1AQWA

Glutathione s-transferase in complex with glutathione
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structures of class pi glutathione S-transferase from human placenta in complex with substrate, transition-state analogue and inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1aqwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aqwA01
2GSTA 5DJMA 3EMXA 1GSDA 1PX7A 4BPYA 4QL7A 1SKWB 4MH3A 1EEJA 2C3QA 3ISOA 2IFQA 1X9SB 5CRGA 4XTSA 3LFLA 5EPFA 2WGRA 4ML6A 2OKAA 2GGTA 1GTIA 4G0IA 2MBTA 2VD0A 3GKMA 1UA5A 5IMVA 2FWGA 3UARA 3Q19A 1A24A 1NHYA 3CSIA 4N10A 5J5NA 1K3OA 2M72A 3LORA 4GWRA 2YCDA 2CVDA 5CYYA 4OO4A 5C00A 2M46A 4YH2A 2DIYA 5ELGA 4BA7A 1QFNA 3KMOA 1SJ6A 2DSAA 4BWQA 1IYHA 4OFTA 3VPQA 4ZBBA 1AQXA 1UC7A 2VIMA 5ECNB 1SENA 3F3QA 2JZSA 5IQYA 5IPHA 1B4QA 3MSZA 5J4UA 4MA9A 1THOA 22GSA 1WWJA 5LCZA 3DD3A 13GSA 4AGSA 5G30A 3O6TA 3OR5A 1UVZA 1EGOA 5IOXA 2UZ8A 1Z5YE 5GAND 4MK3A 5INYA 4PUAA 2CV4A 1V2AA 1M2BA 3H4KA 1FW1A 1LBKA 1BG5A 4TW5A 2J9HA 1FHEA 1K0BA 3LSZA 1GL8A 3M9JA 5ECMB 3E0UA 2H0HA 3IOSA 5ECPB 3DVWA 3FR6A 4DSRA 4IN0A 1GTAA 2DJ2A 5B8AA 3BCIA 5IO0A 2OE3A 2NBSA 4HUAA 5E4WA 1QXHA 4KE3A 1GWCA 5D93A 2GQLA 1Z9HA 2H73A 1N8JA 3D21A 3DVXA 4TXVA 2E2MA 2ZUPA 2J23A 2REMA 1MEKA 1WOUA 2ZNMA 2CAIA 3FK8A 1O7UA 2DJ3A 2HQTA 1BEDA 4K7NA 2Z9SA 3ERWA 3GURA 1XW5A 4IJIA 4JR6A 2HNLA 2PN8A 1EWXA 3IAM2 2YZUA 3ZVJA 4P3YB 2YOIA 2B3SA 4KDUA 3M3MA 2VO4A 3D5JA 2L6CA 2L6DA 5CO3A 5CNWA 3GRXA 2B1LA 4OWYA 4WBJA 2JACA 2DBCA 1U87A 3FW2A 1SL0B 2IFQB 3KP8A 2AHEA 3F6FA 2RUEA 1BYEA 4OFMA 4PX1A 1EP8A 4OMVA 4EL1A 5IPGA 2VCVA 3IR4A 2GZYA 1Y25A 1R4WA 2WCIA 2B5XA 4IHUA 4WKWA 1TW9A 1T7PB 1ZZYA 4MDCA 2YV7A 3TKSA 3HJMA 1SYRA 1A23A 2NVLA 4RI6A 2WDUA 1FOVA 2CA8A 4F9ZA 5G1LA 1OC8A 2WB9A 3VI5A 2I1UA 1MDIA 3P90A 2VL3A 4CDOA 1XOBA 1T00A 2F51A 3ERFA 2L4QA 2V41A 5DCGA 4FYCA 5DCHA 1JLVA 5ECHB 2FWEA 1F3AA 2XBIA 9GSSA 3VWVA 3TRXA 1GTBA 3O76A 4MZCA 1KTEA 4V2LA 3IC8A 1RQMA 5ABRA 4N30A 4XRDA 2PWJA 1Z3EA 4ZILA 4MP4A 1XIYA 3GN3A 3FZ9A 1GUKA 4TVEA 5KEJA 4K7OA 1BJXA 4MF7A 1A8LA 6GSTA 3FZAA 1W4VA 2FHEA 1OKTA 4IBPA 3D4MA 3HYPA 1GNWA 2F8FA 3FHKA 1XVQA 3M8NA 3DGQA 5ECRB 5EL8A 1B9XC 4J56E 4EUYA 1Q4JA 4LMVA 4O92A 1PN9A 2HI7A 2AV4A 2HFDA 2YWMA 4K0GA 1O81A 1HNBA 1YF0A 1YQ1A 2R6KA 2LNSA 3EYTA 2MMZA 2HE3A 3ZREA 3KP9A 2OJLA 3IPZA 1K3YA 4G10A 5IO2A 2O85A 4EXJA 5J3RA 2KOKA 4N11A 3ED3A 2H1GA 5F8BA 4TRXA 2MZCA 6GSSA 1OYJA 2IIYA 4Z7XA 1NM3A 4POBA 3L78A 2YNXA 7GSSA 2XC2A 2FCHA 2K9FA 3S9FA 3TJGA 4DEJA 3EU4A 2ON7A 2VCQA 1B4PA 6GSVA 2CX3A 3DYRA 5F07A 4JEDA 3H93A 1EEMA 1BX9A 2PU9C 5JCUA 4ML1A 3FY7A 2HZEB 1KNGA 3C1SA 2JZRA 2YN1A 4POMA 5IIZA 3A2XA 5B6NA 1GSEA 3TKPA 1BAYA 4PGTA 3A2WA 3M1GA 3QOUA 1U3IA 2HRKA 1QUWA 2I4AA 4ISDA 1PMTA 3UBKA 3FZ4A 5IMZA 2H19A 4GLTA 1LJRA 2FWFA 4Q5QA 5JCGA 1IYIA 3GMFA 4KCAA 3NOFA 1OE7A 4GTUA 6GSUA 2K18A 4TOPA 3I9V2 5IMAA 3M0FA 3WT2A 1FO5A 2A2RA 2TRXA 1TKDB 2DJ0A 4WR5A 2HYXA 3UBLA 3KM6A 4RQXA 1EV4A 10GSA 3DMLA 1FB6A 1KEBA 2TIRA 4I6XA 3EVIA 14GSA 2AB6A 2FA4A 5AIVA 3UAPA 1TJDA 1ERWA 2DJ1A 3ZLPA 3PR8A 5FHIA 3CMIA 1A2JA 1CQHA 4X43A 2ON5A 4RI7A 3PH9A 3RAZA 2L5OA 4IQAA 2LKUA 2DIZA 3IK9A 4KDXA 3UVHA 4BVYA 4ZL9A 3I43A 5FT3A 2OACA 1S3AA 3L9UA 3HVSA 4H86A 1V9WA 2LQOA 5D9TA 3I6AA 2N5BA 1N2AA 5B8BA 1AC1A 1MD3A 5G31A 2H66A 3TCOA 1O73A 2H8LA 4IJ3A 3ZZXA 1F9MA 3IDVA 4XCSA 3RPPA 3U6VA 3HVXA 3KH9A 2FD3A 4YAPA 3NZNA 1R7HA 1VF2A 1XCCA 2JL4A 1TRUA 2LUSA 3K8NA 3F8UA 4KUNA 4OCFA 5BMUA 4KSMA 5H5RA 3IBHA 3FRCA 4EC0A 4GXZA 5HR0A 2AJQB 4RUVA 3GHAA 3FEUA 5ECSA 3EWLA 4G9HA 3IV4A 4XIHA 5CRWA 3ZYWA 2EIOA 1XOAA 4PNGA 1TTZA 1ERTA 2IWTA 1ZOFA 20GSA 3CRUA 3G7JA 2R2JA 2VL2A 4IP6A 5D8IA 4G2EA 5A4UA 2N5AA 2FA8A 4WBRD 5CRDA 4K1FA 4DSQA 4EDZA 1QQ2A 3WGXA 1B8XA 5LD0A 1R5PA 2VCXA 2L59A 2H72A 2KUCA 3HXSA 18GSA 2XPDA 4ZL8A 2GSSA 3CSHA 2JZTA 2HRKB 2VCTA 4KB3A 2LQQA 2BJXA 2LEGA 1RW1A 3KH7A 1WPIA 4LL1B 2PBJA 1M99A 3GUSA 2B6MA 2VLTA 4K9ZA 3L0HA 4BL7A 3QFBC 4IP1A 5H5QA 3HJOA 2C3TA 4V2NA 4ZL7A 4MLYA 5IMDA 1SJIA 3EC3A 2K6VA 1F6MC 4K7IA 4PQHA 1JFUA 4NHZA 2IMIA 5AISA 1Z7RA 1XWCA 2X8CA 1DBYA 3APSA 2DMLA 3ZTLA 4N0ZA 4KSOA 2RM6A 4N0VA 5KN3A 5ECLB 3LQ7A 3CRTA 1HNCA 1JLWA 3KGKA 4K6XA 4USSA 4ZBAA 5A5KA 1YKCA 4CW9A 2WJUA 2H6XA 4TR3A 3ZMKA 2GS3A 4FIWA 4PQIA 5DALA 2KLXA 2CT6A 2LJAA 3GH6A 3Q74A 1K0MA 4I2UA 2CVBA 2JU5A 3RHCA 2JSYA 1OVNA 3HA9A 1AAZA 5J9CA 4MH2A 1S3CA 3IRAA 3O3TA 3DKSA 1WE0A 2FGXA 1YKAA 1TRWA 3C71A 4TR1B 4JZQA 4TKYA 2F3MA 3KD0A 4GSTA 4IS0A 3HY2A 4HQZA 3IHQA 2WFCA 2X99A 3GX0A 1M9BA 2F8AA 2FUG2 4I8BA 4J2FA 3ZMLA 2DJKA 3GSSA 1WJKA 3GSTA 2GVPA 2HSNB 2QSIA 3N5OA 2YV9A 4TR0A 4WF4A 3AY8A 4PURA 1YEXA 2HRFA 1J08A 4D73A 4IGJA 5FWGA 4XS1A 3KXOA 2GTUA 2I9HA 3KCMA 2HSHA 2CZ3A 1ACVA 4GRFA 4NMUA 1DE1A 4BVXA 3MWHA 2YANA 2G2QA 4XHMA 2IN3A 5G5EA 3GX8A 3W8SA 1VF4A 2ALBA 1XWBA 1USBA 3QR6A 3G9BA 1M7TA 2A2SA 2H6ZA 3RDWA 1TI1A 2CX4A 2VCZA 2O7KA 11GSA 1NSWA 1V98A 4BWSA 1R26A 2IMEA 2C0GA 4MF6A 1XWGA 3F9UA 2R5GA 3G7IA 1E6BA 2X64A 2KHPA 1GSYA 2V6OA 4OCEA 3J7Yb 4FYBA 5F05A 4O32A 3PPUA 4RQRA 4BL7B 5AN1A 1X0RA 5HQPA 3ERGA 4YQVA 2P5RA 2GQMA 3VPTA 4Q5FA 3A2VA 3TUEA 2FWHA 4NXIA 2H1BA 16GSA 3UMAA 2H01A 2L4CA 1PX6A 4G19A 3APOA 5KN1A 3VWUA 1TRSA 4EO3A 3VURA 3H1NA 3RBTA 1B9YC 3GH9A 2B1KA 4ECIA 2OE1A 3GA4A 2VM1A 2PPTA 4OO5A 2NDOA 1O8XA 3ZITA 2YWOA 3KTLA 4XRAA 4DVCA 1I9DA 2RLIA 4ZXGA 5L71A 2GDRA 1Z6MA 2HRNA 4KX4A 4HZ2A 4KA0A 2BTOT 5DALB 4AF2A 3IE3A 3KEBA 2WRTA 4JU5A 2V32A 3CBUA 4EDYA 3D6IA 2C8UA 4TXOA 1GSUA 2H76A 2AYTA 2DMMA 2MBSA 4YQUA 3D22A 3EU3A 2HLSA 5CRHA 3TDGA 2NTOA 3DWVA 2MMAA 2R37A 5ID2A 2H6YA 3TJKA 3LJRA 2O89A 3QMXA 2IMDA 4OD7A 3GTUA 1OAZA 1T1VA 4NHWA 2VAFA 2TRCP 3D4TA 1EGRA 2B7JA 1U88A 2XHFA 3EURA 2MMOA 4K8MA 19GSA 4NWYA 3A3TA 3ZFLA 2QC7A 2B5EA 1EOHA 1MTCA 4HZ4A 1Z7PA 2NPBA 3D0ZA 3TB2A 5AGYA 3HHVA 5LNKe 5IOWA 1TOFA 4JE1A 3ZRDA 1A0FA 4GCIA 1DE2A 4PXOA 3QD9A 1T4ZA 5ENUA 2WZ9A 1K0OA 2LRCA 1A8YA 3VI7A 1RK4A 3F63A 3GIXA 1ML6A 4E8HA 3BJ5A 3LYPA 4AJ8A 1PD21 5JWOB 2L5LA 3H79A 4WETA 2HSYA 3QAVA 3C8EA 5A4VA 3FR3A 4MJCA 2PGTA 1M2AA 5D9VA 4FQUA 3KIJA 1F37A 2G0FA 4HU9A 1FAAA 5IM9A 4IVFA 1XW6A 1ILOA 5D9WA 4MJBA 5ECOB 2P31A 4NAXA 1GH2A 2QGVA 4LA1A 2HT9A 2H0IA 1YF1A 2XBQA 1G7OA 4HJMA 3CXGA 4KW6A 1ZL9A 3FYGA 2C0FA 4MPGA 5DJLA 4AJ7A 3FR9A 3CYNA 3IK7A 4KCEA 2LJKA 4I5QA 1LU4A 3DEXA 4KH7A 2GT6A 4L5OA 1FVKA 1U6TA 4L8EA 3KMNA 2D2ZA 3HZ8A 1W89A 4LLRA 1G7EA 1NHOA 3WGEA 4ECBA 3QFAC 2O87A 1TXXA 3BCKA 5G5FA 4V1Ap 4IQ1A 2X8GA 4CHSA 3UVTA 4ILFA 6GSWA 2JADA 1T8EB 2DC5A 1V57A 1G6YA 4TXOB 3LYKA 3US3A 3KJYA 3ZL5A 5J9BA 2LTKA 1M2DA 1AQWA 4F0CA 3C7MA 2C4JA 3WD6A 1J9BA 1K3LA 4L0WA 1PA3A 5ID2B 1QK8A 1R5AA 4KNDA 1EZKA 2GT5A 3GKNA 1VF3A 4X0XA 3GL5A 3VK9A 5CREA 3GTUB 3TOTA 1ZMAA 4HQSA 5J41A 3MAKA 5ECKB 3TRPA 2PMTA 1EP7A 2M80A 3A5WA 3W6GA 3P2AA 3WT1A 4HS1A 3GKKA 3WYWA 4FH8A 1A2LA 5HFGA 2C0DA 3HD5A 2V2GA 1ABAA 1XPVA 5CP1A 1I5GA 2OA7A 1SL1B 3GL3A 2O8VB 3F4TA 5GAPD 2ZCTA 4FYUA 2I81A 4EE0A 2MMNA 4MCUA 2RIIA 1ZCPA 3L9SA 4WEYA 4ID0A 1G6WA 1YY7A 3N9JA 1OKDA 1GUMA 1O85A 2GZPA 3IXRA 1S3DA 1WMJA 2H1AA 4TN8A 2GLRA 1H75A 1PKWA 1GULA 5ECQB 5A4WA 3GNJA 2VLUA 2AAWA 5DQYA 2A4VA 5IMFA 5COHA 2H70A 1DSBA 1VGLA 2X8HA 2GSRA 1SKSB 3KTBA 3APQA 4MJAA 2YWIA 2KP1A 3GYKA 3V1WA 1TK0B 3SWLA 1ZYEA 5HFKA 1TP9A 1F3BA 5DDLA 1SKRB 1KBNA 1OC3A 1XWAA 2OBKA 5D96A 4O5RA 4ZB9A 1Q98A 3HDCA 3C73A 2YJHA 1YDKA 2FNOA 1HYUA 1QGVA 1XVWA 5B7CA 1V58A 2VL9A 4GF0A 4E8EA 1JZWA 1PGTA 1PSQA 5JWQB 5C04A 3TJFA 1EV9A 3R3EA 1AW9A 2H1DA 4PTSA 2FY6A 2CZ2A 3EE2A 4PQ1A 1SD8A 4ECCA 1OE8A 3QAGA 3TJJA 2H74A 1TI3A 2VUPA 1DUGA 2R3XA 4GSSA 1TK5B 1MD4A 4BVYB 3E3EA 4GQFA 1THXA 4NV5A 3IAS2 5JWRB 5HFIA 1GTUA 3ZIJA 4MABA 4HOJA 3I69A 3IA1A 3UEMA 1SK2A 2LRTA 2OADA 1TDIA 2IPAA 3HZ4A 4ZBDA 2HSMA 3F4SA 3SBCA 1TK8B 5DQSA 4KAEA 3F3RA 1M9AA 4IW9A 1YJ6A 5ECIB 1TU8A 2LRNA 3EINA 2RM5A 4KF9A 3VWWA 4TR4A 1H4OA 1T3BA 2VOCA 5GZZB 1TRVA 3BOAA 4IKHA 1ON4A 4GSNA 1XW9A 1U3AA 5HR1A 1K0AA 2LSTA 5DBQA 5KN2A 3HKRA 1V40A 1ST9A 3TJBA 1GNEA 2GQKA 3TGZA 3UJ1A 1B48A 2F9SA 3TOUA 4Q5NA 1A0RP 1PRXA 2CQ9A 3ME8A 1GSSA 4MZBA 4HEA2 1HD2A 3FZ5A 2MYGA 2H0GA 2YJ7A 1XWKA 4JR4A 2PUKC 4ECJA 3LXZA 12GSA 4ACSA 2VD1A 4LMWA 2VL2C 2CVKA 3IC4A 2HZEA 4WF5A 1E2YA 2YZHA 3QDNA 3G7YA 2C3NA 5D73A 2I3YA 4XS6A 3P7XA 1ZGNA 3R2QA 3CTGA 1XFLA 4MMMA 4POKA 1PKZA 1AUCA 3UOMA 2PVQA 3M9KA 2YP6A 3GV1A 4G0LA 6GSYA 2EIQA 2WULA 4HU7A 2LS5A 4X1UA 3PGTA 1AXDA 1G0TA 4EKZA 4KDYA 2P0GA 5H5SA 5EVOA 3C1RA 4DSSA 5F06A 2YWNA 4XS4A 3KZQA 1ERVA 3NIVA 3U5RE 3LG6A 2YPMA 5F0GA 2C80A 4G0KA 1ERUA 4F0BA 1FB0A 1X9WB 2HZFA 2BMXA 3ZFBA 1MDJA 4K0NA 1O8WA 2GZZA 2EIRA 1J0FA 4MZWA 1SU9A 2EC4A 1WRYA 17GSA 3FKFA 3GKXA 1F2EA 4ZIJA 3WGDA 3RPNA 1WIKA 1K0DA 2K8SA 1GLQA 3DXBA 3HVVA 4J57E 3F0IA 2HSMB 5DAKA 1O6JA 2B7KA 4EF0A 2LNTA 1XZOA 2R4VA 3L4NA 1Y6EA 3PINA 3MDKA 2PERA 3BBYA 1AQVA 1K0CA 3J7Yk 1NW2A 3L9VA 2DJJA 3F4RA 1ZYQB 4WR4A 5EY6A 1OC9A 4HI7A 2DLXA 1URMA 5JCWA 4WXTA 2LJRA 3UIWA 3TKQA 4D73B 1GUHA 5DVBA 3GFKA 4PUFC 1SL2B 1HQOA 1GP1A 2OBIA 4F2IA 3P8WA 4BVXB 3DIEA 2N5FA 3DRNA 1CQGA 4L0UA 2P5QA 3Q6OA 1EOGA 2V6KA 4GQCA 2E0QA 1X9MB 1PL1A 1YZXA 3MNGA 1SK1A 4YQMA 1X5EA 3TKSE 1VRSD 3VLNA 2IMFA 2PVOC 4MJEA 1SK0A 3UL3A 5D9XA 1UN2A 2QKEA 2H75A 4V2MA 5GSTA 1T4YA 4LL4B 5GSSA 1A2MA 2VLVA 3LEFA 3LGCA 3CTFA 4HDEA 4ZB8A 4IELA 4KGIA 4PNFA 2CAQA 2OE0A 3EMPA 1SD9A 2E7PA 1SJZA 1JZOA 4POLA 2HRAA 3F6DA 4F82A 1QMVA 4QQ7A 2K8VA 4OFNA 5G2ZA 2JSZA 3TKSC 3ME7A 2C1YA 5HR3A 5IMCA 2IMKA 3ZVJD 1TU7A 4JRRA 1JZDA 3TKRA 2RUFA 1VF1A 4V1Ag 4DSSB 1XXUA 1YEPA 4F03A 2KP2A 2VM2A 3HJPA 4XS4B 3ZIVA 2H71A 1GSQA 3HCZA 1X5DA 3CSJA 6GSXA 4QL9A 3VFIA 8GSSA 2L57A 2E2GA 1K0NA 1JHBA 3W8JA 1PQNA 1XBSA 1GRXA 5KN0A 4I2TA 3LWAA 4NV2A 4MF5A 1GSFA 3TRQA 2XPEA 2B5YA 2IJYA 3H8QA 5E59A 2V1MA 5DAKB 4YAVA 3QAWA 1X5CA 4NPBA 4FO5A 1WP0A 1GLPA 1SYXA 5B6MA 3Q18A 5ELAA 3BD2A 4AJ6A 4TR1A 1C72A 1OC9B 2LV3A 1FG4A 2FLSA 1JZRA 4MPFA 1M0UA 4ULXA 4L5LA 4K2DA 1Z6NA 3E9JB 1PL2A 2WS2A 3LXTA 4O7HA 4I97A 2IL3A 3RHBA 4Q5RA 2VCWA 1HNAA 1MDKA 2H30A 3QCPA 5AIXA 3JCML 2ES7A 2AUVA 2HXKA 4HJ2A 5G1KA 4ZB6A 2GSQA 1AIUA 1BQ7A 5CAXA 3VWXA 4JBBA 4EVMA 2C0EA 5HR2A 3QPMA 1FVJA
