1AR1B

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ar1B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ar1B01
1NIDA 1GS6X 5D4HA 3T71A 3ZDWA 1J9SA 5A7EA 2OJ1A 4E9XA 3ZBMA 3RYMA 2HX9A 3T6ZA 5I6OA 1ZDQA 2XYBA 1WAEA 5I6LA 1BQKA 3NP4A 2PPDA 2QPEB 2UXTA 5FC9A 4G72B 2CJ3A 3PAVA 1MZYA 3BQVA 3UABA 4AI7A 2BP0B 4M3HA 2YAHA 4HIPA 3TASA 1OE1A 1AG0A 1HAUA 1PLCA 5I6PA 3CDZB 1JVOA 2GHZA 2YQBA 4F2FA 2J5WA 3HB3B 3N2JA 4AKOA 3CVDA 1VLXA 1KGYE 2MRYA 3EH3B 1FFTB 4YSCA 1M9WA 3S3DB 2UXGA 4HCFA 1DZ0A 4HHGA 2XV2A 2IAAC 4G7QB 3BVDB 1IC0A 2YAMA 4DP9X 2B3IA 3UAAA 6PCYA 5IY5B 3ZX1A 3AW5A 5I6MA 3SBQA 3FSZA 2XXFA 4HZ1A 4W9ZA 2BZ7A 1OF0A 1WS7A 1NPJA 2GSMB 3OMNB 1WA2X 2UX6A 5E9NA 2BWIA 1TKWA 2FT6A 2I7SA 1MG3C 4PAZA 2CALA 3KW8A 3H4HA 3PAUA 2FQEA 4K9JA 3UADA 1OCCB 4E9SA 1BXAA 4CSZA 1JZHA 4GP8B 1X9UA 2PCYA 5D4IA 2PP7A 3D12B 3QJQB 1RZPA 4YSSA 4YSUA 1ZIBA 1PCSA 1TU2A 1MZZA 1WS8A 2QT6A 1SDDA 3AZUA 1SNRA 2IH9A 2WO3B 2N0MA 3CVCA 3TBCA 3GXUB 2HZHA 2XU9A 3FYIB 3ABKB 3FQ1A 4KO6A 2I85A 3H56A 4JKNA 1DYZA 4YSTA 3JTBA 3GYRA 1PZBA 1BYPA 4DP2X 3FQYA 2FQGA 4DPBX 2IDFA 1CURA 1AS6A 1PNDA 1NIEA 1E5ZA 3FU7A 4QKTA 1E30A 4DP8X 2PPEA 1TEFA 2H5UA 2H47C 1AZBA 3NJMA 1NTDA 4AKPA 3NJFA 3NSFA 6PAZA 2PPFA 4KNSA 4KNTA 2UXFA 2ZOOA 1W6WA 1CYWA 4P5RA 3FPXA 3WIAA 1TEGA 4FAAB 1L9OA 3T6WA 2BP8B 4DP5X 3H4FA 1W8EA 1ADWA 4A2HA 3SQRA 1PZCA 2YAPA 2YXVA 3EH5B 1KDIA 1AAJA 3X1BA 1ET8A 4NERA 5ANHA 3IBOA 4HCIA 5LDUA 1J9QA 1J9TA 4BWWA 4JHVA 1QLEB 2P80D 3TA4D 1GY2A 3WG7B 4KOCA 3TU6A 2VSMB 4KO7A 4KOBA 4DPCX 3ABLB 1JOIA 2Q5BA 1PLBA 1BYOA 2BZCA 3JT2A 4DP7X 4YSAA 3NJJA 3AG1B 1XMEB 1CC3A 4M4RB 4E9QA 2GI0A 4YVUA 3GDCA 1AZNA 4W1TA 4BWUA 3X1FA 3ERXA 5F7BA 2VMJA 1SFHA 1X9RA 1MG2C 2X88A 4BDVA 2UXVA 4NB7A 1UATA 1ASPA 1RCYA 2ZWNA 3DKHA 2JXMA 2IWFA 7PAZA 1ET5A 1JXGA 2R7EA 1PAZA 1AACA 1AANA 4YSQA 5I6NA 4DP6X 1ZPUA 2PPAA 2XVBA 1BQRA 2QPDB 4G71B 4BXSV 2AZAA 2EIJB 4G7SB 2J55A 3CG8A 3G5WA 3NJLA 5B1BB 4UANA 1AIZA 2FWLB 1BXUA 1GR7A 3UGEA 5PAZA 2BHFA 1M57B 3T6XA 2Y69B 2CBPA 1BXVA 1IBZA 2TSAA 2E86A 4YSDA 5I26A 3DTUB 1L9PA 1ZV2A 3PXLA 4YSOA 2I7OA 1NWOA 4GYBA 3OD3A 4A66A 2BP0A 4DP1X 1XB3A 2EILB 2HXAA 1ASQA 1IUZA 4YVNA 1N68A 3KW7A 4FA7B 1ILUA 5F7AA 2ZONA 3FU8A 1SFDA 2CCWA 1W6LA 3L45A 4G70B 2LLNA 2PLTA 3CDZA 3NJGA 1R1CA 5AZUA 4DP4X 1BAWA 2RACA 3ABGA 2GIMA 5I6KA 1ZIAA 2QDVA 1B3IA 4YL4A 2AZUA 3X1GA 1M56B 4ZK8A 4BWTA 2DYRB 3PAZA 2Q9OA 1A4AA 3WNJA 3NJNA 2YAFA 2GBAA 1EZLA 2AVFA 4AX3A 4KNUA 5AFAA 4L0PB 1L9SA 4GP5B 1I53A 3NYKA 1E67A 4F7KA 1ET7A 2XV3A 3ZIYA 3WKQA 1KBWA 1AR1B 1AG6A 2FJSA 2XUWA 4N4YB 1PLAA 4QLWA 4UAHA 2VM3A 3S3BB 1OOWA 2IWEA 2IDTA 4HHWA 4E9VA 2OV0A 2HX7A 1NIFA 4A2EA 1J9RA 2WO2B 2DY2A 3OQRA 2JFCA 3FS9A 5PCYA 1XB8A 5B3SB 2YAQA 1HAWA 2PP9A 3IEAA 4X4KA 3QJVB 1IKOP 3AG2B 1EHKB 4A2FA 2PCFA 1KCBA 3FSAA 1A8ZA 4CSPA 1SF3A 1AQ8A 4WKXA 3NP3A 1L9RA 5B1JC 4E9RA 3C75A 1OCZB 1FA4A 2BW5A 1NDTA 3QJSB 1NINA 1A3ZA 2TSBA 1T5KA 3MBWB 4DPAX 2YEVB 1AZCA 4A2DA 1GYCA 1YLBB 3NSDA 1BEXA 4A2GA 4ENZA 5D4JA 2IDUA 3X2QB 3PPSA 3AY2A 3HEIB 2XXGA 2GB2A 3OMIB 1JZGA 1JZEA 1JZJA 1URIA 4JHUA 3NT0A 2NRDA 1PF3A 2IWKA 4WTQA 2XX1A 4N8UA 1KCWA 2GC7C 4BXVA 2FTAA 3U25A 1NIAA 4KO5A 5TK2A 1GW0A 2B08A 2OCCB 2BP8A 3FSVA 3S3CB 1J5DA 2BWDA 3NJKA 2W8CA 4A68A 3T9WA 3OM3B 2A3TA 1A4BA 2BO0A 2HLEB 2HRGA 3QJRB 4Q89A 8PAZA 1QNIA 1ILSA 3EHBB 5B1KA 2J56A 2JKWA 1NIBA 1QHQA 2VN3A 1BQ5A 3V9CA 5I5IA 5B7FA 1ID2A 4GP4B 2DWTA 3SBPA 2YAEA 4E9TA 4Q8BA 2BW4A 5TK4A 4HAKA 2XX0A 4TXVB 3NJHA 3IN2A 1CYXA 3IE9A 4A67A 2ZXWB 1RKRA 2AANA 2DWSA 5B1JA 3QJUB 2QDWA 5I5MA 1MDAA 1L9TA 3EF4A 1A4CA 1V54B 1AS7A 1A65A 1IBYA 2FQFA 1JXDA 1HFUA 2H3XC 1NICA 1NWPA 3WKPA 1SJMA 1FWXA 2YXWA 3AG4B 1NZRA 1SDDB 4YSEA 2VSKB 3UAEA 1PY0A 1OV8A 3PCYA 3OMAB 4F2EA 3FT0A 2UX7A 4PCYA 1JXFA 1PZAA 3FSWA 3T6VA 1KBVA 2VW7A 3SBRA 5I28A 2IDSA 2EINB 2X87A 2W88A 2YAOA 1AS8A 1J5CA 2EIMB 1JVLA 3FPYA 1ETJA 1CUOA 2IH8A 3CZUB 1GS7A 1PMYA 3NSYA 1OCRB 1E65A 3QJTB 1OE3A 3NJIA 1JZIA 3FU7B 3ASNB 2J57A 4DP0X 2WSDA 1OE2A 1GS8A 1ZDSA 1KYAA 1SHWA 1ASOA 5I5JA 3QPKA 2YARA 2XV0A 3V9EA 9PCYA 1WA1X 1XB6A 1JZFA 3MX0B 3QQXA 4KO9A 3FYEB 3ASOB 4AKQA 1NPNA 2AFNA 7PCYA 4HALA 1L9QA 5AKRA 4NAJA 1N70A 4GXFA 2DV6A 2VW4A 5B7MA 4AZUA 1F56A 1V55B 3S8GB 3FU9A 3WNIA 4E9WA 3EH4B 4EF3A 1SF5A 3FQ2A 1V10A 4GY4A 2EIKB 3NSCA 5B7EA 2FT7A 2VW6A 3ABMB 2CAKA 1AOZA 3S8FB 1GSKA 1WA0X 2VM4A 2XWZA 2FNWA 3TBBA 4BK5C 2FQDA 2P80A 4E9YA 2FT8A 2DYSB 2PPCA 2XLLA 1AZUA 1GY1A 2IDQA 1KV7A 2CUAA 4RH4A 3IN0A 2GC4C 2Y1AA 3WI9A 3PLYA 1E5YA 2PP8A 1PNCA 5B1AB 2MTAA 2HRHA 4MFHA 4BDVB 1AZRA 5EHFA 3DIVA 4YSRA 1RZQA 3N55A 3X1NA 2R7EB 1KDJA 4YSPA 2HX8A 1OCOB 3CVBA 3UACA 1SHXA 4G7RB 4UF7C 4P5SA 1JERA 3X1EA 3AG3B 4HCGA
chains in the Genus database with same CATH superfamily
