1AR1B

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
b'QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
molecule tags Complex (oxidoreductase/antibody)
source organism Paracoccus denitrificans
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ar1B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ar1B01
2PLTA 3TBBA 3NJNA 4W9ZA 4DP2X 1PNDA 1GS7A 1BXUA 1PCSA 3UAEA 1FFTB 1RZPA 2UX7A 1PLBA 2BP8B 2XU9A 1JXGA 4P5SA 3FU7A 1MG3C 4BXSV 4QLWA 5I5MA 1L9PA 2IDUA 2UXTA 3GXUB 5PCYA 1AQ8A 2XX1A 4TXVB 1A3ZA 1AS7A 2VW7A 5IY5B 1OE3A 3BVDB 3CZUB 2YAQA 1AS8A 5LDUA 1NTDA 3ZX1A 1AAJA 2ZOOA 3FT0A 2PPEA 4AKQA 1VLXA 3OM3B 4YVNA 4AKOA 4DP9X 4GP8B 1JERA 1NIDA 2DYSB 2FT6A 1BXAA 4HCFA 5E9NA 1MZZA 2EIKB 1TEFA 4BWWA 3TA4D 3X2QB 3S3DB 4K9JA 3UGEA 1L9TA 2EILB 1NIAA 2LLNA 1GY2A 4YSQA 1SHWA 1OF0A 3QJRB 3OMIB 1JZGA 1A65A 1RZQA 4X4KA 2FQGA 1A4BA 2IDSA 2X87A 1ZDSA 4KO9A 3NJLA 2GBAA 2JKWA 1GR7A 1B3IA 2R7EA 1FA4A 2W88A 1NPNA 1XB3A 3NJKA 4YSEA 3AG2B 2YXWA 2MRYA 2H47C 1EHKB 4Q8BA 1T5KA 1J9RA 3S3CB 3FQ1A 3ASOB 3S8FB 1KCBA 4YSSA 2Q9OA 2UXVA 3QJSB 1CC3A 4RH4A 1BYPA 5B7FA 1W6WA 1AIZA 1NIBA 4Q89A 1XB8A 4GY4A 2YAPA 5A7EA 1BQRA 1ZIAA 2BW5A 3NYKA 1KDJA 3DKHA 2YXVA 2PPDA 4JHUA 2PP8A 2JFCA 1NINA 1KBVA 1AZNA 3G5WA 2IDTA 1GYCA 5B1KA 5I6NA 2Y1AA 4YSUA 2I85A 2QPEB 1AR1B 2PP7A 2XVBA 3IN2A 3EH5B 5D4IA 1A4CA 2CJ3A 4PCYA 3X1GA 3H4HA 4YSCA 7PAZA 1ILSA 1GW0A 1UATA 2B3IA 4G71B 1E5ZA 1X9UA 4YSAA 4AKPA 3ABGA 4BWUA 1WS8A 4BDVA 1NIEA 3ABMB 2AVFA 3S3BB 2OJ1A 1R1CA 5F7AA 2TSAA 3NSFA 1PZCA 3WNJA 2HX9A 1TEGA 1SDDA 1PZBA 3NSDA 1OOWA 4FAAB 3QQXA 2ZXWB 3PLYA 4YL4A 4YVUA 3MX0B 3SBPA 2DYRB 1NZRA 3AG1B 1OCZB 3NP3A 1SFHA 4E9WA 3IEAA 2A3TA 3T6VA 4UF7C 2HRHA 1BXVA 4KNUA 1URIA 1JZJA 3PXLA 1CURA 3IBOA 4HHGA 1JVOA 3JT2A 1ILUA 2QDVA 2IWKA 4WKXA 5AFAA 2YARA 4A68A 1ID2A 3FSAA 2DY2A 4GP4B 4DP6X 1ZDQA 2CCWA 2CUAA 1RCYA 4NERA 