chains in the Genus database with same CATH superfamily
2GSTA 5DJMA 3EMXA 1GSDA 1PX7A 4BPYA 4QL7A 1SKWB 4MH3A 5A34B 1EEJA 2C3QA 3ISOA 5J4YA 2IFQA 1X9SB 5CRGA 4XTSA 3LFLA 5EPFA 2WGRA 4ML6A 2OKAA 2GGTA 1GTIA 4G0IA 2MBTA 2VD0A 3GKMA 2X4AA 1UA5A 5IMVA 2FWGA 3UARA 3Q19A 1A24A 1NHYA 3CSIA 4N10A 5J5NA 1K3OA 1N25A 2M72A 3LORA 4GWRA 2YCDA 5BRTA 2CVDA 5CYYA 4OO4A 5C00A 2M46A 4YH2A 2DIYA 5ELGA 4BA7A 1QFNA 3KMOA 1SJ6A 2DSAA 4BWQA 1IYHA 4OFTA 3VPQA 4ZBBA 1AQXA 1UC7A 2VIMA 5ECNB 5J40A 1SENA 3F3QA 2JZSA 5IQYA 5IPHA 1B4QA 3MSZA 5J4UA 2DKHA 4MA9A 1THOA 22GSA 1WWJA 5LCZA 3DD3A 13GSA 4AGSA 5G30A 3O6TA 3OR5A 1UVZA 4G01A 1EGOA 5IOXA 1I1IP 2UZ8A 1Z5YE 5GAND 4MK3A 5INYA 4PUAA 2CV4A 1V2AA 1M2BA 3H4KA 1FW1A 1LBKA 1BG5A 4TW5A 2J9HA 1FHEA 1K0BA 3LSZA 1M3JA 1GL8A 3M9JA 5ECMB 3E0UA 2H0HA 3IOSA 5ECPB 5J47A 3DVWA 3FR6A 2A4HA 4IN0A 4DSRA 1GTAA 2DJ2A 5B8AA 3BCIA 5IO0A 2OE3A 2NBSA 4HUAA 4O5UA 5E4WA 1QXHA 4KE3A 1GWCA 5D93A 2GQLA 2WZSA 1YEWC 1Z9HA 2H73A 1N8JA 3D21A 3DVXA 4TXVA 2E2MA 2ZUPA 2J23A 2REMA 1MEKA 1WOUA 2ZNMA 2CAIA 3FK8A 1O7UA 2DJ3A 2HQTA 1BEDA 4K7NA 2Z9SA 3ERWA 3GURA 1XW5A 4IJIA 4JR6A 2HNLA 2PN8A 1EWXA 3IAM2 2YZUA 3ZVJA 4P3YB 2YOIA 2B3SA 4KDUA 3M3MA 4AKIA 2VO4A 2EFEA 3D5JA 2L6CA 2L6DA 5CO3A 5CNWA 2O5VA 3GRXA 2B1LA 4OWYA 4WBJA 2JACA 2DBCA 1U87A 3FW2A 1SL0B 2IFQB 3KP8A 2AHEA 3F6FA 2RUEA 1BYEA 4OFMA 4PX1A 1EP8A 4OMVA 4EL1A 5IPGA 4HSCX 2VCVA 3IR4A 2GZYA 1Y25A 1R4WA 2WCIA 2B5XA 4IHUA 4WKWA 1TW9A 4O5QA 1T7PB 1ZZYA 4MDCA 3HVNA 4E68A 2YV7A 3TKSA 3HJMA 1SYRA 1A23A 2NVLA 3MYDA 4RI6A 2WDUA 1FOVA 2CA8A 4F9ZA 5G1LA 1OC8A 4YKGA 2WB9A 3VI5A 2I1UA 1MDIA 3P90A 2VL3A 4CDOA 1XOBA 1T00A 2F51A 3ERFA 2L4QA 2V41A 5DCGA 4FYCA 5DCHA 1JLVA 5ECHB 2FWEA 1F3AA 2XBIA 9GSSA 3VWVA 3TRXA 1GTBA 3O76A 4MZCA 1KTEA 4V2LA 3IC8A 1RQMA 5ABRA 1PFOA 4N30A 4XRDA 2PWJA 1Z3EA 4ZILA 4MP4A 1XIYA 3GN3A 3FZ9A 1GUKA 4TVEA 5KEJA 4K7OA 1BJXA 4Z2RA 4MF7A 1A8LA 4GDFA 6GSTA 3FZAA 1W4VA 2FHEA 1OKTA 4IBPA 3D4MA 3HYPA 1GNWA 2F8FA 3FHKA 1XVQA 3M8NA 3CQFA 3DGQA 5ECRB 5EL8A 1B9XC 4J56E 4EUYA 1Q4JA 4LMVA 4O92A 1PN9A 2HI7A 2AV4A 2HFDA 2YWMA 4K0GA 1O81A 1HNBA 1FOHA 1YF0A 1YQ1A 2R6KA 2LNSA 3EYTA 2MMZA 2HE3A 2O3EA 3ZREA 3KP9A 2OJLA 3IPZA 1K3YA 4G10A 5IO2A 2O85A 4EXJA 5J3RA 2KOKA 4N11A 3ED3A 2H1GA 5F8BA 4TRXA 2MZCA 6GSSA 1OYJA 2IIYA 4Z7XA 1NM3A 4POBA 3L78A 2YNXA 7GSSA 2XC2A 2FCHA 2K9FA 3S9FA 3TJGA 4DEJA 3EU4A 2ON7A 2VCQA 1B4PA 2A2PA 6GSVA 2CX3A 3DYRA 5F07A 4JEDA 3H93A 1EEMA 1BX9A 2PU9C 5JCUA 4ML1A 3FY7A 2HZEB 2X49A 1KNGA 3C1SA 2JZRA 2YN1A 4POMA 5J4VA 5IIZA 3A2XA 5B6NA 1GSEA 3TKPA 1BAYA 4PGTA 3A2WA 3M1GA 1U3IA 3QOUA 2HRKA 1QUWA 2I4AA 4ISDA 1PMTA 3UBKA 3FZ4A 5IMZA 2H19A 4GLTA 1LJRA 2WW2A 2FWFA 4Q5QA 5JCGA 1IYIA 3GMFA 4KCAA 3NOFA 1OE7A 4GTUA 6GSUA 2K18A 4TOPA 3I9V2 5IMAA 3M0FA 3WT2A 1FO5A 2A2RA 2TRXA 1TKDB 2DJ0A 4WR5A 2HYXA 3UBLA 3KM6A 4RQXA 1EV4A 10GSA 3DMLA 1FB6A 1KEBA 2TIRA 4I6XA 3EVIA 14GSA 2AB6A 2FA4A 5AIVA 3UAPA 1TJDA 1ERWA 2DJ1A 3ZLPA 3PR8A 5FHIA 3CMIA 1A2JA 1CQHA 4X43A 2ON5A 2OT3A 4RI7A 3PH9A 3RAZA 2L5OA 4IQAA 2LKUA 2DIZA 3IK9A 4KDXA 3UVHA 4BVYA 4ZL9A 3I43A 5FT3A 2OACA 1S3AA 3L9UA 3HVSA 4H86A 1V9WA 2LQOA 5D9TA 3I6AA 2N5BA 1N2AA 5B8BA 1AC1A 1MD3A 5G31A 2H66A 3TCOA 1O73A 2H8LA 4IJ3A 3ZZXA 1F9MA 3IDVA 4XCSA 3RPPA 3U6VA 3HVXA 3KH9A 2FD3A 4YAPA 3NZNA 1R7HA 1VF2A 1XCCA 2JL4A 1TRUA 2LUSA 3K8NA 3F8UA 4KUNA 4OCFA 5BMUA 4KSMA 5H5RA 3IBHA 3FRCA 5KOXA 4EC0A 4GXZA 5HR0A 2AJQB 4RUVA 3GHAA 3RFRC 3FEUA 5ECSA 3EWLA 4G9HA 3IV4A 4XIHA 5CRWA 3ZYWA 2EIOA 1XOAA 3HMJG 4PNGA 1TTZA 1ERTA 4YKFA 2IWTA 1ZOFA 20GSA 3CRUA 3G7JA 2R2JA 2VL2A 4IP6A 5D8IA 4G2EA 5A4UA 2N5AA 2FA8A 4WBRD 5CRDA 2WW0A 4K1FA 4DSQA 4EDZA 4K5RA 1QQ2A 3WGXA 1B8XA 5LD0A 1R5PA 2VCXA 2L59A 2H72A 2KUCA 3HXSA 18GSA 2XPDA 4ZL8A 2GSSA 3CSHA 2JZTA 2HRKB 2VCTA 3TU3B 4KB3A 2LQQA 2BJXA 2LEGA 1RW1A 3KH7A 1WPIA 4LL1B 2PBJA 1M99A 3GUSA 2B6MA 2VLTA 4K9ZA 3L0HA 4BL7A 3QFBC 4IP1A 5H5QA 3HJOA 2C3TA 4V2NA 4ZL7A 4MLYA 5IMDA 1SJIA 3EC3A 2K6VA 1F6MC 4K7IA 4PQHA 1JFUA 4NHZA 2IMIA 5AISA 1Z7RA 1XWCA 2X8CA 1DBYA 3APSA 2DMLA 3ZTLA 4N0ZA 4KSOA 2RM6A 4N0VA 5KN3A 5ECLB 3LQ7A 3CRTA 1HNCA 4AI6A 1JLWA 3KGKA 4K6XA 4USSA 4ZBAA 5A5KA 2QA2A 1YKCA 4CW9A 2WJUA 2H6XA 4TR3A 3ZMKA 2GS3A 2H1LA 4FIWA 4PI0C 4PQIA 5DALA 2KLXA 2CT6A 1BG1A 2LJAA 3GH6A 3Q74A 5A1NB 1K0MA 4I2UA 2CVBA 2JU5A 3RHCA 2JSYA 1OVNA 3HA9A 1AAZA 5J9CA 4MH2A 1S3CA 3IRAA 3O3TA 3DKSA 1WE0A 2FGXA 1YKAA 4MNNA 1TRWA 3C71A 4TR1B 4JZQA 4TKYA 2F3MA 3KD0A 4GSTA 4IS0A 3HY2A 4HQZA 2WVXB 3IHQA 2WFCA 2X99A 3GX0A 1M9BA 2F8AA 2FUG2 4I8BA 4J2FA 3ZMLA 2DJKA 3GSSA 1WJKA 3GSTA 2GVPA 2HSNB 5BMUB 2QSIA 3N5OA 2YV9A 4TR0A 4WF4A 3AY8A 4PURA 1YEXA 2HRFA 1J08A 4D73A 4IGJA 5FWGA 4XS1A 3KXOA 2GTUA 2I9HA 3KCMA 2HSHA 2CZ3A 1ACVA 4GRFA 4NMUA 1DE1A 4BVXA 3MWHA 2YANA 2G2QA 4XHMA 2UV8G 2IN3A 5G5EA 3GX8A 3W8SA 1VF4A 2ALBA 4AKHA 1XWBA 1USBA 3QR6A 3G9BA 1M7TA 2A2SA 2H6ZA 3RDWA 1TI1A 2CX4A 2VCZA 2O7KA 11GSA 1NSWA 1V98A 4BWSA 1R26A 2IMEA 2C0GA 4MF6A 1XWGA 3F9UA 2R5GA 3G7IA 1E6BA 2X64A 2KHPA 1GSYA 2V6OA 4OCEA 3J7Yb 4FYBA 4EIPA 5F05A 4O32A 3PPUA 4RQRA 4BL7B 5AN1A 1X0RA 5HQPA 3ERGA 4YQVA 4FXYP 2GQMA 2P5RA 3VPTA 4Q5FA 3RGBC 3A2VA 3TUEA 2FWHA 4NXIA 2H1BA 16GSA 3UMAA 2H01A 2L4CA 1PX6A 4G19A 3APOA 5KN1A 3VWUA 1TRSA 4EO3A 4CY6A 3VURA 3H1NA 3RBTA 1B9YC 3GH9A 2B1KA 1S3RA 4ECIA 2OE1A 3GA4A 2R0PA 2VM1A 2PPTA 4OO5A 2NDOA 1O8XA 3ZITA 2YWOA 3KTLA 1SVOA 4XRAA 4DVCA 1I9DA 2RLIA 4ZXGA 5L71A 2GDRA 1Z6MA 2HRNA 4KX4A 4HZ2A 4KA0A 4BIKA 2BTOT 5DALB 4AF2A 3IE3A 3KEBA 2WRTA 4JU5A 2V32A 3CBUA 4EDYA 3D6IA 2C8UA 4TXOA 1GSUA 2H76A 2AYTA 2DMMA 2MBSA 4YQUA 3D22A 3EU3A 2HLSA 5CRHA 3TDGA 2NTOA 3DWVA 2MMAA 2R37A 5ID2A 2H6YA 3TJKA 3LJRA 5KOWA 2O89A 3QMXA 2IMDA 4OD7A 3GTUA 1OAZA 1T1VA 4NHWA 2VAFA 3EPTA 2TRCP 3D4TA 1EGRA 2B7JA 1U88A 2XHFA 3EURA 2MMOA 4K8MA 19GSA 4NWYA 3A3TA 3ZFLA 2QC7A 2B5EA 1EOHA 1MTCA 4HZ4A 1Z7PA 2NPBA 3D0ZA 3TB2A 5AGYA 3HHVA 5LNKe 5IOWA 1TOFA 4JE1A 3ZRDA 1A0FA 4GCIA 1DE2A 4PXOA 3QD9A 1T4ZA 5ENUA 2WZ9A 1K0OA 2LRCA 1A8YA 3VI7A 1RK4A 3F63A 3GIXA 1ML6A 4E8HA 4PHZC 3BJ5A 3LYPA 4AJ8A 1PD21 5JWOB 2L5LA 3H79A 4WETA 2HSYA 3QAVA 3C8EA 5A4VA 3FR3A 4MJCA 2PGTA 5A34A 1M2AA 5D9VA 4FQUA 3KIJA 1F37A 2G0FA 4HU9A 1FAAA 5IM9A 4IVFA 1XW6A 1ILOA 5D9WA 4MJBA 5ECOB 2P31A 4NAXA 1GH2A 2QGVA 4LA1A 2HT9A 1S4BP 2H0IA 1YF1A 2XBQA 1G7OA 4HJMA 3CXGA 4KW6A 1ZYNA 1ZL9A 3FYGA 2C0FA 4MPGA 5DJLA 4AJ7A 3FR9A 3CYNA 3IK7A 4KCEA 4ICYA 2LJKA 4I5QA 1LU4A 3DEXA 4KH7A 2GT6A 4L5OA 1FVKA 1U6TA 4L8EA 3KMNA 2D2ZA 3HZ8A 1W89A 4LLRA 1G7EA 1NHOA 3WGEA 4ECBA 3QFAC 2O87A 1TXXA 3BCKA 5G5FA 4V1Ap 4IQ1A 2X8GA 4CHSA 3UVTA 4ILFA 6GSWA 2JADA 1T8EB 2DC5A 1V57A 1G6YA 4TXOB 3LYKA 3US3A 2WVZA 3KJYA 3ZL5A 5J9BA 2LTKA 1M2DA 1AQWA 4F0CA 3C7MA 1TXUA 2C4JA 3WD6A 1J9BA 1K3LA 4L0WA 1PA3A 5ID2B 1QK8A 1R5AA 4KNDA 1EZKA 2GT5A 3GKNA 1VF3A 4X0XA 3GL5A 3VK9A 5CREA 3GTUB 3TOTA 1ZMAA 4HQSA 5J41A 3MAKA 5ECKB 3TRPA 2PMTA 1EP7A 2M80A 3A5WA 3W6GA 3P2AA 3WT1A 4HS1A 4CY8A 3GKKA 3WYWA 4FH8A 1A2LA 5HFGA 2C0DA 3HD5A 2V2GA 1ABAA 1XPVA 5CP1A 1I5GA 2OA7A 1SL1B 2O36A 3GL3A 2O8VB 3F4TA 5GAPD 2ZCTA 4FYUA 1SVLA 2I81A 4EE0A 2MMNA 4MCUA 2RIIA 1ZCPA 4X4JA 3L9SA 4WEYA 4ID0A 1G6WA 1YY7A 3N9JA 1OKDA 1GUMA 1O85A 2GZPA 3IXRA 1S3DA 1WMJA 2H1AA 4TN8A 4A5PA 4Z2UA 2GLRA 1H75A 1PKWA 1GULA 5ECQB 5A4WA 3GNJA 2VLUA 2AAWA 5DQYA 2A4VA 5IMFA 5COHA 2H70A 1DSBA 1VGLA 2X8HA 2GSRA 1SKSB 3KTBA 3APQA 4MJAA 1PN0A 2YWIA 2KP1A 3GYKA 3V1WA 1TK0B 3SWLA 1ZYEA 5HFKA 1TP9A 3LW9A 1F3BA 2R0GA 5DDLA 1ZYPA 1SKRB 1KBNA 1OC3A 2WVYA 2QA1A 1XWAA 2OBKA 5D96A 4O5RA 4ZB9A 1Q98A 3HDCA 3C73A 2YJHA 1YDKA 2FNOA 1HYUA 1QGVA 4PI2C 1XVWA 5B7CA 2VL9A 1V58A 4GF0A 4E8EA 1JZWA 1PGTA 1PSQA 5JWQB 5C04A 3TJFA 1EV9A 3R3EA 1AW9A 2H1DA 4PTSA 2FY6A 2CZ2A 3EE2A 4PQ1A 1SD8A 4ECCA 1OE8A 3QAGA 3TJJA 2H74A 1TI3A 2VUPA 1DUGA 2R3XA 4GSSA 1TK5B 1MD4A 4BVYB 3E3EA 4GQFA 4AKXB 1THXA 4NV5A 3IAS2 5JWRB 5HFIA 1GTUA 3ZIJA 4MABA 4HOJA 3I69A 3IA1A 3UEMA 1SK2A 2LRTA 2OADA 1TDIA 2IPAA 3HZ4A 4ZBDA 2HSMA 3F4SA 3SBCA 1TK8B 5DQSA 4KAEA 3F3RA 1M9AA 4IW9A 1YJ6A 5ECIB 1TU8A 2LRNA 3EINA 2RM5A 4KF9A 3VWWA 4TR4A 1H4OA 1T3BA 2VOCA 5GZZB 1TRVA 3BOAA 4IKHA 1ON4A 4GSNA 1XW9A 1U3AA 5HR1A 1K0AA 2LSTA 5DBQA 5KN2A 3HKRA 1V40A 1ST9A 3TJBA 1GNEA 2GQKA 3TGZA 3UJ1A 1B48A 2F9SA 3TOUA 4Q5NA 1A0RP 1PRXA 2CQ9A 3ME8A 4K5SA 1GSSA 4MZBA 4HEA2 1HD2A 3FZ5A 2MYGA 2H0GA 2YJ7A 1XWKA 4JR4A 2PUKC 4ECJA 3LXZA 12GSA 4ACSA 2VD1A 4LMWA 2VL2C 2CVKA 3IC4A 2HZEA 4WF5A 1E2YA 2YZHA 3QDNA 2EFCA 3G7YA 2C3NA 5D73A 2I3YA 4XS6A 3P7XA 1ZGNA 3MIXA 3R2QA 3CTGA 1XFLA 4MMMA 4POKA 1PKZA 1AUCA 3UOMA 2PVQA 3M9KA 2YP6A 2VKZG 3GV1A 4Z2TA 4G0LA 6GSYA 2EIQA 2WULA 4HU7A 2LS5A 4X1UA 3PGTA 1AXDA 1G0TA 4EKZA 4KDYA 2P0GA 5H5SA 5EVOA 3C1RA 4DSSA 5F06A 2YWNA 4XS4A 3KZQA 1ERVA 3NIVA 3U5RE 3LG6A 2YPMA 5F0GA 2C80A 4G0KA 4QMKA 1ERUA 4F0BA 1FB0A 1X9WB 2HZFA 2BMXA 3ZFBA 1MDJA 4K0NA 1O8WA 2GZZA 2WW1A 2EIRA 1J0FA 4MZWA 1SU9A 2EC4A 2EFDA 1WRYA 4K2XA 17GSA 3FKFA 3GKXA 1F2EA 4ZIJA 3WGDA 3RPNA 1WIKA 2WW3A 1K0DA 2K8SA 1GLQA 3CWGA 3DXBA 3HVVA 4J57E 3F0IA 2HSMB 5DAKA 1O6JA 2EFHA 2B7KA 4EF0A 2LNTA 1XZOA 2R4VA 3L4NA 1Y6EA 3PINA 3MDKA 2PERA 3BBYA 1AQVA 1K0CA 3J7Yk 1NW2A 3L9VA 2DJJA 3F4RA 1ZYQB 4WR4A 5EY6A 1OC9A 4HI7A 2DLXA 1URMA 1YVLA 5JCWA 4WXTA 2LJRA 3UIWA 5A5HA 3TKQA 4D73B 1GUHA 5DVBA 3GFKA 4PUFC 1SL2B 1HQOA 1GP1A 2OBIA 4F2IA 3A5IA 3P8WA 4ZB7A 4BVXB 3DIEA 2N5FA 3DRNA 1CQGA 3FMWA 4L0UA 2P5QA 4N3ZA 3Q6OA 1EOGA 2V6KA 4GQCA 2E0QA 1X9MB 1PL1A 1YZXA 3MNGA 1SK1A 1M3IA 4W66A 4YQMA 1X5EA 3TKSE 1VRSD 3VLNA 2IMFA 2PVOC 4MJEA 1SK0A 3UL3A 5D9XA 1UN2A 2QKEA 2H75A 4V2MA 5GSTA 1T4YA 4LL4B 5GSSA 1A2MA 2VLVA 3LEFA 3LGCA 3CTFA 4HDEA 4ZB8A 4IELA 4KGIA 4PNFA 2CAQA 2OE0A 3EMPA 1SD9A 2E7PA 1SJZA 1JZOA 4POLA 2HRAA 3F6DA 4F82A 4EIQA 1QMVA 4QQ7A 2K8VA 4OFNA 5G2ZA 2JSZA 3TKSC 3ME7A 4AKGA 2C1YA 5HR3A 5IMCA 2IMKA 3ZVJD 1TU7A 4JRRA 1JZDA 3TKRA 2RUFA 1VF1A 4V1Ag 2R0CA 3CHXC 4DSSB 1XXUA 1YEPA 4F03A 2KP2A 2VM2A 3HJPA 4XS4B 3ZIVA 2H71A 3IHGA 1GSQA 3HCZA 1X5DA 3CSJA 6GSXA 4QL9A 3VFIA 8GSSA 2L57A 2E2GA 1K0NA 1JHBA 3W8JA 1PQNA 1XBSA 1GRXA 5KN0A 4I2TA 3LWAA 4NV2A 4MF5A 1GSFA 3TRQA 2XPEA 2B5YA 2IJYA 3H8QA 5A1NA 2V1MA 5E59A 5DAKB 1XG8A 1Y1UA 4YAVA 3QAWA 1X5CA 4NPBA 4FO5A 1WP0A 1GLPA 1SYXA 5B6MA 1SVMA 3Q18A 5ELAA 3BD2A 4AJ6A 4TR1A 1C72A 1OC9B 2LV3A 1FG4A 2FLSA 2DKIA 1JZRA 4MPFA 2WVXA 1BF5A 5A5HB 1M0UA 4ULXA 4L5LA 4K2DA 1Z6NA 3E9JB 1PL2A 2WS2A 2HSNA 3LXTA 4O7HA 4I97A 2IL3A 3RHBA 4Q5RA 2VCWA 1HNAA 1MDKA 2H30A 3QCPA 5AIXA 3JCML 2ES7A 2AUVA 2HXKA 4HJ2A 5G1KA 4ZB6A 2GSQA 1AIUA 1BQ7A 5CAXA 3VWXA 4JBBA 4EVMA 2C0EA 5HR2A 3QPMA 1FVJA
