TR3A 4PX1A 4LMWA 2YWMA 4MZCA 1FVJA 3GTUB 4MJEA 3BCKA 5DALB 3QFAC 4WKWA 2C0FA 1SJZA 4TR4A 4AJ7A 3ZFBA 1ST9A 4I5QA 2VCVA 1K0BA 2B1KA 1LJRA 5J5NA 2B5YA 3DGQA 2WS2A 5IMZA 3Q74A 1TJDA 1NHOA 2FWEA 5HR1A 4V1Ap 3BJ5A 3IPZA 2VD1A 1YKCA 3CRUA 1TRVA 5ECNB 2L57A 4LL1B 3DWVA 4Z7XA 3ZMLA 3LQ7A 1HNCA 1GWCA 2AAWA 2YN1A 4N11A 2X99A 4KE3A 1FB0A 1PMTA 2OE1A 2IMEA 1SK1A 2JADA 1A8YA 3F4RA 4F0CA 2H6ZA 4MJCA 1V2AA 4IP1A 3KEBA 2GGTA 5CREA 1OYJA 3C1RA 2EIOA 3ISOA 4V1Ag 3ZRDA 1EWXA 1VRSD 2H71A 2R3XA 2LSTA 1XW6A 1U6TA 2FHEA 3DVXA 3KCMA 5IOWA 4I2TA 3ZITA 2OBIA 4EC0A 2LQQA 1M99A 2PWJA 4XS4B 2P5QA 4XS6A 1TRUA 1DSBA 1E2YA 3LFLA 2VUPA 5DALA 3GRXA 1XPVA 1U88A 4FYCA 1TRSA 2F9SA 1JZRA 2H72A 1GRXA 2MMZA 5J9BA 4RUVA 1B4PA 2HSYA 2H6XA 2V6OA 4DVCA 8GSSA 3MWHA 1HD2A 5G31A 1I9DA 1YEXA 1A0RP 4E8EA 1PSQA 5IO0A 2CAIA 1FG4A 4XRAA 2DLXA 4IHUA 3US3A 1EOGA 2VD0A 4MF5A 2V6KA 1YDKA 4EKZA 2N5AA 2ZNMA 2MYGA 4GQCA 3VI5A 5J9CA 3GKNA 3RPNA 3ERGA 1OC9A 4MF7A 4IJ3A 1PD21 3KTLA 2ES7A 4N0ZA 4KCEA 1O8XA 1K0DA 4KB3A 2VIMA 4BWSA 1V40A 1BEDA 2H1AA 5HFGA 3ZYWA 1SKSB 3ZVJD 2RLIA 4WR5A 1X9MB 1KBNA 4F2IA 3QAGA 4BVXA 2IFQB 3E3EA 3UEMA 1R5AA 1Y25A 4OFNA 3KP8A 1XWBA 2R37A 2L59A 3KGKA 2H0GA 2O8VB 1Z7PA 5ECOB 4PTSA 1U3IA 1MD3A 2CX3A 1HQOA 1EP7A 4V2MA 1BJXA 2GQMA 3UJ1A 4XS4A 2IMFA 2C0GA 4FYBA 3GIXA 5B8AA 3LSZA 2AYTA 1VF1A 4BL7A 4PNFA 3CTFA 4MPFA 3GURA 1G6YA 3KJYA 3IAM2 5IOXA 3RAZA 3ZZXA 4IS0A 7GSSA 1MDIA 3KP9A 2GLRA 4FYUA 4IKHA 5DVBA 3F3QA 1Q4JA 5D9VA 4JE1A 2NDOA 2BTOT 2K8SA 3FZ4A 2I9HA 5EY6A 5LD0A 2VAFA 2HZEB 3LG6A 3IC8A 3PGTA 5G5FA 3QD9A 4G0LA 1YKAA 3WYWA 1MTCA 1OC8A 3HDCA 2KLXA 3LGCA 2OKAA 2YV9A 4YQMA 4HOJA 3E9JB 3EINA 1BAYA 3VWUA 1T7PB 4PQHA 1A2JA 2IFQA 5IMVA 3BBYA 1Q98A 4K7IA 4IQAA 3UVTA 2PGTA 2IWTA 4HQSA 4G19A 4BVYA 1YJ6A 2VO4A 3DRNA 1GTUA 1C72A 3H79A 5F06A 1S3DA 5D9WA 3IBHA 4XCSA 3RHCA 1TKDB 3C73A 5F05A 4F9ZA 1PX6A 1V9WA 3OR5A 4IGJA 1PL1A 4MF6A 2L6DA 4ZB9A 5HR2A 1JZDA 1VF2A 4HS1A 3MSZA 5JCGA 2DJ1A 2NVLA 1EGRA 5KEJA 3FKFA 2L5LA 4FO5A 4L0UA 3IOSA 4IJIA 2R6KA 4OO4A 2R5GA 1XIYA 5GSSA 5J4UA 3IC4A 2HZEA 5CNWA 3HKRA 4MABA 3BD2A 1EOHA 1O73A 2OJLA 2LJAA 2MMNA 4HDEA 5J3RA 1OVNA 3QMXA 1GLPA 4Q5QA 3PPUA 1TI3A 2PN8A 1PQNA 3TKQA 3TKSE 3M3MA 4K0GA 3VPTA 5JWOB 4XTSA 1GSDA 5DQSA 4IBPA 1HNAA 1WRYA 3I43A 3GL5A 4AF2A 4WBJA 3O3TA 4MLYA 2FWGA 3KIJA 1G7EA 1ERVA 1K0AA 3IA1A 2V1MA 2FA8A 2JZSA 1GL8A 1BQ7A 4KA0A 1X5DA 3ZREA 3SWLA 1J08A 4H86A 3O76A 1GSQA 4WETA 3HZ8A 1XOBA 1VF3A 4ZB8A 4ECIA 2FD3A 2DMMA 2C1YA 2CVDA 1YZXA 1F37A 2B7JA 4KNDA 2XBQA 2JL4A 3FRCA 3TB2A 2HSNB 4TOPA 3DKSA 2XPEA 2GZPA 3UBLA 1G7OA 3HY2A 4PQ1A 1EEJA 3PR8A 3WT2A 4KGIA 4EE0A 2JZTA 1TU7A 1NM3A 4NHWA 3CBUA 4V2NA 1M0UA 3EURA 2B7KA 3ZL5A 5IPGA 3TUEA 2CA8A 2WDUA 4ZBDA 5DBQA 1XW5A 2O89A 2JU5A 3L9UA 5ABRA 5F0GA 4PUAA 5J41A 1GUHA 1AAZA 1A23A 16GSA 1AQXA 4GRFA 2ALBA 2A2RA 4RI6A 4MH3A 1BYEA 1TK8B 2IMKA 3W8JA 3A5WA 4MP4A 4N30A 2RUEA 1K0MA 3KH9A 5IMAA 2CZ2A 1A24A 3EE2A 3UBKA 4EO3A 5DQYA 2VCQA 1GUKA 1TTZA 2H6YA 6GSWA 2HSHA 1OKDA 1GNWA 3GN3A 2V41A 1SJ6A 2R4VA 1ZL9A 3V1WA 1OE8A 1TK5B 3U6VA 3F3RA 1FHEA 4HZ4A 5ID2B 3PH9A 1SK0A 2CV4A 5KN3A 3HXSA 5EVOA 4J57E 4FH8A 3M9JA 2X64A 2GDRA 3DMLA 1XXUA 3D5JA 4I6XA 4LMVA 1FB6A 1W4VA 1KTEA 5D93A 1PN9A 2HT9A 3ZTLA 2HRAA 4KW6A 4CDOA 2RIIA 2HRKB 5F8BA 4ULXA 5CRDA 5D96A 2BJXA 1WIKA 1XBSA 1WMJA 14GSA 2HE3A 4HU9A 3LWAA 2K9FA 3QAWA 4O92A 1MEKA 4ZILA 4P3YB 3D0ZA 3H8QA 1WJKA 4OD7A 5C04A 1TRWA 4LLRA 4ECJA 1FAAA 3LJRA 1T00A 3IE3A 3F4TA 4MK3A 2PU9C 4N10A 3F6FA 3IRAA 3KXOA 2K6VA 5AISA 5JWRB 2WGRA 1B9YC 2L5OA 2V32A 3P7XA 1ACVA 4GCIA 2H70A 1ZYEA 1M2AA 5D73A 4NV2A 2G2QA 2QSIA 3VPQA 2O87A 1ZMAA 2CQ9A 1JFUA 3M8NA 2GTUA 3F6DA 5ID2A 5ECKB 3P90A 2IMIA 5ELGA 2HSMB 3I69A 5B6MA 2PERA 3P8WA 1TXXA 4J56E 2DJ2A 1F9MA 1B8XA 4K9ZA 17GSA 3GTUA 5ECIB 1V58A 4IELA 2MZCA 2H66A 3HYPA 4X43A 3AY8A 3I9V2 2HRKA 3CXGA 1X9SB 1CQHA 3VURA 4OO5A 5IPHA 3GV1A 3L0HA 1A2LA 2B1LA 5G1LA 3BCIA 1USBA 2LNTA 2VLTA 2H01A 2VL9A 3A2WA 2FLSA 4MDCA 2LKUA 2GZZA 3ZVJA 3G7JA 2WFCA 3W8SA 1OKTA 3QPMA 2L4QA 4OCEA 1TP9A 2YZUA 3FZ5A 2YOIA 2H8LA 2VL2C 3DYRA 1LBKA 3BOAA 2B3SA 1WPIA 3IV4A 4EVMA 1VGLA 4JBBA 4MJBA 2GT6A 3FK8A 4RQRA 1PKWA 2LV3A 2AHEA 1JLWA 5B6NA 1TW9A 2OE0A 1KNGA 3D4TA 1FVKA 1MDKA 4K8MA 4BPYA 3ZFLA 5KN1A 3GL3A 1O85A 2FA4A 2ON7A 4F82A 2HSMA 3HJOA 5DJLA 2GQLA 3EU4A 4MPGA 4BA7A 1JZWA 1ZGNA 3GA4A 1FW1A 4TVEA 3RBTA 3EC3A 1THXA 3R3EA 4POLA 2H75A 3GSTA 4GSNA 2HNLA 4AJ6A 4DSRA 3EWLA 3M9KA 3GH9A 4PUFC 4KUNA 4N0VA 2N5FA 4KSOA 1DE1A 5CAXA 2AUVA 3WGDA 5KN2A 2G0FA 3G7YA 4MCUA 2I4AA 4X1UA 3GH6A 2AB6A 2M72A 4TRXA 3N5OA 4X0XA 1QFNA 4MH2A 2F8FA 3O6TA 1IYIA 1AQVA 2PVQA 2OACA 1HNBA 3TKRA 1U3AA 2IMDA 4TR0A 3DVWA 5GSTA 2YP6A 4OWYA 1GNEA 3E0UA 4IN0A 5AIXA 1X5CA 3TRPA 5G1KA 2WJUA 4K2DA 2PMTA 4EF0A 1RW1A 2H0IA 2IPAA 2H1GA 1F2EA 4G0IA 5D9XA 1GSUA 1T4YA 2NPBA 3ZIJA 4GTUA 1PGTA 3DD3A 2DBCA 3UOMA 2HLSA 5CRWA 5EPFA 3S9FA 5A5KA 4DSQA 3LXTA 1TU8A 1BG5A 3J7Yk 3TJBA 5CO3A 3F9UA 4L8EA 4ID0A 3QFBC 3MDKA 4K0NA 5ECQB 1ZYQB 1OE7A 1NSWA 2KHPA 4GSTA 1SD8A 2ZCTA 3APQA 1XOAA 2VL2A 3VK9A 3CRTA 3VWVA 4IW9A 1VF4A 4OFMA 2GVPA 4XHMA 5GZZB 1ABAA 2I1UA 5G5EA 3L4NA 1UC7A 3GHAA 1SK2A 2LQOA 3LEFA 4GQFA 2O7KA 1A0FA 3F0IA 1G0TA 2LEGA 3QAVA 5DCHA 4NV5A 2HFDA 2A4VA 4GXZA 1GSFA 19GSA 2OADA 4IVFA 3QOUA 1PL2A 1GP1A 1SYRA 2E7PA 2HQTA 5ECSA 1KEBA 3GNJA 1ILOA 5LNKe 1QGVA 2LRNA 4PQIA 1ZOFA 4I97A 5FWGA 1Z9HA 5HR3A 12GSA 1K0OA 4JEDA 1Y6EA 4WF5A 2VCZA 3VLNA 4POKA 6GSVA 3Q19A 3IHQA 1DBYA 4XIHA 3TJKA 1E6BA 3UIWA 5L71A 5ECPB 2TRXA 3HHVA 2B5XA 2YWOA 5B7CA 3ED3A 4NPBA 1IYHA 1GSEA 1XVQA 1X0RA 2MMAA 1YEPA 2F3MA 2VL3A 2OBKA 3HCZA 3LYPA 4FIWA 4ZL9A 2N5BA 4HZ2A 1M2DA 1TDIA 2A2SA 2H74A 4Q5FA 2LUSA 3J7Yb 3CYNA 2K8VA 2YJHA 3VWWA 2H1BA 3FZ9A 2RUFA 2VM1A 5E4WA 3NZNA 3PINA 3D21A 1GSYA 4MA9A 1HYUA 2C4JA 2PVOC 5E59A 5HFIA 2DJ3A 3FY7A 1TOFA 6GSTA 1JZOA 1QK8A 1S3AA 2H73A 1XWGA 1T4ZA 2DMLA 1U87A 2TIRA 3KZQA 3FZAA 4ECCA 3ZLPA 5CYYA 2VCTA 4I2UA 3JCML 4HQZA 4PURA 2HXKA 1ERUA 4MMMA 3UARA 1O7UA 2VCXA 1PKZA 1GUMA 2M80A 5BMUA 2WULA 3MAKA 3G9BA 4BWQA 1PX7A 5B8BA 1GLQA 4HU7A 2CX4A 3TKSA 1RQMA 6GSUA 3ERFA 2DIZA 4F03A 2KUCA 3CSJA 2P31A 6GSXA 2EIQA 3EU3A 2XC2A 2REMA 4J2FA 2K18A 3NIVA 2EIRA 4ZBAA 2WCIA 1SJIA 4ZB6A 5IQYA 3TRXA 2LNSA 3W6GA 1X9WB 1OC3A 5G30A 2PBJA 4F0BA 2C0EA 4JU5A 4GSSA 2XBIA 1A8LA 2YNXA 3F4SA 1F3BA 5FHIA 18GSA 1AQWA 2CAQA 1DUGA 1XW9A 2AV4A 3FYGA 1WOUA 4GF0A 2LJRA 3HD5A 3MNGA 3KTBA 2C3TA 2ON5A 3GSSA 4DSSB 4ZIJA 3TGZA 1TI1A 6GSYA 5G2ZA 4K7OA 4KX4A 4DEJA 4JZQA 2WZ9A 3L9VA 1FOVA 1XFLA 3TDGA 4ISDA 1T3BA 5JCUA 4EDYA 3P2AA 1M9AA 1R26A 1RK4A 4AJ8A 4CW9A 4ECBA 10GSA 3R2QA 2RM6A 2H30A 2QC7A 4HJ2A 4ACSA 1S3CA 1XWCA 5A4VA 3M0FA 2IJYA 5COHA 4XS1A 2JZRA 2R2JA 3GMFA 1M2BA 2I3YA 1AIUA 5ECLB 5ECHB 3GX0A 4YQUA 1A2MA 2OE3A 3GKKA 1XZOA 2NTOA 1Z6NA 4HEA2 1R7HA 1FO5A 5IO2A 4PGTA 1EEMA 4WBRD 3EVIA 1YY7A 2JSYA 1OC9B 3FW2A
chains in the Genus database with same CATH superfamily
5DDLA 2RM5A 5A34B 3ZIVA 3WGXA 1H75A 3UL3A 1BX9A 3A2XA 3FEUA 3U5RE 4BIKA 3IK9A 3M1GA 1GSSA 5IMCA 4K7NA 4POBA 1K3YA 3ME8A 2WB9A 4WF4A 1SL0B 5AIVA 4DSSA 4XRDA 4BVXB 5ECRB 3HJPA 2CVKA 2J23A 3WD6A 3G7IA 4Q5RA 3UVHA 1QUWA 3HVNA 2CT6A 4MZWA 1FOHA 3CSHA 3FHKA 4OFTA 2WRTA 3I6AA 1T8EB 4KDYA 3KMNA 22GSA 3ZMKA 1GH2A 1J9BA 1K0CA 5GAND 1G6WA 3TJJA 6GSSA 4BL7B 3CTGA 2EC4A 2FGXA 4RI7A 5HQPA 1B9XC 2GZYA 3EYTA 5H5SA 3GYKA 2C3NA 5CRGA 2GT5A 1AXDA 3H1NA 5ECMB 2DJ0A 4KF9A 1SENA 2LTKA 3KD0A 4Q5NA 4G0KA 3C8EA 4O5RA 1NW2A 1EGOA 1WWJA 4OCFA 3FR3A 1LU4A 4ILFA 3WT1A 2KP2A 3RPPA 4LL4B 1K3LA 5AGYA 3TOUA 3ME7A 2GQKA 1Z7RA 2FCHA 3SBCA 1GTIA 2CZ3A 1CQGA 5DCGA 5A4UA 4YH2A 1QMVA 4O32A 2IL3A 4G01A 2FWFA 2VM2A 2PPTA 1N8JA 2DJKA 3FR6A 4PXOA 5D8IA 1X5EA 1AUCA 1R5PA 2TRCP 5JWQB 3Q6OA 1EV4A 4YAVA 3APSA 2E2GA 1GULA 3D22A 4D73B 3CHXC 13GSA 4TR1B 4CY8A 4YKGA 2NBSA 2E0QA 3GX8A 3GFKA 3HJMA 3FR9A 4BVYB 1YF0A 3WGEA 4EUYA 2H76A 2FY6A 3IDVA 2GSTA 1Y1UA 2DSAA 4QQ7A 1GTBA 2JSZA 3A2VA 3DEXA 3H4KA 1EZKA 4MJAA 4YAPA 1XWKA 3RDWA 4TXOB 1JLVA 1Z3EA 4AKXB 2WVZA 3IAS2 4KSMA 1SD9A 4ML1A 2YJ7A 2WZSA 4ML6A 1F6MC 4HUAA 1THOA 4L5LA 2IN3A 5LCZA 5DAKB 3HVSA 4KCAA 4NXIA 5JCWA 3EMXA 1I1IP 3CMIA 5DJMA 4NMUA 1B4QA 4K1FA 3TOTA 3IR4A 4IQ1A 2H19A 4TKYA 5HR0A 3EMPA 2GS3A 3L9SA 1Z5YE 3GKMA 4WXTA 3UAPA 5F07A 2OA7A 2QA1A 4HI7A 3K8NA 2X8GA 3D4MA 9GSSA 1ERWA 4ZL7A 3IK7A 4D73A 5FT3A 4L0WA 4TR1A 1SKRB 2B5EA 1GTAA 1N2AA 2JACA 5ENUA 4CHSA 4FQUA 2EFHA 3F63A 5D9TA 5A4WA 4ZXGA 3TKSC 3DIEA 2FWHA 4O5QA 4L5OA 4G9HA 2GSRA 2CVBA 2WW3A 3TCOA 1JHBA 2HYXA 2XPDA 4LA1A 1ERTA 4MZBA 5EL8A 2C3QA 2IIYA 5IMFA 4KH7A 1T1VA 4EDZA 3CSIA 3H93A 3TRQA 4TXOA 1XVWA 1M7TA 1ZZYA 3C7MA 3HA9A 2VCWA 2KP1A 2GSQA 1B48A 20GSA 2LJKA 1O6JA 2X8HA 2F8AA 5DAKA 5AN1A 1XWAA 1V98A 4GDFA 1QQ2A 2AJQB 2YV7A 4WR4A 5INYA 1UA5A 3N9JA 4FXYP 4G10A 5H5QA 3LORA 1SU9A 3CQFA 2E2MA 4NHZA 1AC1A 2LRCA 2XHFA 1J0FA 4WEYA 4V2LA 3F8UA 5ELAA 4OMVA 2I81A 5HFKA 1O81A 1XCCA 2FNOA 5J4VA 1ML6A 4W66A 5CRHA 4GLTA 1PFOA 1H4OA 2HRFA 4I8BA 2DIYA 2J9HA 2MBTA 4RQXA 5CP1A 1ON4A 1OAZA 2C8UA 3D6IA 1AW9A 1EP8A 2HZFA 1PA3A 3KMOA 2LS5A 2DJJA 3IXRA 2B6MA 5IMDA 1UN2A 4PHZC 2KOKA 2C0DA 3HVVA 1QXHA 4JRRA 3TKPA 1F3AA 4KDXA 4JR6A 3QDNA 1TXUA 5A1NB 4N3ZA 1DE2A 1PRXA 3NOFA 2QGVA 4USSA 3APOA 