1QI5A 1E5CA 2CKBB 4UT6H 1GS6X 1GHFH 4NWUL 1XQ8A 5DJCA 1QQDA 1T5EA 3C6LA 2OJ1A 5KJ7E 1QKZH 3K79A 4UOW1 3VG9C 1WBYA 3RYHA 2ZKXA 3WTUA 4GSQA 5DWUL 3FTXA 3VQ1C 1TCRB 4M7KL 2G30A 3DX7B 3U30C 8FABA 1R3HB 4LWSA 2J88L 2P47B 1H8OA 1YZZA 3A0BZ 3ZN1A 1BZ8A 3WUWB 4R6ZA 4MTXA 1MQKL 4N24A 2WA3A 3UDWA 2NZ9C 4LF7O 4U1NA 3ZQ9A 3LUTB 3N1PC 3RHWF 2BP0B 4WI2A 5BMFL 5E23A 5KTEL 1KN2H 1YNLL 2GUOB 3OKOA 1K4DB 1T1YB 1JHKH 4WFGE 3GMPB 4R7XA 4B9JA 1DVFD 3MTRA 2E8ZA 2J2ZB 3CFDB 4W9FC 2DYRC 4JI7O 1GOGA 1S7TB 2ZAIA 2ITDA 1IBDA 4MAUL 2UXGA 2QFPA 3B4NA 3ZKMD 1JR9A 1BVLB 3NAAH 2WQXA 4HH8A 2Z1PA 4L37A 4FM0A 3JAWB 2VB5A 3BVDB 1RURL 4TUKH 3VTMA 4E42B 2QL1A 4GG6E 2WQ8A 3RGVC 1UT9A 3F64A 6PCYA 5IY5B 2W9LA 3CWGA 3QDJA 3I02B 2AEIT 5DYOA 3QO5A 1G1KA 2GTZA 4FP8L 2E59A 1WS7A 2OR9L 4IYIA 1WTGT 3CHOA 3QEQE 4MBRA 4JI1B 3CB2A 1K5NA 4NDMB 4QHPA 5GS0D 1PKXA 3U10A 1WBZA 1XCQB 2DMKA 4JB9H 3F5WC 4BZ1L 4XO3A 2JV6A 2FT6A 1ZJAA 2ESVE 3FQTA 3IGFA 3GJEB 4R4NC 4TNWF 4ZFOL 2F7IA 3UPRA 2EIKC 4FFVD 1IBLB 2VLKB 3MUGB 4QEGA 4AUYA 2I60H 4K5MA 4R5XA 4AV0A 5HGBA 2WZ5A 2ETNA 4MQ7A 5KAQG 3JARB 3MCKB 2NY4C 2WZ0A 3CXHK 4K7PX 3MRQA 4IKLA 1PCSA 3V6OA 3ZL4L 5IFAL 2R23A 3A0RA 1SNRA 4N9OB 1TSRA 2XV6B 1S7XB 3CFKB 5C0GA 3Q8FA 2HZHA 2OMWB 1HINL 3IPEA 4XPAL 1ZWIA 2PWFA 3BN9D 1JRHH 4FG6D 3HG1E 2F7QA 2XNAA 3QIUD 1DQKA 5ESQA 2X2JA 1WV7T 1Q0XH 3O3AA 4JKMA 3WHE0 4X6CE 1HNYA 5K9QI 3GYRA 1ADQA 2AK4D 4M5YH 4NO0A 5BRZB 2PCPA 4OCYH 1KULA 1INEH 5ES4B 3FQYA 2XWBA 4NT6A 5BZWB 1E8XA 4L4JA 3E9UA 2ZWSA 3BD4A 3MRPB 2X4NA 1M05A 1CZ8L 2ZSWA 5C0IA 2UU9B 1U3YA 2Y36L 1QHOA 4AQAB 3QJHA 1V3KA 5IW3A 4IS6A 4IHJA 1JWUB 2ITEA 1OP3H 4JZOA 3GZKA 1O6SA 4V2CB 2PR4H 3QPXH 3JQOB 5EF0A 3PL6B 3FB5A 2C9SA 2XJLA 1CS6A 2VRQA 5D93C 2AJSL 1GMEA 4KQ3H 4AG4L 1SJHB 2O6PA 2WKGA 1IBFA 2XN1A 5DZOA 3HPJB 2XZCL 3CFCH 4ZFOB 3NIFF 4M5ZH 4BUGA 1TT6A 2JCCE 2V5RA 4FQ2L 3L75H 5J12B 3L3DB 1FXKC 5FM5M 5ITZA 1UM6L 2IMNA 1VQ6V 1WJ3A 1NGYB 3LJ3A 1J9QA 3BWUC 4H0LB 3KVDD 3PWUB 2QDOA 3TJHD 4NUJB 3T1WA 2V9UA 1I1YA 3BKJH 2OL3A 3F65A 1MCEA 4F7EB 2VSMB 1RHHA 1AY1L 3ABLB 2WLIA 1WZKA 4C59B 1DBBL 4DZBB 4Z7NF 4PGDB 4ADJA 1YEGL 3ARQA 4N2KA 3LNMB 1KIUA 1A21A 2O5NA 3VI3F 3FUNA 3H9SA 3IAQA 1XF5A 1F18A 3LZQA 1FFXB 4JRXB 1KXTA 2B14A 4KHTL 4HBCH 4J39A 5D72H 2P4VA 2NW2A 2QR0A 4ADGA 3U1PA 1VRSA 1NFKA 3ROOB 5J6GB 3H1KH 1T3FA 2W60A 2TRHA 1KCUH 1RK0B 1P84K 2P5ED 4JQVC 4RETB 1TZOA 3V10A 3VFOB 4H8WL 5JLZB 3O2VH 1CT8A 2ZWNA 3G6DH 4I0XA 3MBEB 1KPUA 2R7EA 4PMEA 3T0VA 3BRGC 3CFEB 2QQNL 3HKEB 1J18A 3KPPB 3MNMA 5LDSA 1WC7A 5E6RB 5INDA 4YNYB 4CDHA 2CO2A 4MD5A 4K07A 3QEQB 2CGOA 5FUZH 1PZ5B 3IJ7A 3UKMA 4HH9A 5FHBL 4P46D 4ZOBA 2QFRA 3GBMH 3F6LA 1U8QB 5L88H 1PJWA 4F7PA 1DN0A 3IVKB 1J9CT 3US0A 1M57B 5CMUA 1OY3B 4ZXBB 2Y69B 4MTFA 5BS0A 1J8HA 1MABG 3I84A 5EZJA 3G5XA 5IB4B 3CC5B 3NCWA 3ZHRA 2Q7EA 3C2AL 3VA6A 3VGGA 4HOWA 3C6EA 2NLJA 4YDZA 2O5ZH 2I7OA 2VJ8A 1BECA 4NO5B 5JMRA 2EE2A 1NWOA 5EN2B 1LEIA 3V0AC 4HJTA 4GW5A 3EKCA 3LN4A 4JG1H 2OAAA 2EKSA 3D51A 3RX9A 4LU5H 5E95B 4U3SB 3REVA 4FA7B 1FQ9C 1Q94A 1ILUA 3VWJC 2Y24A 3FOMB 5FO9B 1YJDH 3ARDC 3SJVD 4HS6A 2HLAA 4UOJA 3PNWA 4Z78B 4PJCB 2FO4B 4X9YA 4IRZH 2AI0L 1X7QA 3D3IA 2YD0A 2ILMA 4J7JA 1W2BU 3ZYZA 1NU1H 2JDIG 1FD9A 2ZCLH 3CLFH 3MLSH 3X1GA 5ACMA 2QMKA 4LF5O 3RB7A 1A4AA 3UO1L 1I7FA 1YHPA 4NM4L 1WPCA 4HFUL 2IADB 5I9QC 1KN4H 2E27L 1VCAA 3DTXA 3OLIA 3BYTA 1LO4H 2KC0A 2DEYX 4L0PB 1U8CB 2NY3D 3U36B 5D70L 2NR6A 1GK9A 3O2DL 2H8PA 2BHZA 3OF6A 1ED3A 2W0LA 4OFQA 3UJJL 4MKTA 1JHLH 3BRCA 4N4YB 2V2WB 1XEUA 2Z3YA 4WHYG 3LH2L 4IU3B 5I2IB 3MLRH 2F74A 5I8CA 1BAFH 3B9VA 4J4PD 4WY7H 3MFFB 4AW4A 1P7GA 3HRPA 1LMKA 4PJFE 1EIBA 2X3AA 4MXVE 1B2WL 3OQRA 4IBYA 1H6FA 1ADQH 3ILQD 4LCWE 4M02A 5F9OH 3RA7L 5EU3A 4X4KA 1K73W 1FVEB 1RJYB 2YXYA 2ADGA 4TV8B 2C9PA 3ATAA 3B7RL 4YHKL 5D1ZC 1JDCA 4U1MB 5IESH 4ZZFA 2AW2A 1L9RA 4WTZG 4KV5E 2JKXA 5DK2A 4EN3B 4N5EC 3VUAA 1FA4A 3K8KA 1JP5A 1ACYH 2OMXB 4U1SB 2LW7A 5DSCA 1YMME 2BSTB 3BZFB 4JFQA 4EUPB 2XTJC 2HVJB 2YN5A 3EDJA 4CGTA 5HYIA 1PU0A 1Q9LA 1TQCC 3H1JH 4LFCB 4DKAA 3S6CA 3RVWD 3NSDA 2WNKA 3MJ9L 4GINA 2ZKHL 4XBEH 4WEUD 1EMTL 1N32O 2VLKD 4XAWL 2QVKA 5GJTH 1JZEA 4QRBA 3GUTB 4QOKA 3TYFA 2IWKA 1VQLV 3DA0A 3RVXC 1HHKA 2KPWA 3EDEA 4JZNB 5F88B 3RQ3A 2VWEC 3MRBB 3NIGB 4KMQA 1YXBA 4ZBJA 1IKFL 3TEUA 3BX7C 2DWEA 1M2VB 2IH1C 4PCTA 3CLWA 2QGCA 3T3MB 1RU9L 2E3CA 5A2QN 5ICZA 5JHDE 3LV3A 1J5DA 2F08A 1OSYA 4IYHA 2AITA 3T5WA 1RIVH 2BDNH 3ORJA 1LE9A 5E00B 2X89D 5BV7L 5BRZD 2A77H 2ICES 1A7QH 3EHBB 3ALPA 3SGDI 4PDMA 1EEYA 1G0DA 2ZYRA 4BFNA 2JIXB 1FORL 1FKAO 4ES9A 3AT8A 3BPCB 1PZDA 2YA2A 4WFFA 2G75A 4FABL 4V1DA 5MERB 3FCSA 5K1XA 1T6VN 1YPZB 2NY1B 3PL6D 1CYXA 1OLZA 4G6JH 1CWVA 1WP6A 2DWSA 3RY4A 4Q9RL 2WMPB 3PABB 1HXYA 3EGXB 4YH6A 2H3XC 5IWLC 4DR7O 2WKLA 1YEFH 4UB6Z 4FQCL 1MXDA 3FT3A 3ECQA 1HX0A 1TPXC 4RQQB 5BVJA 5EEXA 5DEDA 1LTXA 4ADIA 2Y06L 5CKAA 5DHXB 1MCIA 4KXAA 12E8L 3HI6L 5F3HA 4NKQB 3UZEC 2YIBD 5EUOE 5LNEA 5CJQH 2WXJA 1G9NC 4XN5A 2GSGA 2BNUA 2PO6B 4M7LL 1YG9A 1WD9A 1KEMH 4JL2A 1UQSA 4BCZA 3T6VA 4BSVA 2PYEB 4Y4KB 5JTWA 2B9ZA 4UNTA 1CO1A 4OVUA 2VLRB 3P2TA 4I3RH 3P30H 5CJ5A 2AABH 1JNHA 1MSDA 1TF4A 4P05A 4WFGD 5I17B 1B90A 4FXKC 4L05A 5E99H 4I1NB 3QJTB 5DM6V 4Z76B 5BV7B 4JRXD 5CP3A 3UTOA 1ZANH 5GISH 4LHUA 1CFTB 2JKNA 1OOAA 4ZUSB 3D9AH 2CDEB 1S9YB 2MFNA 2R4SL 2KT6A 1QP1A 3L16A 1MCPH 