chains in the Genus database with same CATH topology
2GSTA 5DJMA 3EMXA 1GSDA 1PX7A 4BPYA 4QL7A 1SKWB 4MH3A 5A34B 1EEJA 2C3QA 3ISOA 5J4YA 2IFQA 1X9SB 5CRGA 4XTSA 3LFLA 5EPFA 2WGRA 4ML6A 2OKAA 2GGTA 1GTIA 4G0IA 2MBTA 2VD0A 3GKMA 2X4AA 1UA5A 5IMVA 2FWGA 3UARA 3Q19A 1A24A 1NHYA 3CSIA 4N10A 5J5NA 1K3OA 1N25A 2M72A 3LORA 4GWRA 2YCDA 5BRTA 2CVDA 5CYYA 4OO4A 5C00A 2M46A 4YH2A 2DIYA 5ELGA 4BA7A 1QFNA 3KMOA 1SJ6A 2DSAA 4BWQA 1IYHA 4OFTA 3VPQA 4ZBBA 1AQXA 1UC7A 2VIMA 5ECNB 5J40A 1SENA 3F3QA 2JZSA 5IQYA 5IPHA 1B4QA 3MSZA 5J4UA 2DKHA 4MA9A 1THOA 22GSA 1WWJA 5LCZA 3DD3A 13GSA 4AGSA 5G30A 3O6TA 3OR5A 1UVZA 4G01A 1EGOA 5IOXA 2UZ8A 1Z5YE 5GAND 4MK3A 5INYA 4PUAA 2CV4A 1V2AA 1M2BA 3H4KA 1FW1A 1LBKA 1BG5A 4TW5A 2J9HA 1FHEA 1K0BA 3LSZA 1GL8A 3M9JA 5ECMB 3E0UA 2H0HA 3IOSA 5ECPB 5J47A 3DVWA 3FR6A 2A4HA 4IN0A 4DSRA 1GTAA 2DJ2A 5B8AA 3BCIA 5IO0A 2OE3A 2NBSA 4HUAA 4O5UA 5E4WA 1QXHA 4KE3A 1GWCA 5D93A 2GQLA 1Z9HA 2H73A 1N8JA 3D21A 3DVXA 4TXVA 2E2MA 2ZUPA 2J23A 2REMA 1MEKA 1WOUA 2ZNMA 2CAIA 3FK8A 1O7UA 2DJ3A 2HQTA 1BEDA 4K7NA 2Z9SA 3ERWA 3GURA 1XW5A 4IJIA 4JR6A 2HNLA 2PN8A 1EWXA 3IAM2 2YZUA 3ZVJA 4P3YB 2YOIA 2B3SA 4KDUA 3M3MA 4AKIA 2VO4A 2EFEA 3D5JA 2L6CA 2L6DA 5CO3A 5CNWA 2O5VA 3GRXA 2B1LA 4OWYA 4WBJA 2JACA 2DBCA 1U87A 3FW2A 1SL0B 2IFQB 3KP8A 2AHEA 3F6FA 2RUEA 1BYEA 4OFMA 4PX1A 1EP8A 4OMVA 4EL1A 5IPGA 2VCVA 3IR4A 2GZYA 1Y25A 1R4WA 2WCIA 2B5XA 4IHUA 4WKWA 1TW9A 4O5QA 1T7PB 1ZZYA 4MDCA 4E68A 2YV7A 3TKSA 3HJMA 1SYRA 1A23A 2NVLA 3MYDA 4RI6A 2WDUA 1FOVA 2CA8A 4F9ZA 5G1LA 1OC8A 4YKGA 2WB9A 3VI5A 2I1UA 1MDIA 3P90A 2VL3A 4CDOA 1XOBA 1T00A 2F51A 3ERFA 2L4QA 2V41A 5DCGA 4FYCA 5DCHA 1JLVA 5ECHB 2FWEA 1F3AA 2XBIA 9GSSA 3VWVA 3TRXA 1GTBA 3O76A 4MZCA 1KTEA 4V2LA 3IC8A 1RQMA 5ABRA 4N30A 4XRDA 2PWJA 1Z3EA 4ZILA 4MP4A 1XIYA 3GN3A 3FZ9A 1GUKA 4TVEA 5KEJA 4K7OA 1BJXA 4Z2RA 4MF7A 1A8LA 4GDFA 6GSTA 3FZAA 1W4VA 2FHEA 1OKTA 4IBPA 3D4MA 3HYPA 1GNWA 2F8FA 3FHKA 1XVQA 3M8NA 3DGQA 5ECRB 5EL8A 1B9XC 4J56E 4EUYA 1Q4JA 4LMVA 4O92A 1PN9A 2HI7A 2AV4A 2HFDA 2YWMA 4K0GA 1O81A 1HNBA 1FOHA 1YF0A 1YQ1A 2R6KA 2LNSA 3EYTA 2MMZA 2HE3A 3ZREA 3KP9A 2OJLA 3IPZA 1K3YA 4G10A 5IO2A 2O85A 4EXJA 5J3RA 2KOKA 4N11A 3ED3A 2H1GA 5F8BA 4TRXA 2MZCA 6GSSA 1OYJA 2IIYA 4Z7XA 1NM3A 4POBA 3L78A 2YNXA 7GSSA 2XC2A 2FCHA 2K9FA 3S9FA 3TJGA 4DEJA 3EU4A 2ON7A 2VCQA 1B4PA 2A2PA 6GSVA 2CX3A 3DYRA 5F07A 4JEDA 3H93A 1EEMA 1BX9A 2PU9C 5JCUA 4ML1A 3FY7A 2HZEB 2X49A 1KNGA 3C1SA 2JZRA 2YN1A 4POMA 5J4VA 5IIZA 3A2XA 5B6NA 1GSEA 3TKPA 1BAYA 4PGTA 3A2WA 3M1GA 1U3IA 3QOUA 2HRKA 1QUWA 2I4AA 4ISDA 1PMTA 3UBKA 3FZ4A 5IMZA 2H19A 4GLTA 1LJRA 2FWFA 4Q5QA 5JCGA 1IYIA 3GMFA 4KCAA 3NOFA 1OE7A 4GTUA 6GSUA 2K18A 4TOPA 3I9V2 5IMAA 3M0FA 3WT2A 1FO5A 2A2RA 2TRXA 1TKDB 2DJ0A 4WR5A 2HYXA 3UBLA 3KM6A 4RQXA 1EV4A 10GSA 3DMLA 1FB6A 1KEBA 2TIRA 4I6XA 3EVIA 14GSA 2AB6A 2FA4A 5AIVA 3UAPA 1TJDA 1ERWA 2DJ1A 3ZLPA 3PR8A 5FHIA 3CMIA 1A2JA 1CQHA 4X43A 2ON5A 2OT3A 4RI7A 3PH9A 3RAZA 2L5OA 4IQAA 2LKUA 2DIZA 3IK9A 4KDXA 3UVHA 4BVYA 4ZL9A 3I43A 5FT3A 2OACA 1S3AA 3L9UA 3HVSA 4H86A 1V9WA 2LQOA 5D9TA 3I6AA 2N5BA 1N2AA 5B8BA 1AC1A 1MD3A 5G31A 2H66A 3TCOA 1O73A 2H8LA 4IJ3A 3ZZXA 1F9MA 3IDVA 4XCSA 3RPPA 3U6VA 3HVXA 3KH9A 2FD3A 4YAPA 3NZNA 1R7HA 1VF2A 1XCCA 2JL4A 1TRUA 2LUSA 3K8NA 3F8UA 4KUNA 4OCFA 5BMUA 4KSMA 5H5RA 3IBHA 3FRCA 5KOXA 4EC0A 4GXZA 5HR0A 2AJQB 4RUVA 3GHAA 3FEUA 5ECSA 3EWLA 4G9HA 3IV4A 4XIHA 5CRWA 3ZYWA 2EIOA 1XOAA 3HMJG 4PNGA 1TTZA 1ERTA 4YKFA 2IWTA 1ZOFA 20GSA 3CRUA 3G7JA 2R2JA 2VL2A 4IP6A 5D8IA 4G2EA 5A4UA 2N5AA 2FA8A 4WBRD 5CRDA 4K1FA 4DSQA 4EDZA 4K5RA 1QQ2A 3WGXA 1B8XA 5LD0A 1R5PA 2VCXA 2L59A 2H72A 2KUCA 3HXSA 18GSA 2XPDA 4ZL8A 2GSSA 3CSHA 2JZTA 2HRKB 2VCTA 3TU3B 4KB3A 2LQQA 2BJXA 2LEGA 1RW1A 3KH7A 1WPIA 4LL1B 2PBJA 1M99A 3GUSA 2B6MA 2VLTA 4K9ZA 3L0HA 4BL7A 3QFBC 4IP1A 5H5QA 3HJOA 2C3TA 4V2NA 4ZL7A 4MLYA 5IMDA 1SJIA 3EC3A 2K6VA 1F6MC 4K7IA 4PQHA 1JFUA 4NHZA 2IMIA 5AISA 1Z7RA 1XWCA 2X8CA 1DBYA 3APSA 2DMLA 3ZTLA 4N0ZA 4KSOA 2RM6A 4N0VA 5KN3A 5ECLB 3LQ7A 3CRTA 1HNCA 4AI6A 1JLWA 3KGKA 4K6XA 4USSA 4ZBAA 5A5KA 2QA2A 1YKCA 4CW9A 2WJUA 2H6XA 4TR3A 3ZMKA 2GS3A 2H1LA 4FIWA 4PQIA 5DALA 2KLXA 2CT6A 1BG1A 2LJAA 3GH6A 3Q74A 5A1NB 1K0MA 4I2UA 2CVBA 2JU5A 3RHCA 2JSYA 1OVNA 3HA9A 1AAZA 5J9CA 4MH2A 1S3CA 3IRAA 3O3TA 3DKSA 1WE0A 2FGXA 1YKAA 4MNNA 1TRWA 3C71A 4TR1B 4JZQA 4TKYA 2F3MA 3KD0A 4GSTA 4IS0A 3HY2A 4HQZA 3IHQA 2WFCA 2X99A 3GX0A 1M9BA 2F8AA 2FUG2 4I8BA 4J2FA 3ZMLA 2DJKA 3GSSA 1WJKA 3GSTA 2GVPA 2HSNB 5BMUB 2QSIA 3N5OA 2YV9A 4TR0A 4WF4A 3AY8A 4PURA 1YEXA 2HRFA 1J08A 4D73A 4IGJA 5FWGA 4XS1A 3KXOA 2GTUA 2I9HA 3KCMA 2HSHA 2CZ3A 1ACVA 4GRFA 4NMUA 1DE1A 4BVXA 3MWHA 2YANA 2G2QA 4XHMA 2UV8G 2IN3A 5G5EA 3GX8A 3W8SA 1VF4A 2ALBA 4AKHA 1XWBA 1USBA 3QR6A 3G9BA 1M7TA 2A2SA 2H6ZA 3RDWA 1TI1A 2CX4A 2VCZA 2O7KA 11GSA 1NSWA 1V98A 4BWSA 1R26A 2IMEA 2C0GA 4MF6A 1XWGA 3F9UA 2R5GA 3G7IA 1E6BA 2X64A 2KHPA 1GSYA 2V6OA 4OCEA 3J7Yb 4FYBA 4EIPA 5F05A 4O32A 3PPUA 4RQRA 4BL7B 5AN1A 1X0RA 5HQPA 3ERGA 4YQVA 2P5RA 2GQMA 3VPTA 4Q5FA 3A2VA 3TUEA 2FWHA 4NXIA 2H1BA 16GSA 3UMAA 2H01A 2L4CA 1PX6A 4G19A 3APOA 5KN1A 3VWUA 1TRSA 4EO3A 4CY6A 3VURA 3H1NA 3RBTA 1B9YC 3GH9A 2B1KA 4ECIA 2OE1A 3GA4A 2R0PA 2VM1A 2PPTA 4OO5A 2NDOA 1O8XA 3ZITA 2YWOA 3KTLA 1SVOA 4XRAA 4DVCA 1I9DA 2RLIA 4ZXGA 5L71A 2GDRA 1Z6MA 2HRNA 4KX4A 4HZ2A 4KA0A 2BTOT 5DALB 4AF2A 3IE3A 3KEBA 2WRTA 4JU5A 2V32A 3CBUA 4EDYA 3D6IA 2C8UA 4TXOA 1GSUA 2H76A 2AYTA 2DMMA 2MBSA 4YQUA 3D22A 3EU3A 2HLSA 5CRHA 3TDGA 2NTOA 3DWVA 2MMAA 2R37A 5ID2A 2H6YA 3TJKA 3LJRA 5KOWA 2O89A 3QMXA 2IMDA 4OD7A 3GTUA 1OAZA 1T1VA 4NHWA 2VAFA 3EPTA 2TRCP 3D4TA 1EGRA 2B7JA 1U88A 2XHFA 3EURA 2MMOA 4K8MA 19GSA 4NWYA 3A3TA 3ZFLA 2QC7A 2B5EA 1EOHA 1MTCA 4HZ4A 1Z7PA 2NPBA 3D0ZA 3TB2A 5AGYA 3HHVA 5LNKe 5IOWA 1TOFA 4JE1A 3ZRDA 1A0FA 4GCIA 1DE2A 4PXOA 3QD9A 1T4ZA 5ENUA 2WZ9A 1K0OA 2LRCA 1A8YA 3VI7A 1RK4A 3F63A 3GIXA 1ML6A 4E8HA 3BJ5A 3LYPA 4AJ8A 1PD21 5JWOB 2L5LA 3H79A 4WETA 2HSYA 3QAVA 3C8EA 5A4VA 3FR3A 4MJCA 2PGTA 5A34A 1M2AA 5D9VA 4FQUA 3KIJA 1F37A 2G0FA 4HU9A 1FAAA 5IM9A 4IVFA 1XW6A 1ILOA 5D9WA 4MJBA 5ECOB 2P31A 4NAXA 1GH2A 2QGVA 4LA1A 2HT9A 2H0IA 1YF1A 2XBQA 1G7OA 4HJMA 3CXGA 4KW6A 1ZYNA 1ZL9A 3FYGA 2C0FA 4MPGA 5DJLA 4AJ7A 3FR9A 3CYNA 3IK7A 4KCEA 4ICYA 2LJKA 4I5QA 1LU4A 3DEXA 4KH7A 2GT6A 4L5OA 1FVKA 1U6TA 4L8EA 3KMNA 2D2ZA 3HZ8A 1W89A 4LLRA 1G7EA 1NHOA 3WGEA 4ECBA 3QFAC 2O87A 1TXXA 3BCKA 5G5FA 4V1Ap 4IQ1A 2X8GA 4CHSA 3UVTA 4ILFA 6GSWA 2JADA 1T8EB 2DC5A 1V57A 1G6YA 4TXOB 3LYKA 3US3A 3KJYA 3ZL5A 5J9BA 2LTKA 1M2DA 1AQWA 4F0CA 3C7MA 1TXUA 2C4JA 3WD6A 1J9BA 1K3LA 4L0WA 1PA3A 5ID2B 1QK8A 1R5AA 4KNDA 1EZKA 2GT5A 3GKNA 1VF3A 4X0XA 3GL5A 3VK9A 5CREA 3GTUB 3TOTA 1ZMAA 4HQSA 5J41A 3MAKA 5ECKB 3TRPA 2PMTA 1EP7A 2M80A 3A5WA 3W6GA 3P2AA 3WT1A 4HS1A 4CY8A 3GKKA 3WYWA 4FH8A 1A2LA 5HFGA 2C0DA 3HD5A 2V2GA 1ABAA 1XPVA 5CP1A 1I5GA 2OA7A 1SL1B 3GL3A 2O8VB 3F4TA 5GAPD 2ZCTA 4FYUA 1SVLA 2I81A 4EE0A 2MMNA 4MCUA 2RIIA 1ZCPA 4X4JA 3L9SA 4WEYA 4ID0A 1G6WA 1YY7A 3N9JA 1OKDA 1GUMA 1O85A 2GZPA 3IXRA 1S3DA 1WMJA 2H1AA 4TN8A 4A5PA 4Z2UA 2GLRA 1H75A 1PKWA 1GULA 5ECQB 5A4WA 3GNJA 2VLUA 2AAWA 5DQYA 2A4VA 5IMFA 5COHA 2H70A 1DSBA 1VGLA 2X8HA 2GSRA 1SKSB 3KTBA 3APQA 4MJAA 1PN0A 2YWIA 2KP1A 3GYKA 3V1WA 1TK0B 3SWLA 1ZYEA 5HFKA 1TP9A 3LW9A 1F3BA 2R0GA 5DDLA 1ZYPA 1SKRB 1KBNA 1OC3A 2QA1A 1XWAA 2OBKA 5D96A 4O5RA 4ZB9A 1Q98A 3HDCA 3C73A 2YJHA 1YDKA 2FNOA 1HYUA 1QGVA 1XVWA 5B7CA 1V58A 2VL9A 4GF0A 4E8EA 1JZWA 1PGTA 1PSQA 5JWQB 5C04A 3TJFA 1EV9A 3R3EA 1AW9A 2H1DA 4PTSA 2FY6A 2CZ2A 3EE2A 4PQ1A 1SD8A 4ECCA 1OE8A 3QAGA 3TJJA 2H74A 1TI3A 2VUPA 1DUGA 2R3XA 4GSSA 1TK5B 1MD4A 4BVYB 3E3EA 4GQFA 4AKXB 1THXA 4NV5A 3IAS2 5JWRB 5HFIA 1GTUA 3ZIJA 4MABA 4HOJA 3I69A 3IA1A 3UEMA 1SK2A 2LRTA 2OADA 1TDIA 2IPAA 3HZ4A 4ZBDA 2HSMA 3F4SA 3SBCA 1TK8B 5DQSA 4KAEA 3F3RA 1M9AA 4IW9A 1YJ6A 5ECIB 1TU8A 2LRNA 3EINA 2RM5A 4KF9A 3VWWA 4TR4A 1H4OA 1T3BA 2VOCA 5GZZB 1TRVA 3BOAA 4IKHA 1ON4A 4GSNA 1XW9A 1U3AA 5HR1A 1K0AA 2LSTA 5DBQA 5KN2A 3HKRA 1V40A 1ST9A 3TJBA 1GNEA 2GQKA 3TGZA 3UJ1A 1B48A 2F9SA 3TOUA 4Q5NA 1A0RP 1PRXA 2CQ9A 3ME8A 4K5SA 1GSSA 4MZBA 4HEA2 1HD2A 3FZ5A 2MYGA 2H0GA 2YJ7A 1XWKA 4JR4A 2PUKC 4ECJA 3LXZA 12GSA 4ACSA 2VD1A 4LMWA 