2DC5A 1WP0A 1NHYA 3LYKA 1YF1A 1BF5A 4K6XA 3TJFA 1I5GA 2YCDA 2M46A 1SL2B 4KAEA 3Q18A 2D2ZA 2O85A 1Z6MA 2YWIA 2L4CA 2YWNA 1TK0B 2F51A 4QL7A 4KDUA 5KN0A 2HRNA 1SKWB 4AKGA 4O7HA 1WE0A 1SL1B 3KM6A 3VWXA 4POMA 2YZHA 5H5RA 4G2EA 4TN8A 1UVZA 3VFIA 3HVXA 3ERWA 4ZL8A 3L78A 2HI7A 2V2GA 2ZUPA 3DXBA 2MBSA 2UZ8A 2H1LA 3TJGA 4YQVA 4HJMA 2WW2A 5GAPD 3GUSA 2YANA 4QL9A 1EV9A 4GWRA 2P0GA 2H1DA 1O8WA 1S3RA 2L6CA 4PI2C 2PUKC 3QR6A 4ZBBA 1ZCPA 4TW5A 2P5RA 4E8HA 3RHBA 4TXVA 2FUG2 3HZ4A 1W89A 3C71A 2VLUA 3QCPA 2MMOA 2VLVA 2VOCA 2X8CA 1V57A 2H0HA 3KH7A 5IIZA 4NAXA 4NWYA 4PNGA 5A1NA 1SVOA 5IM9A 2QKEA 1M9BA 4IP6A 1YQ1A 2YPMA 5C00A 2GSSA 3CWGA 1R4WA 3UMAA 3A3TA 1ZYPA 11GSA 4AGSA 4EXJA 4JR4A 1K0NA 2Z9SA 4AKHA 1URMA 3C1SA 3GKXA 3MYDA 1MDJA 4EL1A 2LRTA 1SYXA 1K3OA 3VI7A 3LXZA 2C80A 1MD4A 2BMXA 4TR3A 4PX1A 4LMWA 2YWMA 4MZCA 1FVJA 3GTUB 4MJEA 3BCKA 5DALB 3QFAC 4WKWA 2C0FA 1SJZA 4TR4A 4AJ7A 3ZFBA 1ST9A 4I5QA 2VCVA 1K0BA 2B1KA 1LJRA 5J5NA 2B5YA 3DGQA 2WS2A 5IMZA 3Q74A 1TJDA 1NHOA 2FWEA 5HR1A 4V1Ap 3BJ5A 3IPZA 2VD1A 3RGBC 2WVYA 1YKCA 3CRUA 1TRVA 5ECNB 2L57A 4LL1B 3DWVA 4Z7XA 3ZMLA 3LQ7A 1HNCA 1GWCA 4AI6A 2AAWA 2YN1A 4N11A 2X99A 4KE3A 1FB0A 2X4AA 1PMTA 2OE1A 4K5SA 2IMEA 1SK1A 2JADA 1A8YA 3F4RA 4F0CA 2H6ZA 4MJCA 1V2AA 4IP1A 3KEBA 2GGTA 5CREA 1OYJA 3C1RA 2EIOA 3ISOA 4V1Ag 3ZRDA 1EWXA 1VRSD 2H71A 2R3XA 2LSTA 1XW6A 1U6TA 2FHEA 3DVXA 3KCMA 5IOWA 4I2TA 3ZITA 2OBIA 4EC0A 2LQQA 1M99A 2PWJA 4XS4B 2P5QA 4XS6A 1TRUA 1DSBA 1E2YA 3LFLA 2VUPA 5DALA 3GRXA 1XPVA 1U88A 4ICYA 4FYCA 1TRSA 2F9SA 1JZRA 2H72A 1GRXA 2MMZA 2EFDA 5J9BA 4RUVA 1B4PA 2HSYA 2H6XA 2V6OA 4DVCA 8GSSA 3MWHA 1HD2A 5G31A 1I9DA 1YEXA 1A0RP 4E8EA 1PSQA 5IO0A 2CAIA 1FG4A 4XRAA 2DLXA 4IHUA 3US3A 1EOGA 2VD0A 4MF5A 2V6KA 1YDKA 4EKZA 2N5AA 2ZNMA 2MYGA 4GQCA 3VI5A 5J9CA 3GKNA 4K2XA 3RPNA 3ERGA 1OC9A 4MF7A 4IJ3A 1PD21 5A34A 3KTLA 2ES7A 3MIXA 4HSCX 4N0ZA 4KCEA 1O8XA 1K0DA 4KB3A 2VIMA 4BWSA 1V40A 1BEDA 2H1AA 5HFGA 3ZYWA 1SKSB 3ZVJD 3RFRC 2RLIA 4WR5A 1X9MB 1KBNA 4F2IA 3QAGA 4BVXA 2IFQB 3E3EA 3UEMA 1R5AA 1Y25A 4OFNA 3KP8A 1XWBA 2R37A 2L59A 3KGKA 2H0GA 2O8VB 1Z7PA 5ECOB 4PTSA 1U3IA 1MD3A 2CX3A 1HQOA 1EP7A 4V2MA 1BJXA 1N25A 2GQMA 3UJ1A 4XS4A 2IMFA 2C0GA 4FYBA 3GIXA 5B8AA 3LSZA 2AYTA 1VF1A 4BL7A 4PNFA 4Z2RA 3CTFA 4MPFA 3TU3B 3GURA 1G6YA 3KJYA 3IAM2 5BRTA 5IOXA 3RAZA 3ZZXA 4IS0A 7GSSA 1MDIA 3KP9A 2GLRA 1SVLA 4FYUA 4IKHA 5DVBA 3F3QA 1Q4JA 5D9VA 4JE1A 2NDOA 2BTOT 2K8SA 3FZ4A 2I9HA 5EY6A 5LD0A 2VAFA 2HZEB 3LG6A 3IC8A 3PGTA 4PI0C 5G5FA 3QD9A 4G0LA 1YKAA 3WYWA 1MTCA 1OC8A 2WW0A 3HDCA 2KLXA 3LGCA 2OKAA 2YV9A 4YQMA 5J47A 1ZYNA 4HOJA 3E9JB 4K5RA 3EINA 1BAYA 3VWUA 1T7PB 4PQHA 1A2JA 2IFQA 5IMVA 4A5PA 3BBYA 5J4YA 1Q98A 4K7IA 1YEWC 4IQAA 3UVTA 2PGTA 2IWTA 4HQSA 4G19A 1SVMA 4BVYA 1YJ6A 2VO4A 3DRNA 1GTUA 1C72A 3H79A 5F06A 1S3DA 5D9WA 3IBHA 4XCSA 3RHCA 1TKDB 3C73A 5F05A 4F9ZA 1PX6A 1V9WA 3OR5A 4IGJA 1PL1A 4MF6A 2L6DA 1M3JA 4ZB9A 5HR2A 1JZDA 1VF2A 4HS1A 3MSZA 5JCGA 2DJ1A 2NVLA 1EGRA 2EFCA 5KEJA 3FKFA 2L5LA 4FO5A 4L0UA 3IOSA 2A2PA 4IJIA 2R6KA 4OO4A 2R5GA 1XIYA 5GSSA 5J4UA 3IC4A 2HZEA 5CNWA 3HKRA 4MABA 3BD2A 1EOHA 1O73A 2OJLA 2LJAA 2MMNA 4HDEA 5J3RA 1OVNA 3QMXA 1GLPA 4Q5QA 3PPUA 1TI3A 2PN8A 1PQNA 3TKQA 3TKSE 3M3MA 4K0GA 3VPTA 5JWOB 4XTSA 1GSDA 5DQSA 4IBPA 1HNAA 1WRYA 3I43A 3GL5A 4AF2A 4WBJA 3O3TA 4MLYA 4O5UA 2FWGA 1M3IA 3KIJA 1G7EA 1ERVA 1K0AA 3IA1A 2V1MA 2FA8A 2JZSA 1GL8A 1BQ7A 4KA0A 1X5DA 3ZREA 3SWLA 1J08A 4H86A 3O76A 1GSQA 4WETA 3HZ8A 1XOBA 1VF3A 4ZB8A 4ECIA 2FD3A 2DMMA 2C1YA 2CVDA 2WVXB 1YZXA 1F37A 2B7JA 4KNDA 2XBQA 2JL4A 3FRCA 3TB2A 2HSNB 4TOPA 3DKSA 2XPEA 2GZPA 3UBLA 1G7OA 3HY2A 4PQ1A 4CY6A 1EEJA 3PR8A 3WT2A 4KGIA 4EE0A 2JZTA 1TU7A 1NM3A 4NHWA 3CBUA 4V2NA 1M0UA 3EURA 2B7KA 5A5HB 3ZL5A 5IPGA 3TUEA 2CA8A 2WDUA 4ZBDA 5DBQA 1XW5A 2O89A 2JU5A 3L9UA 5ABRA 5F0GA 4PUAA 5J41A 1GUHA 1AAZA 1A23A 16GSA 1AQXA 3HMJG 4GRFA 2ALBA 2A2RA 4RI6A 4MH3A 1BYEA 1TK8B 2IMKA 3W8JA 3A5WA 4MP4A 4N30A 2RUEA 1K0MA 3KH9A 5IMAA 2CZ2A 1A24A 3EE2A 3UBKA 4EO3A 5DQYA 2VCQA 1GUKA 1TTZA 2H6YA 6GSWA 2HSHA 1OKDA 1GNWA 3GN3A 2V41A 1SJ6A 2R4VA 1ZL9A 3V1WA 1PN0A 1OE8A 1TK5B 2HSNA 3U6VA 3F3RA 1FHEA 4HZ4A 5ID2B 3PH9A 1SK0A 2CV4A 5KN3A 3HXSA 5EVOA 4J57E 4FH8A 3M9JA 2X64A 2GDRA 3DMLA 1XXUA 3D5JA 4I6XA 4LMVA 1FB6A 1W4VA 1KTEA 5D93A 1PN9A 2HT9A 3ZTLA 2HRAA 4KW6A 4CDOA 2RIIA 2HRKB 5F8BA 4ULXA 5CRDA 5D96A 2BJXA 1WIKA 1XBSA 1WMJA 14GSA 2HE3A 4HU9A 3LWAA 2K9FA 3QAWA 4O92A 1MEKA 4ZILA 5KOXA 4P3YB 3D0ZA 3H8QA 1WJKA 4OD7A 5C04A 1TRWA 4LLRA 4ECJA 1FAAA 3LJRA 1T00A 3IE3A 3F4TA 4MK3A 2PU9C 4N10A 3F6FA 3IRAA 3KXOA 2K6VA 5AISA 5JWRB 2WGRA 1B9YC 2L5OA 2V32A 3P7XA 1ACVA 4GCIA 2H70A 1ZYEA 1M2AA 5D73A 4NV2A 2G2QA 2QSIA 3VPQA 2O87A 1ZMAA 2CQ9A 1JFUA 3M8NA 2GTUA 3F6DA 5ID2A 3IHGA 5ECKB 3P90A 2IMIA 5ELGA 2HSMB 4YKFA 2QA2A 3I69A 5B6MA 2PERA 3P8WA 1TXXA 4J56E 4Z2UA 2DJ2A 1F9MA 1B8XA 17GSA 4K9ZA 3GTUA 5ECIB 1V58A 4IELA 2MZCA 2H66A 3HYPA 4X43A 3AY8A 3I9V2 2HRKA 3CXGA 1X9SB 1CQHA 3VURA 4OO5A 5IPHA 3GV1A 3L0HA 1A2LA 2B1LA 5G1LA 3BCIA 1USBA 2LNTA 2VLTA 2H01A 2VL9A 3A2WA 2FLSA 4MDCA 2LKUA 2GZZA 3ZVJA 3G7JA 2WFCA 3W8SA 1OKTA 3QPMA 2DKHA 2L4QA 4OCEA 1TP9A 2YZUA 3FZ5A 2YOIA 2H8LA 2VL2C 3DYRA 1LBKA 3BOAA 2B3SA 2WW1A 1WPIA 3IV4A 4EVMA 1VGLA 2O3EA 4JBBA 4MJBA 2GT6A 3FK8A 4RQRA 1PKWA 2LV3A 2AHEA 1JLWA 5B6NA 1TW9A 2OE0A 1KNGA 3D4TA 1FVKA 1MDKA 4K8MA 4BPYA 3ZFLA 5KN1A 3GL3A 1O85A 2FA4A 2ON7A 4F82A 2HSMA 2O5VA 3HJOA 5DJLA 2GQLA 3A5IA 3EU4A 4MPGA 4BA7A 1JZWA 1ZGNA 3GA4A 1S4BP 1FW1A 4TVEA 3RBTA 3EC3A 1THXA 3R3EA 4POLA 2H75A 3GSTA 4GSNA 2HNLA 4AJ6A 4DSRA 3EWLA 3M9KA 3GH9A 4PUFC 4KUNA 4N0VA 2N5FA 4KSOA 1DE1A 5CAXA 2AUVA 3WGDA 5KN2A 2G0FA 3G7YA 4MCUA 2I4AA 4X1UA 3GH6A 2AB6A 2M72A 4TRXA 3N5OA 4X0XA 1QFNA 4MH2A 2F8FA 3O6TA 1IYIA 1AQVA 2PVQA 2OACA 1HNBA 3TKRA 1U3AA 2IMDA 4TR0A 3DVWA 5GSTA 3LW9A 2VKZG 2YP6A 4OWYA 1GNEA 3E0UA 4IN0A 5AIXA 1X5CA 3TRPA 5G1KA 2WJUA 4K2DA 2PMTA 4EF0A 1RW1A 2H0IA 2IPAA 2H1GA 1F2EA 4G0IA 5D9XA 1GSUA 4E68A 1T4YA 2NPBA 3ZIJA 4GTUA 4EIPA 1PGTA 3DD3A 2DBCA 3UOMA 2HLSA 5CRWA 5EPFA 3S9FA 5A5KA 4DSQA 3LXTA 1TU8A 1BG5A 3J7Yk 3TJBA 5CO3A 3F9UA 4L8EA 4ID0A 3QFBC 3MDKA 4K0NA 5ECQB 1ZYQB 1OE7A 1NSWA 2KHPA 4GSTA 3EPTA 4QMKA 1SD8A 2ZCTA 2R0GA 3APQA 1XOAA 2VL2A 3VK9A 3CRTA 3VWVA 4IW9A 1VF4A 4OFMA 2GVPA 4XHMA 5GZZB 1ABAA 2I1UA 2X49A 5G5EA 3L4NA 1UC7A 3GHAA 1SK2A 2LQOA 3LEFA 4GQFA 2O7KA 1A0FA 3F0IA 1G0TA 2LEGA 3QAVA 5DCHA 4NV5A 2HFDA 2A4VA 4GXZA 1GSFA 19GSA 2OADA 4IVFA 3QOUA 1PL2A 1GP1A 1SYRA 2E7PA 2HQTA 5ECSA 1KEBA 3GNJA 1ILOA 5LNKe 1QGVA 2LRNA 4PQIA 1ZOFA 4I97A 5FWGA 1Z9HA 5BMUB 5HR3A 12GSA 1K0OA 4JEDA 1Y6EA 4WF5A 2VCZA 3VLNA 4POKA 6GSVA 3Q19A 3IHQA 1DBYA 4XIHA 1XG8A 3TJKA 1E6BA 3UIWA 5L71A 5ECPB 2TRXA 3HHVA 4MNNA 2B5XA 2YWOA 5B7CA 3ED3A 4NPBA 1IYHA 1GSEA 1XVQA 1X0RA 2MMAA 1YEPA 2F3MA 2VL3A 2OBKA 3HCZA 3LYPA 4FIWA 4ZL9A 2DKIA 2N5BA 4HZ2A 1M2DA 1TDIA 2A2SA 2H74A 4Q5FA 2LUSA 3J7Yb 3CYNA 2K8VA 2YJHA 3VWWA 2H1BA 4ZB7A 3FZ9A 2RUFA 2VM1A 5E4WA 3NZNA 3PINA 3D21A 1GSYA 2A4HA 4MA9A 1HYUA 2C4JA 2PVOC 5E59A 5HFIA 2DJ3A 4Z2TA 3FY7A 1TOFA 6GSTA 1JZOA 2R0CA 1QK8A 1S3AA 2H73A 1BG1A 1XWGA 1T4ZA 2DMLA 1U87A 2TIRA 3KZQA 3FZAA 4ECCA 3ZLPA 5CYYA 2VCTA 4I2UA 3JCML 4HQZA 4PURA 2HXKA 1ERUA 4MMMA 3UARA 1O7UA 2VCXA 1PKZA 1GUMA 2M80A 3FMWA 5BMUA 2WULA 3MAKA 3G9BA 4BWQA 1PX7A 5B8BA 1GLQA 4HU7A 2CX4A 3TKSA 1RQMA 6GSUA 3ERFA 2DIZA 4F03A 2KUCA 3CSJA 2P31A 6GSXA 2EIQA 3EU3A 2XC2A 2REMA 4J2FA 2K18A 3NIVA 2EIRA 4ZBAA 2WCIA 1SJIA 4ZB6A 5IQYA 3TRXA 4EIQA 2LNSA 1YVLA 3W6GA 1X9WB 1OC3A 5G30A 2PBJA 4F0BA 2C0EA 4JU5A 4GSSA 2XBIA 1A8LA 2WVXA 2YNXA 3F4SA 1F3BA 5FHIA 18GSA 1AQWA 2CAQA 1DUGA 1XW9A 2AV4A 3FYGA 1WOUA 4GF0A 2LJRA 3HD5A 3MNGA 3KTBA 2C3TA 2ON5A 3GSSA 4DSSB 4ZIJA 3TGZA 1TI1A 2UV8G 5A5HA 6GSYA 5G2ZA 4K7OA 4KX4A 4DEJA 4X4JA 4JZQA 2WZ9A 3L9VA 2R0PA 1FOVA 1XFLA 3TDGA 4ISDA 1T3BA 5JCUA 4EDYA 3P2AA 1M9AA 1R26A 1RK4A 4AJ8A 4CW9A 4ECBA 10GSA 3R2QA 2RM6A 2H30A 2QC7A 4HJ2A 4ACSA 1S3CA 1XWCA 5A4VA 3M0FA 2IJYA 5COHA 4XS1A 2JZRA 2R2JA 3GMFA 1M2BA 2I3YA 1AIUA 5ECLB 5ECHB 5J40A 5KOWA 2EFEA 3GX0A 4YQUA 1A2MA 2OE3A 3GKKA 1XZOA 2OT3A 2NTOA 1Z6NA 4HEA2 1R7HA 4AKIA 1FO5A 5IO2A 4PGTA 1EEMA 4WBRD 2O36A 3EVIA 1YY7A 2JSYA 1OC9B 3FW2A
chains in the Genus database with same CATH topology