4R0LB 4BKTC 4QMEA 2EZPA 2KG7A 4TVPH 1WA1X 1PW3A 3T0BA 3MBED 2OYLA 4JCMA 1XOUA 4LCYA 3DHJA 3PHOB 1XHZA 4NPYB 4ZMNA 5HVFB 4R7NA 1UVQB 3K6DA 3PRZA 2AJXH 4LLUB 1HEJC 1IM9B 3CD4A 3QEQD 1V55B 3KVQA 3VG0H 1F6AA 4M1CC 3CSXA 3RW0A 1QWHA 4KRNA 5HD8D 1Y1UA 4XP1L 4I13B 4O5LH 4F9PC 1EO8L 4ZXBD 1TXKA 2HKAA 4KJPC 3PG2A 3QG6A 1HCZA 2IQ9L 1FGVL 1XGQB 1QLRA 4X8GA 4N6RA 3K5NA 3QUGA 1KMIZ 4JDVA 4U05A 5I1AB 2C8NA 3MD0A 4HKXA 3VI4E 3VVVA 5L3BA 2R0LL 4PY8I 1F3JB 2IPTL 4W9KC 1H3TA 1T7ZA 4N0CD 2KERA 4PJDA 1RD6A 4LSSL 5E6YA 3IN0A 2CTPA 3NBNA 1J95A 1MCBA 5GHWH 4M1GH 4N0YL 4JW3A 4YZFF 3W9EA 2BSSA 3ZRXA 1JFFA 1UGKA 5D2LF 3MRIA 5DRNB 1XGRB 4TS6A 1IBMB 1AQKH 3HG1D 4Q74A 1H6UA 3T3PE 2R0KH 3AM8A 2VZUA 1RZQA 2Y2TA 4F93B 4GO8A 1UH2A 2JWYA 4GKSA 5JO5B 1PG7X 1GM8A 3KXFE 3HI1B 5HJ3B 1LK3L 1Z5LB 2B9BA 4LSTH 3LHPL 2EEXA 2DQDH 4Y5YB 1WG3A 1L0XA 1WNSA 4UF7C 2Z93A 3AU1A 3OKKA 3VBBA 1TA8A 3X1EA 3D0AA 1R6KA 4ZQKB 2E9IA 4HCGA 2JB5L 4HA1A 5I30H 2MNUA 3BGMB 5L9DL 1PVHA 1L3NA 4WDIA 1A47A 4LK4A 4K35A 2DWDC 2QVTA 5FDWA 1TJIL 4C57C 2OJZH 3TPKA 4FFZA 2EBOA 3D0VA 1LEGB 4YPJA 3DXAB 2CGRL 4P2RE 3L3GA 2FE0A 4O02L 3MNVA 5F0JB 5FYKU 3OPZH 1K34A 2ITCB 4WENB 1IFHH 3ZBHA 2C3WA 3OE7G 4NWTL 5GGVL 5B4MC 3UABA 3CP1A 2YAHA 2Z5UA 1DJWA 5KG9A 3KPOA 1KPRA 4YC2C 3LRKA 2CBQA 1CLOH 1P4BH 1MHHA 1JVOA 1FRGL 5C71A 5BUGA 4LLWA 3QDAA 3NJVA 5JCOA 4DQOH 3MUY1 3IDMA 2HTLC 5IDJA 4QT5B 4F57H 2RFXB 3OXSB 4HHGA 1ZTXL 3B7TA 5IQ9B 1AE6L 2AV1A 4K9EL 2D7OA 1MSWD 1SUJA 3AY4A 1XL6A 3DUUA 1PGRB 5E8PA 4LBEB 3ESNA 2LGWA 2EYTA 5DK0B 4HLZG 1HR0O 4YEFA 4IBQA 4UCUA 4NKDB 1FJ1B 3BT2L 5I15L 1D5RA 3ARGA 3TJEL 4U3JA 1EAOA 2WB7A 1FNGB 4R5VA 2BC4A 5MEPA 2GSMB 3GS4A 2WSKA 3E22B 2FX9L 3RNQA 2BWIA 2XSKA 1AC6A 3FUJA 4C47A 3OG4B 2OLDA 1CE6B 4KTEH 1T7YA 4RGOH 4UT7L 4Y2OA 2D3VA 3KW8A 5F8QC 5LA6A 2P44B 5DDHB 4PRDA 4D0BB 1QFWI 2V9TA 3IYLW 1O6TA 4GP8B 4GW4A 1HXMA 4IM8A 4O02B 3IXTA 4G43A 6FABH 2FLRT 3K5OA 3N44F 3ESVF 5EORH 5A7BA 1DUYA 3SGIA 1W0WB 3EHBD 2DYSC 4QTIL 3DYMA 4K0OA 2FWOA 3B4SA 3ETQA 3IKCB 2JIXD 3TV3L 5SWQB 3ZEDA 2PCFB 3II2A 4QTHB 2WXRA 5JJNB 3MTXA 2X6AA 3W9DB 3SDXA 5ILTH 1QFOA 4AGOA 4QJ3B 2ZDIC 3OAAG 2NY1D 3CFJB 3FQWB 4N0UE 3D8MA 4YGVA 3BRFA 1ZS8A 4I89A 2WXPA 5BY1A 1G7LA 5B3JF 4X9QA 1PZBA 1VZIA 3MREA 3GSXA 1SERA 1EFXD 3KLDA 5AEAA 3SE4C 1PNDA 2WP3T 1VQ9V 3FU7A 3MXWL 3VRLF 4OLXH 1DO6A 5LVEA 2J8UE 4Y9BA 3U82B 2K9PA 5DJAA 3TGXA 1TFPA 1IQDB 2DQGH 2FJFA 6PAZA 2UUBO 1FE8L 1JA8A 4JHWH 4OZFB 2HVBA 3SKNA 2ZAGA 2NY6C 2WJ7A 4DOHE 4K2UL 4LNUA 1CDYA 3GLEA 2P52A 5BVPH 3ZQXA 3WB0A 4NOFA 3J07A 3Q05A 5D5MA 2BP8B 3NTCH 4P9PA 4U0QB 4U49A 3EGSA 3RIFF 3V4PL 4HXBH 3VFMA 3BSHA 4UU9B 3QI9C 1EJFA 1HQRB 1G6RA 2P48B 1J86A 2R0ZH 3G7TA 5J3HC 4AYEC 2VLRD 2IVFC 1VESA 5B38A 4F24A 2ZOLA 3WDHA 3FQUA 1ET8A 4L0YA 4M1DL 4QLRA 3S36L 5JW4Q 4K7FA 4U31A 3AWFA 4JDTL 3PHAA 1K3EA 1YY9C 3WY1A 4BWWA 1QLNA 5J13B 1KWKA 5C0ND 2V3EA 3LDBC 5C0BE 1A7PL 3UYRH 1S78D 2CJUH 1OP5H 3HKCB 1FFPA 1RUKH 3LZRA 4QCIB 3LS4H 1VB9A 1XH3B 4W9HC 2PWGA 4C58B 3NJJA 4YDKH 4Q56A 5DFTA 1TQTA 3QW9A 3OR7A 2WZ6A 3MODL 1JZDC 3IPFA 3H85A 3DX8A 1KT2B 4K3EH 5C92A 4DAGL 3ASWA 3KLQA 4HISA 4BZYA 2ZX8A 4LPXA 5L3CA 3IAYA 1SFHA 4HMEA 3VMPA 2VKWA 3KWVA 3UBGA 4GAFB 2C3GA 1MG2C 1HL9A 4MS8D 1YMMD 2QPFA 3NOIA 1KC5L 4OCSL 5CZXD 5EIIG 1RCYA 4OJCA 4MVBC 1O9GA 3EG9B 1XSOA 2HKOA 4D0CB 3TZVB 3WE1A 4FFZH 1YHQV 3I9GH 5C8YB 2ZX5A 3MFGB 4HCRH 4HETA 4DV3B 4PQXA 5CJBA 3D05A 1JNLL 3WDJA 1QBBA 3SDYL 5IQNA 4FNPA 2J6EH 4BFGA 4C56E 3QH3A 3LS5L 2J55A 4DJMA 4K94H 3ZMTA 3D1MC 3NJLA 5FXCH 1ZTMA 1D7CA 5J2UB 3V4PB 3GBDA 1AVMA 5JOFB 2FECL 4LSUH 2X4SA 2CGNA 1ODUA 5ADPL 5JR1L 5I26A 4X7TA 5KJRL 5E8OB 3FTGA 3BIKA 4OLYH 2VOTA 1S7QA 1P5UA 1ACCA 1AH1A 3N9GL 5ADOH 4XCYA 4FZ8H 1JI1A 2WN3A 3TEXA 4DP1X 3IRZA 3JVGC 3K4ZA 4J3OH 1NCBH 4G9FA 3OC5A 4O2CB 1GMGA 1E4KA 3QARA 2GSIB 4I55B 1D5XA 1V7ML 2ZIDA 2VUKA 1I8IA 3QNEA 4AHCA 1ZVSB 2VIRB 3BPOC 5CSBA 5FYJH 5T3XH 3LN5B 4RFEB 3WV0A 3BHBB 2X28A 3PE9A 2FTKA 1Z0NA 2XIBA 3MLXL 5ETUB 5FL7G 2DQFB 5I6KA 2QDVA 1R3LA 2X1XR 4ZNEA 1B3IA 4HEPG 3BP4B 4JDEB 4I50A 3DC5A 1E42A 4L4VE 3CRRA 1T4KB 5LMUO 2A9ML 3DXAD 2XWTA 1CD1B 3WNJA 1A4JB 4D7TA 1ODAA 1EZLA 2D3NA 5B8CB 2X70B 4P5TB 1J7VR 5GS3A 1L0LH 2MCG1 4RWHA 3HG2A 1UCTA 1Q7YW 2BSKB 2VLLB 2NY5C 4I9WD 4ELMB 2ZQMA 4DTGH 3QUML 1E5BA 4MTGA 1OEZW 2NNXA 4K94C 4NUGL 2HR3A 2JVDA 1OQXA 1IC4L 2EXYC 1G5GA 3ARFC 5EZOL 1ZSPA 4HC1L 4ZFGH 1WUNT 3OSKA 4MJ2A 5L3EA 4HKZA 2OV0A 4BA8A 1GH6A 2ATPB 2OTLV 2E5LO 4HK3N 4UQ2B 3UIZA 4M3JA 3A23A 1NC4B 1FSKB 2E5EA 3F7RA 3JD1A 2A0LD 3O3EA 1NCAL 2GK0A 4DV4B 1J9RA 4JO2L 4QXTA 3T77B 4QRTA 5IV2A 4K5OA 3RT3C 4UBDC 1JGUL 3QZWB 5EU7E 4F1SA 2PP9A 4RMWA 2W6JG 4Z3IA 2EUXA 3R8BB 3APQA 3ETEA 3GSQA 4X62B 5ICYA 1KJ2L 4UM8A 4M7LT 2DQIL 4CW1B 1AI1H 4N9GB 4PVLA 4WU7B 1NGQH 3VI3A 5MEQB 4JFDE 3TS8A 3IJ9A 4L23A 2UXBB 5JWPA 4A2DA 5KVEE 1Z3RA 4G1EA 1E28A 4AMKL 1PV0A 2BTOA 5LNDA 3FQNB 3QZNA 1A7RH 2CDFB 3ARWA 4TTGA 4DV6O 3BH9B 1MNGA 1G6RH 5DFVC 4NN6C 2EDNA 3KLHD 2CE4A 4O4IA 4EFEA 4XXDB 2Y1VA 2R2HA 4NQQA 1BPVA 1C5BH 1RZGB 3B37A 3FTSA 