2VL2C 2CVKA 3IC4A 2HZEA 4WF5A 1E2YA 2YZHA 3QDNA 2EFCA 3G7YA 2C3NA 5D73A 2I3YA 4XS6A 3P7XA 1ZGNA 3MIXA 3R2QA 3CTGA 1XFLA 4MMMA 4POKA 1PKZA 1AUCA 3UOMA 2PVQA 3M9KA 2YP6A 2VKZG 3GV1A 4Z2TA 4G0LA 6GSYA 2EIQA 2WULA 4HU7A 2LS5A 4X1UA 3PGTA 1AXDA 1G0TA 4EKZA 4KDYA 2P0GA 5H5SA 5EVOA 3C1RA 4DSSA 5F06A 2YWNA 4XS4A 3KZQA 1ERVA 3NIVA 3U5RE 3LG6A 2YPMA 5F0GA 2C80A 4G0KA 4QMKA 1ERUA 4F0BA 1FB0A 1X9WB 2HZFA 2BMXA 3ZFBA 1MDJA 4K0NA 1O8WA 2GZZA 2EIRA 1J0FA 4MZWA 1SU9A 2EC4A 2EFDA 1WRYA 4K2XA 17GSA 3FKFA 3GKXA 1F2EA 4ZIJA 3WGDA 3RPNA 1WIKA 1K0DA 2K8SA 1GLQA 3CWGA 3DXBA 3HVVA 4J57E 3F0IA 2HSMB 5DAKA 1O6JA 2EFHA 2B7KA 4EF0A 2LNTA 1XZOA 2R4VA 3L4NA 1Y6EA 3PINA 3MDKA 2PERA 3BBYA 1AQVA 1K0CA 3J7Yk 1NW2A 3L9VA 2DJJA 3F4RA 1ZYQB 4WR4A 5EY6A 1OC9A 4HI7A 2DLXA 1URMA 1YVLA 5JCWA 4WXTA 2LJRA 3UIWA 5A5HA 3TKQA 4D73B 1GUHA 5DVBA 3GFKA 4PUFC 1SL2B 1HQOA 1GP1A 2OBIA 4F2IA 3A5IA 3P8WA 4ZB7A 4BVXB 3DIEA 2N5FA 3DRNA 1CQGA 3FMWA 4L0UA 2P5QA 4N3ZA 3Q6OA 1EOGA 2V6KA 4GQCA 2E0QA 1X9MB 1PL1A 1YZXA 3MNGA 1SK1A 4W66A 4YQMA 1X5EA 3TKSE 1VRSD 3VLNA 2IMFA 2PVOC 4MJEA 1SK0A 3UL3A 5D9XA 1UN2A 2QKEA 2H75A 4V2MA 5GSTA 1T4YA 4LL4B 5GSSA 1A2MA 2VLVA 3LEFA 3LGCA 3CTFA 4HDEA 4ZB8A 4IELA 4KGIA 4PNFA 2CAQA 2OE0A 3EMPA 1SD9A 2E7PA 1SJZA 1JZOA 4POLA 2HRAA 3F6DA 4F82A 4EIQA 1QMVA 4QQ7A 2K8VA 4OFNA 5G2ZA 2JSZA 3TKSC 3ME7A 4AKGA 2C1YA 5HR3A 5IMCA 2IMKA 3ZVJD 1TU7A 4JRRA 1JZDA 3TKRA 2RUFA 1VF1A 4V1Ag 2R0CA 4DSSB 1XXUA 1YEPA 4F03A 2KP2A 2VM2A 3HJPA 4XS4B 3ZIVA 2H71A 3IHGA 1GSQA 3HCZA 1X5DA 3CSJA 6GSXA 4QL9A 3VFIA 8GSSA 2L57A 2E2GA 1K0NA 1JHBA 3W8JA 1PQNA 1XBSA 1GRXA 5KN0A 4I2TA 3LWAA 4NV2A 4MF5A 1GSFA 3TRQA 2XPEA 2B5YA 2IJYA 3H8QA 5A1NA 2V1MA 5E59A 5DAKB 1Y1UA 4YAVA 3QAWA 1X5CA 4NPBA 4FO5A 1WP0A 1GLPA 1SYXA 5B6MA 1SVMA 3Q18A 5ELAA 3BD2A 4AJ6A 4TR1A 1C72A 1OC9B 2LV3A 1FG4A 2FLSA 2DKIA 1JZRA 4MPFA 1BF5A 5A5HB 1M0UA 4ULXA 4L5LA 4K2DA 1Z6NA 3E9JB 1PL2A 2WS2A 2HSNA 3LXTA 4O7HA 4I97A 2IL3A 3RHBA 4Q5RA 2VCWA 1HNAA 1MDKA 2H30A 3QCPA 5AIXA 3JCML 2ES7A 2AUVA 2HXKA 4HJ2A 5G1KA 4ZB6A 2GSQA 1AIUA 1BQ7A 5CAXA 3VWXA 4JBBA 4EVMA 2C0EA 5HR2A 3QPMA 1FVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GST A;  5DJM A;  3EMX A;  1GSD A;  1PX7 A;  4BPY A;  4QL7 A;  1SKW B;  4MH3 A;  1EEJ A;  2C3Q A;  3ISO A;  2IFQ A;  1X9S B;  5CRG A;  4XTS A;  3LFL A;  5EPF A;  2WGR A;  4ML6 A;  2OKA A;  2GGT A;  1GTI A;  4G0I A;  2MBT A;  2VD0 A;  3GKM A;  1UA5 A;  5IMV A;  2FWG A;  3UAR A;  3Q19 A;  1A24 A;  1NHY A;  3CSI A;  4N10 A;  5J5N A;  1K3O A;  2M72 A;  3LOR A;  4GWR A;  2YCD A;  2CVD A;  5CYY A;  4OO4 A;  5C00 A;  2M46 A;  4YH2 A;  2DIY A;  5ELG A;  4BA7 A;  1QFN A;  3KMO A;  1SJ6 A;  2DSA A;  4BWQ A;  1IYH A;  4OFT A;  3VPQ A;  4ZBB A;  1AQX A;  1UC7 A;  2VIM A;  5ECN B;  1SEN A;  3F3Q A;  2JZS A;  5IQY A;  5IPH A;  1B4Q A;  3MSZ A;  5J4U A;  4MA9 A;  1THO A;  22GS A;  1WWJ A;  5LCZ A;  3DD3 A;  13GS A;  4AGS A;  5G30 A;  3O6T A;  3OR5 A;  1UVZ A;  1EGO A;  5IOX A;  2UZ8 A;  1Z5Y E;  5GAN D;  4MK3 A;  5INY A;  4PUA A;  2CV4 A;  1V2A A;  1M2B A;  3H4K A;  1FW1 A;  1LBK A;  1BG5 A;  4TW5 A;  2J9H A;  1FHE A;  1K0B A;  3LSZ A;  1GL8 A;  3M9J A;  5ECM B;  3E0U A;  2H0H A;  3IOS A;  5ECP B;  3DVW A;  3FR6 A;  4DSR A;  4IN0 A;  1GTA A;  2DJ2 A;  5B8A A;  3BCI A;  5IO0 A;  2OE3 A;  2NBS A;  4HUA A;  5E4W A;  1QXH A;  4KE3 A;  1GWC A;  5D93 A;  2GQL A;  1Z9H A;  2H73 A;  1N8J A;  3D21 A;  3DVX A;  4TXV A;  2E2M A;  2ZUP A;  2J23 A;  2REM A;  1MEK A;  1WOU A;  2ZNM A;  2CAI A;  3FK8 A;  1O7U A;  2DJ3 A;  2HQT A;  1BED A;  4K7N A;  2Z9S A;  3ERW A;  3GUR A;  1XW5 A;  4IJI A;  4JR6 A;  2HNL A;  2PN8 A;  1EWX A;  3IAM 2;  2YZU A;  3ZVJ A;  4P3Y B;  2YOI A;  2B3S A;  4KDU A;  3M3M A;  2VO4 A;  3D5J A;  2L6C A;  2L6D A;  5CO3 A;  5CNW A;  3GRX A;  2B1L A;  4OWY A;  4WBJ A;  2JAC A;  2DBC A;  1U87 A;  3FW2 A;  1SL0 B;  2IFQ B;  3KP8 A;  2AHE A;  3F6F A;  2RUE A;  1BYE A;  4OFM A;  4PX1 A;  1EP8 A;  4OMV A;  4EL1 A;  5IPG A;  2VCV A;  3IR4 A;  2GZY A;  1Y25 A;  1R4W A;  2WCI A;  2B5X A;  4IHU A;  4WKW A;  1TW9 A;  1T7P B;  1ZZY A;  4MDC A;  2YV7 A;  3TKS A;  3HJM A;  1SYR A;  1A23 A;  2NVL A;  4RI6 A;  2WDU A;  1FOV A;  2CA8 A;  4F9Z A;  5G1L A;  1OC8 A;  2WB9 A;  3VI5 A;  2I1U A;  1MDI A;  3P90 A;  2VL3 A;  4CDO A;  1XOB A;  1T00 A;  2F51 A;  3ERF A;  2L4Q A;  2V41 A;  5DCG A;  4FYC A;  5DCH A;  1JLV A;  5ECH B;  2FWE A;  1F3A A;  2XBI A;  9GSS A;  3VWV A;  3TRX A;  1GTB A;  3O76 A;  4MZC A;  1KTE A;  4V2L A;  3IC8 A;  1RQM A;  5ABR A;  4N30 A;  4XRD A;  2PWJ A;  1Z3E A;  4ZIL A;  4MP4 A;  1XIY A;  3GN3 A;  3FZ9 A;  1GUK A;  4TVE A;  5KEJ A;  4K7O A;  1BJX A;  4MF7 A;  1A8L A;  6GST A;  3FZA A;  1W4V A;  2FHE A;  1OKT A;  4IBP A;  3D4M A;  3HYP A;  1GNW A;  2F8F A;  3FHK A;  1XVQ A;  3M8N A;  3DGQ A;  5ECR B;  5EL8 A;  1B9X C;  4J56 E;  4EUY A;  1Q4J A;  4LMV A;  4O92 A;  1PN9 A;  2HI7 A;  2AV4 A;  2HFD A;  2YWM A;  4K0G A;  1O81 A;  1HNB A;  1YF0 A;  1YQ1 A;  2R6K A;  2LNS A;  3EYT A;  2MMZ A;  2HE3 A;  3ZRE A;  3KP9 A;  2OJL A;  3IPZ A;  1K3Y A;  4G10 A;  5IO2 A;  2O85 A;  4EXJ A;  5J3R A;  2KOK A;  4N11 A;  3ED3 A;  2H1G A;  5F8B A;  4TRX A;  2MZC A;  6GSS A;  1OYJ A;  2IIY A;  4Z7X A;  1NM3 A;  4POB A;  3L78 A;  2YNX A;  7GSS A;  2XC2 A;  2FCH A;  2K9F A;  3S9F A;  3TJG A;  4DEJ A;  3EU4 A;  2ON7 A;  2VCQ A;  1B4P A;  6GSV A;  2CX3 A;  3DYR A;  5F07 A;  4JED A;  3H93 A;  1EEM A;  1BX9 A;  2PU9 C;  5JCU A;  4ML1 A;  3FY7 A;  2HZE B;  1KNG A;  3C1S A;  2JZR A;  2YN1 A;  4POM A;  5IIZ A;  3A2X A;  5B6N A;  1GSE A;  3TKP A;  1BAY A;  4PGT A;  3A2W A;  3M1G A;  3QOU A;  1U3I A;  2HRK A;  1QUW A;  2I4A A;  4ISD A;  1PMT A;  3UBK A;  3FZ4 A;  5IMZ A;  2H19 A;  4GLT A;  1LJR A;  2FWF A;  4Q5Q A;  5JCG A;  1IYI A;  3GMF A;  4KCA A;  3NOF A;  1OE7 A;  4GTU A;  6GSU A;  2K18 A;  4TOP A;  3I9V 2;  5IMA A;  3M0F A;  3WT2 A;  1FO5 A;  2A2R A;  2TRX A;  1TKD B;  2DJ0 A;  4WR5 A;  2HYX A;  3UBL A;  3KM6 A;  4RQX A;  1EV4 A;  10GS A;  3DML A;  1FB6 A;  1KEB A;  2TIR A;  4I6X A;  3EVI A;  14GS A;  2AB6 A;  2FA4 A;  5AIV A;  3UAP A;  1TJD A;  1ERW A;  2DJ1 A;  3ZLP A;  3PR8 A;  5FHI A;  3CMI A;  1A2J A;  1CQH A;  4X43 A;  2ON5 A;  4RI7 A;  3PH9 A;  3RAZ A;  2L5O A;  4IQA A;  2LKU A;  2DIZ A;  3IK9 A;  4KDX A;  3UVH A;  4BVY A;  4ZL9 A;  3I43 A;  5FT3 A;  2OAC A;  1S3A A;  3L9U A;  3HVS A;  4H86 A;  1V9W A;  2LQO A;  5D9T A;  3I6A A;  2N5B A;  1N2A A;  5B8B A;  1AC1 A;  1MD3 A;  5G31 A;  2H66 A;  3TCO A;  1O73 A;  2H8L A;  4IJ3 A;  3ZZX A;  1F9M A;  3IDV A;  4XCS A;  3RPP A;  3U6V A;  3HVX A;  3KH9 A;  2FD3 A;  4YAP A;  3NZN A;  1R7H A;  1VF2 A;  1XCC A;  2JL4 A;  1TRU A;  2LUS A;  3K8N A;  3F8U A;  4KUN A;  4OCF A;  5BMU A;  4KSM A;  5H5R A;  3IBH A;  3FRC A;  4EC0 A;  4GXZ A;  5HR0 A;  2AJQ B;  4RUV A;  3GHA A;  3FEU A;  5ECS A;  3EWL A;  4G9H A;  3IV4 A;  4XIH A;  5CRW A;  3ZYW A;  2EIO A;  1XOA A;  4PNG A;  1TTZ A;  1ERT A;  2IWT A;  1ZOF A;  20GS A;  3CRU A;  3G7J A;  2R2J A;  2VL2 A;  4IP6 A;  5D8I A;  4G2E A;  5A4U A;  2N5A A;  2FA8 A;  4WBR D;  5CRD A;  4K1F A;  4DSQ A;  4EDZ A;  1QQ2 A;  3WGX A;  1B8X A;  5LD0 A;  1R5P A;  2VCX A;  2L59 A;  2H72 A;  2KUC A;  3HXS A;  18GS A;  2XPD A;  4ZL8 A;  2GSS A;  3CSH A;  2JZT A;  2HRK B;  2VCT A;  4KB3 A;  2LQQ A;  2BJX A;  2LEG A;  1RW1 A;  3KH7 A;  1WPI A;  4LL1 B;  2PBJ A;  1M99 A;  3GUS A;  2B6M A;  2VLT A;  4K9Z A;  3L0H A;  4BL7 A;  3QFB C;  4IP1 A;  5H5Q A;  3HJO A;  2C3T A;  4V2N A;  4ZL7 A;  4MLY A;  5IMD A;  1SJI A;  3EC3 A;  2K6V A;  1F6M C;  4K7I A;  4PQH A;  1JFU A;  4NHZ A;  2IMI A;  5AIS A;  1Z7R A;  1XWC A;  2X8C A;  1DBY A;  3APS A;  2DML A;  3ZTL A;  4N0Z A;  4KSO A;  2RM6 A;  4N0V A;  5KN3 A;  5ECL B;  3LQ7 A;  3CRT A;  1HNC A;  1JLW A;  3KGK A;  4K6X A;  4USS A;  4ZBA A;  5A5K A;  1YKC A;  4CW9 A;  2WJU A;  2H6X A;  4TR3 A;  3ZMK A;  2GS3 A;  4FIW A;  4PQI A;  5DAL A;  2KLX A;  2CT6 A;  2LJA A;  3GH6 A;  3Q74 A;  1K0M A;  4I2U A;  2CVB A;  2JU5 A;  3RHC A;  2JSY A;  1OVN A;  3HA9 A;  1AAZ A;  5J9C A;  4MH2 A;  1S3C A;  3IRA A;  3O3T A;  3DKS A;  1WE0 A;  2FGX A;  1YKA A;  1TRW A;  3C71 A;  4TR1 B;  4JZQ A;  4TKY A;  2F3M A;  3KD0 A;  4GST A;  4IS0 A;  3HY2 A;  4HQZ A;  3IHQ A;  2WFC A;  2X99 A;  3GX0 A;  1M9B A;  2F8A A;  2FUG 2;  4I8B A;  4J2F A;  3ZML A;  2DJK A;  3GSS A;  1WJK A;  3GST A;  2GVP A;  2HSN B;  2QSI A;  3N5O A;  2YV9 A;  4TR0 A;  4WF4 A;  3AY8 A;  4PUR A;  1YEX A;  2HRF A;  1J08 A;  4D73 A;  4IGJ A;  5FWG A;  4XS1 A;  3KXO A;  2GTU A;  2I9H A;  3KCM A;  2HSH A;  2CZ3 A;  1ACV A;  4GRF A;  4NMU A;  1DE1 A;  4BVX A;  3MWH A;  2YAN A;  2G2Q A;  4XHM A;  2IN3 A;  5G5E A;  3GX8 A;  3W8S A;  1VF4 A;  2ALB A;  1XWB A;  1USB A;  3QR6 A;  3G9B A;  1M7T A;  2A2S A;  2H6Z A;  3RDW A;  1TI1 A;  2CX4 A;  2VCZ A;  2O7K A;  11GS A;  1NSW A;  1V98 A;  4BWS A;  1R26 A;  2IME A;  2C0G A;  4MF6 A;  1XWG A;  3F9U A;  2R5G A;  3G7I A;  1E6B A;  2X64 A;  2KHP A;  1GSY A;  2V6O A;  4OCE A;  3J7Y b;  4FYB A;  5F05 A;  4O32 A;  3PPU A;  4RQR A;  4BL7 B;  5AN1 A;  1X0R A;  5HQP A;  3ERG A;  4YQV A;  2P5R A;  2GQM A;  3VPT A;  4Q5F A;  3A2V A;  3TUE A;  2FWH A;  4NXI A;  2H1B A;  16GS A;  3UMA A;  2H01 A;  2L4C A;  1PX6 A;  4G19 A;  3APO A;  5KN1 A;  3VWU A;  1TRS A;  4EO3 A;  3VUR A;  3H1N A;  3RBT A;  1B9Y C;  3GH9 A;  2B1K A;  4ECI A;  2OE1 A;  3GA4 A;  2VM1 A;  2PPT A;  4OO5 A;  2NDO A;  1O8X A;  3ZIT A;  2YWO A;  3KTL A;  4XRA A;  4DVC A;  1I9D A;  2RLI