5DDLA 2RM5A 5A34B 3ZIVA 3WGXA 1H75A 3UL3A 1BX9A 3A2XA 3FEUA 3U5RE 3IK9A 3M1GA 1GSSA 5IMCA 4K7NA 4POBA 1K3YA 3ME8A 2WB9A 4WF4A 1SL0B 5AIVA 4DSSA 4XRDA 4BVXB 5ECRB 3HJPA 2CVKA 2J23A 3WD6A 3G7IA 4Q5RA 3UVHA 1QUWA 2CT6A 4MZWA 1FOHA 3CSHA 3FHKA 4OFTA 2WRTA 3I6AA 1T8EB 4KDYA 3KMNA 22GSA 3ZMKA 1GH2A 1J9BA 1K0CA 5GAND 1G6WA 3TJJA 6GSSA 4BL7B 3CTGA 2EC4A 2FGXA 4RI7A 5HQPA 1B9XC 2GZYA 3EYTA 5H5SA 3GYKA 2C3NA 5CRGA 2GT5A 1AXDA 3H1NA 5ECMB 2DJ0A 4KF9A 1SENA 2LTKA 3KD0A 4Q5NA 4G0KA 3C8EA 4O5RA 1NW2A 1EGOA 1WWJA 4OCFA 3FR3A 1LU4A 4ILFA 3WT1A 2KP2A 3RPPA 4LL4B 1K3LA 5AGYA 3TOUA 3ME7A 2GQKA 1Z7RA 2FCHA 3SBCA 1GTIA 2CZ3A 1CQGA 5DCGA 5A4UA 4YH2A 1QMVA 4O32A 2IL3A 4G01A 2FWFA 2VM2A 2PPTA 1N8JA 2DJKA 3FR6A 4PXOA 5D8IA 1X5EA 1AUCA 1R5PA 2TRCP 5JWQB 3Q6OA 1EV4A 4YAVA 3APSA 2E2GA 1GULA 3D22A 4D73B 13GSA 4TR1B 4CY8A 4YKGA 2NBSA 2E0QA 3GX8A 3GFKA 3HJMA 3FR9A 4BVYB 1YF0A 3WGEA 4EUYA 2H76A 2FY6A 3IDVA 2GSTA 1Y1UA 2DSAA 4QQ7A 1GTBA 2JSZA 3A2VA 3DEXA 3H4KA 1EZKA 4MJAA 4YAPA 1XWKA 3RDWA 4TXOB 1JLVA 1Z3EA 4AKXB 3IAS2 4KSMA 1SD9A 4ML1A 2YJ7A 4ML6A 1F6MC 4HUAA 1THOA 4L5LA 2IN3A 5LCZA 5DAKB 3HVSA 4KCAA 4NXIA 5JCWA 3EMXA 3CMIA 5DJMA 4NMUA 1B4QA 4K1FA 3TOTA 3IR4A 4IQ1A 2H19A 4TKYA 5HR0A 3EMPA 2GS3A 3L9SA 1Z5YE 3GKMA 4WXTA 3UAPA 5F07A 2OA7A 2QA1A 4HI7A 3K8NA 2X8GA 3D4MA 9GSSA 1ERWA 4ZL7A 3IK7A 4D73A 5FT3A 4L0WA 4TR1A 1SKRB 2B5EA 1GTAA 1N2AA 2JACA 5ENUA 4CHSA 4FQUA 2EFHA 3F63A 5D9TA 5A4WA 4ZXGA 3TKSC 3DIEA 2FWHA 4O5QA 4L5OA 4G9HA 2GSRA 2CVBA 3TCOA 1JHBA 2HYXA 2XPDA 4LA1A 1ERTA 4MZBA 5EL8A 2C3QA 2IIYA 5IMFA 4KH7A 1T1VA 4EDZA 3CSIA 3H93A 3TRQA 4TXOA 1XVWA 1M7TA 1ZZYA 3C7MA 3HA9A 2VCWA 2KP1A 2GSQA 1B48A 20GSA 2LJKA 1O6JA 2X8HA 2F8AA 5DAKA 5AN1A 1XWAA 1V98A 4GDFA 1QQ2A 2AJQB 2YV7A 4WR4A 5INYA 1UA5A 3N9JA 4G10A 5H5QA 3LORA 1SU9A 2E2MA 4NHZA 1AC1A 2LRCA 2XHFA 1J0FA 4WEYA 4V2LA 3F8UA 5ELAA 4OMVA 2I81A 5HFKA 1O81A 1XCCA 2FNOA 5J4VA 1ML6A 4W66A 5CRHA 4GLTA 1H4OA 2HRFA 4I8BA 2DIYA 2J9HA 2MBTA 4RQXA 5CP1A 1ON4A 1OAZA 2C8UA 3D6IA 1AW9A 1EP8A 2HZFA 1PA3A 3KMOA 2LS5A 2DJJA 3IXRA 2B6MA 5IMDA 1UN2A 2KOKA 2C0DA 3HVVA 1QXHA 4JRRA 3TKPA 1F3AA 4KDXA 4JR6A 3QDNA 1TXUA 5A1NB 4N3ZA 1DE2A 1PRXA 3NOFA 2QGVA 4USSA 3APOA 2DC5A 1WP0A 1NHYA 3LYKA 1YF1A 1BF5A 4K6XA 3TJFA 1I5GA 2YCDA 2M46A 1SL2B 4KAEA 3Q18A 2D2ZA 2O85A 1Z6MA 2YWIA 2L4CA 2YWNA 1TK0B 2F51A 4QL7A 4KDUA 5KN0A 2HRNA 1SKWB 4AKGA 4O7HA 1WE0A 1SL1B 3KM6A 3VWXA 4POMA 2YZHA 5H5RA 4G2EA 4TN8A 1UVZA 3VFIA 3HVXA 3ERWA 4ZL8A 3L78A 2HI7A 2V2GA 2ZUPA 3DXBA 2MBSA 2UZ8A 2H1LA 3TJGA 4YQVA 4HJMA 5GAPD 3GUSA 2YANA 4QL9A 1EV9A 4GWRA 2P0GA 2H1DA 1O8WA 2L6CA 2PUKC 3QR6A 4ZBBA 1ZCPA 4TW5A 2P5RA 4E8HA 3RHBA 4TXVA 2FUG2 3HZ4A 1W89A 3C71A 2VLUA 3QCPA 2MMOA 2VLVA 2VOCA 2X8CA 1V57A 2H0HA 3KH7A 5IIZA 4NAXA 4NWYA 4PNGA 5A1NA 1SVOA 5IM9A 2QKEA 1M9BA 4IP6A 1YQ1A 2YPMA 5C00A 2GSSA 3CWGA 1R4WA 3UMAA 3A3TA 1ZYPA 11GSA 4AGSA 4EXJA 4JR4A 1K0NA 2Z9SA 4AKHA 1URMA 3C1SA 3GKXA 3MYDA 1MDJA 4EL1A 2LRTA 1SYXA 1K3OA 3VI7A 3LXZA 2C80A 1MD4A 2BMXA 4TR3A 4PX1A 4LMWA 2YWMA 4MZCA 1FVJA 3GTUB 4MJEA 3BCKA 5DALB 3QFAC 4WKWA 2C0FA 1SJZA 4TR4A 4AJ7A 3ZFBA 1ST9A 4I5QA 2VCVA 1K0BA 2B1KA 1LJRA 5J5NA 2B5YA 3DGQA 2WS2A 5IMZA 3Q74A 1TJDA 1NHOA 2FWEA 5HR1A 4V1Ap 3BJ5A 3IPZA 2VD1A 1YKCA 3CRUA 1TRVA 5ECNB 2L57A 4LL1B 3DWVA 4Z7XA 3ZMLA 3LQ7A 1HNCA 1GWCA 4AI6A 2AAWA 2YN1A 4N11A 2X99A 4KE3A 1FB0A 2X4AA 1PMTA 2OE1A 4K5SA 2IMEA 1SK1A 2JADA 1A8YA 3F4RA 4F0CA 2H6ZA 4MJCA 1V2AA 4IP1A 3KEBA 2GGTA 5CREA 1OYJA 3C1RA 2EIOA 3ISOA 4V1Ag 3ZRDA 1EWXA 1VRSD 2H71A 2R3XA 2LSTA 1XW6A 1U6TA 2FHEA 3DVXA 3KCMA 5IOWA 4I2TA 3ZITA 2OBIA 4EC0A 2LQQA 1M99A 2PWJA 4XS4B 2P5QA 4XS6A 1TRUA 1DSBA 1E2YA 3LFLA 2VUPA 5DALA 3GRXA 1XPVA 1U88A 4ICYA 4FYCA 1TRSA 2F9SA 1JZRA 2H72A 1GRXA 2MMZA 2EFDA 5J9BA 4RUVA 1B4PA 2HSYA 2H6XA 2V6OA 4DVCA 8GSSA 3MWHA 1HD2A 5G31A 1I9DA 1YEXA 1A0RP 4E8EA 1PSQA 5IO0A 2CAIA 1FG4A 4XRAA 2DLXA 4IHUA 3US3A 1EOGA 2VD0A 4MF5A 2V6KA 1YDKA 4EKZA 2N5AA 2ZNMA 2MYGA 4GQCA 3VI5A 5J9CA 3GKNA 4K2XA 3RPNA 3ERGA 1OC9A 4MF7A 4IJ3A 1PD21 5A34A 3KTLA 2ES7A 3MIXA 4N0ZA 4KCEA 1O8XA 1K0DA 4KB3A 2VIMA 4BWSA 1V40A 1BEDA 2H1AA 5HFGA 3ZYWA 1SKSB 3ZVJD 2RLIA 4WR5A 1X9MB 1KBNA 4F2IA 3QAGA 4BVXA 2IFQB 3E3EA 3UEMA 1R5AA 1Y25A 4OFNA 3KP8A 1XWBA 2R37A 2L59A 3KGKA 2H0GA 2O8VB 1Z7PA 5ECOB 4PTSA 1U3IA 1MD3A 2CX3A 1HQOA 1EP7A 4V2MA 1BJXA 1N25A 2GQMA 3UJ1A 4XS4A 2IMFA 2C0GA 4FYBA 3GIXA 5B8AA 3LSZA 2AYTA 1VF1A 4BL7A 4PNFA 4Z2RA 3CTFA 4MPFA 3TU3B 3GURA 1G6YA 3KJYA 3IAM2 5BRTA 5IOXA 3RAZA 3ZZXA 4IS0A 7GSSA 1MDIA 3KP9A 2GLRA 1SVLA 4FYUA 4IKHA 5DVBA 3F3QA 1Q4JA 5D9VA 4JE1A 2NDOA 2BTOT 2K8SA 3FZ4A 2I9HA 5EY6A 5LD0A 2VAFA 2HZEB 3LG6A 3IC8A 3PGTA 5G5FA 3QD9A 4G0LA 1YKAA 3WYWA 1MTCA 1OC8A 3HDCA 2KLXA 3LGCA 2OKAA 2YV9A 4YQMA 5J47A 1ZYNA 4HOJA 3E9JB 4K5RA 3EINA 1BAYA 3VWUA 1T7PB 4PQHA 1A2JA 2IFQA 5IMVA 4A5PA 3BBYA 5J4YA 1Q98A 4K7IA 4IQAA 3UVTA 2PGTA 2IWTA 4HQSA 4G19A 1SVMA 4BVYA 1YJ6A 2VO4A 3DRNA 1GTUA 1C72A 3H79A 5F06A 1S3DA 5D9WA 3IBHA 4XCSA 3RHCA 1TKDB 3C73A 5F05A 4F9ZA 1PX6A 1V9WA 3OR5A 4IGJA 1PL1A 4MF6A 2L6DA 4ZB9A 5HR2A 1JZDA 1VF2A 4HS1A 3MSZA 5JCGA 2DJ1A 2NVLA 1EGRA 2EFCA 5KEJA 3FKFA 2L5LA 4FO5A 4L0UA 3IOSA 2A2PA 4IJIA 2R6KA 4OO4A 2R5GA 1XIYA 5GSSA 5J4UA 3IC4A 2HZEA 5CNWA 3HKRA 4MABA 3BD2A 1EOHA 1O73A 2OJLA 2LJAA 2MMNA 4HDEA 5J3RA 1OVNA 3QMXA 1GLPA 4Q5QA 3PPUA 1TI3A 2PN8A 1PQNA 3TKQA 3TKSE 3M3MA 4K0GA 3VPTA 5JWOB 4XTSA 1GSDA 5DQSA 4IBPA 1HNAA 1WRYA 3I43A 3GL5A 4AF2A 4WBJA 3O3TA 4MLYA 4O5UA 2FWGA 3KIJA 1G7EA 1ERVA 1K0AA 3IA1A 2V1MA 2FA8A 2JZSA 1GL8A 1BQ7A 4KA0A 1X5DA 3ZREA 3SWLA 1J08A 4H86A 3O76A 1GSQA 4WETA 3HZ8A 1XOBA 1VF3A 4ZB8A 4ECIA 2FD3A 2DMMA 2C1YA 2CVDA 1YZXA 1F37A 2B7JA 4KNDA 2XBQA 2JL4A 3FRCA 3TB2A 2HSNB 4TOPA 3DKSA 2XPEA 2GZPA 3UBLA 1G7OA 3HY2A 4PQ1A 4CY6A 1EEJA 3PR8A 3WT2A 4KGIA 4EE0A 2JZTA 1TU7A 1NM3A 4NHWA 3CBUA 4V2NA 1M0UA 3EURA 2B7KA 5A5HB 3ZL5A 5IPGA 3TUEA 2CA8A 2WDUA 4ZBDA 5DBQA 1XW5A 2O89A 2JU5A 3L9UA 5ABRA 5F0GA 4PUAA 5J41A 1GUHA 1AAZA 1A23A 16GSA 1AQXA 3HMJG 4GRFA 2ALBA 2A2RA 4RI6A 4MH3A 1BYEA 1TK8B 2IMKA 3W8JA 3A5WA 4MP4A 4N30A 2RUEA 1K0MA 3KH9A 5IMAA 2CZ2A 1A24A 3EE2A 3UBKA 4EO3A 5DQYA 2VCQA 1GUKA 1TTZA 2H6YA 6GSWA 2HSHA 1OKDA 1GNWA 3GN3A 2V41A 1SJ6A 2R4VA 1ZL9A 3V1WA 1PN0A 1OE8A 1TK5B 2HSNA 3U6VA 3F3RA 1FHEA 4HZ4A 5ID2B 3PH9A 1SK0A 2CV4A 5KN3A 3HXSA 5EVOA 4J57E 4FH8A 3M9JA 2X64A 2GDRA 3DMLA 1XXUA 3D5JA 4I6XA 4LMVA 1FB6A 1W4VA 1KTEA 5D93A 1PN9A 2HT9A 3ZTLA 2HRAA 4KW6A 4CDOA 2RIIA 2HRKB 5F8BA 4ULXA 5CRDA 5D96A 2BJXA 1WIKA 1XBSA 1WMJA 14GSA 2HE3A 4HU9A 3LWAA 2K9FA 3QAWA 4O92A 1MEKA 4ZILA 5KOXA 4P3YB 3D0ZA 3H8QA 1WJKA 4OD7A 5C04A 1TRWA 4LLRA 4ECJA 1FAAA 3LJRA 1T00A 3IE3A 3F4TA 4MK3A 2PU9C 4N10A 3F6FA 3IRAA 3KXOA 2K6VA 5AISA 5JWRB 2WGRA 1B9YC 2L5OA 2V32A 3P7XA 1ACVA 4GCIA 2H70A 1ZYEA 1M2AA 5D73A 4NV2A 2G2QA 2QSIA 3VPQA 2O87A 1ZMAA 2CQ9A 1JFUA 3M8NA 2GTUA 3F6DA 5ID2A 3IHGA 5ECKB 3P90A 2IMIA 5ELGA 2HSMB 4YKFA 2QA2A 3I69A 5B6MA 2PERA 3P8WA 1TXXA 4J56E 4Z2UA 2DJ2A 1F9MA 1B8XA 17GSA 4K9ZA 3GTUA 5ECIB 1V58A 4IELA 2MZCA 2H66A 3HYPA 4X43A 3AY8A 3I9V2 2HRKA 3CXGA 1X9SB 1CQHA 3VURA 4OO5A 5IPHA 3GV1A 3L0HA 1A2LA 2B1LA 5G1LA 3BCIA 1USBA 2LNTA 2VLTA 2H01A 2VL9A 3A2WA 2FLSA 4MDCA 2LKUA 2GZZA 3ZVJA 3G7JA 2WFCA 3W8SA 1OKTA 3QPMA 2DKHA 2L4QA 4OCEA 1TP9A 2YZUA 3FZ5A 2YOIA 2H8LA 2VL2C 3DYRA 1LBKA 3BOAA 2B3SA 1WPIA 3IV4A 4EVMA 1VGLA 4JBBA 4MJBA 2GT6A 3FK8A 4RQRA 1PKWA 2LV3A 2AHEA 1JLWA 5B6NA 1TW9A 2OE0A 1KNGA 3D4TA 1FVKA 1MDKA 4K8MA 4BPYA 3ZFLA 5KN1A 3GL3A 1O85A 2FA4A 2ON7A 4F82A 2HSMA 2O5VA 3HJOA 5DJLA 2GQLA 3A5IA 3EU4A 4MPGA 4BA7A 1JZWA 1ZGNA 3GA4A 1FW1A 4TVEA 3RBTA 3EC3A 1THXA 3R3EA 4POLA 2H75A 3GSTA 4GSNA 2HNLA 4AJ6A 4DSRA 3EWLA 3M9KA 3GH9A 4PUFC 4KUNA 4N0VA 2N5FA 4KSOA 1DE1A 5CAXA 2AUVA 3WGDA 5KN2A 2G0FA 3G7YA 4MCUA 2I4AA 4X1UA 3GH6A 2AB6A 2M72A 4TRXA 3N5OA 4X0XA 1QFNA 4MH2A 2F8FA 3O6TA 1IYIA 1AQVA 2PVQA 2OACA 1HNBA 3TKRA 1U3AA 2IMDA 4TR0A 3DVWA 5GSTA 3LW9A 2VKZG 2YP6A 4OWYA 1GNEA 3E0UA 4IN0A 5AIXA 1X5CA 3TRPA 5G1KA 2WJUA 4K2DA 2PMTA 4EF0A 1RW1A 2H0IA 2IPAA 2H1GA 1F2EA 4G0IA 5D9XA 1GSUA 4E68A 1T4YA 2NPBA 3ZIJA 4GTUA 4EIPA 1PGTA 3DD3A 2DBCA 3UOMA 2HLSA 5CRWA 5EPFA 3S9FA 5A5KA 4DSQA 3LXTA 1TU8A 1BG5A 3J7Yk 3TJBA 5CO3A 3F9UA 4L8EA 4ID0A 3QFBC 3MDKA 4K0NA 5ECQB 1ZYQB 1OE7A 1NSWA 2KHPA 4GSTA 3EPTA 4QMKA 1SD8A 2ZCTA 2R0GA 3APQA 1XOAA 2VL2A 3VK9A 3CRTA 3VWVA 4IW9A 1VF4A 4OFMA 2GVPA 4XHMA 5GZZB 1ABAA 2I1UA 2X49A 5G5EA 3L4NA 1UC7A 3GHAA 1SK2A 2LQOA 3LEFA 4GQFA 2O7KA 1A0FA 3F0IA 1G0TA 2LEGA 3QAVA 5DCHA 4NV5A 2HFDA 2A4VA 4GXZA 1GSFA 19GSA 2OADA 4IVFA 3QOUA 1PL2A 1GP1A 1SYRA 2E7PA 2HQTA 5ECSA 1KEBA 3GNJA 1ILOA 5LNKe 1QGVA 2LRNA 4PQIA 1ZOFA 4I97A 5FWGA 1Z9HA 5BMUB 5HR3A 12GSA 1K0OA 4JEDA 1Y6EA 4WF5A 2VCZA 3VLNA 4POKA 6GSVA 3Q19A 3IHQA 1DBYA 4XIHA 3TJKA 1E6BA 3UIWA 5L71A 5ECPB 2TRXA 3HHVA 4MNNA 2B5XA 2YWOA 5B7CA 3ED3A 4NPBA 1IYHA 1GSEA 1XVQA 1X0RA 2MMAA 1YEPA 2F3MA 2VL3A 2OBKA 3HCZA 3LYPA 4FIWA 4ZL9A 2DKIA 2N5BA 4HZ2A 1M2DA 1TDIA 2A2SA 2H74A 4Q5FA 2LUSA 3J7Yb 3CYNA 2K8VA 2YJHA 3VWWA 2H1BA 4ZB7A 3FZ9A 2RUFA 2VM1A 5E4WA 3NZNA 3PINA 3D21A 1GSYA 2A4HA 4MA9A 1HYUA 2C4JA 2PVOC 5E59A 5HFIA 2DJ3A 4Z2TA 3FY7A 1TOFA 6GSTA 1JZOA 2R0CA 1QK8A 1S3AA 2H73A 1BG1A 1XWGA 1T4ZA 2DMLA 1U87A 2TIRA 3KZQA 3FZAA 4ECCA 3ZLPA 5CYYA 2VCTA 4I2UA 3JCML 4HQZA 4PURA 2HXKA 1ERUA 4MMMA 3UARA 1O7UA 2VCXA 1PKZA 1GUMA 2M80A 3FMWA 5BMUA 2WULA 3MAKA 3G9BA 4BWQA 1PX7A 5B8BA 1GLQA 4HU7A 2CX4A 3TKSA 1RQMA 6GSUA 3ERFA 2DIZA 4F03A 2KUCA 3CSJA 2P31A 6GSXA 2EIQA 3EU3A 2XC2A 2REMA 4J2FA 2K18A 3NIVA 2EIRA 4ZBAA 2WCIA 1SJIA 4ZB6A 5IQYA 3TRXA 4EIQA 2LNSA 1YVLA 3W6GA 1X9WB 1OC3A 5G30A 2PBJA 4F0BA 2C0EA 4JU5A 4GSSA 2XBIA 1A8LA 2YNXA 3F4SA 1F3BA 5FHIA 18GSA 1AQWA 2CAQA 1DUGA 1XW9A 2AV4A 3FYGA 1WOUA 4GF0A 2LJRA 3HD5A 3MNGA 3KTBA 2C3TA 2ON5A 3GSSA 4DSSB 4ZIJA 3TGZA 1TI1A 2UV8G 5A5HA 6GSYA 5G2ZA 4K7OA 4KX4A 4DEJA 4X4JA 4JZQA 2WZ9A 3L9VA 2R0PA 1FOVA 1XFLA 3TDGA 4ISDA 1T3BA 5JCUA 4EDYA 3P2AA 1M9AA 1R26A 1RK4A 4AJ8A 4CW9A 4ECBA 10GSA 3R2QA 2RM6A 2H30A 2QC7A 4HJ2A 4ACSA 1S3CA 1XWCA 5A4VA 3M0FA 2IJYA 5COHA 4XS1A 2JZRA 2R2JA 3GMFA 1M2BA 2I3YA 1AIUA 5ECLB 5ECHB 5J40A 5KOWA 2EFEA 3GX0A 4YQUA 1A2MA 2OE3A 3GKKA 