5D8JL 3STZB 3N2GB 3CHSA 3QUMB 5CSZB 2E7DA 4DK6A 4UV9A 2R83A 5E2UL 1ZV5A 3RWJB 2CG9X 5E0QA 1GYAA 1F42A 3VCLA 1ZY9A 2YICA 3KPRE 4ONOA 1BPLB 4UQEA 4YDLB 5K5YA 3TNNA 4PWJA 3APDA 2A3TA 4TVUA 3QTCA 3TTYA 1TZHA 5EBLC 2BO0A 3C6SB 4ZT1A 1N8OE 2P1YA 1DLBA 5ABDE 4JG0L 1G7MB 4MAZA 4NPKA 4JYBA 3EJTA 1NSNL 2FJGB 4KX8A 3K9AA 5I8EB 5CXPA 3WFDL 2WTPA 4DESA 4GP4B 4Z0XA 2EC8A 4I9QA 5FGCE 2R0WL 1PZ2A 1H0DB 2H7WA 2EDXA 3PS6A 1KJ2B 5DJZB 4TYUA 3SE8H 2PW1B 2X4QA 4GKNB 1A14L 3KXFD 3V0VA 4EIUA 2E9WA 4LSVL 5BXFA 4LF4B 2MPAL 5TE7H 1VFAB 5JA8B 3ZHSA 3D09A 4EJ1C 2JIZG 2QDWA 1T03H 4J27A 1KYOF 4XCCH 1GN4A 4CNIB 5T1LA 5TPWH 4L8CB 4QHLA 3P3PA 1BHAA 1EZSA 1JXDA 1MCHA 1FCGA 1NCWL 2C1OA 3O81A 2OSWA 3LTVA 3D2UA 5EDSA 5JHAA 4OCXL 4XVJL 3N04A 5I76A 1KGWA 2WBKA 3D50A 3U4BL 1GTNA 3DJSA 2IAMD 4R4BA 2BFGA 3UAEA 3BW9A 5L6YL 1WWCA 1KTDA 2PY5A 3CQFA 4P2RD 4YFEA 2QJDA 3WY2A 2FIKB 1QEXA 2E0PA 5SWZA 4WW2A 2CIKB 1PZAA 2QSVA 3IFPA 4JK0D 1D9KB 3O11A 1U58B 5D2NA 1AGFB 3MUUA 4MS2A 4AT6A 1MEXL 4I1RA 3RPIB 5F89B 4BINA 3WLBB 2K7PA 3MU3A 4CMMB 5K9KA 5J11B 4U2ZA 2C1PA 4R97B 2C4FT 2ZCKH 5KUMA 3MV8B 3QDMB 4H20H 5LGJB 1DL7L 4AITA 1JDAA 4MMXB 2J57A 3OKMB 4JHBA 3V4VH 3MHZA 5DRWA 3L4CA 4O2FA 3ZHKA 5I66B 1SQBH 2ZJSH 3AG2C 4PGBA 4L8JA 1S5IH 1SHWA 2FJHB 4UQAA 2JTDA 9PCYA 4X66O 1RV6X 1A66A 5KVMC 4Q4IA 4JRYE 3HE6C 5F93C 3B8NA 1U2HA 2RJMA 1J05A 3KYMA 3KWXA 1B04A 1QHTA 4AKQA 3CAFA 4EDXA 4ODSL 4GAJL 4W9IC 3BH4A 4J6RL 4G27B 4IHOA 1OGAA 3AS1A 4LOVA 4G83A 1PFCA 1BM3H 4BFIA 2VXSH 1TUPA 2ZSVB 4KFMA 1A6ZA 4JZJA 1P2CA 4PJ7E 2FR4A 3L1FA 3WNIA 1T1WB 3LZOA 3V6ZB 1XBDA 4N2AA 32C2B 5T33L 3S96B 5L4JA 1T80A 2DIAA 4M56A 3O2WH 4IT5A 4HWEL 5FKPA 1K7DA 3QRGH 3AG1C 1TENA 3IFNH 2R2EB 4MASA 4PJIA 2NX5E 4PB9H 3L3HB 3J8F7 3GKWH 4LEXH 3UCSC 4NBYB 4LLVB 3GSWB 5EOTA 2I9TA 2AEPL 1AQDA 2AJVL 4IK7A 5IQLA 3SQBA 2DM3A 3FZUD 3FO1A 5LNGA 4XVSL 5EV7A 3IJHB 4GRLB 4K5PA 3PJSA 3VXNA 1O6VA 4GRMB 4FNUA 2YPVA 4LP8A 3SD2A 2EIZB 1LO2H 1BT8A 1M7IB 3QUYA 4Z9KB 5KUKA 1B0GA 3FRPB 1C8PA 3IFOB 3KWWA 3QXAA 2GUYA 4QXUH 1HTYA 1JNNH 4MFHA 2R56H 3L4UA 1VFMA 4KKBD 1MFEL 4YHLL 3FO9A 5IMOA 3N55A 1MI5A 1MFCL 4HUVB 2NZIA 1JPGB 1H3UA 4UTCA 5E6IA 5BUPA 5B1BC 5JQIB 1S3KL 5ANMB 1X5AA 2YR3A 4MJ4A 1UC6A 4P5TD 4FZ1A 1NEZG 3QA3A 3P3RA 5DJ6A 3UTTE 1B0RA 5EO9A 3GIZL 3ARTA 4QXGL 2NNUA 3DIFB 3GB7B 4G6AD 4OCMC 4BZ2H 1EGJH 1G9MH 1A6WH 3E8GA 5H94B 1PKOA 3EOBB 4R50A 2Z31A 2VC2L 3IDXL 4KQ4H 2X7RB 4KZEL 3SKMA 1U8LB 2WUCH 2JVUA 5A2AA 3G4SV 1SMAA 5F1NB 1XUQA 4JY4B 4TQEH 1RZJH 2WWNA 1BQKA 4N2GA 1AKJB 1NC4D 3KPLB 4Z95H 5ID1B 4MD0B 4JRWA 3BAAA 4HHAA 3K0GA 2GIYA 4LXFA 4LRIA 2NY0C 1GRJA 2A9CA 3IMWA 2EXWC 3MRGA 3EJYC 1HH9A 4GLXA 2D0FA 3P54A 1O75A 4FNTA 5J8OA 3W5MA 5I1CL 4DN3H 3ZRCC 3EGDB 2XKNA 4KXCA 3RUGB 5CP7B 1MY7A 1UH3A 3CUPA 4FQHA 1KSRA 4PR5B 5C70A 4F58H 4IMKA 5HI4C 2GK2A 3ICXA 3W7TA 1XZ0A 2R1YA 4RGNB 5CBEB 5K1JA 3F04A 3D30A 3RYFA 3SGEI 3DOHA 2ZUYA 3OZKA 4MB3A 3U2JA 1JHTB 2L7JA 2E7LA 4ANWA 2KS0A 2VERA 1T7WA 1S7RB 2JMRA 2BSBA 2ATKA 4NRZB 2W92A 1FGNH 1S7WA 4WFED 4LIQE 3ZMNA 4HWBL 4HK0B 5DQDL 1MCKA 4MHHI 4WFAV 2NDFA 4UFZA 5T1KA 2UX6A 4L5FE 5C0FB 4IRJC 2WB1A 4IGBA 1O9HA 1TKWA 1CGUA 5EOQH 1CPUA 1QVFU 2VC2B 3MRNB 3PUCA 3H4HA 2B1HH 5CA1B 4XZUB 5AZEL 1T20B 5HHME 2ADFH 4B27A 4PJ8D 5AKTA 2Y6SD 3CFUA 4OZHB 3VFSB 4LOUC 2MQ3A 2ZX7A 3F7YB 3RVVC 4PHZA 2D2CB 1R5VB 3DGGA 4JPQA 2WXLA 4YDJB 5C7ZA 4HQQH 3JALA 4L4TE 3FB8A 2XAQA 1TLKA 5LHHA 3TBCA 2ICEA 1U36A 1M53A 3FCTA 1OAYL 3VQXA 3BGFC 4MQXC 1DQLL 2R15A 5CSGA 4GG6F 3FYIB 4BH8A 5TE4H 3HRZC 1X9LA 4ZX6A 4GQ9H 2IPKA 3AWGA 4H0IA 2EYRB 4YSTA 4WUUB 2OJEB 2ITFA 4AEIL 1Z9SB 3T1HB 1U93A 3P9WB 5D2LA 3MJ7A 5D55A 5DD5H 4EVNA 1GMIA 1VFOA 3SYAA 2D3JA 2Q3XA 5HVHB 4ZW6A 5DT1H 4J9ZB 5CLYA 5E1AC 3GRBA 4TF4A 5L3GA 1C08B 1NTDA 1H15A 4OFYD 3QSKB 4DKTA 1JYVA 4XGZA 3ZKXB 4Z77B 3RGVA 2FSEB 2P4KA 4U1GB 3U7YH 1H8LA 4DW2H 4G28B 1U8OA 4YY3B 4MD4A 1I8AA 3HKFA 5JHLL 2VDPL 2NYYD 4N23A 3A21A 2ZTBA 2ETWA 4ZX3A 4QIRA 1UFGA 1TEGA 3MLZH 3PUUA 4OXSA 4DK0A 4HJ0C 4MBOA 3ARUA 5IBTL 4ZOLB 5GS2D 2XTSA 2E9JA 4X88A 3FFDA 1DCLA 3WD5L 2L4OA 3RX5A 3ISRA 3LZPA 4PJCF 15C8L 2UZYB 3II3A 1IM3B 2ILLA 3MV8D 3QDMD 4PJHE 3G6JE 3IGAB 4KTGA 3SKJH 4B53A 4X6CF 1V27A 3T4YB 1IU1A 1EEZB 2K8QA 2FX7L 5IJBC 5HYEA 4DYLA 1EDYA 2FBJL 3L17A 3M88A 4WJ5B 5CZRA 3DVGA 4KO7A 3DX9A 1OTSC 2BHYA 1UXSB 4R7VA 3N27A 4TRPH 1OSZB 5D9SA 4YX2L 2MCMA 1A1OA 2WBJB 1U8HB 3HAEB 4CH4A 4LAQL 4BA0A 1FIGH 3LD8B 4M4RB 3GS0A 3RIAF 1AZNA 4W1TA 2K6WA 3B1TA 3ZL1A 2P3YA 3X1FA 2UXCB 4AVJA 1JPEA 1FCCA 4DR5O 1YMHA 2M26A 3NQKA 4HJJH 4PRPA 2BOCB 1HS6A 3GI8L 2VQTA 4ZS6D 4G11A 4UXNA 3SPIA 1KG0A 2AJ3A 3LNEA 4JI6O 1OTUD 2P26A 3K6IA 3ULVE 2JXMA 3UBXG 2F6AA 5IROD 2JCCF 3E6HB 4XAKE 1PAZA 4YSQA 4XCNB 4KKLD 1Q4NX 1K5QA 1OCRC 1TZ8A 1LP9E 2VDPB 3BKML 3HI5L 4FYSA 5AVXB 3RU8H 4PV8B 2IU0A 5A40E 2AZAA 5C0CA 2VLMD 1SOXA 2FWUA 3EUDA 3HC2A 1S5LZ 1KLGA 1AIZA 1TJHH 1I9RH 3MI6A 1Z9NA 4F7MA 2NXYC 4YHPA 2WYHA 4GRLD 4M7JL 4YDIL 4YL9A 4E41B 3PJLA 1FAKT 1CBVL 1A8JH 4EAEA 1KBGH 4DR3B 5ENWA 2TSAA 3I6GA 4PLJD 2E86A 4OGAD 