A;  4ZXG A;  5L71 A;  2GDR A;  1Z6M A;  2HRN A;  4KX4 A;  4HZ2 A;  4KA0 A;  2BTO T;  5DAL B;  4AF2 A;  3IE3 A;  3KEB A;  2WRT A;  4JU5 A;  2V32 A;  3CBU A;  4EDY A;  3D6I A;  2C8U A;  4TXO A;  1GSU A;  2H76 A;  2AYT A;  2DMM A;  2MBS A;  4YQU A;  3D22 A;  3EU3 A;  2HLS A;  5CRH A;  3TDG A;  2NTO A;  3DWV A;  2MMA A;  2R37 A;  5ID2 A;  2H6Y A;  3TJK A;  3LJR A;  2O89 A;  3QMX A;  2IMD A;  4OD7 A;  3GTU A;  1OAZ A;  1T1V A;  4NHW A;  2VAF A;  2TRC P;  3D4T A;  1EGR A;  2B7J A;  1U88 A;  2XHF A;  3EUR A;  2MMO A;  4K8M A;  19GS A;  4NWY A;  3A3T A;  3ZFL A;  2QC7 A;  2B5E A;  1EOH A;  1MTC A;  4HZ4 A;  1Z7P A;  2NPB A;  3D0Z A;  3TB2 A;  5AGY A;  3HHV A;  5LNK e;  5IOW A;  1TOF A;  4JE1 A;  3ZRD A;  1A0F A;  4GCI A;  1DE2 A;  4PXO A;  3QD9 A;  1T4Z A;  5ENU A;  2WZ9 A;  1K0O A;  2LRC A;  1A8Y A;  3VI7 A;  1RK4 A;  3F63 A;  3GIX A;  1ML6 A;  4E8H A;  3BJ5 A;  3LYP A;  4AJ8 A;  1PD2 1;  5JWO B;  2L5L A;  3H79 A;  4WET A;  2HSY A;  3QAV A;  3C8E A;  5A4V A;  3FR3 A;  4MJC A;  2PGT A;  1M2A A;  5D9V A;  4FQU A;  3KIJ A;  1F37 A;  2G0F A;  4HU9 A;  1FAA A;  5IM9 A;  4IVF A;  1XW6 A;  1ILO A;  5D9W A;  4MJB A;  5ECO B;  2P31 A;  4NAX A;  1GH2 A;  2QGV A;  4LA1 A;  2HT9 A;  2H0I A;  1YF1 A;  2XBQ A;  1G7O A;  4HJM A;  3CXG A;  4KW6 A;  1ZL9 A;  3FYG A;  2C0F A;  4MPG A;  5DJL A;  4AJ7 A;  3FR9 A;  3CYN A;  3IK7 A;  4KCE A;  2LJK A;  4I5Q A;  1LU4 A;  3DEX A;  4KH7 A;  2GT6 A;  4L5O A;  1FVK A;  1U6T A;  4L8E A;  3KMN A;  2D2Z A;  3HZ8 A;  1W89 A;  4LLR A;  1G7E A;  1NHO A;  3WGE A;  4ECB A;  3QFA C;  2O87 A;  1TXX A;  3BCK A;  5G5F A;  4V1A p;  4IQ1 A;  2X8G A;  4CHS A;  3UVT A;  4ILF A;  6GSW A;  2JAD A;  1T8E B;  2DC5 A;  1V57 A;  1G6Y A;  4TXO B;  3LYK A;  3US3 A;  3KJY A;  3ZL5 A;  5J9B A;  2LTK A;  1M2D A;  1AQW A;  4F0C A;  3C7M A;  2C4J A;  3WD6 A;  1J9B A;  1K3L A;  4L0W A;  1PA3 A;  5ID2 B;  1QK8 A;  1R5A A;  4KND A;  1EZK A;  2GT5 A;  3GKN A;  1VF3 A;  4X0X A;  3GL5 A;  3VK9 A;  5CRE A;  3GTU B;  3TOT A;  1ZMA A;  4HQS A;  5J41 A;  3MAK A;  5ECK B;  3TRP A;  2PMT A;  1EP7 A;  2M80 A;  3A5W A;  3W6G A;  3P2A A;  3WT1 A;  4HS1 A;  3GKK A;  3WYW A;  4FH8 A;  1A2L A;  5HFG A;  2C0D A;  3HD5 A;  2V2G A;  1ABA A;  1XPV A;  5CP1 A;  1I5G A;  2OA7 A;  1SL1 B;  3GL3 A;  2O8V B;  3F4T A;  5GAP D;  2ZCT A;  4FYU A;  2I81 A;  4EE0 A;  2MMN A;  4MCU A;  2RII A;  1ZCP A;  3L9S A;  4WEY A;  4ID0 A;  1G6W A;  1YY7 A;  3N9J A;  1OKD A;  1GUM A;  1O85 A;  2GZP A;  3IXR A;  1S3D A;  1WMJ A;  2H1A A;  4TN8 A;  2GLR A;  1H75 A;  1PKW A;  1GUL A;  5ECQ B;  5A4W A;  3GNJ A;  2VLU A;  2AAW A;  5DQY A;  2A4V A;  5IMF A;  5COH A;  2H70 A;  1DSB A;  1VGL A;  2X8H A;  2GSR A;  1SKS B;  3KTB A;  3APQ A;  4MJA A;  2YWI A;  2KP1 A;  3GYK A;  3V1W A;  1TK0 B;  3SWL A;  1ZYE A;  5HFK A;  1TP9 A;  1F3B A;  5DDL A;  1SKR B;  1KBN A;  1OC3 A;  1XWA A;  2OBK A;  5D96 A;  4O5R A;  4ZB9 A;  1Q98 A;  3HDC A;  3C73 A;  2YJH A;  1YDK A;  2FNO A;  1HYU A;  1QGV A;  1XVW A;  5B7C A;  1V58 A;  2VL9 A;  4GF0 A;  4E8E A;  1JZW A;  1PGT A;  1PSQ A;  5JWQ B;  5C04 A;  3TJF A;  1EV9 A;  3R3E A;  1AW9 A;  2H1D A;  4PTS A;  2FY6 A;  2CZ2 A;  3EE2 A;  4PQ1 A;  1SD8 A;  4ECC A;  1OE8 A;  3QAG A;  3TJJ A;  2H74 A;  1TI3 A;  2VUP A;  1DUG A;  2R3X A;  4GSS A;  1TK5 B;  1MD4 A;  4BVY B;  3E3E A;  4GQF A;  1THX A;  4NV5 A;  3IAS 2;  5JWR B;  5HFI A;  1GTU A;  3ZIJ A;  4MAB A;  4HOJ A;  3I69 A;  3IA1 A;  3UEM A;  1SK2 A;  2LRT A;  2OAD A;  1TDI A;  2IPA A;  3HZ4 A;  4ZBD A;  2HSM A;  3F4S A;  3SBC A;  1TK8 B;  5DQS A;  4KAE A;  3F3R A;  1M9A A;  4IW9 A;  1YJ6 A;  5ECI B;  1TU8 A;  2LRN A;  3EIN A;  2RM5 A;  4KF9 A;  3VWW A;  4TR4 A;  1H4O A;  1T3B A;  2VOC A;  5GZZ B;  1TRV A;  3BOA A;  4IKH A;  1ON4 A;  4GSN A;  1XW9 A;  1U3A A;  5HR1 A;  1K0A A;  2LST A;  5DBQ A;  5KN2 A;  3HKR A;  1V40 A;  1ST9 A;  3TJB A;  1GNE A;  2GQK A;  3TGZ A;  3UJ1 A;  1B48 A;  2F9S A;  3TOU A;  4Q5N A;  1A0R P;  1PRX A;  2CQ9 A;  3ME8 A;  1GSS A;  4MZB A;  4HEA 2;  1HD2 A;  3FZ5 A;  2MYG A;  2H0G A;  2YJ7 A;  1XWK A;  4JR4 A;  2PUK C;  4ECJ A;  3LXZ A;  12GS A;  4ACS A;  2VD1 A;  4LMW A;  2VL2 C;  2CVK A;  3IC4 A;  2HZE A;  4WF5 A;  1E2Y A;  2YZH A;  3QDN A;  3G7Y A;  2C3N A;  5D73 A;  2I3Y A;  4XS6 A;  3P7X A;  1ZGN A;  3R2Q A;  3CTG A;  1XFL A;  4MMM A;  4POK A;  1PKZ A;  1AUC A;  3UOM A;  2PVQ A;  3M9K A;  2YP6 A;  3GV1 A;  4G0L A;  6GSY A;  2EIQ A;  2WUL A;  4HU7 A;  2LS5 A;  4X1U A;  3PGT A;  1AXD A;  1G0T A;  4EKZ A;  4KDY A;  2P0G A;  5H5S A;  5EVO A;  3C1R A;  4DSS A;  5F06 A;  2YWN A;  4XS4 A;  3KZQ A;  1ERV A;  3NIV A;  3U5R E;  3LG6 A;  2YPM A;  5F0G A;  2C80 A;  4G0K A;  1ERU A;  4F0B A;  1FB0 A;  1X9W B;  2HZF A;  2BMX A;  3ZFB A;  1MDJ A;  4K0N A;  1O8W A;  2GZZ A;  2EIR A;  1J0F A;  4MZW A;  1SU9 A;  2EC4 A;  1WRY A;  17GS A;  3FKF A;  3GKX A;  1F2E A;  4ZIJ A;  3WGD A;  3RPN A;  1WIK A;  1K0D A;  2K8S A;  1GLQ A;  3DXB A;  3HVV A;  4J57 E;  3F0I A;  2HSM B;  5DAK A;  1O6J A;  2B7K A;  4EF0 A;  2LNT A;  1XZO A;  2R4V A;  3L4N A;  1Y6E A;  3PIN A;  3MDK A;  2PER A;  3BBY A;  1AQV A;  1K0C A;  3J7Y k;  1NW2 A;  3L9V A;  2DJJ A;  3F4R A;  1ZYQ B;  4WR4 A;  5EY6 A;  1OC9 A;  4HI7 A;  2DLX A;  1URM A;  5JCW A;  4WXT A;  2LJR A;  3UIW A;  3TKQ A;  4D73 B;  1GUH A;  5DVB A;  3GFK A;  4PUF C;  1SL2 B;  1HQO A;  1GP1 A;  2OBI A;  4F2I A;  3P8W A;  4BVX B;  3DIE A;  2N5F A;  3DRN A;  1CQG A;  4L0U A;  2P5Q A;  3Q6O A;  1EOG A;  2V6K A;  4GQC A;  2E0Q A;  1X9M B;  1PL1 A;  1YZX A;  3MNG A;  1SK1 A;  4YQM A;  1X5E A;  3TKS E;  1VRS D;  3VLN A;  2IMF A;  2PVO C;  4MJE A;  1SK0 A;  3UL3 A;  5D9X A;  1UN2 A;  2QKE A;  2H75 A;  4V2M A;  5GST A;  1T4Y A;  4LL4 B;  5GSS A;  1A2M A;  2VLV A;  3LEF A;  3LGC A;  3CTF A;  4HDE A;  4ZB8 A;  4IEL A;  4KGI A;  4PNF A;  2CAQ A;  2OE0 A;  3EMP A;  1SD9 A;  2E7P A;  1SJZ A;  1JZO A;  4POL A;  2HRA A;  3F6D A;  4F82 A;  1QMV A;  4QQ7 A;  2K8V A;  4OFN A;  5G2Z A;  2JSZ A;  3TKS C;  3ME7 A;  2C1Y A;  5HR3 A;  5IMC A;  2IMK A;  3ZVJ D;  1TU7 A;  4JRR A;  1JZD A;  3TKR A;  2RUF A;  1VF1 A;  4V1A g;  4DSS B;  1XXU A;  1YEP A;  4F03 A;  2KP2 A;  2VM2 A;  3HJP A;  4XS4 B;  3ZIV A;  2H71 A;  1GSQ A;  3HCZ A;  1X5D A;  3CSJ A;  6GSX A;  4QL9 A;  3VFI A;  8GSS A;  2L57 A;  2E2G A;  1K0N A;  1JHB A;  3W8J A;  1PQN A;  1XBS A;  1GRX A;  5KN0 A;  4I2T A;  3LWA A;  4NV2 A;  4MF5 A;  1GSF A;  3TRQ A;  2XPE A;  2B5Y A;  2IJY A;  3H8Q A;  5E59 A;  2V1M A;  5DAK B;  4YAV A;  3QAW A;  1X5C A;  4NPB A;  4FO5 A;  1WP0 A;  1GLP A;  1SYX A;  5B6M A;  3Q18 A;  5ELA A;  3BD2 A;  4AJ6 A;  4TR1 A;  1C72 A;  1OC9 B;  2LV3 A;  1FG4 A;  2FLS A;  1JZR A;  4MPF A;  1M0U A;  4ULX A;  4L5L A;  4K2D A;  1Z6N A;  3E9J B;  1PL2 A;  2WS2 A;  3LXT A;  4O7H A;  4I97 A;  2IL3 A;  3RHB A;  4Q5R A;  2VCW A;  1HNA A;  1MDK A;  2H30 A;  3QCP A;  5AIX A;  3JCM L;  2ES7 A;  2AUV A;  2HXK A;  4HJ2 A;  5G1K A;  4ZB6 A;  2GSQ A;  1AIU A;  1BQ7 A;  5CAX A;  3VWX A;  4JBB A;  4EVM A;  2C0E A;  5HR2 A;  3QPM A;  1FVJ A; 
#chains in the Genus database with same CATH topology
 2GST A;  5DJM A;  3EMX A;  1GSD A;  1PX7 A;  4BPY A;  4QL7 A;  1SKW B;  4MH3 A;  5A34 B;  1EEJ A;  2C3Q A;  3ISO A;  5J4Y A;  2IFQ A;  1X9S B;  5CRG A;  4XTS A;  3LFL A;  5EPF A;  2WGR A;  4ML6 A;  2OKA A;  2GGT A;  1GTI A;  4G0I A;  2MBT A;  2VD0 A;  3GKM A;  2X4A A;  1UA5 A;  5IMV A;  2FWG A;  3UAR A;  3Q19 A;  1A24 A;  1NHY A;  3CSI A;  4N10 A;  5J5N A;  1K3O A;  1N25 A;  2M72 A;  3LOR A;  4GWR A;  2YCD A;  5BRT A;  2CVD A;  5CYY A;  4OO4 A;  5C00 A;  2M46 A;  4YH2 A;  2DIY A;  5ELG A;  4BA7 A;  1QFN A;  3KMO A;  1SJ6 A;  2DSA A;  4BWQ A;  1IYH A;  4OFT A;  3VPQ A;  4ZBB A;  1AQX A;  1UC7 A;  2VIM A;  5ECN B;  5J40 A;  1SEN A;  3F3Q A;  2JZS A;  5IQY A;  5IPH A;  1B4Q A;  3MSZ A;  5J4U A;  2DKH A;  4MA9 A;  1THO A;  22GS A;  1WWJ A;  5LCZ A;  3DD3 A;  13GS A;  4AGS A;  5G30 A;  3O6T A;  3OR5 A;  1UVZ A;  4G01 A;  1EGO A;  5IOX A;  1I1I P;  2UZ8 A;  1Z5Y E;  5GAN D;  4MK3 A;  5INY A;  4PUA A;  2CV4 A;  1V2A A;  1M2B A;  3H4K A;  1FW1 A;  1LBK A;  1BG5 A;  4TW5 A;  2J9H A;  1FHE A;  1K0B A;  3LSZ A;  1M3J A;  1GL8 A;  3M9J A;  5ECM B;  3E0U A;  2H0H A;  3IOS A;  5ECP B;  5J47 A;  3DVW A;  3FR6 A;  2A4H A;  4IN0 A;  4DSR A;  1GTA A;  2DJ2 A;  5B8A A;  3BCI A;  5IO0 A;  2OE3 A;  2NBS A;  4HUA A;  4O5U A;  5E4W A;  1QXH A;  4KE3 A;  1GWC A;  5D93 A;  2GQL A;  2WZS A;  1YEW C;  1Z9H A;  2H73 A;  1N8J A;  3D21 A;  3DVX A;  4TXV A;  2E2M A;  2ZUP A;  2J23 A;  2REM A;  1MEK A;  1WOU A;  2ZNM A;  2CAI A;  3FK8 A;  1O7U A;  2DJ3 A;  2HQT A;  1BED A;  4K7N A;  2Z9S A;  3ERW A;  3GUR A;  1XW5 A;  4IJI A;  4JR6 A;  2HNL A;  2PN8 A;  1EWX A;  3IAM 2;  2YZU A;  3ZVJ A;  4P3Y B;  2YOI A;  2B3S A;  4KDU A;  3M3M A;  4AKI A;  2VO4 A;  2EFE A;  3D5J A;  2L6C A;  2L6D A;  5CO3 A;  5CNW A;  2O5V A;  3GRX A;  2B1L A;  4OWY A;  4WBJ A;  2JAC A;  2DBC A;  1U87 A;  3FW2 A;  1SL0 B;  2IFQ B;  3KP8 A;  2AHE A;  3F6F A;  2RUE A;  1BYE A;  4OFM A;  4PX1 A;  1EP8 A;  4OMV A;  4EL1 A;  5IPG A;  4HSC X;  2VCV A;  3IR4 A;  2GZY A;  1Y25 A;  1R4W A;  2WCI A;  2B5X A;  4IHU A;  4WKW A;  1TW9 A;  4O5Q A;  1T7P B;  1ZZY A;  4MDC A;  3HVN A;  4E68 A;  2YV7 A;  3TKS A;  3HJM A;  1SYR A;  1A23 A;  2NVL A;  3MYD A;  4RI6 A;  2WDU A;  1FOV A;  2CA8 A;  4F9Z A;  5G1L A;  1OC8 A;  4YKG A;  2WB9 A;  3VI5 A;  2I1U A;  1MDI A;  3P90 A;  2VL3 A;  4CDO A;  1XOB A;  1T00 A;  