1XZOA 2OT3A 2NTOA 1Z6NA 4HEA2 1R7HA 4AKIA 1FO5A 5IO2A 4PGTA 1EEMA 4WBRD 3EVIA 1YY7A 2JSYA 1OC9B 3FW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DDL A;  2RM5 A;  3ZIV A;  3WGX A;  1H75 A;  3UL3 A;  1BX9 A;  3A2X A;  3FEU A;  3U5R E;  3IK9 A;  3M1G A;  1GSS A;  5IMC A;  4K7N A;  4POB A;  1K3Y A;  3ME8 A;  2WB9 A;  4WF4 A;  1SL0 B;  5AIV A;  4DSS A;  4XRD A;  4BVX B;  5ECR B;  3HJP A;  2CVK A;  2J23 A;  3WD6 A;  3G7I A;  4Q5R A;  3UVH A;  1QUW A;  2CT6 A;  4MZW A;  3CSH A;  3FHK A;  4OFT A;  2WRT A;  3I6A A;  1T8E B;  4KDY A;  3KMN A;  22GS A;  3ZMK A;  1GH2 A;  1J9B A;  1K0C A;  5GAN D;  1G6W A;  3TJJ A;  6GSS A;  4BL7 B;  3CTG A;  2EC4 A;  2FGX A;  4RI7 A;  5HQP A;  1B9X C;  2GZY A;  3EYT A;  5H5S A;  3GYK A;  2C3N A;  5CRG A;  2GT5 A;  1AXD A;  3H1N A;  5ECM B;  2DJ0 A;  4KF9 A;  1SEN A;  2LTK A;  3KD0 A;  4Q5N A;  4G0K A;  3C8E A;  4O5R A;  1NW2 A;  1EGO A;  1WWJ A;  4OCF A;  3FR3 A;  1LU4 A;  4ILF A;  3WT1 A;  2KP2 A;  3RPP A;  4LL4 B;  1K3L A;  5AGY A;  3TOU A;  3ME7 A;  2GQK A;  1Z7R A;  2FCH A;  3SBC A;  1GTI A;  2CZ3 A;  1CQG A;  5DCG A;  5A4U A;  4YH2 A;  1QMV A;  4O32 A;  2IL3 A;  2FWF A;  2VM2 A;  2PPT A;  1N8J A;  2DJK A;  3FR6 A;  4PXO A;  5D8I A;  1X5E A;  1AUC A;  1R5P A;  2TRC P;  5JWQ B;  3Q6O A;  1EV4 A;  4YAV A;  3APS A;  2E2G A;  1GUL A;  3D22 A;  4D73 B;  13GS A;  4TR1 B;  2NBS A;  2E0Q A;  3GX8 A;  3GFK A;  3HJM A;  3FR9 A;  4BVY B;  1YF0 A;  3WGE A;  4EUY A;  2H76 A;  2FY6 A;  3IDV A;  2GST A;  2DSA A;  4QQ7 A;  1GTB A;  2JSZ A;  3A2V A;  3DEX A;  3H4K A;  1EZK A;  4MJA A;  4YAP A;  1XWK A;  3RDW A;  4TXO B;  1JLV A;  1Z3E A;  3IAS 2;  4KSM A;  1SD9 A;  4ML1 A;  2YJ7 A;  4ML6 A;  1F6M C;  4HUA A;  1THO A;  4L5L A;  2IN3 A;  5LCZ A;  5DAK B;  3HVS A;  4KCA A;  4NXI A;  5JCW A;  3EMX A;  3CMI A;  5DJM A;  4NMU A;  1B4Q A;  4K1F A;  3TOT A;  3IR4 A;  4IQ1 A;  2H19 A;  4TKY A;  5HR0 A;  3EMP A;  2GS3 A;  3L9S A;  1Z5Y E;  3GKM A;  4WXT A;  3UAP A;  5F07 A;  2OA7 A;  4HI7 A;  3K8N A;  2X8G A;  3D4M A;  9GSS A;  1ERW A;  4ZL7 A;  3IK7 A;  4D73 A;  5FT3 A;  4L0W A;  4TR1 A;  1SKR B;  2B5E A;  1GTA A;  1N2A A;  2JAC A;  5ENU A;  4CHS A;  4FQU A;  3F63 A;  5D9T A;  5A4W A;  4ZXG A;  3TKS C;  3DIE A;  2FWH A;  4L5O A;  4G9H A;  2GSR A;  2CVB A;  3TCO A;  1JHB A;  2HYX A;  2XPD A;  4LA1 A;  1ERT A;  4MZB A;  5EL8 A;  2C3Q A;  2IIY A;  5IMF A;  4KH7 A;  1T1V A;  4EDZ A;  3CSI A;  3H93 A;  3TRQ A;  4TXO A;  1XVW A;  1M7T A;  1ZZY A;  3C7M A;  3HA9 A;  2VCW A;  2KP1 A;  2GSQ A;  1B48 A;  20GS A;  2LJK A;  1O6J A;  2X8H A;  2F8A A;  5DAK A;  5AN1 A;  1XWA A;  1V98 A;  1QQ2 A;  2AJQ B;  2YV7 A;  4WR4 A;  5INY A;  1UA5 A;  3N9J A;  4G10 A;  5H5Q A;  3LOR A;  1SU9 A;  2E2M A;  4NHZ A;  1AC1 A;  2LRC A;  2XHF A;  1J0F A;  4WEY A;  4V2L A;  3F8U A;  5ELA A;  4OMV A;  2I81 A;  5HFK A;  1O81 A;  1XCC A;  2FNO A;  1ML6 A;  5CRH A;  4GLT A;  1H4O A;  2HRF A;  4I8B A;  2DIY A;  2J9H A;  2MBT A;  4RQX A;  5CP1 A;  1ON4 A;  1OAZ A;  2C8U A;  3D6I A;  1AW9 A;  1EP8 A;  2HZF A;  1PA3 A;  3KMO A;  2LS5 A;  2DJJ A;  3IXR A;  2B6M A;  5IMD A;  1UN2 A;  2KOK A;  2C0D A;  3HVV A;  1QXH A;  4JRR A;  3TKP A;  1F3A A;  4KDX A;  4JR6 A;  3QDN A;  1DE2 A;  1PRX A;  3NOF A;  2QGV A;  4USS A;  3APO A;  2DC5 A;  1WP0 A;  1NHY A;  3LYK A;  1YF1 A;  4K6X A;  3TJF A;  1I5G A;  2YCD A;  2M46 A;  1SL2 B;  4KAE A;  3Q18 A;  2D2Z A;  2O85 A;  1Z6M A;  2YWI A;  2L4C A;  2YWN A;  1TK0 B;  2F51 A;  4QL7 A;  4KDU A;  5KN0 A;  2HRN A;  1SKW B;  4O7H A;  1WE0 A;  1SL1 B;  3KM6 A;  3VWX A;  4POM A;  2YZH A;  5H5R A;  4G2E A;  4TN8 A;  1UVZ A;  3VFI A;  3HVX A;  3ERW A;  4ZL8 A;  3L78 A;  2HI7 A;  2V2G A;  2ZUP A;  3DXB A;  2MBS A;  2UZ8 A;  3TJG A;  4YQV A;  4HJM A;  5GAP D;  3GUS A;  2YAN A;  4QL9 A;  1EV9 A;  4GWR A;  2P0G A;  2H1D A;  1O8W A;  2L6C A;  2PUK C;  3QR6 A;  4ZBB A;  1ZCP A;  4TW5 A;  2P5R A;  4E8H A;  3RHB A;  4TXV A;  2FUG 2;  3HZ4 A;  1W89 A;  3C71 A;  2VLU A;  3QCP A;  2MMO A;  2VLV A;  2VOC A;  2X8C A;  1V57 A;  2H0H A;  3KH7 A;  5IIZ A;  4NAX A;  4NWY A;  4PNG A;  5IM9 A;  2QKE A;  1M9B A;  4IP6 A;  1YQ1 A;  2YPM A;  5C00 A;  2GSS A;  1R4W A;  3UMA A;  3A3T A;  11GS A;  4AGS A;  4EXJ A;  4JR4 A;  1K0N A;  2Z9S A;  1URM A;  3C1S A;  3GKX A;  1MDJ A;  4EL1 A;  2LRT A;  1SYX A;  1K3O A;  3VI7 A;  3LXZ A;  2C80 A;  1MD4 A;  2BMX A;  4TR3 A;  4PX1 A;  4LMW A;  2YWM A;  4MZC A;  1FVJ A;  3GTU B;  4MJE A;  3BCK A;  5DAL B;  3QFA C;  4WKW A;  2C0F A;  1SJZ A;  4TR4 A;  4AJ7 A;  3ZFB A;  1ST9 A;  4I5Q A;  2VCV A;  1K0B A;  2B1K A;  1LJR A;  5J5N A;  2B5Y A;  3DGQ A;  2WS2 A;  5IMZ A;  3Q74 A;  1TJD A;  1NHO A;  2FWE A;  5HR1 A;  4V1A p;  3BJ5 A;  3IPZ A;  2VD1 A;  1YKC A;  3CRU A;  1TRV A;  5ECN B;  2L57 A;  4LL1 B;  3DWV A;  4Z7X A;  3ZML A;  3LQ7 A;  1HNC A;  1GWC A;  2AAW A;  2YN1 A;  4N11 A;  2X99 A;  4KE3 A;  1FB0 A;  1PMT A;  2OE1 A;  2IME A;  1SK1 A;  2JAD A;  1A8Y A;  3F4R A;  4F0C A;  2H6Z A;  4MJC A;  1V2A A;  4IP1 A;  3KEB A;  2GGT A;  5CRE A;  1OYJ A;  3C1R A;  2EIO A;  3ISO A;  4V1A g;  3ZRD A;  1EWX A;  1VRS D;  2H71 A;  2R3X A;  2LST A;  1XW6 A;  1U6T A;  2FHE A;  3DVX A;  3KCM A;  5IOW A;  4I2T A;  3ZIT A;  2OBI A;  4EC0 A;  2LQQ A;  1M99 A;  2PWJ A;  4XS4 B;  2P5Q A;  4XS6 A;  1TRU A;  1DSB A;  1E2Y A;  3LFL A;  2VUP A;  5DAL A;  3GRX A;  1XPV A;  1U88 A;  4FYC A;  1TRS A;  2F9S A;  1JZR A;  2H72 A;  1GRX A;  2MMZ A;  5J9B A;  4RUV A;  1B4P A;  2HSY A;  2H6X A;  2V6O A;  4DVC A;  8GSS A;  3MWH A;  1HD2 A;  5G31 A;  1I9D A;  1YEX A;  1A0R P;  4E8E A;  1PSQ A;  5IO0 A;  2CAI A;  1FG4 A;  4XRA A;  2DLX A;  4IHU A;  3US3 A;  1EOG A;  2VD0 A;  4MF5 A;  2V6K A;  1YDK A;  4EKZ A;  2N5A A;  2ZNM A;  2MYG A;  4GQC A;  3VI5 A;  5J9C A;  3GKN A;  3RPN A;  3ERG A;  1OC9 A;  4MF7 A;  4IJ3 A;  1PD2 1;  3KTL A;  2ES7 A;  4N0Z A;  4KCE A;  1O8X A;  1K0D A;  4KB3 A;  2VIM A;  4BWS A;  1V40 A;  1BED A;  2H1A A;  5HFG A;  3ZYW A;  1SKS B;  3ZVJ D;  2RLI A;  4WR5 A;  1X9M B;  1KBN A;  4F2I A;  3QAG A;  4BVX A;  2IFQ B;  3E3E A;  3UEM A;  1R5A A;  1Y25 A;  4OFN A;  3KP8 A;  1XWB A;  2R37 A;  2L59 A;  3KGK A;  2H0G A;  2O8V B;  1Z7P A;  5ECO B;  4PTS A;  1U3I A;  1MD3 A;  2CX3 A;  1HQO A;  1EP7 A;  4V2M A;  1BJX A;  2GQM A;  3UJ1 A;  4XS4 A;  2IMF A;  2C0G A;  4FYB A;  3GIX A;  5B8A A;  3LSZ A;  2AYT A;  1VF1 A;  4BL7 A;  4PNF A;  3CTF A;  4MPF A;  3GUR A;  1G6Y A;  3KJY A;  3IAM 2;  5IOX A;  3RAZ A;  3ZZX A;  4IS0 A;  7GSS A;  1MDI A;  3KP9 A;  2GLR A;  4FYU A;  4IKH A;  5DVB A;  3F3Q A;  1Q4J A;  5D9V A;  4JE1 A;  2NDO A;  2BTO T;  2K8S A;  3FZ4 A;  2I9H A;  5EY6 A;  5LD0 A;  2VAF A;  2HZE B;  3LG6 A;  3IC8 A;  3PGT A;  5G5F A;  3QD9 A;  4G0L A;  1YKA A;  3WYW A;  1MTC A;  1OC8 A;  3HDC A;  2KLX A;  3LGC A;  2OKA A;  2YV9 A;  4YQM A;  4HOJ A;  3E9J B;  3EIN A;  1BAY A;  3VWU A;  1T7P B;  4PQH A;  1A2J A;  2IFQ A;  5IMV A;  3BBY A;  1Q98 A;  4K7I A;  4IQA A;  3UVT A;  2PGT A;  2IWT A;  4HQS A;  4G19 A;  4BVY A;  1YJ6 A;  2VO4 A;  3DRN A;  1GTU A;  1C72 A;  3H79 A;  5F06 A;  1S3D A;  5D9W A;  3IBH A;  4XCS A;  3RHC A;  1TKD B;  3C73 A;  5F05 A;  4F9Z A;  1PX6 A;  1V9W A;  3OR5 A;  4IGJ A;  1PL1 A;  4MF6 A;  2L6D A;  4ZB9 A;  5HR2 A;  1JZD A;  1VF2 A;  4HS1 A;  3MSZ A;  5JCG A;  2DJ1 A;  2NVL A;  1EGR A;  5KEJ A;  3FKF A;  2L5L A;  4FO5 A;  4L0U A;  3IOS A;  4IJI A;  2R6K A;  4OO4 A;  2R5G A;  1XIY A;  5GSS A;  5J4U A;  3IC4 A;  2HZE A;  5CNW A;  3HKR A;  4MAB A;  3BD2 A;  1EOH A;  1O73 A;  2OJL A;  2LJA A;  2MMN A;  4HDE A;  5J3R A;  1OVN A;  3QMX A;  1GLP A;  4Q5Q A;  3PPU A;  1TI3 A;  2PN8 A;  1PQN A;  3TKQ A;  3TKS E;  3M3M A;  4K0G A;  3VPT A;  5JWO B;  4XTS A;  1GSD A;  5DQS A;  4IBP A;  1HNA A;  1WRY A;  3I43 A;  3GL5 A;  4AF2 A;  4WBJ A;  3O3T A;  4MLY A;  2FWG A;  3KIJ A;  1G7E A;  1ERV A;  1K0A A;  3IA1 A;  2V1M A;  2FA8 A;  2JZS A;  1GL8 A;  1BQ7 A;  4KA0 A;  1X5D A;  3ZRE A;  3SWL A;  1J08 A;  4H86 A;  3O76 A;  1GSQ A;  4WET A;  3HZ8 A;  1XOB A;  1VF3 A;  4ZB8 A;  4ECI A;  2FD3 A;  2DMM A;  2C1Y A;  2CVD A;  1YZX A;  1F37 A;  2B7J A;  4KND A;  2XBQ A;  2JL4 A;  3FRC A;  3TB2 A;  2HSN B;  4TOP A;  3DKS A;  2XPE A;  2GZP A;  3UBL A;  1G7O A;  3HY2 A;  4PQ1 A;  1EEJ A;  3PR8 A;  3WT2 A;  4KGI A;  4EE0 A;  2JZT A;  1TU7 A;  1NM3 A;  4NHW A;  3CBU A;  4V2N A;  1M0U A;  3EUR A;  2B7K A;  3ZL5 A;  5IPG A;  3TUE A;  2CA8 A;  2WDU A;  4ZBD A;  5DBQ A;  1XW5 A;  2O89 A;  2JU5 A;  3L9U A;  5ABR A;  5F0G A;  4PUA A;  5J41 A;  1GUH A;  1AAZ A;  1A23 A;  16GS A;  1AQX A;  4GRF A;  2ALB A;  2A2R A;  4RI6 A;  4MH3 A;  1BYE A;  1TK8 B;  2IMK A;  3W8J A;  3A5W A;  4MP4 A;  4N30 A;  2RUE A;  1K0M A;  3KH9 A;  5IMA A;  2CZ2 A;  1A24 A;  3EE2 A;  3UBK A;  4EO3 A;  5DQY A;  2VCQ A;  1GUK A;  1TTZ A;  2H6Y A;  6GSW A;  2HSH A;  1OKD A;  1GNW A;  3GN3 A;  2V41 A;  1SJ6 A;  2R4V A;  1ZL9 A;  3V1W A;  1OE8 A;  1TK5 B;  3U6V A;  3F3R A;  1FHE A;  4HZ4 A;  5ID2 B;  3PH9 A;  1SK0 A;  2CV4 A;  5KN3 A;  3HXS A;  5EVO A;  4J57 E;  4FH8 A;  3M9J A;  2X64 A;  2GDR A;  3DML A;  1XXU A;  3D5J A;  4I6X A;  4LMV A;  1FB6 A;  1W4V A;  1KTE A;  5D93 A;  1PN9 A;  2HT9 A;  3ZTL A;  2HRA A;  4KW6 A;  4CDO A;  2RII A;  2HRK B;  5F8B A;  4ULX A;  5CRD A;  5D96 A;  2BJX A;  1WIK A;  1XBS A;  1WMJ A;  14GS A;  2HE3 A;  4HU9 A;  3LWA A;  2K9F A;  3QAW A;  4O92 A;  1MEK A;  4ZIL A;  4P3Y B;  3D0Z A;  3H8Q A;  1WJK A;  4OD7 A;  5C04 A;  1TRW A;  4LLR A;  4ECJ A;  1FAA A;  3LJR A;  1T00 A;  3IE3 A;  3F4T A;  4MK3 A;  2PU9 C;  4N10 A;  3F6F A;  3IRA A;  3KXO A;  2K6V A;  5AIS A;  5JWR B;  2WGR A;  1B9Y C;  2L5O A;  2V32 A;  3P7X A;  1ACV A;  4GCI A;  2H70 A;  1ZYE A;  1M2A A;  5D73 A;  4NV2 A;  2G2Q A;  2QSI A;  3VPQ A;  2O87 A;  1ZMA A;  2CQ9 A;  1JFU A;  3M8N A;  2GTU A;  3F6D A;  5ID2 A;  5ECK B;  3P90 A;  2IMI A;  5ELG A;  2HSM B;  3I69 A;  5B6M A;  2PER A;  3P8W A;  1TXX A;  4J56 E;  2DJ2 A;  1F9M A;  1B8X A;  4K9Z A;  17GS A;  3GTU A;  5ECI B;  1V58 A;  4IEL A;  2MZC A;  2H66 A;  3HYP A;  4X43 A;  3AY8 A;  3I9V 2;  2HRK A;  3CXG A;  1X9S B;  1CQH A;  3VUR A;  4OO5 A;  5IPH A;  3GV1 A;  3L0H A;  1A2L A;  2B1L A;  5G1L A;  3BCI A;  1USB A;  2LNT A;  2VLT A;  2H01 A;  2VL9 A;  3A2W A;  2FLS A;  4MDC A;  2LKU A;  2GZZ A;  3ZVJ A;  3G7J A;  2WFC A;  3W8S A;  1OKT A;  3QPM A;  2L4Q A;  4OCE A;  1TP9 A;  2YZU A;  3FZ5 A;  2YOI A;  2H8L A;  2VL2 C;  3DYR A;  1LBK A;  3BOA A;  2B3S A;  1WPI A;  3IV4 A;  4EVM A;  1VGL A;  4JBB A;  4MJB A;  2GT6 A;  3FK8 A;  4RQR A;  1PKW A;  2LV3 A;  2AHE A;  1JLW A;  5B6N A;  1TW9 A;  2OE0 A;  1KNG A;  3D4T A;  1FVK A;  1MDK A;  4K8M A;  4BPY A;  3ZFL A;  5KN1 A;  3GL3 A;  1O85 A;  2FA4 A;  2ON7 A;  4F82 A;  2HSM A;  3HJO A;  5DJL A;  2GQL A;  3EU4 A;  4MPG A;  4BA7 A;  1JZW A;  1ZGN A;  3GA4 A;  1FW1 A;  4TVE A;  3RBT A;  3EC3 A;  1THX A;  3R3E A;  4POL A;  2H75 A;  3GST A;  4GSN A;  2HNL A;  4AJ6 A;  4DSR A;  3EWL A;  3M9K A;  3GH9 A;  4PUF C;  4KUN A;  4N0V A;  2N5F A;  4KSO A;  1DE1 A;  5CAX A;  2AUV A;  3WGD A;  5KN2 A;  2G0F A;  3G7Y A;  4MCU A;  2I4A A;  4X1U A;  3GH6 A;  2AB6 A;  2M72 A;  4TRX A;  3N5O A;  4X0X A;  1QFN A;  4MH2 A;  2F8F A;  3O6T A;  1IYI A;  1AQV A;  2PVQ A;  2OAC A;  1HNB A;  3TKR A;  1U3A A;  2IMD A;  4TR0 A;  3DVW A;  5GST A;  2YP6 A;  4OWY A;  1GNE A;  3E0U A;  4IN0 A;  5AIX A;  1X5C A;  3TRP A;  5G1K A;  2WJU A;  4K2D A;  2PMT A;  4EF0 A;  1RW1 A;  2H0I A;  2IPA A;  2H1G A;  1F2E A;  4G0I A;  5D9X A;  1GSU A;  1T4Y A;  2NPB A;  3ZIJ A;  4GTU A;  1PGT A;  3DD3 A;  2DBC A;  3UOM A;  2HLS A;  5CRW A;  5EPF A;  3S9F A;  5A5K A;  4DSQ A;  3LXT A;  1TU8 A;  1BG5 A;  3J7Y k;  3TJB A;  5CO3 A;  3F9U A;  4L8E A;  4ID0 A;  3QFB C;  3MDK A;  4K0N A;  5ECQ B;  1ZYQ B;  1OE7 A;  1NSW A;  2KHP A;  4GST A;  1SD8 A;  2ZCT A;  3APQ A;  1XOA A;  2VL2 A;  3VK9 A;  3CRT A;  3VWV A;  4IW9 A;  1VF4 A;  4OFM A;  2GVP A;  4XHM A;  5GZZ B;  1ABA A;  2I1U A;  5G5E A;  3L4N A;  1UC7 A;  3GHA A;  1SK2 A;  2LQO A;  3LEF A;  4GQF A;  2O7K A;  1A0F A;  3F0I A;  1G0T A;  2LEG A;  3QAV A;  5DCH A;  4NV5 A;  2HFD A;  2A4V A;  4GXZ A;  1GSF A;  19GS A;  2OAD A;  4IVF A;  3QOU A;  1PL2 A;  1GP1 A;  1SYR A;  2E7P A;  2HQT A;  5ECS A;  1KEB A;  3GNJ A;  1ILO A;  5LNK e;  1QGV A;  2LRN A;  4PQI A;  1ZOF A;  4I97 A;  5FWG A;  1Z9H A;  5HR3 A;  12GS A;  1K0O A;  4JED A;  1Y6E A;  4WF5 A;  2VCZ A;  3VLN A;  4POK A;  6GSV A;  3Q19 A;  3IHQ A;  1DBY A;  4XIH A;  3TJK A;  1E6B A;  3UIW A;  5L71 A;  5ECP B;  2TRX A;  3HHV A;  2B5X A;  2YWO A;  5B7C A;  3ED3 A;  4NPB A;  1IYH A;  1GSE A;  1XVQ A;  1X0R A;  2MMA A;  1YEP A;  2F3M A;  2VL3 A;  2OBK A;  3HCZ A;  3LYP A;  4FIW A;  4ZL9 A;  2N5B A;  4HZ2 A;  1M2D A;  1TDI A;  2A2S A;  2H74 A;  4Q5F A;  2LUS A;  3J7Y b;  3CYN A;  2K8V A;  2YJH A;  3VWW A;  2H1B A;  3FZ9 A;  2RUF A;  2VM1 A;  5E4W A;  3NZN A;  3PIN A;  3D21 A;  1GSY A;  4MA9 A;  1HYU A;  2C4J A;  2PVO C;  5E59 A;  5HFI A;  2DJ3 A;  3FY7 A;  1TOF A;  6GST A;  1JZO A;  1QK8 A;  1S3A A;  2H73 A;  1XWG A;  1T4Z A;  2DML A;  1U87 A;  2TIR A;  3KZQ A;  3FZA A;  4ECC A;  3ZLP A;  5CYY A;  2VCT A;  4I2U A;  3JCM L;  4HQZ A;  4PUR A;  2HXK A;  1ERU A;  4MMM A;  3UAR A;  1O7U A;  2VCX A;  1PKZ A;  1GUM A;  2M80 A;  5BMU A;  2WUL A;  3MAK A;  3G9B A;  4BWQ A;  1PX7 A;  5B8B A;  1GLQ A;  4HU7 A;  2CX4 A;  3TKS A;  1RQM A;  6GSU A;  3ERF A;  2DIZ A;  4F03 A;  2KUC A;  3CSJ A;  2P31 A;  6GSX A;  2EIQ A;  3EU3 A;  2XC2 A;  2REM A;  4J2F A;  2K18 A;  3NIV A;  2EIR A;  4ZBA A;  2WCI A;  1SJI A;  4ZB6 A;  5IQY A;  3TRX A;  2LNS A;  3W6G A;  1X9W B;  1OC3 A;  5G30 A;  2PBJ A;  4F0B A;  2C0E A;  4JU5 A;  4GSS A;  2XBI A;  1A8L A;  2YNX A;  3F4S A;  1F3B A;  5FHI A;  18GS A;  1AQW A;  2CAQ A;  1DUG A;  1XW9 A;  2AV4 A;  3FYG A;  1WOU A;  4GF0 A;  2LJR A;  3HD5 A;  3MNG A;  3KTB A;  2C3T A;  2ON5 A;  3GSS A;  4DSS B;  4ZIJ A;  3TGZ A;  1TI1 A;  6GSY A;  5G2Z A;  4K7O A;  4KX4 A;  4DEJ A;  4JZQ A;  2WZ9 A;  3L9V A;  1FOV A;  1XFL A;  3TDG A;  4ISD A;  1T3B A;  5JCU A;  4EDY A;  3P2A A;  1M9A A;  1R26 A;  1RK4 A;  4AJ8 A;  4CW9 A;  4ECB A;  10GS A;  3R2Q A;  2RM6 A;  2H30 A;  2QC7 A;  4HJ2 A;  4ACS A;  1S3C A;  1XWC A;  5A4V A;  3M0F A;  2IJY A;  5COH A;  4XS1 A;  2JZR A;  2R2J A;  3GMF A;  1M2B A;  2I3Y A;  1AIU A;  5ECL B;  5ECH B;  3GX0 A;  4YQU A;  1A2M A;  2OE3 A;  3GKK A;  1XZO A;  2NTO A;  1Z6N A;  4HEA 2;  1R7H A;  1FO5 A;  5IO2 A;  4PGT A;  1EEM A;  4WBR D;  3EVI A;  1YY7 A;  2JSY A;  1OC9 B;  3FW2 A; 
#chains in the Genus database with same CATH topology
 5DDL A;  2RM5 A;  5A34 B;  3ZIV A;  3WGX A;  1H75 A;  3UL3 A;  1BX9 A;  3A2X A;  3FEU A;  3U5R E;  4BIK A;  3IK9 A;  3M1G A;  1GSS A;  5IMC A;  4K7N A;  4POB A;  1K3Y A;  3ME8 A;  2WB9 A;  4WF4 A;  1SL0 B;  5AIV A;  4DSS A;  4XRD A;  4BVX B;  5ECR B;  3HJP A;  2CVK A;  2J23 A;  3WD6 A;  3G7I A;  4Q5R A;  3UVH A;  1QUW A;  3HVN A;  2CT6 A;  4MZW A;  1FOH A;  3CSH A;  3FHK A;  4OFT A;  2WRT A;  3I6A A;  1T8E B;  4KDY A;  3KMN A;  22GS A;  3ZMK A;  1GH2 A;  1J9B A;  1K0C A;  5GAN D;  1G6W A;  3TJJ A;  6GSS A;  4BL7 B;  3CTG A;  2EC4 A;  2FGX A;  4RI7 A;  5HQP A;  1B9X C;  2GZY A;  3EYT A;  5H5S A;  3GYK A;  2C3N A;  5CRG A;  2GT5 A;  1AXD A;  3H1N A;  5ECM B;  2DJ0 A;  4KF9 A;  1SEN A;  2LTK A;  3KD0 A;  4Q5N A;  4G0K A;  3C8E A;  4O5R A;  1NW2 A;  1EGO A;  1WWJ A;  4OCF A;  3FR3 A;  1LU4 A;  4ILF A;  3WT1 A;  2KP2 A;  3RPP A;  4LL4 B;  1K3L A;  5AGY A;  3TOU A;  3ME7 A;  2GQK A;  1Z7R A;  2FCH A;  3SBC A;  1GTI A;  2CZ3 A;  1CQG A;  5DCG A;  5A4U A;  4YH2 A;  1QMV A;  4O32 A;  2IL3 A;  4G01 A;  2FWF A;  2VM2 A;  2PPT A;  1N8J A;  2DJK A;  3FR6 A;  4PXO A;  5D8I A;  1X5E A;  1AUC A;  1R5P A;  2TRC P;  5JWQ B;  3Q6O A;  1EV4 A;  4YAV A;  3APS A;  2E2G A;  1GUL A;  3D22 A;  4D73 B;  3CHX C;  13GS A;  4TR1 B;  4CY8 A;  4YKG A;  2NBS A;  2E0Q A;  3GX8 A;  3GFK A;  3HJM A;  3FR9 A;  4BVY B;  1YF0 A;  3WGE A;  4EUY A;  2H76 A;  2FY6 A;  3IDV A;  2GST A;  1Y1U A;  2DSA A;  4QQ7 A;  1GTB A;  2JSZ A;  3A2V A;  3DEX A;  3H4K A;  1EZK A;  4MJA A;  4YAP A;  1XWK A;  3RDW A;  4TXO B;  1JLV A;  1Z3E A;  4AKX B;  2WVZ A;  3IAS 2;  4KSM A;  1SD9 A;  4ML1 A;  2YJ7 A;  2WZS A;  4ML6 A;  1F6M C;  4HUA A;  1THO A;  4L5L A;  2IN3 A;  5LCZ A;  5DAK B;  3HVS A;  4KCA A;  4NXI A;  5JCW A;  3EMX A;  1I1I P;  3CMI A;  5DJM A;  4NMU A;  1B4Q A;  4K1F A;  3TOT A;  3IR4 A;  4IQ1 A;  2H19 A;  4TKY A;  5HR0 A;  3EMP A;  2GS3 A;  3L9S A;  1Z5Y E;  3GKM A;  4WXT A;  3UAP A;  5F07 A;  2OA7 A;  2QA1 A;  4HI7 A;  3K8N A;  2X8G A;  3D4M A;  9GSS A;  1ERW A;  4ZL7 A;  3IK7 A;  4D73 A;  5FT3 A;  4L0W A;  4TR1 A;  1SKR B;  2B5E A;  1GTA A;  1N2A A;  2JAC A;  5ENU A;  4CHS A;  4FQU A;  2EFH A;  3F63 A;  5D9T A;  5A4W A;  4ZXG A;  3TKS C;  3DIE A;  2FWH A;  4O5Q A;  4L5O A;  4G9H A;  2GSR A;  2CVB A;  2WW3 A;  3TCO A;  1JHB A;  2HYX A;  2XPD A;  4LA1 A;  1ERT A;  4MZB A;  5EL8 A;  2C3Q A;  2IIY A;  5IMF A;  4KH7 A;  1T1V A;  4EDZ A;  3CSI A;  3H93 A;  3TRQ A;  4TXO A;  1XVW A;  1M7T A;  1ZZY A;  3C7M A;  3HA9 A;  2VCW A;  2KP1 A;  2GSQ A;  1B48 A;  20GS A;  2LJK A;  1O6J A;  2X8H A;  2F8A A;  5DAK A;  5AN1 A;  1XWA A;  1V98 A;  4GDF A;  1QQ2 A;  2AJQ B;  2YV7 A;  4WR4 A;  5INY A;  1UA5 A;  3N9J A;  4FXY P;  4G10 A;  5H5Q A;  3LOR A;  1SU9 A;  3CQF A;  2E2M A;  4NHZ A;  1AC1 A;  2LRC A;  2XHF A;  1J0F A;  4WEY A;  4V2L A;  3F8U A;  5ELA A;  4OMV A;  2I81 A;  5HFK A;  1O81 A;  1XCC A;  2FNO A;  5J4V A;  1ML6 A;  4W66 A;  5CRH A;  4GLT A;  1PFO A;  1H4O A;  2HRF A;  4I8B A;  2DIY A;  2J9H A;  2MBT A;  4RQX A;  5CP1 A;  1ON4 A;  1OAZ A;  2C8U A;  3D6I A;  1AW9 A;  1EP8 A;  2HZF A;  1PA3 A;  3KMO A;  2LS5 A;  2DJJ A;  3IXR A;  2B6M A;  5IMD A;  1UN2 A;  4PHZ C;  2KOK A;  2C0D A;  3HVV A;  1QXH A;  4JRR A;  3TKP A;  1F3A A;  4KDX A;  4JR6 A;  3QDN A;  1TXU A;  5A1N B;  4N3Z A;  1DE2 A;  1PRX A;  3NOF A;  2QGV A;  4USS A;  3APO A;  2DC5 A;  1WP0 A;  1NHY A;  3LYK A;  1YF1 A;  1BF5 A;  4K6X A;  3TJF A;  1I5G A;  2YCD A;  2M46 A;  1SL2 B;  4KAE A;  3Q18 A;  2D2Z A;  2O85 A;  1Z6M A;  2YWI A;  2L4C A;  2YWN