3D3VA 2NT1A 1NL0H 2CMRH 4UCRA 4YDVB 3BJLA 3K59A 4JPIB 3RVTC 1DJIA 2AAVA 4TL4A 1IBHA 5F1IB 3IM1A 3MO1A 1IJ9A 1DK1A 2V9RA 4PV9A 5IM7B 4TULH 1MFUA 1PP9H 3KW7A 5AL0A 2XTAA 1VACA 4PJBE 2RCVA 1IGMH 4U3CA 3BH8B 3PAYA 2B9AA 1CFVH 3VWKA 4JM2F 3H1LH 4IMLB 3VFRB 5CJOH 5AZUA 2HN7A 4G5AA 2VLJE 2DI7A 1U6AL 3RYCA 2PF4E 1QRNE 4G7YL 3A8TA 4LCUB 4O2EB 4X7CC 3T3MF 3I85A 4X6EA 5FYKL 4AZ8A 3JD0A 1FJGO 4H5SA 1QABA 4TT3G 1FVDB 5HYQB 4PBVC 4BWTA 1B3JA 3CSGA 4ZW3A 1CU4H 1FFOA 2C2AA 4JFEB 3RTQB 4YHYC 1GYVA 1IGJA 3BI9X 2HVKC 3RWCA 4JVWA 1AKJD 2XWDA 3L9EA 4B9ZA 2R9RB 1YN7B 3QR2A 1KUMA 1O7VA 1IE5A 3KLKA 4D0DA 1K92A 4JKPH 5B1AC 5E8EB 1Z7JA 1DEEB 3FAVA 4PRAB 1E67A 4JN1L 1IZ3A 4DR1O 1T1XB 2W1NA 4I3GA 2HFFA 5IW6A 1TQVA 1H3WM 1PLAA 3VRJB 3NZ8B 3VMNA 1SEQL 1OOWA 3O3DA 3GHPA 4LASH 2AVGA 3OJDA 4X9GA 2X5PA 1RZFL 1WAAA 1MIEH 2AXJA 3LQMA 4JLRB 4I5BB 3FH5A 4K3JH 5ACZA 5KYXA 4RGND 2Q6AA 1U97A 4JFPB 3HZ3A 1B9KA 4UTBL 3D69B 4ZSOB 1MHPH 5F7UA 5KS9E 5TF1L 1ZE3C 2QKIB 2AKRA 2NCEA 5IKCA 5GIRB 4CMHC 2FZ3A 2XBDA 3WNLA 1NCCH 3JUZA 1EHKB 3BVXA 3GD1C 4AIZA 3VD7A 3KYNB 2KZBA 4A2FA 4HJGB 3BC9A 3GMOA 1OTTD 5B1JC 3QWNA 3T8XA 1OCZB 1WLHA 3IJYA 2BFVH 3OHXC 3TN0A 4HUXA 1U8KA 2YEQA 2OMTB 4GG8B 4YIQB 2WXIA 3HN3A 1CB4A 5EC1B 1GZQB 2P46B 3GMMA 1LHZA 3PQYA 1OAXH 5DJYA 2DBJA 5K39A 3ARPA 3X2QB 1LQSR 4MSWA 5FB8B 1JVKA 1I7UA 4XCFL 3FT2B 4C55A 1URIA 2ZOTA 1QBZA 4OD2A 5BW7A 2CJSA 1X5IA 1JK8A 4GNKB 4F33B 1CR9H 4YHNA 2ZM6O 5LLIC 1EANA 3P73B 2ZQKA 5F9DC 4HJEA 4KJWD 4YGAB 3THOA 2WLJA 5J1TC 1DVFA 4PN6A 4GO9A 4LF3A 5E0FA 1TGOA 4KX7A 4A68A 2CAZC 4RMUA 1LL1A 1ZCRA 1BWMA 4WUUD 3N40F 2ZIOA 2WXKA 4KV5F 1M1XB 1SY6A 3HBZA 5C2BL 3X11A 1OSPH 1E4XL 3TWCL 1R5WB 2JKWA 1QHQA 2DYPB 1UWEH 1BQ5A 2EILC 2JCWA 3W3BA 1TUBB 3EYSH 2VGLM 1B2YA 1U0QA 1T0NA 3IMTA 3PWVB 1K33A 1N0JA 2PKDA 3CMOL 1M7DB 1VGEH 3ATBA 3C8HA 4ZMPA 5HHOE 4QAMB 2BPBA 5DHVB 1AR5A 3C8KB 2AANA 2PR9A 3Q0HA 2WPGA 1CGSH 1SYVA 4XODA 4XN9A 3TBWB 4ESKA 3IWUA 2H3NB 1MN4A 1DVXA 2D2OA 2B77A 4GKZB 3VH8B 2DQUH 3WCYA 3UO2A 2L7EA 1IGIH 4BFJA 3OG6B 1N0XL 2WLNA 1NWPA 1BF2A 4CUCA 3QEGH 2HPTA 4EE2A 5A3IC 3BFOA 4UM9A 3P0GB 4ZMOA 3GRWA 4IHBA 1DJGA 3OUSA 3D7PA 5IJCC 3ZRSA 2W0PA 1K9TA 1L7IH 1GOFA 1S7VA 1MWOA 3KJ4B 3PCYA 2BVQB 1AHKA 5IJ0A 2HYMA 3D0LB 4XNDA 1I7RA 1IDSA 5KHGA 2DM7A 2H1XA 2UX7A 2FNBA 4KTDL 4EMZA 3BAEL 4YXKH 1AYOA 3GXMA 5D7IA 4YHHO 3EYUL 1SEBB 2TAAA 3Q2CA 4NZJA 5B1NA 4WEBL 3B9KC 5LBSH 3D5OF 3PHQA 4D3CH 2ZP0T 3TEWA 2WBJD 1CUOA 3KPSE 5HGGS 3I6KA 2OPCA 3ETTA 3QIWC 1KB5H 3D07A 5CF3A 1CICB 3ETDA 1NQBA 2SEBA 1AHWB 2X2YA 4S1SH 2KB1A 4NEHB 3HNTH 3QXWA 3A24A 4E5XB 2HMID 3BEWA 3KDMA 4MJ6A 3WJJA 2PW2B 3DGDA 1RVFH 3RX8A 3BD3A 2E6QA 5GGVY 2DMGA 3T2PA 4IIQC 3FC8A 3V6FB 2ALAA 3ZTJG 4J3BA 3U46A 3KLSA 1QUNA 2V17L 5TE6H 4XPTH 3DRTA 3VD4A 7PCYA 3TT3L 3FFCB 1U8PB 4M61A 5GXBB 5L8JB 1KPVB 5LOVA 3ZMEA 3SPJA 1D3CA 5KSAC 3QIBB 3L4YA 3O4LE 2R1XB 4YK4C 5AOIA 2X2IA 2UWEB 1UWYA 3DJTA 5EUOF 5GTHZ 3B2VH 4CVXA 3I3DA 2A4EA 4F9LA 1EX0A 4NGHL 5JXAL 3JATB 3DO3A 4XP4L 5A6IA 4EF3A 1R0AH 1K4CC 4NZUL 5BOZG 3NSCA 5DMKA 3S3WA 1U4EA 5IWLA 4TUYA 5D1QA 4A7GF 2QPUA 5HHMD 1PEWA 3SQOL 4BCXA 3FNKA 3X12A 3G08B 4S2SA 4E4EA 3KCWA 2P7TB 3VDAA 5JPMB 4OV5B 2RR3A 2O5YH 4IOIA 2PXYC 2IG2H 2YGVA 3L3JA 4QYOA 3QAZC 3V5HB 4IU2A 3MZTA 1BOYA 4PVNA 1Q86W 4LSPH 1NUDA 4R2GB 1X44A 4C4KO 4OQTH 1QFUH 2Y72A 5IBUB 4AGPA 1W2KT 3GKZA 4CVZA 1I8LA 4FFKA 2HT4D 2RIKA 5F7DB 4MXWL 1DBJL 3BFWA 1EZVH 5D7JC 3TGUH 1J0HA 5DURD 3L9DA 3GMLB 4MRBA 3JTTB 2CNZA 1QSZA 3BUIA 2P5EA 2XA8H 5FYLE 2JE8A 2HX8A 2Q20A 3VVWA 1G1YA 3FMGH 4RRPA 4DV2O 4YHIB 5JA9A 5FLVA 4KZDH 5F72S 4PGCB 4DZ8A 1A3QA 4WW1A 1C1EL 2YPLB 3GK8L 3P9MB 1YI2V 1A7BA 4MVMA 4BIUA 4U7OA 1YEIH 3H6JA 3D2TA 1SOSA 2YMXH 4L9LB 4RUEA 4R26H 1DQJA 2P8PB 2ZICA 3FW6A 3EXJA 3CPLB 1FLRH 3PP4L 3SDDB 4JKKA 1J8KA 4MJIE 4B5ZA 3TCLB 4XBFA 4UB0L 4U7SA 1SZNA 2VISB 3HNSH 4GS7B 2D31A 2OMVA 3LHAA 1AO7B 4ILDA 2IJJA 1WZ1L 5KSVA 2GJRA 3F7QA 5E1GA 3T4AB 3T3PF 2C7UA 4TPRL 5IFHH 4LNRA 3TETA 5JQHC 3JAMN 4PVBA 4X0KA 1AGCB 1I5YA 2QTOA 5C1MB 3HKBA 4J3UA 4WGKA 5JW4M 2YQBA 4X6DE 2CIIB 2FJUB 5HHPA 1CXFA 4NLHA 4FI8A 2H26B 1VLXA 1RSOB 2VDKH 4NQDA 4UV7H 4HX1A 3BMVA 4HT1L 2ZE6A 2GV9A 3S8WA 5KW9L 5F96L 1ZLUH 5GS0H 4QPEA 4JQIA 2OS7A 5FYKD 3DV6B 3OKNB 1AI5A 5IE9A 5J1AA 3DVIA 5EEWA 4M7ZC 1TCRA 5I6MA 5GGRA 1CFQB 4UQBA 2Y0SA 3K1DA 2LAGB 4HZ1A 1R3IL 1TQUA 4RISH 4LF5B 3RL2A 1QLFB 3SBWC 4PYHA 3VXSE 2QSCL 3ASOC 4Z1VA 5JPNC 1PKQA 2V5TA 4DR6B 2HJLA 3M8OL 4HGKC 1NT2B 1R3KC 4PG2C 2DJMA 5KVDH 3UPAA 4XAKD 1YDXA 4FLRA 1NEPA 3ZHFA 2WSSG 2E74B 1RL1A 1Y0LB 3GMPA 1VP7A 4MX7A 4A5UB 4P4KC 3QISA 4PD4J 5D4IA 5AYUL 4PIBA 1BCIA 1LDSA 4JI5O 1JHKL 1LE5A 4GO6B 3EXLA 2JKJA 1MZZA 5E94A 2QT6A 4KY1L 2DLFH 3CSTA 2DYPD 2EX3A 2A4CA 2EYSB 3G5VB 3GXNA 4E42A 2KH2B 4X9IA 1PYWB 4TNEA 2FB4H 2CDGB 3R8QA 3I02A 4B3MO 3UG3A 1RP9A 3IT8D 3Q5OA 4EI5D 3DV4A 4TUKL 3WS3B 1ETZA 2B15A 1QPXA 3OWRA 4YPGA 2FATH 4XNUL 2QZQA 2F7OA 3LQAH 3MLYH 4FNSA 4TLKA 5AUMA 3P0YL 5IYBO 4P23B 4ZPTA 2J7LA 5GS0C 3W37A 3MLWH 5DQJB 4HGMA 2A7WA 1CURA 2ZKWA 3ZYIA 