2EIJB 2BWDA 4QKTA 3FPXA 3X1NA 5I6MA 3PPSA 1E67A 5D4HA 2TSBA 1N70A 1L9QA 2HRGA 3EH4B 2VSMB 2Y69B 3OMAB 4PAZA 4AX3A 2PCYA 2W8CA 5I26A 2FWLB 2PCFA 2IWFA 1PMYA 1A4AA 5EHFA 2GC4C 1KV7A 4WTQA 3TASA 1J9TA 4NB7A 4N4YB 3EF4A 4KO6A 3S8GB 2EIMB 2OV0A 2BZ7A 3FQYA 2FQEA 1ETJA 2YAOA 2J5WA 1KGYE 1JOIA 2XLLA 2NRDA 3PCYA 2XX0A 4A2FA 2UX6A 2PPAA 2PP9A 4G70B 3NJMA 1NWPA 3FYEB 4E9XA 1N68A 3D12B 4A67A 3H56A 3IE9A 1PLAA 4DP8X 1IC0A 3NJHA 2QT6A 3T6WA 5AZUA 3WKPA 4DPBX 3DIVA 2YQBA 5I6LA 1WA2X 3CVDA 3FU8A 1GS8A 4FA7B 3FYIB 3ZDWA 2GSMB 4N8UA 3SBQA 1J9SA 1GY1A 3T9WA 1SJMA 2WSDA 2FQFA 1HAWA 2BZCA 2WO2B 4DP4X 3PAZA 1MG2C 3N55A 1KCWA 2IWEA 1OE2A 3GYRA 1WA1X 3X1BA 3KW8A 1SNRA 1L9SA 4NAJA 1JXDA 1SF5A 4KO5A 5D4JA 1AG0A 2VSKB 4A2GA 7PCYA 1WAEA 2HX8A 5AKRA 4DP5X 4A2HA 3X1EA 1ZV2A 2BWIA 1AACA 4YSDA 4KOCA 2AZAA 3TBCA 4E9YA 3WI9A 3ERXA 2VM3A 2GB2A 3ASNB 2VMJA 3CDZA 3NJIA 3WIAA 1J5CA 3QJUB 4DPCX 5I6OA 1ADWA 3AW5A 4BDVB 2FT8A 1M57B 1SFDA 2BP0A 1W8EA 2H3XC 4E9VA 1NPJA 3MBWB 1JZIA 1PY0A 2YAEA 1ET7A 6PAZA 1W6LA 4EF3A 1J9QA 2UXFA 3CDZB 3FS9A 3OQRA 3FU7B 1OCOB 1QLEB 3H4FA 2BW4A 3T71A 4GYBA 3RYMA 9PCYA 1NIFA 2J55A 1QHQA 2VM4A 3ZIYA 5B7EA 3NJGA 2XUWA 1X9RA 2XXFA 3NJJA 3PAUA 1CYWA 4GP5B 4L0PB 3V9EA 2AZUA 4W1TA 1ASOA 1M9WA 3CG8A 1A8ZA 1ZIBA 4A66A 4JHVA 2HZHA 1AG6A 1PLCA 1WS7A 1AZCA 1DYZA 2J56A 2FNWA 4KNTA 4E9SA 4HHWA 2FQDA 5I28A 3ABKB 3UAAA 2JXMA 3CVCA 3X1FA 3QJTB 3V9CA 2I7OA 4AZUA 4KOBA 1BEXA 1XMEB 1AZUA 5ANHA 5TK2A 5FC9A 1ASQA 3OMNB 2ZWNA 3SQRA 3GDCA 3L45A 2OCCB 3AG4B 3T6XA 3FU9A 4HCGA 4A2DA 1PNCA 1ET8A 4F2FA 2AFNA 4G72B 4DP0X 3NT0A 1AZRA 1DZ0A 4HALA 3T6ZA 4AI7A 3QJQB 3ABLB 2DWSA 1CUOA 2PPFA 3PAVA 1BAWA 2GI0A 2I7SA 4G7SB 1MZYA 3NP4A 1AANA 1AS6A 2XV2A 2HX7A 4KNSA 1XB6A 1I53A 2P80A 1YLBB 1KBWA 3WG7B 2UXGA 2B08A 1ET5A 1WA0X 3EH3B 3NJFA 1NICA 4BXVA 2J57A 1J5DA 2Q5BA 2EINB 1JZFA 4HCIA 2X88A 1JZEA 3FQ2A 4F2EA 2YAMA 