2F51 A;  3ERF A;  2L4Q A;  2V41 A;  5DCG A;  4FYC A;  5DCH A;  1JLV A;  5ECH B;  2FWE A;  1F3A A;  2XBI A;  9GSS A;  3VWV A;  3TRX A;  1GTB A;  3O76 A;  4MZC A;  1KTE A;  4V2L A;  3IC8 A;  1RQM A;  5ABR A;  1PFO A;  4N30 A;  4XRD A;  2PWJ A;  1Z3E A;  4ZIL A;  4MP4 A;  1XIY A;  3GN3 A;  3FZ9 A;  1GUK A;  4TVE A;  5KEJ A;  4K7O A;  1BJX A;  4Z2R A;  4MF7 A;  1A8L A;  4GDF A;  6GST A;  3FZA A;  1W4V A;  2FHE A;  1OKT A;  4IBP A;  3D4M A;  3HYP A;  1GNW A;  2F8F A;  3FHK A;  1XVQ A;  3M8N A;  3CQF A;  3DGQ A;  5ECR B;  5EL8 A;  1B9X C;  4J56 E;  4EUY A;  1Q4J A;  4LMV A;  4O92 A;  1PN9 A;  2HI7 A;  2AV4 A;  2HFD A;  2YWM A;  4K0G A;  1O81 A;  1HNB A;  1FOH A;  1YF0 A;  1YQ1 A;  2R6K A;  2LNS A;  3EYT A;  2MMZ A;  2HE3 A;  2O3E A;  3ZRE A;  3KP9 A;  2OJL A;  3IPZ A;  1K3Y A;  4G10 A;  5IO2 A;  2O85 A;  4EXJ A;  5J3R A;  2KOK A;  4N11 A;  3ED3 A;  2H1G A;  5F8B A;  4TRX A;  2MZC A;  6GSS A;  1OYJ A;  2IIY A;  4Z7X A;  1NM3 A;  4POB A;  3L78 A;  2YNX A;  7GSS A;  2XC2 A;  2FCH A;  2K9F A;  3S9F A;  3TJG A;  4DEJ A;  3EU4 A;  2ON7 A;  2VCQ A;  1B4P A;  2A2P A;  6GSV A;  2CX3 A;  3DYR A;  5F07 A;  4JED A;  3H93 A;  1EEM A;  1BX9 A;  2PU9 C;  5JCU A;  4ML1 A;  3FY7 A;  2HZE B;  2X49 A;  1KNG A;  3C1S A;  2JZR A;  2YN1 A;  4POM A;  5J4V A;  5IIZ A;  3A2X A;  5B6N A;  1GSE A;  3TKP A;  1BAY A;  4PGT A;  3A2W A;  3M1G A;  1U3I A;  3QOU A;  2HRK A;  1QUW A;  2I4A A;  4ISD A;  1PMT A;  3UBK A;  3FZ4 A;  5IMZ A;  2H19 A;  4GLT A;  1LJR A;  2WW2 A;  2FWF A;  4Q5Q A;  5JCG A;  1IYI A;  3GMF A;  4KCA A;  3NOF A;  1OE7 A;  4GTU A;  6GSU A;  2K18 A;  4TOP A;  3I9V 2;  5IMA A;  3M0F A;  3WT2 A;  1FO5 A;  2A2R A;  2TRX A;  1TKD B;  2DJ0 A;  4WR5 A;  2HYX A;  3UBL A;  3KM6 A;  4RQX A;  1EV4 A;  10GS A;  3DML A;  1FB6 A;  1KEB A;  2TIR A;  4I6X A;  3EVI A;  14GS A;  2AB6 A;  2FA4 A;  5AIV A;  3UAP A;  1TJD A;  1ERW A;  2DJ1 A;  3ZLP A;  3PR8 A;  5FHI A;  3CMI A;  1A2J A;  1CQH A;  4X43 A;  2ON5 A;  2OT3 A;  4RI7 A;  3PH9 A;  3RAZ A;  2L5O A;  4IQA A;  2LKU A;  2DIZ A;  3IK9 A;  4KDX A;  3UVH A;  4BVY A;  4ZL9 A;  3I43 A;  5FT3 A;  2OAC A;  1S3A A;  3L9U A;  3HVS A;  4H86 A;  1V9W A;  2LQO A;  5D9T A;  3I6A A;  2N5B A;  1N2A A;  5B8B A;  1AC1 A;  1MD3 A;  5G31 A;  2H66 A;  3TCO A;  1O73 A;  2H8L A;  4IJ3 A;  3ZZX A;  1F9M A;  3IDV A;  4XCS A;  3RPP A;  3U6V A;  3HVX A;  3KH9 A;  2FD3 A;  4YAP A;  3NZN A;  1R7H A;  1VF2 A;  1XCC A;  2JL4 A;  1TRU A;  2LUS A;  3K8N A;  3F8U A;  4KUN A;  4OCF A;  5BMU A;  4KSM A;  5H5R A;  3IBH A;  3FRC A;  5KOX A;  4EC0 A;  4GXZ A;  5HR0 A;  2AJQ B;  4RUV A;  3GHA A;  3RFR C;  3FEU A;  5ECS A;  3EWL A;  4G9H A;  3IV4 A;  4XIH A;  5CRW A;  3ZYW A;  2EIO A;  1XOA A;  3HMJ G;  4PNG A;  1TTZ A;  1ERT A;  4YKF A;  2IWT A;  1ZOF A;  20GS A;  3CRU A;  3G7J A;  2R2J A;  2VL2 A;  4IP6 A;  5D8I A;  4G2E A;  5A4U A;  2N5A A;  2FA8 A;  4WBR D;  5CRD A;  2WW0 A;  4K1F A;  4DSQ A;  4EDZ A;  4K5R A;  1QQ2 A;  3WGX A;  1B8X A;  5LD0 A;  1R5P A;  2VCX A;  2L59 A;  2H72 A;  2KUC A;  3HXS A;  18GS A;  2XPD A;  4ZL8 A;  2GSS A;  3CSH A;  2JZT A;  2HRK B;  2VCT A;  3TU3 B;  4KB3 A;  2LQQ A;  2BJX A;  2LEG A;  1RW1 A;  3KH7 A;  1WPI A;  4LL1 B;  2PBJ A;  1M99 A;  3GUS A;  2B6M A;  2VLT A;  4K9Z A;  3L0H A;  4BL7 A;  3QFB C;  4IP1 A;  5H5Q A;  3HJO A;  2C3T A;  4V2N A;  4ZL7 A;  4MLY A;  5IMD A;  1SJI A;  3EC3 A;  2K6V A;  1F6M C;  4K7I A;  4PQH A;  1JFU A;  4NHZ A;  2IMI A;  5AIS A;  1Z7R A;  1XWC A;  2X8C A;  1DBY A;  3APS A;  2DML A;  3ZTL A;  4N0Z A;  4KSO A;  2RM6 A;  4N0V A;  5KN3 A;  5ECL B;  3LQ7 A;  3CRT A;  1HNC A;  4AI6 A;  1JLW A;  3KGK A;  4K6X A;  4USS A;  4ZBA A;  5A5K A;  2QA2 A;  1YKC A;  4CW9 A;  2WJU A;  2H6X A;  4TR3 A;  3ZMK A;  2GS3 A;  2H1L A;  4FIW A;  4PI0 C;  4PQI A;  5DAL A;  2KLX A;  2CT6 A;  1BG1 A;  2LJA A;  3GH6 A;  3Q74 A;  5A1N B;  1K0M A;  4I2U A;  2CVB A;  2JU5 A;  3RHC A;  2JSY A;  1OVN A;  3HA9 A;  1AAZ A;  5J9C A;  4MH2 A;  1S3C A;  3IRA A;  3O3T A;  3DKS A;  1WE0 A;  2FGX A;  1YKA A;  4MNN A;  1TRW A;  3C71 A;  4TR1 B;  4JZQ A;  4TKY A;  2F3M A;  3KD0 A;  4GST A;  4IS0 A;  3HY2 A;  4HQZ A;  2WVX B;  3IHQ A;  2WFC A;  2X99 A;  3GX0 A;  1M9B A;  2F8A A;  2FUG 2;  4I8B A;  4J2F A;  3ZML A;  2DJK A;  3GSS A;  1WJK A;  3GST A;  2GVP A;  2HSN B;  5BMU B;  2QSI A;  3N5O A;  2YV9 A;  4TR0 A;  4WF4 A;  3AY8 A;  4PUR A;  1YEX A;  2HRF A;  1J08 A;  4D73 A;  4IGJ A;  5FWG A;  4XS1 A;  3KXO A;  2GTU A;  2I9H A;  3KCM A;  2HSH A;  2CZ3 A;  1ACV A;  4GRF A;  4NMU A;  1DE1 A;  4BVX A;  3MWH A;  2YAN A;  2G2Q A;  4XHM A;  2UV8 G;  2IN3 A;  5G5E A;  3GX8 A;  3W8S A;  1VF4 A;  2ALB A;  4AKH A;  1XWB A;  1USB A;  3QR6 A;  3G9B A;  1M7T A;  2A2S A;  2H6Z A;  3RDW A;  1TI1 A;  2CX4 A;  2VCZ A;  2O7K A;  11GS A;  1NSW A;  1V98 A;  4BWS A;  1R26 A;  2IME A;  2C0G A;  4MF6 A;  1XWG A;  3F9U A;  2R5G A;  3G7I A;  1E6B A;  2X64 A;  2KHP A;  1GSY A;  2V6O A;  4OCE A;  3J7Y b;  4FYB A;  4EIP A;  5F05 A;  4O32 A;  3PPU A;  4RQR A;  4BL7 B;  5AN1 A;  1X0R A;  5HQP A;  3ERG A;  4YQV A;  4FXY P;  2GQM A;  2P5R A;  3VPT A;  4Q5F A;  3RGB C;  3A2V A;  3TUE A;  2FWH A;  4NXI A;  2H1B A;  16GS A;  3UMA A;  2H01 A;  2L4C A;  1PX6 A;  4G19 A;  3APO A;  5KN1 A;  3VWU A;  1TRS A;  4EO3 A;  4CY6 A;  3VUR A;  3H1N A;  3RBT A;  1B9Y C;  3GH9 A;  2B1K A;  1S3R A;  4ECI A;  2OE1 A;  3GA4 A;  2R0P A;  2VM1 A;  2PPT A;  4OO5 A;  2NDO A;  1O8X A;  3ZIT A;  2YWO A;  3KTL A;  1SVO A;  4XRA A;  4DVC A;  1I9D A;  2RLI A;  4ZXG A;  5L71 A;  2GDR A;  1Z6M A;  2HRN A;  4KX4 A;  4HZ2 A;  4KA0 A;  4BIK A;  2BTO T;  5DAL B;  4AF2 A;  3IE3 A;  3KEB A;  2WRT A;  4JU5 A;  2V32 A;  3CBU A;  4EDY A;  3D6I A;  2C8U A;  4TXO A;  1GSU A;  2H76 A;  2AYT A;  2DMM A;  2MBS A;  4YQU A;  3D22 A;  3EU3 A;  2HLS A;  5CRH A;  3TDG A;  2NTO A;  3DWV A;  2MMA A;  2R37 A;  5ID2 A;  2H6Y A;  3TJK A;  3LJR A;  5KOW A;  2O89 A;  3QMX A;  2IMD A;  4OD7 A;  3GTU A;  1OAZ A;  1T1V A;  4NHW A;  2VAF A;  3EPT A;  2TRC P;  3D4T A;  1EGR A;  2B7J A;  1U88 A;  2XHF A;  3EUR A;  2MMO A;  4K8M A;  19GS A;  4NWY A;  3A3T A;  3ZFL A;  2QC7 A;  2B5E A;  1EOH A;  1MTC A;  4HZ4 A;  1Z7P A;  2NPB A;  3D0Z A;  3TB2 A;  5AGY A;  3HHV A;  5LNK e;  5IOW A;  1TOF A;  4JE1 A;  3ZRD A;  1A0F A;  4GCI A;  1DE2 A;  4PXO A;  3QD9 A;  1T4Z A;  5ENU A;  2WZ9 A;  1K0O A;  2LRC A;  1A8Y A;  3VI7 A;  1RK4 A;  3F63 A;  3GIX A;  1ML6 A;  4E8H A;  4PHZ C;  3BJ5 A;  3LYP A;  4AJ8 A;  1PD2 1;  5JWO B;  2L5L A;  3H79 A;  4WET A;  2HSY A;  3QAV A;  3C8E A;  5A4V A;  3FR3 A;  4MJC A;  2PGT A;  5A34 A;  1M2A A;  5D9V A;  4FQU A;  3KIJ A;  1F37 A;  2G0F A;  4HU9 A;  1FAA A;  5IM9 A;  4IVF A;  1XW6 A;  1ILO A;  5D9W A;  4MJB A;  5ECO B;  2P31 A;  4NAX A;  1GH2 A;  2QGV A;  4LA1 A;  2HT9 A;  1S4B P;  2H0I A;  1YF1 A;  2XBQ A;  1G7O A;  4HJM A;  3CXG A;  4KW6 A;  1ZYN A;  1ZL9 A;  3FYG A;  2C0F A;  4MPG A;  5DJL A;  4AJ7 A;  3FR9 A;  3CYN A;  3IK7 A;  4KCE A;  4ICY A;  2LJK A;  4I5Q A;  1LU4 A;  3DEX A;  4KH7 A;  2GT6 A;  4L5O A;  1FVK A;  1U6T A;  4L8E A;  3KMN A;  2D2Z A;  3HZ8 A;  1W89 A;  4LLR A;  1G7E A;  1NHO A;  3WGE A;  4ECB A;  3QFA C;  2O87 A;  1TXX A;  3BCK A;  5G5F A;  4V1A p;  4IQ1 A;  2X8G A;  4CHS A;  3UVT A;  4ILF A;  6GSW A;  2JAD A;  1T8E B;  2DC5 A;  1V57 A;  1G6Y A;  4TXO B;  3LYK A;  3US3 A;  2WVZ A;  3KJY A;  3ZL5 A;  5J9B A;  2LTK A;  1M2D A;  1AQW A;  4F0C A;  3C7M A;  1TXU A;  2C4J A;  3WD6 A;  1J9B A;  1K3L A;  4L0W A;  1PA3 A;  5ID2 B;  1QK8 A;  1R5A A;  4KND A;  1EZK A;  2GT5 A;  3GKN A;  1VF3 A;  4X0X A;  3GL5 A;  3VK9 A;  5CRE A;  3GTU B;  3TOT A;  1ZMA A;  4HQS A;  5J41 A;  3MAK A;  5ECK B;  3TRP A;  2PMT A;  1EP7 A;  2M80 A;  3A5W A;  3W6G A;  3P2A A;  3WT1 A;  4HS1 A;  4CY8 A;  3GKK A;  3WYW A;  4FH8 A;  1A2L A;  5HFG A;  2C0D A;  3HD5 A;  2V2G A;  1ABA A;  1XPV A;  5CP1 A;  1I5G A;  2OA7 A;  1SL1 B;  2O36 A;  3GL3 A;  2O8V B;  3F4T A;  5GAP D;  2ZCT A;  4FYU A;  1SVL A;  2I81 A;  4EE0 A;  2MMN A;  4MCU A;  2RII A;  1ZCP A;  4X4J A;  3L9S A;  4WEY A;  4ID0 A;  1G6W A;  1YY7 A;  3N9J A;  1OKD A;  1GUM A;  1O85 A;  2GZP A;  3IXR A;  1S3D A;  1WMJ A;  2H1A A;  4TN8 A;  4A5P A;  4Z2U A;  2GLR A;  1H75 A;  1PKW A;  1GUL A;  5ECQ B;  5A4W A;  3GNJ A;  2VLU A;  2AAW A;  5DQY A;  2A4V A;  5IMF A;  5COH A;  2H70 A;  1DSB A;  1VGL A;  2X8H A;  2GSR A;  1SKS B;  3KTB A;  3APQ A;  4MJA A;  1PN0 A;  2YWI A;  2KP1 A;  3GYK A;  3V1W A;  1TK0 B;  3SWL A;  1ZYE A;  5HFK A;  1TP9 A;  3LW9 A;  1F3B A;  2R0G A;  5DDL A;  1ZYP A;  1SKR B;  1KBN A;  1OC3 A;  2WVY A;  2QA1 A;  1XWA A;  2OBK A;  5D96 A;  4O5R A;  4ZB9 A;  1Q98 A;  3HDC A;  3C73 A;  2YJH A;  1YDK A;  2FNO A;  1HYU A;  1QGV A;  4PI2 C;  1XVW A;  5B7C A;  2VL9 A;  1V58 A;  4GF0 A;  4E8E A;  1JZW A;  1PGT A;  1PSQ A;  5JWQ B;  5C04 A;  3TJF A;  1EV9 A;  3R3E A;  1AW9 A;  2H1D A;  4PTS A;  2FY6 A;  2CZ2 A;  3EE2 A;  4PQ1 A;  1SD8 A;  4ECC A;  1OE8 A;  3QAG A;  3TJJ A;  2H74 A;  1TI3 A;  2VUP A;  1DUG A;  2R3X A;  4GSS A;  1TK5 B;  1MD4 A;  4BVY B;  3E3E A;  4GQF A;  4AKX B;  1THX A;  4NV5 A;  3IAS 2;  5JWR B;  5HFI A;  1GTU A;  3ZIJ A;  4MAB A;  4HOJ A;  3I69 A;  3IA1 A;  3UEM A;  1SK2 A;  2LRT A;  2OAD A;  1TDI A;  2IPA A;  3HZ4 A;  4ZBD A;  2HSM A;  3F4S A;  3SBC A;  1TK8 B;  5DQS A;  4KAE A;  3F3R A;  1M9A A;  4IW9 A;  1YJ6 A;  5ECI B;  1TU8 A;  2LRN A;  3EIN A;  2RM5 A;  4KF9 A;  3VWW A;  4TR4 A;  1H4O A;  1T3B A;  2VOC A;  5GZZ B;  1TRV A;  3BOA A;  4IKH A;  1ON4 A;  4GSN A;  1XW9 A;  1U3A A;  5HR1 A;  1K0A A;  2LST A;  5DBQ A;  5KN2 A;  3HKR A;  1V40 A;  1ST9 A;  3TJB A;  1GNE A;  2GQK A;  3TGZ A;  3UJ1 A;  1B48 A;  2F9S A;  3TOU A;  4Q5N A;  1A0R P;  1PRX A;  2CQ9 A;  3ME8 A;  4K5S A;  1GSS A;  4MZB A;  4HEA 2;  1HD2 A;  3FZ5 A;  2MYG A;  2H0G A;  2YJ7 A;  1XWK A;  4JR4 A;  2PUK C;  4ECJ A;  3LXZ A;  12GS A;  4ACS A;  2VD1 A;  4LMW A;  2VL2 C;  2CVK A;  3IC4 A;  2HZE A;  4WF5 A;  1E2Y A;  2YZH A;  3QDN A;  2EFC A;  3G7Y A;  2C3N A;  5D73 A;  2I3Y A;  4XS6 A;  3P7X A;  1ZGN A;  3MIX A;  3R2Q A;  3CTG A;  1XFL A;  4MMM A;  4POK A;  1PKZ A;  1AUC A;  3UOM A;  2PVQ A;  3M9K A;  2YP6 A;  2VKZ G;  3GV1 A;  4Z2T A;  4G0L A;  6GSY A;  2EIQ A;  2WUL A;  4HU7 A;  2LS5 A;  4X1U A;  3PGT A;  1AXD A;  1G0T A;  4EKZ A;  4KDY A;  2P0G A;  5H5S A;  5EVO A;  3C1R A;  4DSS A;  5F06 A;  2YWN A;  4XS4 A;  3KZQ A;  1ERV A;  3NIV A;  3U5R E;  3LG6 A;  2YPM A;  5F0G A;  2C80 A;  4G0K A;  4QMK A;  1ERU A;  4F0B A;  1FB0 A;  1X9W B;  2HZF A;  2BMX A;  3ZFB A;  1MDJ A;  4K0N A;  1O8W A;  2GZZ A;  2WW1 A;  2EIR A;  1J0F A;  4MZW A;  1SU9 A;  2EC4 A;  2EFD A;  1WRY A;  4K2X A;  17GS A;  3FKF A;  3GKX A;  1F2E A;  4ZIJ A;  3WGD A;  3RPN A;  1WIK A;  2WW3 A;  1K0D A;  2K8S A;  1GLQ A;  3CWG A;  3DXB A;  3HVV A;  4J57 E;  3F0I A;  2HSM B;  5DAK A;  1O6J A;  2EFH A;  2B7K A;  4EF0 A;  2LNT A;  1XZO A;  2R4V A;  3L4N A;  1Y6E A;  3PIN A;  3MDK A;  2PER A;  3BBY A;  1AQV A;  1K0C A;  3J7Y k;  1NW2 A;  3L9V A;  2DJJ A;  3F4R A;  1ZYQ B;  4WR4 A;  5EY6 A;  1OC9 A;  4HI7 A;  2DLX A;  1URM A;  1YVL A;  5JCW A;  4WXT A;  2LJR A;  3UIW A;  5A5H A;  3TKQ A;  4D73 B;  1GUH A;  5DVB A;  3GFK A;  4PUF C;  1SL2 B;  1HQO A;  1GP1 A;  2OBI A;  4F2I A;  3A5I A;  3P8W A;  4ZB7 A;  4BVX B;  3DIE A;  2N5F A;  3DRN A;  1CQG A;  3FMW A;  4L0U A;  2P5Q A;  4N3Z A;  3Q6O A;  1EOG A;  2V6K A;  4GQC A;  2E0Q A;  1X9M B;  1PL1 A;  1YZX A;  3MNG A;  1SK1 A;  1M3I A;  4W66 A;  4YQM A;  1X5E A;  3TKS E;  1VRS D;  3VLN A;  2IMF A;  2PVO C;  4MJE A;  1SK0 A;  3UL3 A;  5D9X A;  1UN2 A;  2QKE A;  2H75 A;  4V2M A;  5GST A;  1T4Y A;  4LL4 B;  5GSS A;  1A2M A;  2VLV A;  3LEF A;  3LGC A;  3CTF A;  4HDE A;  4ZB8 A;  4IEL A;  4KGI A;  4PNF A;  2CAQ A;  2OE0 A;  3EMP A;  1SD9 A;  2E7P A;  1SJZ A;  1JZO A;  4POL A;  2HRA A;  3F6D A;  4F82 A;  4EIQ A;  1QMV A;  4QQ7 A;  2K8V A;  4OFN A;  5G2Z A;  2JSZ A;  3TKS C;  3ME7 A;  4AKG A;  2C1Y A;  5HR3 A;  5IMC A;  2IMK A;  3ZVJ D;  1TU7 A;  4JRR A;  1JZD A;  3TKR A;  2RUF A;  1VF1 A;  4V1A g;  2R0C A;  3CHX C;  4DSS B;  1XXU A;  1YEP A;  4F03 A;  2KP2 A;  2VM2 A;  3HJP A;  4XS4 B;  3ZIV A;  2H71 A;  3IHG A;  1GSQ A;  3HCZ A;  1X5D A;  3CSJ A;  6GSX A;  4QL9 A;  3VFI A;  8GSS A;  2L57 A;  2E2G A;  1K0N A;  1JHB A;  3W8J A;  1PQN A;  1XBS A;  1GRX A;  5KN0 A;  4I2T A;  3LWA A;  4NV2 A;  4MF5 A;  1GSF A;  3TRQ A;  2XPE A;  2B5Y A;  2IJY A;  3H8Q A;  5A1N A;  2V1M A;  5E59 A;  5DAK B;  1XG8 A;  1Y1U A;  4YAV A;  3QAW A;  1X5C A;  4NPB A;  4FO5 A;  1WP0 A;  1GLP A;  1SYX A;  5B6M A;  1SVM A;  3Q18 A;  5ELA A;  3BD2 A;  4AJ6 A;  4TR1 A;  1C72 A;  1OC9 B;  2LV3 A;  1FG4 A;  2FLS A;  2DKI A;  1JZR A;  4MPF A;  2WVX A;  1BF5 A;  5A5H B;  1M0U A;  4ULX A;  4L5L A;  4K2D A;  1Z6N A;  3E9J B;  1PL2 A;  2WS2 A;  2HSN A;  3LXT A;  4O7H A;  4I97 A;  2IL3 A;  3RHB A;  4Q5R A;  2VCW A;  1HNA A;  1MDK A;  2H30 A;  3QCP A;  5AIX A;  3JCM L;  2ES7 A;  2AUV A;  2HXK A;  4HJ2 A;  5G1K A;  4ZB6 A;  2GSQ A;  1AIU A;  1BQ7 A;  5CAX A;  3VWX A;  4JBB A;  4EVM A;  2C0E A;  5HR2 A;  3QPM A;  1FVJ A; 
#chains in the Genus database with same CATH homology
 2GST A;  5DJM A;  3EMX A;  1GSD A;  1PX7 A;  4BPY A;  4QL7 A;  1SKW B;  4MH3 A;  5A34 B;  1EEJ A;  2C3Q A;  3ISO A;  5J4Y A;  2IFQ A;  1X9S B;  5CRG A;  4XTS A;  3LFL A;  5EPF A;  2WGR A;  4ML6 A;  2OKA A;  2GGT A;  1GTI A;  4G0I A;  2MBT A;  2VD0 A;  3GKM A;  2X4A A;  1UA5 A;  5IMV A;  2FWG A;  3UAR A;  3Q19 A;  1A24 A;  1NHY A;  3CSI A;  4N10 A;  5J5N A;  1K3O A;  1N25 A;  2M72 A;  3LOR A;  4GWR A;  2YCD A;  5BRT A;  2CVD A;  5CYY A;  4OO4 A;  5C00 A;  2M46 A;  4YH2 A;  2DIY A;  5ELG A;  4BA7 A;  1QFN A;  3KMO A;  1SJ6 A;  2DSA A;  4BWQ A;  1IYH A;  4OFT A;  3VPQ A;  4ZBB A;  1AQX A;  1UC7 A;  2VIM A;  5ECN B;  5J40 A;  1SEN A;  3F3Q A;  2JZS A;  5IQY A;  5IPH A;  1B4Q A;  3MSZ A;  5J4U A;  2DKH A;  4MA9 A;  1THO A;  22GS A;  1WWJ A;  5LCZ A;  3DD3 A;  13GS A;  4AGS A;  5G30 A;  3O6T A;  3OR5 A;  1UVZ A;  4G01 A;  1EGO A;  5IOX A;  2UZ8 A;  1Z5Y E;  5GAN D;  4MK3 A;  5INY A;  4PUA A;  2CV4 A;  1V2A A;  1M2B A;  3H4K A;  1FW1 A;  1LBK A;  1BG5 A;  4TW5 A;  2J9H A;  1FHE A;  1K0B A;  3LSZ A;  1GL8 A;  3M9J A;  5ECM B;  3E0U A;  2H0H A;  3IOS A;  5ECP B;  5J47 A;  3DVW A;  3FR6 A;  2A4H A;  4IN0 A;  4DSR A;  1GTA A;  2DJ2 A;  5B8A A;  3BCI A;  5IO0 A;  2OE3 A;  2NBS A;  4HUA A;  4O5U A;  5E4W A;  1QXH A;  4KE3 A;  1GWC A;  5D93 A;  2GQL A;  1Z9H A;  2H73 A;  1N8J A;  3D21 A;  3DVX A;  4TXV A;  2E2M A;  2ZUP A;  2J23 A;  2REM A;  1MEK A;  1WOU A;  2ZNM A;  2CAI A;  3FK8 A;  1O7U A;  2DJ3 A;  2HQT A;  1BED A;  4K7N A;  2Z9S A;  3ERW A;  3GUR A;  1XW5 A;  4IJI A;  4JR6 A;  2HNL A;  2PN8 A;  1EWX A;  3IAM 2;  2YZU A;  3ZVJ A;  4P3Y B;  2YOI A;  2B3S A;  4KDU A;  3M3M A;  4AKI A;  2VO4 A;  2EFE A;  3D5J A;  2L6C A;  2L6D A;  5CO3 A;  5CNW A;  2O5V A;  3GRX A;  2B1L A;  4OWY A;  4WBJ A;  2JAC A;  2DBC A;  1U87 A;  3FW2 A;  1SL0 B;  2IFQ B;  3KP8 A;  2AHE A;  3F6F A;  2RUE A;  1BYE A;  4OFM A;  4PX1 A;  1EP8 A;  4OMV A;  4EL1 A;  5IPG A;  2VCV A;  3IR4 A;  2GZY A;  1Y25 A;  1R4W A;  2WCI A;  2B5X A;  4IHU A;  4WKW A;  1TW9 A;  4O5Q A;  1T7P B;  1ZZY A;  4MDC A;  4E68 A;  2YV7 A;  3TKS A;  3HJM A;  1SYR A;  1A23 A;  2NVL A;  3MYD A;  4RI6 A;  2WDU A;  1FOV A;  2CA8 A;  4F9Z A;  5G1L A;  1OC8 A;  4YKG A;  2WB9 A;  3VI5 A;  2I1U A;  1MDI A;  3P90 A;  2VL3 A;  4CDO A;  1XOB A;  1T00 A;  2F51 A;  3ERF A;  2L4Q A;  2V41 A;  5DCG A;  4FYC A;  5DCH A;  1JLV A;  5ECH B;  2FWE A;  1F3A A;  2XBI A;  9GSS A;  3VWV A;  3TRX A;  1GTB A;  3O76 A;  4MZC A;  1KTE A;  4V2L A;  3IC8 A;  1RQM A;  5ABR A;  4N30 A;  4XRD A;  2PWJ A;  1Z3E A;  4ZIL A;  4MP4 A;  1XIY A;  3GN3 A;  3FZ9 A;  1GUK A;  4TVE A;  5KEJ A;  4K7O A;  1BJX A;  4Z2R A;  4MF7 A;  1A8L A;  4GDF A;  6GST A;  3FZA A;  1W4V A;  2FHE A;  1OKT A;  4IBP A;  3D4M A;  3HYP A;  1GNW A;  2F8F A;  3FHK A;  1XVQ A;  3M8N A;  3DGQ A;  5ECR B;  5EL8 A;  1B9X C;  4J56 E;  4EUY A;  1Q4J A;  4LMV A;  4O92 A;  1PN9 A;  2HI7 A;  2AV4 A;  2HFD A;  2YWM A;  4K0G A;  1O81 A;  1HNB A;  1FOH A;  1YF0 A;  1YQ1 A;  2R6K A;  2LNS A;  3EYT A;  2MMZ A;  2HE3 A;  3ZRE A;  3KP9 A;  2OJL A;  3IPZ A;  1K3Y A;  4G10 A;  5IO2 A;  2O85 A;  4EXJ A;  5J3R A;  2KOK A;  4N11 A;  3ED3 A;  2H1G A;  5F8B A;  4TRX A;  2MZC A;  6GSS A;  1OYJ A;  2IIY A;  4Z7X A;  1NM3 A;  4POB A;  3L78 A;  2YNX A;  7GSS A;  2XC2 A;  2FCH A;  2K9F A;  3S9F A;  3TJG A;  4DEJ A;  3EU4 A;  2ON7 A;  2VCQ A;  1B4P A;  2A2P A;  6GSV A;  2CX3 A;  3DYR A;  5F07 A;  4JED A;  3H93 A;  1EEM A;  1BX9 A;  2PU9 C;  5JCU A;  4ML1 A;  3FY7 A;  2HZE B;  2X49 A;  1KNG A;  3C1S A;  2JZR A;  2YN1 A;  4POM A;  5J4V A;  5IIZ A;  3A2X A;  5B6N A;  1GSE A;  3TKP A;  1BAY A;  4PGT A;  3A2W A;  3M1G A;  1U3I A;  3QOU A;  2HRK A;  1QUW A;  2I4A A;  4ISD A;  1PMT A;  3UBK A;  3FZ4 A;  5IMZ A;  2H19 A;  4GLT A;  1LJR A;  2FWF A;  4Q5Q A;  5JCG A;  1IYI A;  3GMF A;  4KCA A;  3NOF A;  1OE7 A;  4GTU A;  6GSU A;  2K18 A;  4TOP A;  3I9V 2;  5IMA A;  3M0F A;  3WT2 A;  1FO5 A;  2A2R A;  2TRX A;  1TKD B;  2DJ0 A;  4WR5 A;  2HYX A;  3UBL A;  3KM6 A;  4RQX A;  1EV4 A;  10GS A;  3DML A;  1FB6 A;  1KEB A;  2TIR A;  4I6X A;  3EVI A;  14GS A;  2AB6 A;  2FA4 A;  5AIV A;  3UAP A;  1TJD A;  1ERW A;  2DJ1 A;  3ZLP A;  3PR8 A;  5FHI A;  3CMI A;  1A2J A;  1CQH A;  4X43 A;  2ON5 A;  2OT3 A;  4RI7 A;  3PH9 A;  3RAZ A;  2L5O A;  4IQA A;  2LKU A;  2DIZ A;  3IK9 A;  4KDX A;  3UVH A;  4BVY A;  4ZL9 A;  3I43 A;  5FT3 A;  2OAC A;  1S3A A;  3L9U A;  3HVS A;  4H86 A;  1V9W A;  2LQO A;  5D9T A;  3I6A A;  2N5B A;  1N2A A;  5B8B A;  1AC1 A;  1MD3 A;  5G31 A;  2H66 A;  3TCO A;  1O73 A;  2H8L A;  4IJ3 A;  3ZZX A;  1F9M A;  3IDV A;  4XCS A;  3RPP A;  3U6V A;  3HVX A;  3KH9 A;  2FD3 A;  4YAP A;  3NZN A;  1R7H A;  1VF2 A;  1XCC A;  2JL4 A;  1TRU A;  2LUS A;  3K8N A;  3F8U A;  4KUN A;  4OCF A;  5BMU A;  4KSM A;  5H5R A;  3IBH A;  3FRC A;  5KOX A;  4EC0 A;  4GXZ A;  5HR0 A;  2AJQ B;  4RUV A;  3GHA A;  3FEU A;  5ECS A;  3EWL A;  4G9H A;  3IV4 A;  4XIH A;  5CRW A;  3ZYW A;  2EIO A;  1XOA A;  3HMJ G;  4PNG A;  1TTZ A;  1ERT A;  4YKF A;  2IWT A;  1ZOF A;  20GS A;  3CRU A;  3G7J A;  2R2J A;  2VL2 A;  4IP6 A;  5D8I A;  4G2E A;  5A4U A;  2N5A A;  2FA8 A;  4WBR D;  5CRD A;  4K1F A;  4DSQ A;  4EDZ A;  4K5R A;  1QQ2 A;  3WGX A;  1B8X A;  5LD0 A;  1R5P A;  2VCX A;  2L59 A;  2H72 A;  2KUC A;  3HXS A;  18GS A;  2XPD A;  4ZL8 A;  2GSS A;  3CSH A;  2JZT A;  2HRK B;  2VCT A;  3TU3 B;  4KB3 A;  2LQQ A;  2BJX A;  2LEG A;  1RW1 A;  3KH7 A;  1WPI A;  4LL1 B;  2PBJ A;  1M99 A;  3GUS A;  2B6M A;  2VLT A;  4K9Z A;  3L0H A;  4BL7 A;  3QFB C;  4IP1 A;  5H5Q A;  3HJO A;  2C3T A;  4V2N A;  4ZL7 A;  4MLY A;  5IMD A;  1SJI A;  3EC3 A;  2K6V A;  1F6M C;  4K7I A;  4PQH A;  1JFU A;  4NHZ A;  2IMI A;  5AIS A;  1Z7R A;  1XWC A;  2X8C A;  1DBY A;  3APS A;  