1Z3GL 4R3SA 5C0AB 3WNNA 2F4VB 2G5UA 3MUGA 4F8NA 4J8QA 2HB0A 4JFXB 4FFVC 4O2BB 3QHFH 1Q72H 4HDIA 2CHNA 3LRSB 3QCVL 1ZHKB 3JARA 1R3JB 4I48A 5IBLD 3MYJB 4JQXC 2V5MA 3OKLB 1W6WA 5SWSB 1JWMA 2ADPA 2WWKT 3BSZA 3H3PH 4ALAH 1T1ZB 4QRPE 2YD6A 4KI5E 3UO8B 3ZDXB 1AXTL 4I2XA 4A2HA 1MCRA 4K0KO 2YAPA 3X13A 1RMFH 2VO8A 3IDIA 5TDPB 1T89A 5FNVB 1JN6A 2X7LB 3EH5B 3BN9C 2ROYA 1MHCB 2EVFA 3W0WA 3QNXA 3ILPA 5GSRA 3ZR5A 1CICD 3MUJA 4UINL 3RBGA 1JRHL 1NCDL 3KL5A 1ES0A 5MHSE 3U0WL 3T1YB 2NT0A 3TTSA 4X8CA 4KOCA 2ADJA 2JJWA 3TT1L 3HB3C 5JUEL 3VXRA 1UWGL 2O93L 3STLA 1TUEB 4LMQI 4OCYL 5DEJA 1IFGA 4GB9A 1IZKA 1GXEA 3LPFA 4ELMF 4Z3TA 2IH3C 5DA4A 1E4XI 3MQIA 1FZJA 5D7SH 5JJEB 3FFCD 3LQAC 2DD8L 4P3DB 2OK0L 5CJXA 3QIBD 2GJJA 4JYYA 2WQAA 4LCIH 1GIGH 5ECJE 4QNPE 4UNVA 5MENA 1PLGH 2EQDA 3T65A 1TSHA 3O41A 5KSUA 2ICWA 3MRLB 1MNUL 3RFZB 1CQYA 2QELA 3LSOB 3MVSA 3JV4B 3TL5A 3FOLA 4XPGL 4HBNA 5AVYB 2OMUB 4PJXE 3ARYA 3N85H 1AACA 3BE1L 2IM9A 4OJFL 3BA9A 3IWVA 3BUPA 2DICA 4M5ZL 1BYNA 1RHFA 2QQQA 4BXSV 4R9HA 4WUKL 3MRHA 4H37A 3U4EA 3MNWA 4ZPVB 4AJWA 2OTWB 3FTVA 1BQHA 1GCYA 1FBIH 1N6QH 1FNLA 1A6VH 3E8UL 5G2NA 4CC5A 1F58L 2BHFA 3GVMA 3R18A 4FC3E 4DVRH 2Q7GA 3VNYA 4R2GD 4QRSA 4WFGA 5CNHA 5HPMA 1VF6C 4WCEV 3I2CL 4Q9QL 2DTMH 4OD1H 1NLDH 5CD5D 4FQ1H 4D9RD 1NBVL 3NRPA 1ACXA 1WQVT 5AAPA 2Z7WA 4RMBA 3QULA 5EOCJ 3DSFH 1X7TA 2HXAA 1XIWC 2XWJA 1HDMA 4LL1A 2AJZB 4F6RA 3OAZH 4PDRA 3DOSA 4M4PA 4GG6A 4OIIL 1T0MB 1A9EB 4XNYL 4G70B 4JO5A 4NR1A 4RQEA 1YECL 4W4LA 1BVOA 1YEHL 4MB4A 1NFDE 5L0QB 4XN8A 3TN0D 3C5ZB 4YNYA 5I8OL 4FQXC 3BO8A 5HHOD 1RI8A 3QEQA 4ZI8A 2BS9A 2AGJL 4CN4A 4HOZA 4J9YB 3SDDD 2VAAB 2EZOA 2YN3A 1M2OA 3B3IB 3GBNL 3NEOA 1V5JA 3ULUL 1MA1A 2V2TA 5HSFA 1A0QL 5KMGB 3NCXA 1A1MB 3RGBA 4KVPA 5EA0H 3JV6B 3IVKA 5F2VO 3RN4A 3CC5A 4ERSH 4JFYB 2LO1A 1SLVA 1UUNA 4U1LB 3B3BA 1JPFB 1MUJA 1YYLL 2N01B 3L1OH 1VQMV 2I5YL 4Z7WB 1P69B 3B9DA 4HIHA 4K8RL 3S98A 3WKQA 2A6DA 1NCOA 3LH8A 2FJSA 3Q6GL 4ODUB 2C26A 4ZW5A 1JYXA 9CGTA 4K3GA 1OAKL 3WNMA 3ZRWA 1BM7A 3G04B 5IVZB 2A6JA 2O5ZL 4NM8H 4PREA 4LVEA 5CEZE 4KK9D 4WSKA 4LVHC 3ZR6A 4WTXA 3EYFA 3L3OB 2E7BA 3ISWA 4HSQA 4F91B 5JNYA 1KJ3L 3E86A 3HG1A 1Q9WA 4FI6A 4MMZC 1E0OB 3FT9A 1N0NA 2CA3A 2D7NA 2ZAHA 4NWUH 4WFBV 2UVFA 4X6CA 3BQUA 4AENB 1OALA 3B8YA 3AAZB 4HPYL 4JPKL 1MOFA 2RB8A 1C12B 3QZBA 4YXHL 5DWUH 5D4QA 4M7KH 3ULVC 3HE7B 2UZIL 1T66C 3UCRA 1T04A 2HT3C 2J88H 4X5XA 1PCXA 3BXNA 5DJCB 3C6LB 2Z3FA 1L6XA 4H8PA 5BZBA 1MQKH 1U8CA 1SHSA 2TSBA 1WBYB 3RYHB 1L7TL 1BG9A 4EPSA 1GYWA 8FABB 4LWSB 2GBTA 1E3FA 3S0PA 1CI3M 1BEXA 1K4DC 1YNLH 2V2WA 5KTEH 2JS3A 1FFNA 4FN0A 2GW5A 4K5LA 5DF0A 2BERA 3JZYA 3MRCA 3L73H 4U1NB 3TCTA 1NC2A 4HIXH 1P9MC 4G3YL 4JHUA 3QNYA 1PF3A 2IW5A 4ZS7L 2JCCA 4MAUH 3OKOB 4ZYKA 2XZAL 3CZNA 1QX1A 4XDJA 3H1IH 5IWAB 3LKPA 1CXZB 3ILQC 4Z7IA 1RJYA 1RURH 4TV8A 1DANU 2ITDB 4U1MA 4BGLA 5IY5C 4DRXA 2EH8H 2FL5A 2VYRE 1OV9A 3E8BA 1K8IA 2V7HA 3ARFA 2VABA 4L37B 2Y5QA 1PJ9A 3QFGA 4FP8H 2HRGA 3EDDA 3QJRB 2OR9H 4R8WH 1QNIA 5CM1A 4NZDA 5IESL 2A06H 5HTSA 1ONQA 3IDGA 3QDJB 4BZ1H 1GH7A 3ARXA 1EN4A 5I5IA 1BVKA 2EDBA 5DYOB 4A7TA 1ACYL 2GTZB 5C0AD 4PJ9D 5KOVC 4OF3A 1BJMA 3RVWC 1B9ZA 4TXVB 1HR0B 2FVNA 1K5NB 4Q6IB 5E5LA 1WBZB 1IL1A 5EEYA 3FH8A 3UTZA 4U1JA 1G7HB 3T1FA 3IE9A 5SWSD 4ZMQA 4JM2A 4N0RA 3MRBA 4H0GA 3E38A 3O2DA 3ZL4H 4CU7A 2P24A 5IFAH 4H13B 4A7UA 3UPRB 1W72L 2DLEA 1Q90A 2UZPA 4H8QA 4L3EE 1MFMA 1NICA 4HIEA 4HWNA 4MQ7B 5HGBB 1BD2E 1F2XK 3NCYS 1HINH 1WEJL 1O7DE 4XPAH 3RBZA 1CFBA 2YXWA 3MRQB 3J81N 2R23B 3SHSA 4MWFA 2VSKB 3C08L 5C0GB 4AM0Q 2OL3L 3UZVA 1AR1C 1F3DH 1N9PA 1ZWIB 3K4AA 3NACL 2XRAL 3KGSA 4XXCA 2X6BA 2BDNL 2OSLB 5ESQB 3FN0L 1CZ8H 3ZXAC 1AS8A 2Y36H 1A7QL 4V33A 2L04A 4UIMA 2ZUWA 4NO0B 1LXMA 1U8MA 1GS7A 2PCPB 4JZGA 3O0RL 2CGYA 2JJSA 4GSDL 2XWBB 2ZXAA 4NT6B 2QHRL 4WFHE 4WRLA 5E2TL 5C6TL 3H9ZA 3PL6C 2X4NB 1M05B 2ZSWB 2QV2A 3LKQB 5C0IB 3HG4A 4GX0A 1OE2A 4K7PL 3QJHB 1EFXA 2AJSH 3EGXA 4IS6B 4IHJB 5F9AC 3MJ9A 3TA3C 1KECA 3EUUA 4JZOB 4AG4H 1O6SB 2ADYA 2ENQA 1XB6A 1GW6A 3FB5B 5DJXA 1NTMH 2RDCA 3A0OA 4FQ2H 4Z7VE 3V52L 1KGUA 3N1QC 4I18C 3V5KB 5HP5A 5I16A 2AFNA 5DHYA 1UM6H 4NAJA 3PFQA 1WJZA 4H0LC 2J1ZA 3DLQR 4FQIL 1W72B 4P2QB 4XN4A 2Z7UA 3O3BA 3G6EV 3LPGA 5E4EB 1RULL 4JREB 5HHNA 5BZDA 5ITZB 3GZQA 4I0PD 3LXUX 2FT7A 1ORQA 3ABMB 1ZLDA 1DBBH 2CZNA 3AABA 1YEGH 2BOBC 2WTOA 4UZGA 3ZLQC 1ZAUA 4XOCA 1GSKA 1UT1A 3FB6C 2FNWA 5GGQL 1XEQA 1CFTA 1I1YB 2AQNA 2OL3B 1TVKA 3BZDA 3SDLA 1RHHB 2WLIB 4LKCA 2Q10A 2XCMC 4LF6B 4JAAA 2PI5A 2XLLA 1RJCA 4PJFA 3CNKA 1KIUB 4JVUA 1G4YB 1P5VA 3H9SB 2VDOL 4N68A 3CZFB 4RH4A 1XF5B 2FHFA 5HYFA 4LCWA 2KDGA 1KXTB 1MW0A 1JIBA 1SVZA 2DIJA 4H8WH 4LAJH 2KL6A 5E1QA 1PNCA 1JRHI 2NW2B 3S48A 2QR0B 3C5ZD 5GRWA 1YQ2A 5M95B 1T3FB 2W60B 3T8MA 4CVUA 5GS1C 1CT8B 4I0XB 1YMMA 1Z66A 1CFSA 3RVUD 1KPUB 2R7EB 1RLBA 1X4XA 4PJAE 1KDJA 5CN1A 3TYGL 1WC7B 5INDB 2H6UA 3HMXA 1QZ1A 3JT0A 1M57C 5GPRA 4ZXBC 2WYZA 2OP4L 3VG0L 3ME0B 4MD5B 2FB5A 1MPAL 1SLXA 3TP4A 4MMYA 5EU6E 3C2AH 3I9IA 4HH9B 1WYJA 2NMSA 2VQ1A 3HN8A 2PGGA 1H5BC 1MDTA 5E9DE 