3SBRA 2E86A 3FSWA 1FWXA 2MTAA 5B1JC 1GSKA 3CVBA 4P5RA 2GC7C 1GS6X 1V10A 4UANA 4BWTA 2XV3A 2XXGA 1KYAA 2CBPA 1NDTA 2DV6A 1QNIA 1AZBA 1OCCB 2IDFA 4UAHA 4YSPA 1PF3A 1SF3A 4A2EA 2HLEB 4M4RB 5I6KA 5B3SB 2CAKA 3IN0A 3UADA 2HXAA 1M56B 2GIMA 1L9RA 1SDDB 3HEIB 3BQVA 5PAZA 3EHBB 3UABA 2N0MA 2IH9A 1OCRB 2IAAC 1ZPUA 4E9TA 3HB3B 3ZBMA 1IBZA 1CYXA 1PAZA 3KW7A 4CSPA 4HAKA 4ENZA 4DPAX 2H5UA 4KO7A 4YSTA 5F7BA 3UACA 2VW6A 2YAFA 1E5YA 4GXFA 8PAZA 2ZONA 4HZ1A 3U25A 2QPDB 1IUZA 4YSOA 3TU6A 2IDQA 2VN3A 2FT7A 1V54B 3AZUA 1BQKA 3QJVB 5I5JA 5B1JA 1E30A 3FSVA 1BYOA 2QDWA 4MFHA 4ZK8A 2YAHA 2BP8A 2IH8A 4HIPA 2P80D 2PPCA 2FJSA 4CSZA 2AANA 1V55B 2BP0B 2XWZA 2BO0A 1OE1A 4M3HA 3DTUB 1HAUA 2BHFA 2RACA 3AY2A 2YEVB 3OD3A 1PZAA 2DWTA 5B1AB 2GHZA 1L9OA 2CALA 2FTAA 1TKWA 1IBYA 4G7RB 1OV8A 1EZLA 3WNIA 4DP1X 1NWOA 5TK4A 5I5IA 4G7QB 1RKRA 3FPYA 1JVLA 5B7MA 1JXFA 2VW4A 3QPKA 3AG3B 5B1BB 1KDIA 4E9RA 3JTBA 4YSRA 4BK5C 2R7EB 2XV0A 1SHXA 6PCYA 1HFUA 4E9QA 1ASPA 5I6PA 2WO3B 3N2JA 4JKNA 3NSYA 1AOZA 1TU2A 3FSZA 1JZHA 1MDAA 2XYBA 4F7KA 4DP7X 1E65A 3C75A 1BQ5A 1IKOP 3NSCA 3WKQA 1F56A
chains in the Genus database with same CATH superfamily
3B8MA 1GS7A 4OZIA 1HWGB 1QYGH 2FYYB 3L72H 2A9ML 2ENJA 2WGXA 1MZFA 1XGPA 3P3PA 2RHEA 3SGJC 1F4NA 3B2XA 2MCPL 1B3JA 4UQEA 3U1SL 1N5AA 2YI9A 2MJWA 4YEEA 3ISYA 3E1F1 5MP6L 3TP4A 5I5RA 4QRTA 4JI3B 1MAJA 3OX8A 4JPRA 5GGUB 3WG7C 1KGWA 2VW7A 1PJWA 3A21A 3NTCH 4FLSA 3ETBF 1A8JH 2NY6B 2WBXA 1E4XL 4HZLB 5F8QC 1NTDA 3QEQD 5E8OB 3UOAB 3LPFA 2KZBA 2ZYSA 1A0QH 4F4LA 3C2AH 5IYDO 3HTLX 1GC1C 4KQ4H 4YVNA 3DOSB 4N25A 3H54A 5GRYA 3F7YC 2NQDA 4KX7A 1MPAL 4OZHB 4TQEL 5I2IA 1RERA 3QIWB 4A04A 5I19H 3TO2A 4FCAA 4EVNB 5IMLA 3TA4D 3X2QB 2BM3A 5AUMA 4U1IA 1KBGL 1F1GA 4GS7B 5J6GA 5IW1A 4RRPM 1EJFA 3U36B 5E9DD 3PJSB 3K8MA 5ALCL 2G9HB 4N8VB 3SDCC 4MMYA 5CZRA 3ASNC 2YXFA 3R0MA 4ERSL 1I7FA 1F2XK 1P1ZB 3V4PB 