2DML A;  3ZTL A;  4N0Z A;  4KSO A;  2RM6 A;  4N0V A;  5KN3 A;  5ECL B;  3LQ7 A;  3CRT A;  1HNC A;  4AI6 A;  1JLW A;  3KGK A;  4K6X A;  4USS A;  4ZBA A;  5A5K A;  2QA2 A;  1YKC A;  4CW9 A;  2WJU A;  2H6X A;  4TR3 A;  3ZMK A;  2GS3 A;  2H1L A;  4FIW A;  4PQI A;  5DAL A;  2KLX A;  2CT6 A;  1BG1 A;  2LJA A;  3GH6 A;  3Q74 A;  5A1N B;  1K0M A;  4I2U A;  2CVB A;  2JU5 A;  3RHC A;  2JSY A;  1OVN A;  3HA9 A;  1AAZ A;  5J9C A;  4MH2 A;  1S3C A;  3IRA A;  3O3T A;  3DKS A;  1WE0 A;  2FGX A;  1YKA A;  4MNN A;  1TRW A;  3C71 A;  4TR1 B;  4JZQ A;  4TKY A;  2F3M A;  3KD0 A;  4GST A;  4IS0 A;  3HY2 A;  4HQZ A;  3IHQ A;  2WFC A;  2X99 A;  3GX0 A;  1M9B A;  2F8A A;  2FUG 2;  4I8B A;  4J2F A;  3ZML A;  2DJK A;  3GSS A;  1WJK A;  3GST A;  2GVP A;  2HSN B;  5BMU B;  2QSI A;  3N5O A;  2YV9 A;  4TR0 A;  4WF4 A;  3AY8 A;  4PUR A;  1YEX A;  2HRF A;  1J08 A;  4D73 A;  4IGJ A;  5FWG A;  4XS1 A;  3KXO A;  2GTU A;  2I9H A;  3KCM A;  2HSH A;  2CZ3 A;  1ACV A;  4GRF A;  4NMU A;  1DE1 A;  4BVX A;  3MWH A;  2YAN A;  2G2Q A;  4XHM A;  2UV8 G;  2IN3 A;  5G5E A;  3GX8 A;  3W8S A;  1VF4 A;  2ALB A;  4AKH A;  1XWB A;  1USB A;  3QR6 A;  3G9B A;  1M7T A;  2A2S A;  2H6Z A;  3RDW A;  1TI1 A;  2CX4 A;  2VCZ A;  2O7K A;  11GS A;  1NSW A;  1V98 A;  4BWS A;  1R26 A;  2IME A;  2C0G A;  4MF6 A;  1XWG A;  3F9U A;  2R5G A;  3G7I A;  1E6B A;  2X64 A;  2KHP A;  1GSY A;  2V6O A;  4OCE A;  3J7Y b;  4FYB A;  4EIP A;  5F05 A;  4O32 A;  3PPU A;  4RQR A;  4BL7 B;  5AN1 A;  1X0R A;  5HQP A;  3ERG A;  4YQV A;  2P5R A;  2GQM A;  3VPT A;  4Q5F A;  3A2V A;  3TUE A;  2FWH A;  4NXI A;  2H1B A;  16GS A;  3UMA A;  2H01 A;  2L4C A;  1PX6 A;  4G19 A;  3APO A;  5KN1 A;  3VWU A;  1TRS A;  4EO3 A;  4CY6 A;  3VUR A;  3H1N A;  3RBT A;  1B9Y C;  3GH9 A;  2B1K A;  4ECI A;  2OE1 A;  3GA4 A;  2R0P A;  2VM1 A;  2PPT A;  4OO5 A;  2NDO A;  1O8X A;  3ZIT A;  2YWO A;  3KTL A;  1SVO A;  4XRA A;  4DVC A;  1I9D A;  2RLI A;  4ZXG A;  5L71 A;  2GDR A;  1Z6M A;  2HRN A;  4KX4 A;  4HZ2 A;  4KA0 A;  2BTO T;  5DAL B;  4AF2 A;  3IE3 A;  3KEB A;  2WRT A;  4JU5 A;  2V32 A;  3CBU A;  4EDY A;  3D6I A;  2C8U A;  4TXO A;  1GSU A;  2H76 A;  2AYT A;  2DMM A;  2MBS A;  4YQU A;  3D22 A;  3EU3 A;  2HLS A;  5CRH A;  3TDG A;  2NTO A;  3DWV A;  2MMA A;  2R37 A;  5ID2 A;  2H6Y A;  3TJK A;  3LJR A;  5KOW A;  2O89 A;  3QMX A;  2IMD A;  4OD7 A;  3GTU A;  1OAZ A;  1T1V A;  4NHW A;  2VAF A;  3EPT A;  2TRC P;  3D4T A;  1EGR A;  2B7J A;  1U88 A;  2XHF A;  3EUR A;  2MMO A;  4K8M A;  19GS A;  4NWY A;  3A3T A;  3ZFL A;  2QC7 A;  2B5E A;  1EOH A;  1MTC A;  4HZ4 A;  1Z7P A;  2NPB A;  3D0Z A;  3TB2 A;  5AGY A;  3HHV A;  5LNK e;  5IOW A;  1TOF A;  4JE1 A;  3ZRD A;  1A0F A;  4GCI A;  1DE2 A;  4PXO A;  3QD9 A;  1T4Z A;  5ENU A;  2WZ9 A;  1K0O A;  2LRC A;  1A8Y A;  3VI7 A;  1RK4 A;  3F63 A;  3GIX A;  1ML6 A;  4E8H A;  3BJ5 A;  3LYP A;  4AJ8 A;  1PD2 1;  5JWO B;  2L5L A;  3H79 A;  4WET A;  2HSY A;  3QAV A;  3C8E A;  5A4V A;  3FR3 A;  4MJC A;  2PGT A;  5A34 A;  1M2A A;  5D9V A;  4FQU A;  3KIJ A;  1F37 A;  2G0F A;  4HU9 A;  1FAA A;  5IM9 A;  4IVF A;  1XW6 A;  1ILO A;  5D9W A;  4MJB A;  5ECO B;  2P31 A;  4NAX A;  1GH2 A;  2QGV A;  4LA1 A;  2HT9 A;  2H0I A;  1YF1 A;  2XBQ A;  1G7O A;  4HJM A;  3CXG A;  4KW6 A;  1ZYN A;  1ZL9 A;  3FYG A;  2C0F A;  4MPG A;  5DJL A;  4AJ7 A;  3FR9 A;  3CYN A;  3IK7 A;  4KCE A;  4ICY A;  2LJK A;  4I5Q A;  1LU4 A;  3DEX A;  4KH7 A;  2GT6 A;  4L5O A;  1FVK A;  1U6T A;  4L8E A;  3KMN A;  2D2Z A;  3HZ8 A;  1W89 A;  4LLR A;  1G7E A;  1NHO A;  3WGE A;  4ECB A;  3QFA C;  2O87 A;  1TXX A;  3BCK A;  5G5F A;  4V1A p;  4IQ1 A;  2X8G A;  4CHS A;  3UVT A;  4ILF A;  6GSW A;  2JAD A;  1T8E B;  2DC5 A;  1V57 A;  1G6Y A;  4TXO B;  3LYK A;  3US3 A;  3KJY A;  3ZL5 A;  5J9B A;  2LTK A;  1M2D A;  1AQW A;  4F0C A;  3C7M A;  1TXU A;  2C4J A;  3WD6 A;  1J9B A;  1K3L A;  4L0W A;  1PA3 A;  5ID2 B;  1QK8 A;  1R5A A;  4KND A;  1EZK A;  2GT5 A;  3GKN A;  1VF3 A;  4X0X A;  3GL5 A;  3VK9 A;  5CRE A;  3GTU B;  3TOT A;  1ZMA A;  4HQS A;  5J41 A;  3MAK A;  5ECK B;  3TRP A;  2PMT A;  1EP7 A;  2M80 A;  3A5W A;  3W6G A;  3P2A A;  3WT1 A;  4HS1 A;  4CY8 A;  3GKK A;  3WYW A;  4FH8 A;  1A2L A;  5HFG A;  2C0D A;  3HD5 A;  2V2G A;  1ABA A;  1XPV A;  5CP1 A;  1I5G A;  2OA7 A;  1SL1 B;  3GL3 A;  2O8V B;  3F4T A;  5GAP D;  2ZCT A;  4FYU A;  1SVL A;  2I81 A;  4EE0 A;  2MMN A;  4MCU A;  2RII A;  1ZCP A;  4X4J A;  3L9S A;  4WEY A;  4ID0 A;  1G6W A;  1YY7 A;  3N9J A;  1OKD A;  1GUM A;  1O85 A;  2GZP A;  3IXR A;  1S3D A;  1WMJ A;  2H1A A;  4TN8 A;  4A5P A;  4Z2U A;  2GLR A;  1H75 A;  1PKW A;  1GUL A;  5ECQ B;  5A4W A;  3GNJ A;  2VLU A;  2AAW A;  5DQY A;  2A4V A;  5IMF A;  5COH A;  2H70 A;  1DSB A;  1VGL A;  2X8H A;  2GSR A;  1SKS B;  3KTB A;  3APQ A;  4MJA A;  1PN0 A;  2YWI A;  2KP1 A;  3GYK A;  3V1W A;  1TK0 B;  3SWL A;  1ZYE A;  5HFK A;  1TP9 A;  3LW9 A;  1F3B A;  2R0G A;  5DDL A;  1ZYP A;  1SKR B;  1KBN A;  1OC3 A;  2QA1 A;  1XWA A;  2OBK A;  5D96 A;  4O5R A;  4ZB9 A;  1Q98 A;  3HDC A;  3C73 A;  2YJH A;  1YDK A;  2FNO A;  1HYU A;  1QGV A;  1XVW A;  5B7C A;  1V58 A;  2VL9 A;  4GF0 A;  4E8E A;  1JZW A;  1PGT A;  1PSQ A;  5JWQ B;  5C04 A;  3TJF A;  1EV9 A;  3R3E A;  1AW9 A;  2H1D A;  4PTS A;  2FY6 A;  2CZ2 A;  3EE2 A;  4PQ1 A;  1SD8 A;  4ECC A;  1OE8 A;  3QAG A;  3TJJ A;  2H74 A;  1TI3 A;  2VUP A;  1DUG A;  2R3X A;  4GSS A;  1TK5 B;  1MD4 A;  4BVY B;  3E3E A;  4GQF A;  4AKX B;  1THX A;  4NV5 A;  3IAS 2;  5JWR B;  5HFI A;  1GTU A;  3ZIJ A;  4MAB A;  4HOJ A;  3I69 A;  3IA1 A;  3UEM A;  1SK2 A;  2LRT A;  2OAD A;  1TDI A;  2IPA A;  3HZ4 A;  4ZBD A;  2HSM A;  3F4S A;  3SBC A;  1TK8 B;  5DQS A;  4KAE A;  3F3R A;  1M9A A;  4IW9 A;  1YJ6 A;  5ECI B;  1TU8 A;  2LRN A;  3EIN A;  2RM5 A;  4KF9 A;  3VWW A;  4TR4 A;  1H4O A;  1T3B A;  2VOC A;  5GZZ B;  1TRV A;  3BOA A;  4IKH A;  1ON4 A;  4GSN A;  1XW9 A;  1U3A A;  5HR1 A;  1K0A A;  2LST A;  5DBQ A;  5KN2 A;  3HKR A;  1V40 A;  1ST9 A;  3TJB A;  1GNE A;  2GQK A;  3TGZ A;  3UJ1 A;  1B48 A;  2F9S A;  3TOU A;  4Q5N A;  1A0R P;  1PRX A;  2CQ9 A;  3ME8 A;  4K5S A;  1GSS A;  4MZB A;  4HEA 2;  1HD2 A;  3FZ5 A;  2MYG A;  2H0G A;  2YJ7 A;  1XWK A;  4JR4 A;  2PUK C;  4ECJ A;  3LXZ A;  12GS A;  4ACS A;  2VD1 A;  4LMW A;  2VL2 C;  2CVK A;  3IC4 A;  2HZE A;  4WF5 A;  1E2Y A;  2YZH A;  3QDN A;  2EFC A;  3G7Y A;  2C3N A;  5D73 A;  2I3Y A;  4XS6 A;  3P7X A;  1ZGN A;  3MIX A;  3R2Q A;  3CTG A;  1XFL A;  4MMM A;  4POK A;  1PKZ A;  1AUC A;  3UOM A;  2PVQ A;  3M9K A;  2YP6 A;  2VKZ G;  3GV1 A;  4Z2T A;  4G0L A;  6GSY A;  2EIQ A;  2WUL A;  4HU7 A;  2LS5 A;  4X1U A;  3PGT A;  1AXD A;  1G0T A;  4EKZ A;  4KDY A;  2P0G A;  5H5S A;  5EVO A;  3C1R A;  4DSS A;  5F06 A;  2YWN A;  4XS4 A;  3KZQ A;  1ERV A;  3NIV A;  3U5R E;  3LG6 A;  2YPM A;  5F0G A;  2C80 A;  4G0K A;  4QMK A;  1ERU A;  4F0B A;  1FB0 A;  1X9W B;  2HZF A;  2BMX A;  3ZFB A;  1MDJ A;  4K0N A;  1O8W A;  2GZZ A;  2EIR A;  1J0F A;  4MZW A;  1SU9 A;  2EC4 A;  2EFD A;  1WRY A;  4K2X A;  17GS A;  3FKF A;  3GKX A;  1F2E A;  4ZIJ A;  3WGD A;  3RPN A;  1WIK A;  1K0D A;  2K8S A;  1GLQ A;  3CWG A;  3DXB A;  3HVV A;  4J57 E;  3F0I A;  2HSM B;  5DAK A;  1O6J A;  2EFH A;  2B7K A;  4EF0 A;  2LNT A;  1XZO A;  2R4V A;  3L4N A;  1Y6E A;  3PIN A;  3MDK A;  2PER A;  3BBY A;  1AQV A;  1K0C A;  3J7Y k;  1NW2 A;  3L9V A;  2DJJ A;  3F4R A;  1ZYQ B;  4WR4 A;  5EY6 A;  1OC9 A;  4HI7 A;  2DLX A;  1URM A;  1YVL A;  5JCW A;  4WXT A;  2LJR A;  3UIW A;  5A5H A;  3TKQ A;  4D73 B;  1GUH A;  5DVB A;  3GFK A;  4PUF C;  1SL2 B;  1HQO A;  1GP1 A;  2OBI A;  4F2I A;  3A5I A;  3P8W A;  4ZB7 A;  4BVX B;  3DIE A;  2N5F A;  3DRN A;  1CQG A;  3FMW A;  4L0U A;  2P5Q A;  4N3Z A;  3Q6O A;  1EOG A;  2V6K A;  4GQC A;  2E0Q A;  1X9M B;  1PL1 A;  1YZX A;  3MNG A;  1SK1 A;  4W66 A;  4YQM A;  1X5E A;  3TKS E;  1VRS D;  3VLN A;  2IMF A;  2PVO C;  4MJE A;  1SK0 A;  3UL3 A;  5D9X A;  1UN2 A;  2QKE A;  2H75 A;  4V2M A;  5GST A;  1T4Y A;  4LL4 B;  5GSS A;  1A2M A;  2VLV A;  3LEF A;  3LGC A;  3CTF A;  4HDE A;  4ZB8 A;  4IEL A;  4KGI A;  4PNF A;  2CAQ A;  2OE0 A;  3EMP A;  1SD9 A;  2E7P A;  1SJZ A;  1JZO A;  4POL A;  2HRA A;  3F6D A;  4F82 A;  4EIQ A;  1QMV A;  4QQ7 A;  2K8V A;  4OFN A;  5G2Z A;  2JSZ A;  3TKS C;  3ME7 A;  4AKG A;  2C1Y A;  5HR3 A;  5IMC A;  2IMK A;  3ZVJ D;  1TU7 A;  4JRR A;  1JZD A;  3TKR A;  2RUF A;  1VF1 A;  4V1A g;  2R0C A;  4DSS B;  1XXU A;  1YEP A;  4F03 A;  2KP2 A;  2VM2 A;  3HJP A;  4XS4 B;  3ZIV A;  2H71 A;  3IHG A;  1GSQ A;  3HCZ A;  1X5D A;  3CSJ A;  6GSX A;  4QL9 A;  3VFI A;  8GSS A;  2L57 A;  2E2G A;  1K0N A;  1JHB A;  3W8J A;  1PQN A;  1XBS A;  1GRX A;  5KN0 A;  4I2T A;  3LWA A;  4NV2 A;  4MF5 A;  1GSF A;  3TRQ A;  2XPE A;  2B5Y A;  2IJY A;  3H8Q A;  5A1N A;  2V1M A;  5E59 A;  5DAK B;  1Y1U A;  4YAV A;  3QAW A;  1X5C A;  4NPB A;  4FO5 A;  1WP0 A;  1GLP A;  1SYX A;  5B6M A;  1SVM A;  3Q18 A;  5ELA A;  3BD2 A;  4AJ6 A;  4TR1 A;  1C72 A;  1OC9 B;  2LV3 A;  1FG4 A;  2FLS A;  2DKI A;  1JZR A;  4MPF A;  1BF5 A;  5A5H B;  1M0U A;  4ULX A;  4L5L A;  4K2D A;  1Z6N A;  3E9J B;  1PL2 A;  2WS2 A;  2HSN A;  3LXT A;  4O7H A;  4I97 A;  2IL3 A;  3RHB A;  4Q5R A;  2VCW A;  1HNA A;  1MDK A;  2H30 A;  3QCP A;  5AIX A;  3JCM L;  2ES7 A;  2AUV A;  2HXK A;  4HJ2 A;  5G1K A;  4ZB6 A;  2GSQ A;  1AIU A;  1BQ7 A;  5CAX A;  3VWX A;  4JBB A;  4EVM A;  2C0E A;  5HR2 A;  3QPM A;  1FVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...