4OSUL 4F7PB 1DTUA 1DN0B 3CX2A 1F3JA 5BS0B 1J8HB 5EZJB 3DNKA 3G5XB 2H4EA 2ODHA 4KI5D 4U6VL 4KXDA 2L35A 4N0CC 2NLJB 4GBXC 4R83A 3ZT7A 1LEIB 5JHDA 2JF1A 4GW5B 3LN4B 1EXHA 2IFGA 2EKSB 4OFPA 3Q43A 2VAJA 1A25A 1MFNA 5D6DA 1Q94B 3REVB 1KP2A 3PDOA 4EUPH 3QUXA 4KXRA 1A22B 4TNVF 4HS6B 4NXNO 2HLAB 4X2UA 1Y4MA 3CCUV 2VDOB 3A4EA 3PNWB 5AAWA 1T2JA 1OGTA 3HE7D 3SE9L 4H8WC 5I6XC 1X7QB 4S0SD 3UO1H 2WXMA 1NVPB 4Q58C 5HDQL 4WGWB 3C6LD 5D5QA 4LLMA 2E27H 3K3WA 4B3EA 4BYHA 1SC5B 4IDJL 4LSTL 1TZIA 2AP2A 3QQ9C 5D70H 3FDWA 1Z1WA 2EEFA 3O2DH 1BIIA 2WIMA 3ULUD 3UJJH 4PP1D 2VRZA 3AK3A 2P5OA 5I30L 4R6UA 3DTXB 3LEVL 3MUZ1 3LH2H 2E56A 5LMUB 2YIHA 1VQ5V 2ITCA 1KBKA 2H8PB 5AW4B 3DXRA 1ED3B 2WA4A 3TPUA 4O4YL 4IK6A 1CN4A 2D9CA 3S4SA 1C5CL 5CZVL 4K8RD 1ITCA 4OTXL 3TIEA 1B2WH 5LP6C 3H3BC 4Y88A 1FO0L 2CALA 2F74B 3OPZL 5I8CB 5EUOA 3RA7H 2FQEA 3OC8A 1A64A 5CGMA 1OJHA 3BT0A 1IGFL 3OKYA 5AW6B 4EN3C 1F4XL 1CLOL 1DJZA 1IBBA 4FCHA 4M43L 2ADGB 3EFFK 4LP4A 2CHWA 3QDJD 4LBEA 4OR1A 2QQKL 2W65A 4ETQA 4F37F 1D5ZA 4F57L 3ABKB 5DK2B 4IBVA 4KJYA 3MJ9H 2LVEA 4L1DA 2ZKHH 4PPTA 5DSCB 4JTAB 1EMTH 1KB9F 1RJLA 1ZMYA 4WEMB 4XAWH 2YZ1A 1O9ZA 1I1AD 1NBCA 1YAIA 1Q9LB 2XN9E 3GHEL 1QO3A 3KPNB 4NO2A 2AQQA 3CBRA 2R4RL 2IIJA 5B39G 2DE0X 1CE6A 2IDFA 3Q2LA 5HPOA 4X80L 1IKFH 4G8IA 1E30A 1SJXA 1XNRO 5DDHA 4QOKB 1C8QA 1OP5K 3TYFB 4H1LA 1HHKB 2F54E 3IDYB 1Y1DA 2ZOOA 1DZBA 2DWEB 3DK2A 3UGXA 1W0WA 5IB1A 3WNKA 5IP4A 3M7FB 2XFGB 4OW6A 5C9JA 2UXDO 5GGUA 4JFVA 5ICZB 1OIOA 4FKKA 3LV3B 2E9BA 4RAHA 3JD4A 1FORH 3W9DA 4DV5O 4MA1B 2APXA 1NUGA 4BH7A 1WP7A 4ZAKD 4PJ6A 4KDWA 4FABH 1EEYB 1G1CA 5CCKL 2NY1C 2ZR2A 3IJ8A 4EXKA 1KNOB 1QSVA 3S3JA 3ZE0E 3ISYA 4Q9RH 3HG0A 4YAQA 2G75B 3CJHA 5BQ7A 4BJLA 4V1DB 2B1IA 2QLYA 3FCSB 3TCUA 3FUHA 3QORA 1RIHL 1IQDA 1M42A 1XO8A 4FQCH 5FFGA 1KIPA 1YCSA 3KXFA 4MNQE 2Y06H 4MZ3A 1MFAL 3HRZA 5KANG 4LARL 4NKGB 1HXYB 4OLXL 12E8H 3HI6H 1G8MA 3ECVA 3FT3B 2PO6C 4P2QD 5L4IA 4M7LH 5BVJB 3NH7L 2CPUA 2BLFA 1JGDA 4Y4KC 4JI3B 1N0LA 5F3HB 3VDBA 5E1AA 3J80N 4PD4K 2EDOA 4N8VG 1KTJA 2GSGB 2BNUB 2IJ0C 1YEJL 2IAMA 1J0KA 1ZPUA 5D96B 1UQSB 2QPDB 5BV7C 4P2RA 1KFAL 4PG9A 4G71B 2AEOA 4UQ9A 4PJHF 3D85A 5EZPA 4NQVA 4BSVB 2WOBA 1JXJA 2FWLB 4FL4B 3Q5YA 5JORA 2R4SH 3PV7A 1F23A 1BXUA 1XT5A 1JNHB 1GGCL 2DEWX 3B56A 4R0LC 2Q8AL 5I75B 2VQEO 1EAJA 1LD9A 1IAKB 4G80A 1QW9A 1QVGU 1SN2A 2CBPA 1IBZA 4LHUB 5G5DA 3CU1A 2E76B 4HD5A 3FK3A 1N8ZA 4W81A 1YSCA 1HNZO 1FI8C 1RUKL 4JGSA 3HUJE 5FCSH 3S9DB 2KG7B 5MI0C 5DEFA 2Z8WC 3Q2NA 3QJFA 3H9YA 1CPYA 2CK2A 3CVHA 3HHSA 3EG9A 3KYKL 3HZKA 4LCYB 5AW7B 1WFOA 3E0GA 4P2OC 4LEEA 3X3FL 2VR8A 2JI3A 2WKOF 1Y6XA 2IQ9H 1FGVH 2D9QB 1F6AB 3ABGA 5FPIA 2MOGA 2YSTA 4QXVA 5MP6L 2PZSA 4N2EA 2A83A 3TO4D 3FBKA 2P67A 1ML0A 2PTUA 3I9GL 1P1VA 2XUMA 1J8HD 5CS7A 4JYAB 1E3ZA 3QG6B 5B3NA 3NJNA 2R0LH 1QLRB 3W2DL 2IPTH 4JDVB 3BAYA 2YGQA 3M1CA 4LSSH 4RZKA 5DRZA 4N0YH 3KCXA 1BD2D 4HKXB 5AFAA 3FKSG 3CK0L 3U4KA 3JWOL 1S9KC 4J2XA 1HZKA 3ZJAA 2YGOA 2XV3A 4PGZA 1VZGA 2K1EA 4PJDB 4WJKB 3PP3H 2DTSA 2NTFA 3S3BB 3W9EB 2BSSB 2H9GB 1Q9OA 1JFFB 4I55A 3MRIB 4U6YA 1LK3H 3K1KC 1BMFG 1JPTL 4FZ8L 1NVPD 4PJBF 4UILH 3LHPH 2O26U 4QJFB 3OUFA 1VQ7V 3DWTA 3ESPA 1NCBL 3MACL 3S5LG 4K15A 4GKSB 2JB5H 2HG0A 3UX9B 3UYPA 4N0UA 3T2MA 2W38A 4WFHD 2J1YA 5J5EA 5IQMA 1ERNA 4L1HA 1E43A 4XXWC 2Z93B 3AU1B 1TJIH 3OKKB 3RHWK 1AQ8A 4HK3J 4JZ2A 4ZFQA 3ZE1B 2AGAA 3BYYA 5I1DA 2CGRH 1VARA 3AACA 4O02H 1T5XA 5EBWA 2J8UA 3OF6D 1OZTG 4Z7OB 4B3RB 2W80C 4AH2A 5FDWB 3BFRA 4NWTH 1WTLA 5GGVH 1GZHA 3OFNG 1S9VA 3D0VB 1NKRA 2BNRE 2FEDC 4DUYO 3L3GB 3MNVB 1J0JA 4PA7A 3WN5C 1EQWA 4ODTL 2XXGA 3TEZA 1FRGH 4DTGL 5BJTB 4NRYA 5ACLA 3O9WB 2CK3G 1TDQA 2BVUA 2YLKA 3J27A 5KG9B 2GC7C 4FMTA 2A0LC 4C8XA 3NN8A 4RFNC 3ZMZA 3QZWA 2G5BB 1MHHB 1ZTXH 2HT2D 4IBSA 1AE6H 2NZ1A 4K9EH 3BCDA 5IVXE 4F20A 3EO9L 5KS9F 4I7ZB 3JASA 4LLWB 5IG7A 2Q3ZA 1XH0A 2B5IB 3IDMB 3DJZA 2RMNA 2LFSA 3B2UC 4Z3HA 3WYRA 5C0BA 5I15H 3BT2H 4DW1A 2A5UA 1K72A 4L48A 5DEGA 2KMWA 3TJEH 4CW1A 1ORSA 2AV1B 4EDWL 5CR1A 4OZFH 5E8PB 3DUUB 5FS5A 1DLHA 5TJWK 3MRKA 4NQCE 2EYTB 4OX9O 4M9PA 4XWGH 2FX9H 2A9AA 4X89A 1ID2A 4GI8A 1S4IA 2YAEA 4U3JB 3FJTA 4UT7H 2BW4A 4GUPB 4LGRB 5TK4A 2VXQA 4QOKD 1G4RA 5MEPB 3TBYB 4X98A 2J20A 2W9EL 4FLHA 3IN2A 1I8KA 3RNQB 2DMHA 3QUZD 3ZMRA 5FOBA 2OT5A 2R9AA 4Y2OB 5B1JA 4FA6A 3K06A 1MDAA 5LA6B 2V37A 1G6RL 4N3UA 1FNHA 2Q7YA 4PRDB 4QTIH 2MKLC 3GC3A 3TV3H 4FVMA 4GW4B 2YS8A 5AVUB 4NN5B 4K3DL 1BL8A 1AQMA 3IXTB 5LBVA 4DIXA 4JFFE 4ZTOL 4PJ8A 1PIGA 3F7LA 4C56A 3KMDA 2WZAA 2LLGA 1IRAY 1DUYB 2A9HA 2D7MA 2QQLL 5JIPA 2BWQA 2FWOB 2YFNA 3IJEA 4L3AA 1N19A 3IK2A 3KNBA 1HILA 5I8EA 3W57A 3ATDA 1M71A 1BZ9B 4BWAA 2BNQE 3L13A 4K9EC 3CCMV 4WFFD 3SDXB 2FO8A 5I28A 4MYWB 2Q86A 4B3SO 2H2PC 2VN6A 3MXWH 4OLVL 4UDUA 1HNWO 4YGVB 1ZS8B 1EPFA 1G7LB 5ISZE 2D03L 2X9XA 5D1XE 2NY7H 1ZLSL 3CS5A 3ZN0A 1FE8H 3SJCC 3MREB 1P53A 3GSXB 3MR9A 2QTSA 1PX3A 2YD3A 1ZHLB 4RX4D 3FU7B 2UUAO 4XHJC 3U6XA 4K2UH 1FUNA 3RPKA 5KZCB 2NYKA 3VXUE 4L8CA 5DJAB 3RZCC 5SV4A 2FJFB 2PNDA 3O8XB 3RJOA 4Y5VC 4PJGE 1JSYA 4M00A 3SKNB 