2IDSA 3ARBC 3WELA 3CIAA 4AMWA 3K6IA 4P48A 5D55A 3JWOL 4O2AB 3LV3B 1O7DE 3L4TA 2WTRA 1WFJA 5CSZA 3DV6B 2G38A 4MJIB 4CH3A 1RULL 4YSEA 1AC6A 3QCVL 3T1YO 4AH2A 3FQUA 5BZWB 1UA6L 4PJ7B 1BZQK 5J89A 2XASA 2DS4A 2B59A 2EIZA 2ZNXA 4I3SL 1JGVH 4YY3O 2I9LA 4RZKA 4YSSA 1FFOB 2ATKC 1WFIA 2UXVA 3S5LA 3PJLA 1WBZA 3INUH 4LQ1A 1ZV5A 4OU3A 3TZVC 1DLHB 3MSPA 1JMXA 4NQUA 1U30A 4FQ2L 1IEHA 3QDME 1HSAA 3BAJA 3CFJB 2VDQL 4EI6A 5HD8D 2CIKA 1SQQH 1KB5B 3IU4L 1XB8A 2QTSA 3QQNA 4XCFL 3G6AA 4LPYA 1XF1A 3OXRA 4Q9CA 2PPDA 3RWGA 2BSSB 1G1YA 1NGYB 1WIOA 2CCVA 2A74A 4L1TA 4M7KH 3EOAA 4O4IB 1MRFH 4WAFA 1CMOA 1IURA 3LXUX 1N59B 1CFNB 2YMXL 5EIVA 3GM8A 4KV5F 2OMZB 3KR3L 4MLIA 1FXHA 4J3OD 4BFEA 5GISL 4XHJD 1UACL 1D5XA 2WXPA 4FCHA 4MSWB 4OIIL 5DWPA 2KLTA 4DCQA 3P69A 1ORQA 1IEAB 2EKSA 3S3BB 2WINB 3U1PA 3ZEDA 1RFYA 1ZY9A 2YIHA 3NSFA 3UYPA 2WBJA 3QG6A 2VQEB 5DRZB 4C57C 3GBML 1RUAL 3ARGA 1PEZA 1WN7A 4TNVF 1EZUA 1SBBA 4XPBL 4H25A 4YL4A 3WFCL 4FNLL 3O65A 5FGBA 4FNQA 4XOBA 3QAZB 1V05A 4PBDA 2FAUA 3UO1L 3VXSE 1MOEA 3ETBJ 4GXUM 5HYQB 2Q9LA 4P46C 4U6VH 5EWIL 3Q8EA 1RZ8A 1CURA 3LKRA 4J4PA 1D7BA 2DJUA 5F21B 3T77A 1YEKH 5DEDA 1NGQL 1QZ1A 1WDAA 2Y9RT 3GS4A 1XIWD 3BJ91 3BSHA 1ZGLP 2CO3A 1E0OB 4NN7C 4QRBA 4JYCA 3G08B 6CGTA 4WTZA 3KYMB 4XWGH 5IB1A 1FCGA 3S3SA 4GKNA 2IV9A 5FGCE 4AUJA 1J0IA 2WOBA 4RFOL 5ITFA 3S35L 2CTWA 4X5QA 4YOKA 1N70A 4N1CA 5DK2A 3KYOB 1QWNA 4RRPA 4U1MB 1AJPA 1BGXL 4NRYA 3C6EA 1KKDA 1U8JB 2PXYA 1KLGB 1A4AA 3QWNA 1IXBA 1ND0A 3H9VA 4F7CA 3ILPB 4WTQA 1I8LC 1GZQA 1I3RB 2E76B 3QO7A 4N5EC 3APMA 2OKMA 3SCMA 1AHWA 1DN2A 4GUNA 3RPBA 5E70A 5LAXB 2DIBA 1FDLH 3FRPA 4D9QE 4FKEA 3BP5A 3A22A 2VIRB 2J5WA 2DE0X 3IRCA 4NWUL 4RMWA 5DXWA 2V17L 4MVBD 1MI5B 3UBXI 4LVEA 3GPSA 2UX6A 2JGDB 4XXCA 3GRWL 4MWFB 1MFAL 4LPXA 1NWPA 5KYUA 2A38A 3Q3GB 1K8DB 4YC2C 4WF7A 4XPHL 2COVD 4QRRD 1BECA 3L5JA 4BUQA 4UOJA 2C2AA 2JRIA 1IAII 