A;  1TK0 B;  2F51 A;  4QL7 A;  4KDU A;  5KN0 A;  2HRN A;  1SKW B;  4AKG A;  4O7H A;  1WE0 A;  1SL1 B;  3KM6 A;  3VWX A;  4POM A;  2YZH A;  5H5R A;  4G2E A;  4TN8 A;  1UVZ A;  3VFI A;  3HVX A;  3ERW A;  4ZL8 A;  3L78 A;  2HI7 A;  2V2G A;  2ZUP A;  3DXB A;  2MBS A;  2UZ8 A;  2H1L A;  3TJG A;  4YQV A;  4HJM A;  2WW2 A;  5GAP D;  3GUS A;  2YAN A;  4QL9 A;  1EV9 A;  4GWR A;  2P0G A;  2H1D A;  1O8W A;  1S3R A;  2L6C A;  4PI2 C;  2PUK C;  3QR6 A;  4ZBB A;  1ZCP A;  4TW5 A;  2P5R A;  4E8H A;  3RHB A;  4TXV A;  2FUG 2;  3HZ4 A;  1W89 A;  3C71 A;  2VLU A;  3QCP A;  2MMO A;  2VLV A;  2VOC A;  2X8C A;  1V57 A;  2H0H A;  3KH7 A;  5IIZ A;  4NAX A;  4NWY A;  4PNG A;  5A1N A;  1SVO A;  5IM9 A;  2QKE A;  1M9B A;  4IP6 A;  1YQ1 A;  2YPM A;  5C00 A;  2GSS A;  3CWG A;  1R4W A;  3UMA A;  3A3T A;  1ZYP A;  11GS A;  4AGS A;  4EXJ A;  4JR4 A;  1K0N A;  2Z9S A;  4AKH A;  1URM A;  3C1S A;  3GKX A;  3MYD A;  1MDJ A;  4EL1 A;  2LRT A;  1SYX A;  1K3O A;  3VI7 A;  3LXZ A;  2C80 A;  1MD4 A;  2BMX A;  4TR3 A;  4PX1 A;  4LMW A;  2YWM A;  4MZC A;  1FVJ A;  3GTU B;  4MJE A;  3BCK A;  5DAL B;  3QFA C;  4WKW A;  2C0F A;  1SJZ A;  4TR4 A;  4AJ7 A;  3ZFB A;  1ST9 A;  4I5Q A;  2VCV A;  1K0B A;  2B1K A;  1LJR A;  5J5N A;  2B5Y A;  3DGQ A;  2WS2 A;  5IMZ A;  3Q74 A;  1TJD A;  1NHO A;  2FWE A;  5HR1 A;  4V1A p;  3BJ5 A;  3IPZ A;  2VD1 A;  3RGB C;  2WVY A;  1YKC A;  3CRU A;  1TRV A;  5ECN B;  2L57 A;  4LL1 B;  3DWV A;  4Z7X A;  3ZML A;  3LQ7 A;  1HNC A;  1GWC A;  4AI6 A;  2AAW A;  2YN1 A;  4N11 A;  2X99 A;  4KE3 A;  1FB0 A;  2X4A A;  1PMT A;  2OE1 A;  4K5S A;  2IME A;  1SK1 A;  2JAD A;  1A8Y A;  3F4R A;  4F0C A;  2H6Z A;  4MJC A;  1V2A A;  4IP1 A;  3KEB A;  2GGT A;  5CRE A;  1OYJ A;  3C1R A;  2EIO A;  3ISO A;  4V1A g;  3ZRD A;  1EWX A;  1VRS D;  2H71 A;  2R3X A;  2LST A;  1XW6 A;  1U6T A;  2FHE A;  3DVX A;  3KCM A;  5IOW A;  4I2T A;  3ZIT A;  2OBI A;  4EC0 A;  2LQQ A;  1M99 A;  2PWJ A;  4XS4 B;  2P5Q A;  4XS6 A;  1TRU A;  1DSB A;  1E2Y A;  3LFL A;  2VUP A;  5DAL A;  3GRX A;  1XPV A;  1U88 A;  4ICY A;  4FYC A;  1TRS A;  2F9S A;  1JZR A;  2H72 A;  1GRX A;  2MMZ A;  2EFD A;  5J9B A;  4RUV A;  1B4P A;  2HSY A;  2H6X A;  2V6O A;  4DVC A;  8GSS A;  3MWH A;  1HD2 A;  5G31 A;  1I9D A;  1YEX A;  1A0R P;  4E8E A;  1PSQ A;  5IO0 A;  2CAI A;  1FG4 A;  4XRA A;  2DLX A;  4IHU A;  3US3 A;  1EOG A;  2VD0 A;  4MF5 A;  2V6K A;  1YDK A;  4EKZ A;  2N5A A;  2ZNM A;  2MYG A;  4GQC A;  3VI5 A;  5J9C A;  3GKN A;  4K2X A;  3RPN A;  3ERG A;  1OC9 A;  4MF7 A;  4IJ3 A;  1PD2 1;  5A34 A;  3KTL A;  2ES7 A;  3MIX A;  4HSC X;  4N0Z A;  4KCE A;  1O8X A;  1K0D A;  4KB3 A;  2VIM A;  4BWS A;  1V40 A;  1BED A;  2H1A A;  5HFG A;  3ZYW A;  1SKS B;  3ZVJ D;  3RFR C;  2RLI A;  4WR5 A;  1X9M B;  1KBN A;  4F2I A;  3QAG A;  4BVX A;  2IFQ B;  3E3E A;  3UEM A;  1R5A A;  1Y25 A;  4OFN A;  3KP8 A;  1XWB A;  2R37 A;  2L59 A;  3KGK A;  2H0G A;  2O8V B;  1Z7P A;  5ECO B;  4PTS A;  1U3I A;  1MD3 A;  2CX3 A;  1HQO A;  1EP7 A;  4V2M A;  1BJX A;  1N25 A;  2GQM A;  3UJ1 A;  4XS4 A;  2IMF A;  2C0G A;  4FYB A;  3GIX A;  5B8A A;  3LSZ A;  2AYT A;  1VF1 A;  4BL7 A;  4PNF A;  4Z2R A;  3CTF A;  4MPF A;  3TU3 B;  3GUR A;  1G6Y A;  3KJY A;  3IAM 2;  5BRT A;  5IOX A;  3RAZ A;  3ZZX A;  4IS0 A;  7GSS A;  1MDI A;  3KP9 A;  2GLR A;  1SVL A;  4FYU A;  4IKH A;  5DVB A;  3F3Q A;  1Q4J A;  5D9V A;  4JE1 A;  2NDO A;  2BTO T;  2K8S A;  3FZ4 A;  2I9H A;  5EY6 A;  5LD0 A;  2VAF A;  2HZE B;  3LG6 A;  3IC8 A;  3PGT A;  4PI0 C;  5G5F A;  3QD9 A;  4G0L A;  1YKA A;  3WYW A;  1MTC A;  1OC8 A;  2WW0 A;  3HDC A;  2KLX A;  3LGC A;  2OKA A;  2YV9 A;  4YQM A;  5J47 A;  1ZYN A;  4HOJ A;  3E9J B;  4K5R A;  3EIN A;  1BAY A;  3VWU A;  1T7P B;  4PQH A;  1A2J A;  2IFQ A;  5IMV A;  4A5P A;  3BBY A;  5J4Y A;  1Q98 A;  4K7I A;  1YEW C;  4IQA A;  3UVT A;  2PGT A;  2IWT A;  4HQS A;  4G19 A;  1SVM A;  4BVY A;  1YJ6 A;  2VO4 A;  3DRN A;  1GTU A;  1C72 A;  3H79 A;  5F06 A;  1S3D A;  5D9W A;  3IBH A;  4XCS A;  3RHC A;  1TKD B;  3C73 A;  5F05 A;  4F9Z A;  1PX6 A;  1V9W A;  3OR5 A;  4IGJ A;  1PL1 A;  4MF6 A;  2L6D A;  1M3J A;  4ZB9 A;  5HR2 A;  1JZD A;  1VF2 A;  4HS1 A;  3MSZ A;  5JCG A;  2DJ1 A;  2NVL A;  1EGR A;  2EFC A;  5KEJ A;  3FKF A;  2L5L A;  4FO5 A;  4L0U A;  3IOS A;  2A2P A;  4IJI A;  2R6K A;  4OO4 A;  2R5G A;  1XIY A;  5GSS A;  5J4U A;  3IC4 A;  2HZE A;  5CNW A;  3HKR A;  4MAB A;  3BD2 A;  1EOH A;  1O73 A;  2OJL A;  2LJA A;  2MMN A;  4HDE A;  5J3R A;  1OVN A;  3QMX A;  1GLP A;  4Q5Q A;  3PPU A;  1TI3 A;  2PN8 A;  1PQN A;  3TKQ A;  3TKS E;  3M3M A;  4K0G A;  3VPT A;  5JWO B;  4XTS A;  1GSD A;  5DQS A;  4IBP A;  1HNA A;  1WRY A;  3I43 A;  3GL5 A;  4AF2 A;  4WBJ A;  3O3T A;  4MLY A;  4O5U A;  2FWG A;  1M3I A;  3KIJ A;  1G7E A;  1ERV A;  1K0A A;  3IA1 A;  2V1M A;  2FA8 A;  2JZS A;  1GL8 A;  1BQ7 A;  4KA0 A;  1X5D A;  3ZRE A;  3SWL A;  1J08 A;  4H86 A;  3O76 A;  1GSQ A;  4WET A;  3HZ8 A;  1XOB A;  1VF3 A;  4ZB8 A;  4ECI A;  2FD3 A;  2DMM A;  2C1Y A;  2CVD A;  2WVX B;  1YZX A;  1F37 A;  2B7J A;  4KND A;  2XBQ A;  2JL4 A;  3FRC A;  3TB2 A;  2HSN B;  4TOP A;  3DKS A;  2XPE A;  2GZP A;  3UBL A;  1G7O A;  3HY2 A;  4PQ1 A;  4CY6 A;  1EEJ A;  3PR8 A;  3WT2 A;  4KGI A;  4EE0 A;  2JZT A;  1TU7 A;  1NM3 A;  4NHW A;  3CBU A;  4V2N A;  1M0U A;  3EUR A;  2B7K A;  5A5H B;  3ZL5 A;  5IPG A;  3TUE A;  2CA8 A;  2WDU A;  4ZBD A;  5DBQ A;  1XW5 A;  2O89 A;  2JU5 A;  3L9U A;  5ABR A;  5F0G A;  4PUA A;  5J41 A;  1GUH A;  1AAZ A;  1A23 A;  16GS A;  1AQX A;  3HMJ G;  4GRF A;  2ALB A;  2A2R A;  4RI6 A;  4MH3 A;  1BYE A;  1TK8 B;  2IMK A;  3W8J A;  3A5W A;  4MP4 A;  4N30 A;  2RUE A;  1K0M A;  3KH9 A;  5IMA A;  2CZ2 A;  1A24 A;  3EE2 A;  3UBK A;  4EO3 A;  5DQY A;  2VCQ A;  1GUK A;  1TTZ A;  2H6Y A;  6GSW A;  2HSH A;  1OKD A;  1GNW A;  3GN3 A;  2V41 A;  1SJ6 A;  2R4V A;  1ZL9 A;  3V1W A;  1PN0 A;  1OE8 A;  1TK5 B;  2HSN A;  3U6V A;  3F3R A;  1FHE A;  4HZ4 A;  5ID2 B;  3PH9 A;  1SK0 A;  2CV4 A;  5KN3 A;  3HXS A;  5EVO A;  4J57 E;  4FH8 A;  3M9J A;  2X64 A;  2GDR A;  3DML A;  1XXU A;  3D5J A;  4I6X A;  4LMV A;  1FB6 A;  1W4V A;  1KTE A;  5D93 A;  1PN9 A;  2HT9 A;  3ZTL A;  2HRA A;  4KW6 A;  4CDO A;  2RII A;  2HRK B;  5F8B A;  4ULX A;  5CRD A;  5D96 A;  2BJX A;  1WIK A;  1XBS A;  1WMJ A;  14GS A;  2HE3 A;  4HU9 A;  3LWA A;  2K9F A;  3QAW A;  4O92 A;  1MEK A;  4ZIL A;  5KOX A;  4P3Y B;  3D0Z A;  3H8Q A;  1WJK A;  4OD7 A;  5C04 A;  1TRW A;  4LLR A;  4ECJ A;  1FAA A;  3LJR A;  1T00 A;  3IE3 A;  3F4T A;  4MK3 A;  2PU9 C;  4N10 A;  3F6F A;  3IRA A;  3KXO A;  2K6V A;  5AIS A;  5JWR B;  2WGR A;  1B9Y C;  2L5O A;  2V32 A;  3P7X A;  1ACV A;  4GCI A;  2H70 A;  1ZYE A;  1M2A A;  5D73 A;  4NV2 A;  2G2Q A;  2QSI A;  3VPQ A;  2O87 A;  1ZMA A;  2CQ9 A;  1JFU A;  3M8N A;  2GTU A;  3F6D A;  5ID2 A;  3IHG A;  5ECK B;  3P90 A;  2IMI A;  5ELG A;  2HSM B;  4YKF A;  2QA2 A;  3I69 A;  5B6M A;  2PER A;  3P8W A;  1TXX A;  4J56 E;  4Z2U A;  2DJ2 A;  1F9M A;  1B8X A;  17GS A;  4K9Z A;  3GTU A;  5ECI B;  1V58 A;  4IEL A;  2MZC A;  2H66 A;  3HYP A;  4X43 A;  3AY8 A;  3I9V 2;  2HRK A;  3CXG A;  1X9S B;  1CQH A;  3VUR A;  4OO5 A;  5IPH A;  3GV1 A;  3L0H A;  1A2L A;  2B1L A;  5G1L A;  3BCI A;  1USB A;  2LNT A;  2VLT A;  2H01 A;  2VL9 A;  3A2W A;  2FLS A;  4MDC A;  2LKU A;  2GZZ A;  3ZVJ A;  3G7J A;  2WFC A;  3W8S A;  1OKT A;  3QPM A;  2DKH A;  2L4Q A;  4OCE A;  1TP9 A;  2YZU A;  3FZ5 A;  2YOI A;  2H8L A;  2VL2 C;  3DYR A;  1LBK A;  3BOA A;  2B3S A;  2WW1 A;  1WPI A;  3IV4 A;  4EVM A;  1VGL A;  2O3E A;  4JBB A;  4MJB A;  2GT6 A;  3FK8 A;  4RQR A;  1PKW A;  2LV3 A;  2AHE A;  1JLW A;  5B6N A;  1TW9 A;  2OE0 A;  1KNG A;  3D4T A;  1FVK A;  1MDK A;  4K8M A;  4BPY A;  3ZFL A;  5KN1 A;  3GL3 A;  1O85 A;  2FA4 A;  2ON7 A;  4F82 A;  2HSM A;  2O5V A;  3HJO A;  5DJL A;  2GQL A;  3A5I A;  3EU4 A;  4MPG A;  4BA7 A;  1JZW A;  1ZGN A;  3GA4 A;  1S4B P;  1FW1 A;  4TVE A;  3RBT A;  3EC3 A;  1THX A;  3R3E A;  4POL A;  2H75 A;  3GST A;  4GSN A;  2HNL A;  4AJ6 A;  4DSR A;  3EWL A;  3M9K A;  3GH9 A;  4PUF C;  4KUN A;  4N0V A;  2N5F A;  4KSO A;  1DE1 A;  5CAX A;  2AUV A;  3WGD A;  5KN2 A;  2G0F A;  3G7Y A;  4MCU A;  2I4A A;  4X1U A;  3GH6 A;  2AB6 A;  2M72 A;  4TRX A;  3N5O A;  4X0X A;  1QFN A;  4MH2 A;  2F8F A;  3O6T A;  1IYI A;  1AQV A;  2PVQ A;  2OAC A;  1HNB A;  3TKR A;  1U3A A;  2IMD A;  4TR0 A;  3DVW A;  5GST A;  3LW9 A;  2VKZ G;  2YP6 A;  4OWY A;  1GNE A;  3E0U A;  4IN0 A;  5AIX A;  1X5C A;  3TRP A;  5G1K A;  2WJU A;  4K2D A;  2PMT A;  4EF0 A;  1RW1 A;  2H0I A;  2IPA A;  2H1G A;  1F2E A;  4G0I A;  5D9X A;  1GSU A;  4E68 A;  1T4Y A;  2NPB A;  3ZIJ A;  4GTU A;  4EIP A;  1PGT A;  3DD3 A;  2DBC A;  3UOM A;  2HLS A;  5CRW A;  5EPF A;  3S9F A;  5A5K A;  4DSQ A;  3LXT A;  1TU8 A;  1BG5 A;  3J7Y k;  3TJB A;  5CO3 A;  3F9U A;  4L8E A;  4ID0 A;  3QFB C;  3MDK A;  4K0N A;  5ECQ B;  1ZYQ B;  1OE7 A;  1NSW A;  2KHP A;  4GST A;  3EPT A;  4QMK A;  1SD8 A;  2ZCT A;  2R0G A;  3APQ A;  1XOA A;  2VL2 A;  3VK9 A;  3CRT A;  3VWV A;  4IW9 A;  1VF4 A;  4OFM A;  2GVP