4OFYA 3OLGA 3V4PH 1E1QG 4LNUB 1IBKB 2XAHA 4NENA 1EHLL 5TPWL 3T2NL 4MNHB 2BCMA 3DGEA 5D5MB 1ZT1A 2CR0A 2Y7MA 4L4VA 3A5VA 2FBRA 3VFWA 1B4TA 3CDGA 5JIDA 3EGSB 2D7QA 3H01A 3S36H 2GAZA 3LDCA 5J13C 2VW4A 4JDTH 3VFMB 5B7MA 1G6RB 3K5MA 4JDZA 1D2DA 1CXLA 4BFKA 3C5SA 5B38B 2VSCA 5AW9B 5LG6A 1OO2A 1A7PH 3FQ2A 2RMKB 2ZOLB 4FEIA 4CADA 1IMHC 1BF8A 1JZ7A 2DS4A 5FGBC 2NNFA 1ETA1 2MSPA 3COOA 1NCIA 4K7FB 3RE0A 4W93A 1UWFA 2MEJB 3S3SA 1ANUA 2HHHB 3MODH 1YIJV 5HYSG 3ZKNC 2XETA 4DAGH 1U3HC 1I3GL 2DLIA 1FFPB 2QPSA 4HUUA 4Y16D 5JYMA 1K9MW 1HHIA 5KOMC 2X6VA 1WLEA 2AQ1A 4F4LA 3OR7B 3V95A 3Q8EA 4XTRD 3CXHF 3DX8B 4DXWA 1KC5H 3IMSA 4OCSH 3FO2A 4KP4A 1QWUA 3D25A 2VO5A 4JMXA 1F2QA 4M6OL 3TZVC 4B9PA 2Z35A 5E8DL 5M94B 1JNLH 3AXHA 2PYLA 3HZYA 3SDYH 3LPPA 5CBHA 2ZUTA 4Y1AE 2XN9D 3LZNA 2JELL 3HHRB 3KGRA 3LS5H 2ADIA 4QE9A 4JFDA 1P49A 4HG4J 4HMDA 3S96A 3RYIA 1NBYA 4G7RB 4JI6B 4N0FB 1F51A 2ZOUA 2ZIMA 1SN0A 1KLUA 4ORZC 3QH3B 4RGMB 5KJRH 1A2YA 4AIEA 3T4ZA 4QO1A 4LR3A 3VFPB 2F54D 3ZTDC 2I25N 4P30A 3MLPA 3N9GH 1JJUA 4Z3EA 2ENJA 2X4SB 2QWQB 3BZ4B 3MBWA 4GIOA 5DXWA 5BOJA 5BR8B 2E46A 2ZOWA 5EC2A 3CZJA 4X7TB 3FUFA 5C97A 3SGEH 3FTGB 3AG4C 3BIKB 5I6LA 1S7QB 3NP4A 5FC9A 5E6ZA 2UXTA 4XCYB 1V7MH 1EZVX 2NCMA 2CJ3A 1A4KA 2WUBL 2RTTA 3Q2VA 4MB1A 3KPRA 4AI7A 4AOFA 2A9BA 4G9FB 3MLXH 5CGBA 3MRJA 3CMGA 3E83A 4H8VA 5I1GL 1N26A 1D5XB 3ZRFC 1N8RW 4UV8A 2DN7A 1I8IB 5IMLB 1J0ZA 1KYOJ 5GW7A 3KBEA 3KH3A 5AOKA 4AKOA 2F53E 4E2OA 2PXYA 2A9MH 4DUZO 3FU0A 4IBTA 5B8CC 1FF5A 3K8MA 4P5TC 3S3DB 1HSAA 3UXFA 2X9WA 3MV7E 3GB7A 1R3LB 3W7XA 1HI6B 4K71B 4I50B 1E4JA 4Z1PA 3Q13A 1I4FA 2XWTB 4FYQA 2OR7A 3QUMH 1LILA 4PBWD 4DQAA 1EZUA 4NUGH 3JCUZ 3RDJA 3HJEA 1MRDL 3OX8B 1IC4H 4PH8A 5EZOH 4RLDA 1OF0A 4HC1H 1G9ML 1TTUA 1VENA 1AKJA 1W9XA 3O9WD 1FFRA 4PTTA 1FSKC 4OUUA 2NUTA 3F00A 1DQDH 1NCAH 2DF3A 5E7BA 1XHXA 4JO2H 1HK6A 3BAWA 1MJ7L 2I32A 1MG3C 4TQDA 3AC0A 4PAZA 4J41A 3NIFB 3TVMC 1JGUH 3GF8A 2XI9A 3VNZA 1KXVC 5L2KE 2DIBA 4N2CA 2BVOA 3VJ6A 3O3EB 4DEWA 2ZE5A 3QPQD 2GK0B 4QXTB 5KVGE 5CP7A 1QHPA 2X4PB 1DLFL 4QRTB 5IV2B 1KJ2H 1NUNB 4LMQE 2DQIH 4KK5D 2E9GA 2R59A 5C0JA 1NM4A 4KJQD 2WO3B 1MY5A 1MCWM 1JV5A 3QFJE 3GSQB 1I8UA 5ICYB 2IQAA 5GJSL 2I9LA 1BW8A 3DX2A 3LIZA 2R29A 4J3OG 3PNRB 4NB5A 3CBJB 4MNGE 2WLMA 4GQPH 3L72H 2AK1H 4GAYA 4RAUA 4NI6A 5DVKA 1RPQA 4AMKH 1HNXB 3VI3B 2OFQA 1INQA 2ZPKL 3KWTA 4JRYA 2R9HD 4G1EB 5L4FA 1E28B 3L7EA 4ZUTA 5I1LA 3STZC 5D8JH 3P3NA 1VSCA 2ZUQB 3OTOB 3MV01 1HYSD 3VYNA 5GS2H 3BPLB 4O4IB 4Y1AB 2R2HB 4M8QA 4YDLC 2FL4A 2H2SC 4IEFA 3K03A 2I24N 1KBBA 4A63A 1CDBA 1W0KG 2YIDA 1UD8A 2Y3NA 2IGLA 4JG0H 1X5LA 2CU9A 1NSNH 2XHNA 3VCLB 1PZCA 3K46A 1R3KA 5F8RC 4KH9A 2NX5A 1JCKA 4PG2A 3WFDH 3TNNB 2KSDA 4HQQL 1A9BA 1QOKA 1KDIA 4G9DA 4HKBA 3TLRA 4RDQG 3C9NA 5HY9A 3BPNC 1VQ8V 1XNQO 3CC7V 4CGUB 4UNUA 5KZCD 1A14H 2ED6A 4Z0XB 1EAPA 4LSVH 3TEYA 3UOAB 2MPAH 4I8DA 1FP5A 2A79B 3QR0A 3DPBA 3D6GA 3O8XD 4UCTA 1JWSB 1U41A 3FRUA 5I1HL 2OWOA 4B97A 4FFWC 2X4QB 1FC2D 3LNGA 3RFRA 3UJIL 2Y4UA 3V0VB 4JI2O 5DD5L 3FHEA 2CXGA 3PWNA 4LPYA 4MVQA 5BXFB 4W68A 1P7QD 5HVWA 4XVJH 5DO2D 2GI0A 3Q2WA 4WHDA 5E7FA 4NCC1 2PMZA 5BZXA 4OZHE 4F8OA 4CN1A 5T1LB 1RZKC 4N21A 4W4NA 4QHLB 4XP9L 2X0VA 3ERXA 4HYTB 2VMJA 4QGPA 5L6YH 2C1OB 5AW2B 4JAVA 3VGAB 4OCWL 3D2UB 4DW2L 3ZDYE 1D2OA 2HAZA 5I76B 3MJ6A 4FLQA 4KI5F 4FG4A 2KZ1B 2XFXA 1D9KC 3D18A 1K2DA 4R4BB 4CSTA 1JXGA 1HZHL 1JZ6A 1PD1A 1KTDB 2AQPA 1MEXH 3WLWD 1FYTE 3IGAA 5SWZB 4WW2B 5J11C 1V3MA 3GRGA 4PP2B 3IFPB 1SVCP 5DZVA 2EIJB 4MMXC 1DL7H 3O11B 4GLRH 2V7QG 3MCYA 2YPVL 3OGIB 4AT6B 3P3SA 3VYOA 4LDOB 5K9KB 5DO8A 4ZDHA 4X4XB 2C1PB 4IRSA 4HPOL 4WWOA 2W5PA 2ICWJ 2NPLX 5KA5A 3R0NA 5DRWB 4O2FB 3DTUB 4FERA 3WB1A 2EDEA 5LXGL 4PGBB 3VE0A 4ODSH 5IREA 4UUJA 5I1IH 3ULUF 4R90L 3SOBL 2O6FA 3EJPA 2K6YA 1SLUA 1XB3A 4QNPF 1IUZA 4ZS6C 1CK0L 2OM5A 3PWPE 1QSFE 3L4WA 3KYMB 1J05B 3FN3A 4EDXB 1OB1A 3CDZA 2PLTA 4M03A 1GKOA 4IHOB 4LPCA 1OGAB 3MJ8A 5T33H 3WNPA 5IROC 3FH7A 1FLTX 2LE9A 3KLAA 4PJXF 4F5CE 4HWEH 2UUCO 4H0HB 4BFIB 5KHKA 4FLWA 1A6ZB 4JZJB 2FR4B 1P2CB 4PW9A 2CTWA 1S5HA 4WI7A 3VRIA 1F3DJ 2YUVA 2P43B 2ZOKA 2AEPH 2FUQA 2AJVH 1T83A 5FKPB 3QO7A 1V7NL 2YXMA 4XVSH 2YPKA 1UADC 4GRLC 2OW6A 4PJIB 4PRNA 3QE5A 4OV6F 4WO4C 2I9TB 2K70A 4UVCA 5EOTB 5J56B 4KZ0A 4PLJC 1I9RL 1AVAA 1AQDB 1CLCA 4JFFD 4JN2A 4BE6A 1Z5YD 3SQBB 3FO1B 5EF3A 4X6FA 4G9FD 4KRLB 1JMZA 3S5YA 2WOYA 1KBGL 3PJSB 3VXNB 1AG6A 1MFEH 4YHLH 5H35A 1BVZA 3UG5A 4P57B 5HI3D 2XHBA 3C60C 1MFCH 3QUYB 1N36O 4L4TA 3QFDA 2BNQD 2EUZA 1S3KH 2ZX6A 3DK0A 3KWWB 3QXAB 4IMLA 3VFRA 4OM0L 4AYGA 3U0PA 2H0JA 2AXFA 3GJFA 3ZMUA 4UMSA 3FO9B 5IMOB 2WNWA 4TULL 3GIZH 1VIBA 1MI5B 5TF0A 4QXGH 5DS8A 5EIBC 3MPCA 3FS9A 4LCUA 3UAJC 4JO4L 5E6IB 1VF6A 2HRLA 3DI3B 5D1XD 3WU2Z 3ESUF 3QC5X 4KHXL 1FVDA 4ZNCD 3QA3B 2ZNWA 2VC2H 3IDXH 1B0RB 4M93B 4MCYA 4GCZA 4POZC 5DJ6B 4KZEH 1K5WA 1UZ6E 4AQ1C 4RRPM 4WSJA 4L0ZA 1AFVL 1NDTA 1OT4A 1DUZA 1NJIW 1NINA 1OAZL 1Z2KA 3MA9L 2Z31B 3WE6A 3SKMB 4WEEA 1T1XA 1EHXA 2MOVA 4P9HL 3VFNA 2OCFD 1F90L 2R8SL 4LNVA 5I1CH 5DRXA 2HJDA 1RK1A <