A;  4XHM A;  5GZZ B;  1ABA A;  2I1U A;  2X49 A;  5G5E A;  3L4N A;  1UC7 A;  3GHA A;  1SK2 A;  2LQO A;  3LEF A;  4GQF A;  2O7K A;  1A0F A;  3F0I A;  1G0T A;  2LEG A;  3QAV A;  5DCH A;  4NV5 A;  2HFD A;  2A4V A;  4GXZ A;  1GSF A;  19GS A;  2OAD A;  4IVF A;  3QOU A;  1PL2 A;  1GP1 A;  1SYR A;  2E7P A;  2HQT A;  5ECS A;  1KEB A;  3GNJ A;  1ILO A;  5LNK e;  1QGV A;  2LRN A;  4PQI A;  1ZOF A;  4I97 A;  5FWG A;  1Z9H A;  5BMU B;  5HR3 A;  12GS A;  1K0O A;  4JED A;  1Y6E A;  4WF5 A;  2VCZ A;  3VLN A;  4POK A;  6GSV A;  3Q19 A;  3IHQ A;  1DBY A;  4XIH A;  1XG8 A;  3TJK A;  1E6B A;  3UIW A;  5L71 A;  5ECP B;  2TRX A;  3HHV A;  4MNN A;  2B5X A;  2YWO A;  5B7C A;  3ED3 A;  4NPB A;  1IYH A;  1GSE A;  1XVQ A;  1X0R A;  2MMA A;  1YEP A;  2F3M A;  2VL3 A;  2OBK A;  3HCZ A;  3LYP A;  4FIW A;  4ZL9 A;  2DKI A;  2N5B A;  4HZ2 A;  1M2D A;  1TDI A;  2A2S A;  2H74 A;  4Q5F A;  2LUS A;  3J7Y b;  3CYN A;  2K8V A;  2YJH A;  3VWW A;  2H1B A;  4ZB7 A;  3FZ9 A;  2RUF A;  2VM1 A;  5E4W A;  3NZN A;  3PIN A;  3D21 A;  1GSY A;  2A4H A;  4MA9 A;  1HYU A;  2C4J A;  2PVO C;  5E59 A;  5HFI A;  2DJ3 A;  4Z2T A;  3FY7 A;  1TOF A;  6GST A;  1JZO A;  2R0C A;  1QK8 A;  1S3A A;  2H73 A;  1BG1 A;  1XWG A;  1T4Z A;  2DML A;  1U87 A;  2TIR A;  3KZQ A;  3FZA A;  4ECC A;  3ZLP A;  5CYY A;  2VCT A;  4I2U A;  3JCM L;  4HQZ A;  4PUR A;  2HXK A;  1ERU A;  4MMM A;  3UAR A;  1O7U A;  2VCX A;  1PKZ A;  1GUM A;  2M80 A;  3FMW A;  5BMU A;  2WUL A;  3MAK A;  3G9B A;  4BWQ A;  1PX7 A;  5B8B A;  1GLQ A;  4HU7 A;  2CX4 A;  3TKS A;  1RQM A;  6GSU A;  3ERF A;  2DIZ A;  4F03 A;  2KUC A;  3CSJ A;  2P31 A;  6GSX A;  2EIQ A;  3EU3 A;  2XC2 A;  2REM A;  4J2F A;  2K18 A;  3NIV A;  2EIR A;  4ZBA A;  2WCI A;  1SJI A;  4ZB6 A;  5IQY A;  3TRX A;  4EIQ A;  2LNS A;  1YVL A;  3W6G A;  1X9W B;  1OC3 A;  5G30 A;  2PBJ A;  4F0B A;  2C0E A;  4JU5 A;  4GSS A;  2XBI A;  1A8L A;  2WVX A;  2YNX A;  3F4S A;  1F3B A;  5FHI A;  18GS A;  1AQW A;  2CAQ A;  1DUG A;  1XW9 A;  2AV4 A;  3FYG A;  1WOU A;  4GF0 A;  2LJR A;  3HD5 A;  3MNG A;  3KTB A;  2C3T A;  2ON5 A;  3GSS A;  4DSS B;  4ZIJ A;  3TGZ A;  1TI1 A;  2UV8 G;  5A5H A;  6GSY A;  5G2Z A;  4K7O A;  4KX4 A;  4DEJ A;  4X4J A;  4JZQ A;  2WZ9 A;  3L9V A;  2R0P A;  1FOV A;  1XFL A;  3TDG A;  4ISD A;  1T3B A;  5JCU A;  4EDY A;  3P2A A;  1M9A A;  1R26 A;  1RK4 A;  4AJ8 A;  4CW9 A;  4ECB A;  10GS A;  3R2Q A;  2RM6 A;  2H30 A;  2QC7 A;  4HJ2 A;  4ACS A;  1S3C A;  1XWC A;  5A4V A;  3M0F A;  2IJY A;  5COH A;  4XS1 A;  2JZR A;  2R2J A;  3GMF A;  1M2B A;  2I3Y A;  1AIU A;  5ECL B;  5ECH B;  5J40 A;  5KOW A;  2EFE A;  3GX0 A;  4YQU A;  1A2M A;  2OE3 A;  3GKK A;  1XZO A;  2OT3 A;  2NTO A;  1Z6N A;  4HEA 2;  1R7H A;  4AKI A;  1FO5 A;  5IO2 A;  4PGT A;  1EEM A;  4WBR D;  2O36 A;  3EVI A;  1YY7 A;  2JSY A;  1OC9 B;  3FW2 A; 
#chains in the Genus database with same CATH homology
 5DDL A;  2RM5 A;  5A34 B;  3ZIV A;  3WGX A;  1H75 A;  3UL3 A;  1BX9 A;  3A2X A;  3FEU A;  3U5R E;  3IK9 A;  3M1G A;  1GSS A;  5IMC A;  4K7N A;  4POB A;  1K3Y A;  3ME8 A;  2WB9 A;  4WF4 A;  1SL0 B;  5AIV A;  4DSS A;  4XRD A;  4BVX B;  5ECR B;  3HJP A;  2CVK A;  2J23 A;  3WD6 A;  3G7I A;  4Q5R A;  3UVH A;  1QUW A;  2CT6 A;  4MZW A;  1FOH A;  3CSH A;  3FHK A;  4OFT A;  2WRT A;  3I6A A;  1T8E B;  4KDY A;  3KMN A;  22GS A;  3ZMK A;  1GH2 A;  1J9B A;  1K0C A;  5GAN D;  1G6W A;  3TJJ A;  6GSS A;  4BL7 B;  3CTG A;  2EC4 A;  2FGX A;  4RI7 A;  5HQP A;  1B9X C;  2GZY A;  3EYT A;  5H5S A;  3GYK A;  2C3N A;  5CRG A;  2GT5 A;  1AXD A;  3H1N A;  5ECM B;  2DJ0 A;  4KF9 A;  1SEN A;  2LTK A;  3KD0 A;  4Q5N A;  4G0K A;  3C8E A;  4O5R A;  1NW2 A;  1EGO A;  1WWJ A;  4OCF A;  3FR3 A;  1LU4 A;  4ILF A;  3WT1 A;  2KP2 A;  3RPP A;  4LL4 B;  1K3L A;  5AGY A;  3TOU A;  3ME7 A;  2GQK A;  1Z7R A;  2FCH A;  3SBC A;  1GTI A;  2CZ3 A;  1CQG A;  5DCG A;  5A4U A;  4YH2 A;  1QMV A;  4O32 A;  2IL3 A;  4G01 A;  2FWF A;  2VM2 A;  2PPT A;  1N8J A;  2DJK A;  3FR6 A;  4PXO A;  5D8I A;  1X5E A;  1AUC A;  1R5P A;  2TRC P;  5JWQ B;  3Q6O A;  1EV4 A;  4YAV A;  3APS A;  2E2G A;  1GUL A;  3D22 A;  4D73 B;  13GS A;  4TR1 B;  4CY8 A;  4YKG A;  2NBS A;  2E0Q A;  3GX8 A;  3GFK A;  3HJM A;  3FR9 A;  4BVY B;  1YF0 A;  3WGE A;  4EUY A;  2H76 A;  2FY6 A;  3IDV A;  2GST A;  1Y1U A;  2DSA A;  4QQ7 A;  1GTB A;  2JSZ A;  3A2V A;  3DEX A;  3H4K A;  1EZK A;  4MJA A;  4YAP A;  1XWK A;  3RDW A;  4TXO B;  1JLV A;  1Z3E A;  4AKX B;  3IAS 2;  4KSM A;  1SD9 A;  4ML1 A;  2YJ7 A;  4ML6 A;  1F6M C;  4HUA A;  1THO A;  4L5L A;  2IN3 A;  5LCZ A;  5DAK B;  3HVS A;  4KCA A;  4NXI A;  5JCW A;  3EMX A;  3CMI A;  5DJM A;  4NMU A;  1B4Q A;  4K1F A;  3TOT A;  3IR4 A;  4IQ1 A;  2H19 A;  4TKY A;  5HR0 A;  3EMP A;  2GS3 A;  3L9S A;  1Z5Y E;  3GKM A;  4WXT A;  3UAP A;  5F07 A;  2OA7 A;  2QA1 A;  4HI7 A;  3K8N A;  2X8G A;  3D4M A;  9GSS A;  1ERW A;  4ZL7 A;  3IK7 A;  4D73 A;  5FT3 A;  4L0W A;  4TR1 A;  1SKR B;  2B5E A;  1GTA A;  1N2A A;  2JAC A;  5ENU A;  4CHS A;  4FQU A;  2EFH A;  3F63 A;  5D9T A;  5A4W A;  4ZXG A;  3TKS C;  3DIE A;  2FWH A;  4O5Q A;  4L5O A;  4G9H A;  2GSR A;  2CVB A;  3TCO A;  1JHB A;  2HYX A;  2XPD A;  4LA1 A;  1ERT A;  4MZB A;  5EL8 A;  2C3Q A;  2IIY A;  5IMF A;  4KH7 A;  1T1V A;  4EDZ A;  3CSI A;  3H93 A;  3TRQ A;  4TXO A;  1XVW A;  1M7T A;  1ZZY A;  3C7M A;  3HA9 A;  2VCW A;  2KP1 A;  2GSQ A;  1B48 A;  20GS A;  2LJK A;  1O6J A;  2X8H A;  2F8A A;  5DAK A;  5AN1 A;  1XWA A;  1V98 A;  4GDF A;  1QQ2 A;  2AJQ B;  2YV7 A;  4WR4 A;  5INY A;  1UA5 A;  3N9J A;  4G10 A;  5H5Q A;  3LOR A;  1SU9 A;  2E2M A;  4NHZ A;  1AC1 A;  2LRC A;  2XHF A;  1J0F A;  4WEY A;  4V2L A;  3F8U A;  5ELA A;  4OMV A;  2I81 A;  5HFK A;  1O81 A;  1XCC A;  2FNO A;  5J4V A;  1ML6 A;  4W66 A;  5CRH A;  4GLT A;  1H4O A;  2HRF A;  4I8B A;  2DIY A;  2J9H A;  2MBT A;  4RQX A;  5CP1 A;  1ON4 A;  1OAZ A;  2C8U A;  3D6I A;  1AW9 A;  1EP8 A;  2HZF A;  1PA3 A;  3KMO A;  2LS5 A;  2DJJ A;  3IXR A;  2B6M A;  5IMD A;  1UN2 A;  2KOK A;  2C0D A;  3HVV A;  1QXH A;  4JRR A;  3TKP A;  1F3A A;  4KDX A;  4JR6 A;  3QDN A;  1TXU A;  5A1N B;  4N3Z A;  1DE2 A;  1PRX A;  3NOF A;  2QGV A;  4USS A;  3APO A;  2DC5 A;  1WP0 A;  1NHY A;  3LYK A;  1YF1 A;  1BF5 A;  4K6X A;  3TJF A;  1I5G A;  2YCD A;  2M46 A;  1SL2 B;  4KAE A;  3Q18 A;  2D2Z A;  2O85 A;  1Z6M A;  2YWI A;  2L4C A;  2YWN A;  1TK0 B;  2F51 A;  4QL7 A;  4KDU A;  5KN0 A;  2HRN A;  1SKW B;  4AKG A;  4O7H A;  1WE0 A;  1SL1 B;  3KM6 A;  3VWX A;  4POM A;  2YZH A;  5H5R A;  4G2E A;  4TN8 A;  1UVZ A;  3VFI A;  3HVX A;  3ERW A;  4ZL8 A;  3L78 A;  2HI7 A;  2V2G A;  2ZUP A;  3DXB A;  2MBS A;  2UZ8 A;  2H1L A;  3TJG A;  4YQV A;  4HJM A;  5GAP D;  3GUS A;  2YAN A;  4QL9 A;  1EV9 A;  4GWR A;  2P0G A;  2H1D A;  1O8W A;  2L6C A;  2PUK C;  3QR6 A;  4ZBB A;  1ZCP A;  4TW5 A;  2P5R A;  4E8H A;  3RHB A;  4TXV A;  2FUG 2;  3HZ4 A;  1W89 A;  3C71 A;  2VLU A;  3QCP A;  2MMO A;  2VLV A;  2VOC A;  2X8C A;  1V57 A;  2H0H A;  3KH7 A;  5IIZ A;  4NAX A;  4NWY A;  4PNG A;  5A1N A;  1SVO A;  5IM9 A;  2QKE A;  1M9B A;  4IP6 A;  1YQ1 A;  2YPM A;  5C00 A;  2GSS A;  3CWG A;  1R4W A;  3UMA A;  3A3T A;  1ZYP A;  11GS A;  4AGS A;  4EXJ A;  4JR4 A;  1K0N A;  2Z9S A;  4AKH A;  1URM A;  3C1S A;  3GKX A;  3MYD A;  1MDJ A;  4EL1 A;  2LRT A;  1SYX A;  1K3O A;  3VI7 A;  3LXZ A;  2C80 A;  1MD4 A;  2BMX A;  4TR3 A;  4PX1 A;  4LMW A;  2YWM A;  4MZC A;  1FVJ A;  3GTU B;  4MJE A;  3BCK A;  5DAL B;  3QFA C;  4WKW A;  2C0F A;  1SJZ A;  4TR4 A;  4AJ7 A;  3ZFB A;  1ST9 A;  4I5Q A;  2VCV A;  1K0B A;  2B1K A;  1LJR A;  5J5N A;  2B5Y A;  3DGQ A;  2WS2 A;  5IMZ A;  3Q74 A;  1TJD A;  1NHO A;  2FWE A;  5HR1 A;  4V1A p;  3BJ5 A;  3IPZ A;  2VD1 A;  1YKC A;  3CRU A;  1TRV A;  5ECN B;  2L57 A;  4LL1 B;  3DWV A;  4Z7X A;  3ZML A;  3LQ7 A;  1HNC A;  1GWC A;  4AI6 A;  2AAW A;  2YN1 A;  4N11 A;  2X99 A;  4KE3 A;  1FB0 A;  2X4A A;  1PMT A;  2OE1 A;  4K5S A;  2IME A;  1SK1 A;  2JAD A;  1A8Y A;  3F4R A;  4F0C A;  2H6Z A;  4MJC A;  1V2A A;  4IP1 A;  3KEB A;  2GGT A;  5CRE A;  1OYJ A;  3C1R A;  2EIO A;  3ISO A;  4V1A g;  3ZRD A;  1EWX A;  1VRS D;  2H71 A;  2R3X A;  2LST A;  1XW6 A;  1U6T A;  2FHE A;  3DVX A;  3KCM A;  5IOW A;  4I2T A;  3ZIT A;  2OBI A;  4EC0 A;  2LQQ A;  1M99 A;  2PWJ A;  4XS4 B;  2P5Q A;  4XS6 A;  1TRU A;  1DSB A;  1E2Y A;  3LFL A;  2VUP A;  5DAL A;  3GRX A;  1XPV A;  1U88 A;  4ICY A;  4FYC A;  1TRS A;  2F9S A;  1JZR A;  2H72 A;  1GRX A;  2MMZ A;  2EFD A;  5J9B A;  4RUV A;  1B4P A;  2HSY A;  2H6X A;  2V6O A;  4DVC A;  8GSS A;  3MWH A;  1HD2 A;  5G31 A;  1I9D A;  1YEX A;  1A0R P;  4E8E A;  1PSQ A;  5IO0 A;  2CAI A;  1FG4 A;  4XRA A;  2DLX A;  4IHU A;  3US3 A;  1EOG A;  2VD0 A;  4MF5 A;  2V6K A;  1YDK A;  4EKZ A;  2N5A A;  2ZNM A;  2MYG A;  4GQC A;  3VI5 A;  5J9C A;  3GKN A;  4K2X A;  3RPN A;  3ERG A;  1OC9 A;  4MF7 A;  4IJ3 A;  1PD2 1;  5A34 A;  3KTL A;  2ES7 A;  3MIX A;  4N0Z A;  4KCE A;  1O8X A;  1K0D A;  4KB3 A;  2VIM A;  4BWS A;  1V40 A;  1BED A;  2H1A A;  5HFG A;  3ZYW A;  1SKS B;  3ZVJ D;  2RLI A;  4WR5 A;  1X9M B;  1KBN A;  4F2I A;  3QAG A;  4BVX A;  2IFQ B;  3E3E A;  3UEM A;  1R5A A;  1Y25 A;  4OFN A;  3KP8 A;  1XWB A;  2R37 A;  2L59 A;  3KGK A;  2H0G A;  2O8V B;  1Z7P A;  5ECO B;  4PTS A;  1U3I A;  1MD3 A;  2CX3 A;  1HQO A;  1EP7 A;  4V2M A;  1BJX A;  1N25 A;  2GQM A;  3UJ1 A;  4XS4 A;  2IMF A;  2C0G A;  4FYB A;  3GIX A;  5B8A A;  3LSZ A;  2AYT A;  1VF1 A;  4BL7 A;  4PNF A;  4Z2R A;  3CTF A;  4MPF A;  3TU3 B;  3GUR A;  1G6Y A;  3KJY A;  3IAM 2;  5BRT A;  5IOX A;  3RAZ A;  3ZZX A;  4IS0 A;  7GSS A;  1MDI A;  3KP9 A;  2GLR A;  1SVL A;  4FYU A;  4IKH A;  5DVB A;  3F3Q A;  1Q4J A;  5D9V A;  4JE1 A;  2NDO A;  2BTO T;  2K8S A;  3FZ4 A;  2I9H A;  5EY6 A;  5LD0 A;  2VAF A;  2HZE B;  3LG6 A;  3IC8 A;  3PGT A;  5G5F A;  3QD9 A;  4G0L A;  1YKA A;  3WYW A;  1MTC A;  1OC8 A;  3HDC A;  2KLX A;  3LGC A;  2OKA A;  2YV9 A;  4YQM A;  5J47 A;  1ZYN A;  4HOJ A;  3E9J B;  4K5R A;  3EIN A;  1BAY A;  3VWU A;  1T7P B;  4PQH A;  1A2J A;  2IFQ A;  5IMV A;  4A5P A;  3BBY A;  5J4Y A;  1Q98 A;  4K7I A;  4IQA A;  3UVT A;  2PGT A;  2IWT A;  4HQS A;  4G19 A;  1SVM A;  4BVY A;  1YJ6 A;  2VO4 A;  3DRN A;  1GTU A;  1C72 A;  3H79 A;  5F06 A;  1S3D A;  5D9W A;  3IBH A;  4XCS A;  3RHC A;  1TKD B;  3C73 A;  5F05 A;  4F9Z A;  1PX6 A;  1V9W A;  3OR5 A;  4IGJ A;  1PL1 A;  4MF6 A;  2L6D A;  4ZB9 A;  5HR2 A;  1JZD A;  1VF2 A;  4HS1 A;  3MSZ A;  5JCG A;  2DJ1 A;  2NVL A;  1EGR A;  2EFC A;  5KEJ A;  3FKF A;  2L5L A;  4FO5 A;  4L0U A;  3IOS A;  2A2P A;  4IJI A;  2R6K A;  4OO4 A;  2R5G A;  1XIY A;  5GSS A;  5J4U A;  3IC4 A;  2HZE A;  5CNW A;  3HKR A;  4MAB A;  3BD2 A;  1EOH A;  1O73 A;  2OJL A;  2LJA A;  2MMN A;  4HDE A;  5J3R A;  1OVN A;  3QMX A;  1GLP A;  4Q5Q A;  3PPU A;  1TI3 A;  2PN8 A;  1PQN A;  3TKQ A;  3TKS E;  3M3M A;  4K0G A;  3VPT A;  5JWO B;  4XTS A;  1GSD A;  5DQS A;  4IBP A;  1HNA A;  1WRY A;  3I43 A;  3GL5 A;  4AF2 A;  4WBJ A;  3O3T A;  4MLY A;  4O5U A;  2FWG A;  3KIJ A;  1G7E A;  1ERV A;  1K0A A;  3IA1 A;  2V1M A;  2FA8 A;  2JZS A;  1GL8 A;  1BQ7 A;  4KA0 A;  1X5D A;  3ZRE A;  3SWL A;  1J08 A;  4H86 A;  3O76 A;  1GSQ A;  4WET A;  3HZ8 A;  1XOB A;  1VF3 A;  4ZB8 A;  4ECI A;  2FD3 A;  2DMM A;  2C1Y A;  2CVD A;  1YZX A;  1F37 A;  2B7J A;  4KND A;  2XBQ A;  2JL4 A;  3FRC A;  3TB2 A;  2HSN B;  4TOP A;  3DKS A;  2XPE A;  2GZP A;  3UBL A;  1G7O A;  3HY2 A;  4PQ1 A;  4CY6 A;  1EEJ A;  3PR8 A;  3WT2 A;  4KGI A;  4EE0 A;  2JZT A;  1TU7 A;  1NM3 A;  4NHW A;  3CBU A;  4V2N A;  1M0U A;  3EUR A;  2B7K A;  5A5H B;  3ZL5 A;  5IPG A;  3TUE A;  2CA8 A;  2WDU A;  4ZBD A;  5DBQ A;  1XW5 A;  2O89 A;  2JU5 A;  3L9U A;  5ABR A;  5F0G A;  4PUA A;  5J41 A;  1GUH A;  1AAZ A;  1A23 A;  16GS A;  1AQX A;  3HMJ G;  4GRF A;  2ALB A;  2A2R A;  4RI6 A;  4MH3 A;  1BYE A;  1TK8 B;  2IMK A;  3W8J A;  3A5W A;  4MP4 A;  4N30 A;  2RUE A;  1K0M A;  3KH9 A;  5IMA A;  2CZ2 A;  1A24 A;  3EE2 A;  3UBK A;  4EO3 A;  5DQY A;  2VCQ A;  1GUK A;  1TTZ A;  2H6Y A;  6GSW A;  2HSH A;  1OKD A;  1GNW A;  3GN3 A;  2V41 A;  1SJ6 A;  2R4V A;  1ZL9 A;  3V1W A;  1PN0 A;  1OE8 A;  1TK5 B;  2HSN A;  3U6V A;  3F3R A;  1FHE A;  4HZ4 A;  5ID2 B;  3PH9 A;  1SK0 A;  2CV4 A;  5KN3 A;  3HXS A;  5EVO A;  4J57 E;  4FH8 A;  3M9J A;  2X64 A;  2GDR A;  3DML A;  1XXU A;  3D5J A;  4I6X A;  4LMV A;  1FB6 A;  1W4V A;  1KTE A;  5D93 A;  1PN9 A;  2HT9 A;  3ZTL A;  2HRA A;  4KW6 A;  4CDO A;  2RII A;  2HRK B;  5F8B A;  4ULX A;  5CRD A;  5D96 A;  2BJX A;  1WIK A;  1XBS A;  1WMJ A;  14GS A;  2HE3 A;  4HU9 A;  3LWA A;  2K9F A;  3QAW A;  4O92 A;  1MEK A;  4ZIL A;  5KOX A;  4P3Y B;  3D0Z A;  3H8Q A;  1WJK A;  4OD7 A;  5C04 A;  1TRW A;  4LLR A;  4ECJ A;  1FAA A;  3LJR A;  1T00 A;  3IE3 A;  3F4T A;  4MK3 A;  2PU9 C;  4N10 A;  3F6F A;  3IRA A;  3KXO A;  2K6V A;  5AIS A;  5JWR B;  2WGR A;  1B9Y C;  2L5O A;  2V32 A;  3P7X A;  1ACV A;  4GCI A;  2H70 A;  1ZYE A;  1M2A A;  5D73 A;  4NV2 A;  2G2Q A;  2QSI A;  3VPQ A;  2O87 A;  1ZMA A;  2CQ9 A;  1JFU A;  3M8N A;  2GTU A;  3F6D A;  5ID2 A;  3IHG A;  5ECK B;  3P90 A;  2IMI A;  5ELG A;  2HSM B;  4YKF A;  2QA2 A;  3I69 A;  5B6M A;  2PER A;  3P8W A;  1TXX A;  4J56 E;  4Z2U A;  2DJ2 A;  1F9M A;  1B8X A;  17GS A;  4K9Z A;  3GTU A;  5ECI B;  1V58 A;  4IEL A;  2MZC A;  2H66 A;  3HYP A;  4X43 A;  3AY8 A;  3I9V 2;  2HRK A;  3CXG A;  1X9S B;  1CQH A;  3VUR A;  4OO5 A;  5IPH A;  3GV1 A;  3L0H A;  1A2L A;  2B1L A;  5G1L A;  3BCI A;  1USB A;  2LNT A;  2VLT A;  2H01 A;  2VL9 A;  3A2W A;  2FLS A;  4MDC A;  2LKU A;  2GZZ A;  3ZVJ A;  3G7J A;  2WFC A;  3W8S A;  1OKT A;  3QPM A;  2DKH A;  2L4Q A;  4OCE A;  1TP9 A;  2YZU A;  3FZ5 A;  2YOI A;  2H8L A;  2VL2 C;  3DYR A;  1LBK A;  3BOA A;  2B3S A;  1WPI A;  3IV4 A;  4EVM A;  1VGL A;  4JBB A;  4MJB A;  2GT6 A;  3FK8 A;  4RQR A;  1PKW A;  2LV3 A;  2AHE A;  1JLW A;  5B6N A;  1TW9 A;  2OE0 A;  1KNG A;  3D4T A;  1FVK A;  1MDK A;  4K8M A;  4BPY A;  3ZFL A;  5KN1 A;  3GL3 A;  1O85 A;  2FA4 A;  2ON7 A;  4F82 A;  2HSM A;  2O5V A;  3HJO A;  5DJL A;  2GQL A;  3A5I A;  3EU4 A;  4MPG A;  4BA7 A;  1JZW A;  1ZGN A;  3GA4 A;  1FW1 A;  4TVE A;  3RBT A;  3EC3 A;  1THX A;  3R3E A;  4POL A;  2H75 A;  3GST A;  4GSN A;  2HNL A;  4AJ6 A;  4DSR A;  3EWL A;  3M9K A;  3GH9 A;  4PUF C;  4KUN A;  4N0V A;  2N5F A;  4KSO A;  1DE1 A;  5CAX A;  2AUV A;  3WGD A;  5KN2 A;  2G0F A;  3G7Y A;  4MCU A;  2I4A A;  4X1U A;  3GH6 A;  2AB6 A;  2M72 A;  4TRX A;  3N5O A;  4X0X A;  1QFN A;  4MH2 A;  2F8F A;  3O6T A;  1IYI A;  1AQV A;  2PVQ A;  2OAC A;  1HNB A;  3TKR A;  1U3A A;  2IMD A;  4TR0 A;  3DVW A;  5GST A;  3LW9 A;  2VKZ G;  2YP6 A;  4OWY A;  1GNE A;  3E0U A;  4IN0 A;  5AIX A;  1X5C A;  3TRP A;  5G1K A;  2WJU A;  4K2D A;  2PMT A;  4EF0 A;  1RW1 A;  2H0I A;  2IPA A;  2H1G A;  1F2E A;  4G0I A;  5D9X A;  1GSU A;  4E68 A;  1T4Y A;  2NPB A;  3ZIJ A;  4GTU A;  4EIP A;  1PGT A;  3DD3 A;  2DBC A;  3UOM A;  2HLS A;  5CRW A;  5EPF A;  3S9F A;  5A5K A;  4DSQ A;  3LXT A;  1TU8 A;  1BG5 A;  3J7Y k;  3TJB A;  5CO3 A;  3F9U A;  4L8E A;  4ID0 A;  3QFB C;  3MDK A;  4K0N A;  5ECQ B;  1ZYQ B;  1OE7 A;  1NSW A;  2KHP A;  4GST A;  3EPT A;  4QMK A;  1SD8 A;  2ZCT A;  2R0G A;  3APQ A;  1XOA A;  2VL2 A;  3VK9 A;  3CRT A;  3VWV A;  4IW9 A;  1VF4 A;  4OFM A;  2GVP A;  4XHM A;  5GZZ B;  1ABA A;  2I1U A;  2X49 A;  5G5E A;  3L4N A;  1UC7 A;  3GHA A;  1SK2 A;  2LQO A;  3LEF A;  4GQF A;  2O7K A;  1A0F A;  3F0I A;  1G0T A;  2LEG A;  3QAV A;  5DCH A;  4NV5 A;  2HFD A;  2A4V A;  4GXZ A;  1GSF A;  19GS A;  2OAD A;  4IVF A;  3QOU A;  1PL2 A;  1GP1 A;  1SYR A;  2E7P A;  2HQT A;  5ECS A;  1KEB A;  3GNJ A;  1ILO A;  5LNK e;  1QGV A;  2LRN A;  4PQI A;  1ZOF A;  4I97 A;  5FWG A;  1Z9H A;  5BMU B;  5HR3 A;  12GS A;  1K0O A;  4JED A;  1Y6E A;  4WF5 A;  2VCZ A;  3VLN A;  4POK A;  6GSV A;  3Q19 A;  3IHQ A;  1DBY A;  4XIH A;  3TJK A;  1E6B A;  3UIW A;  5L71 A;  5ECP B;  2TRX A;  3HHV A;  4MNN A;  2B5X A;  2YWO A;  5B7C A;  3ED3 A;  4NPB A;  1IYH A;  1GSE A;  1XVQ A;  1X0R A;  2MMA A;  1YEP A;  2F3M A;  2VL3 A;  2OBK A;  3HCZ A;  3LYP A;  4FIW A;  4ZL9 A;  2DKI A;  2N5B A;  4HZ2 A;  1M2D A;  1TDI A;  2A2S A;  2H74 A;  4Q5F A;  2LUS A;  3J7Y b;  3CYN A;  2K8V A;  2YJH A;  3VWW A;  2H1B A;  4ZB7 A;  3FZ9 A;  2RUF A;  2VM1 A;  5E4W A;  3NZN A;  3PIN A;  3D21 A;  1GSY A;  2A4H A;  4MA9 A;  1HYU A;  2C4J A;  2PVO C;  5E59 A;  5HFI A;  2DJ3 A;  4Z2T A;  3FY7 A;  1TOF A;  6GST A;  1JZO A;  2R0C A;  1QK8 A;  1S3A A;  2H73 A;  1BG1 A;  1XWG A;  1T4Z A;  2DML A;  1U87 A;  2TIR A;  3KZQ A;  3FZA A;  4ECC A;  3ZLP A;  5CYY A;  2VCT A;  4I2U A;  3JCM L;  4HQZ A;  4PUR A;  2HXK A;  1ERU A;  4MMM A;  3UAR A;  1O7U A;  2VCX A;  1PKZ A;  1GUM A;  2M80 A;  3FMW A;  5BMU A;  2WUL A;  3MAK A;  3G9B A;  4BWQ A;  1PX7 A;  5B8B A;  1GLQ A;  4HU7 A;  2CX4 A;  3TKS A;  1RQM A;  6GSU A;  3ERF A;  2DIZ A;  4F03 A;  2KUC A;  3CSJ A;  2P31 A;  6GSX A;  2EIQ A;  3EU3 A;  2XC2 A;  2REM A;  4J2F A;  2K18 A;  3NIV A;  2EIR A;  4ZBA A;  2WCI A;  1SJI A;  4ZB6 A;  5IQY A;  3TRX A;  4EIQ A;  2LNS A;  1YVL A;  3W6G A;  1X9W B;  1OC3 A;  5G30 A;  2PBJ A;  4F0B A;  2C0E A;  4JU5 A;  4GSS A;  2XBI A;  1A8L A;  2YNX A;  3F4S A;  1F3B A;  5FHI A;  18GS A;  1AQW A;  2CAQ A;  1DUG A;  1XW9 A;  2AV4 A;  3FYG A;  1WOU A;  4GF0 A;  2LJR A;  3HD5 A;  3MNG A;  3KTB A;  2C3T A;  2ON5 A;  3GSS A;  4DSS B;  4ZIJ A;  3TGZ A;  1TI1 A;  2UV8 G;  5A5H A;  6GSY A;  5G2Z A;  4K7O A;  4KX4 A;  4DEJ A;  4X4J A;  4JZQ A;  2WZ9 A;  3L9V A;  2R0P A;  1FOV A;  1XFL A;  3TDG A;  4ISD A;  1T3B A;  5JCU A;  4EDY A;  3P2A A;  1M9A A;  1R26 A;  1RK4 A;  4AJ8 A;  4CW9 A;  4ECB A;  10GS A;  3R2Q A;  2RM6 A;  2H30 A;  2QC7 A;  4HJ2 A;  4ACS A;  1S3C A;  1XWC A;  5A4V A;  3M0F A;  2IJY A;  5COH A;  4XS1 A;  2JZR A;  2R2J A;  3GMF A;  1M2B A;  2I3Y A;  1AIU A;  5ECL B;  5ECH B;  5J40 A;  5KOW A;  2EFE A;  3GX0 A;  4YQU A;  1A2M A;  2OE3 A;  3GKK A;  1XZO A;  2OT3 A;  2NTO A;  1Z6N A;  4HEA 2;  1R7H A;  4AKI A;  1FO5 A;  5IO2 A;  4PGT A;  1EEM A;  4WBR D;  3EVI A;  1YY7 A;  2JSY A;  1OC9 B;  3FW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...