1E5CA 4AV0A 3MNMA 4GIOA 5DC9B 3VSVA 3TZVA 1TZIA 3FULA 3HC3L 3O6FC 4AIZA 3FYIB 3L7FB 1G6RL 3Q05A 4N8UA 1XF3B 3DSFH 5DHVB 5I1GL 2YPLE 3POHA 1HNWB 1KWGA 2PO6D 4L48A 4Z3FA 1N6QL 2P6JA 4FZEL 3ARZA 1IZJA 1CTMA 3QYCA 4U1HB 1H2NA 3SE3C 3I6LD 4EUPG 2BSRB 4P2OA 1EANA 2M1KA 1ERNA 5HYQA 1JXDA 3B2DC 1SF5A 3TK1A 1YEKL 1HDJA 4JFTA 4JKPH 4U1GB 1U3JA 7PCYA 1YY9D 1XX9C 1D6VH 4XO8A 4TSCL 3BAYA 4H5SA 4E9LA 4DV4O 3C9NB 1IKFL 4IU2A 4JO2L 3UJIL 5KHKA 2F7QA 4KOCA 3SY0A 2ZP9A 3BH9A 3ASNB 1VGKA 2VMJA 5CZXD 4XVUD 1KT2A 1BEYH 2C7UA 2IOOA 1G1CA 1F6AB 1UB5A 1QHOA 2APWA 3HE6D 5KS9B 4NXNO 1CWVA 3QEGL 4E68A 3TM6A 4RGOH 3AMKA 3IF1B 2X42A 4LNVA 4XNXH 1NL0H 4Y4FC 2UUBB 4DO4A 4B9ZA 3GS7A 3GSRB 2BCMA 5GSRB 3RVXC 4RSYA 1KTCA 3D36C 1KJVB 1K92A 3V8CA 2XAQA 2DLTA 3RU8L 4RAIA 5KHJA 5CD3A 2A74B 1A7OH 3JTSA 5F3BA 1R3HA 4X1KB 2WQUA 1Q6IA 2VXQL 5SWQB 1DO6A 2Z92A 1SHMA 1QW8A 2EAEA 3KD4A 1R19A 4NNYB 3RNKA 2PNDA 5ANMA 1FZJA 1YPZA 1YEIL 1P6AB 2HTLD 3QIBA 1YECH 1HWWA 3AADB 5GGTA 4L0ZA 3ZDYF 1MQKH 2OQJA 3UIZA 1IGIL 5CU9A 4HLJA 4RFEA 3LS5L 4L37A 1LEKB 4A6YB 4KX9A 2VWEE 1YN7B 2R2EA 4MRCA 5DEZA 3RBZA 3MNWA 4HFWB 2WLKA 4MA8L 1LM8V 1HHKB 1IGYA 1E90A 1SXBA 4ODBD 1CE6B 4G8FB 2MW2B 1ROPA 4J2XA 3LKNB 4HSAC 4H8WL 5IOKA 1Z3GH 5BR8O 1W59A 3KLDA 4HIIB 3DV6A 4TUJA 5D8JH 4YDLB 3QQDB 4M8UA 4OJYA 5ESVA 1JGVL 4BSWB 4NPJA 4AQ1A 4GOSA 1DQQA 5LG6A 4LL9A 2GK0A 5F7WC 4WO4C 1OD7A 5ANHA 2XIDA 4OF8A 1QO3B 3CRRA 4Y7OC 1JVKA 2OMVB 4JR9L 1CCZA 3ZY7A 1MN4A 4LNUB 4JO8A 5CJOH 2DW4A 3FU9A 4EE2A 5J6GB 1KTDA 5D71L 3RYHA 1PTZA 4JI1O 1UJWB 2DQDH 3LVEA 4V2BA 2VZVA 3P2TA 3KLHD 2GJ6B 2Y0PA 4LBEC 4EUPA 2PPFA 4QD2E 3ARDA 5CD5C 3GIVA 1XGUA 4JM4L 4PJIF 1U6AL 3MBEA 3LNIA 4OLXH 3IGKA 5EWIH 3GM0A 3EJZC 4NS0A 4WY7L 3O6FA 4KMQA 3R4DA 1EBPA 1XTLA 4PA3A 5LMUO 3BH8A 3NJFA 1Z5LB 2ZYRA 4ZSOB 4L8CA 5AAMA 4XTRD 5FL7G 5D2LF 3ATFA 2CJUH 4JI5O 3MKKA 5C08D 3B9KA 4XCNB 2D9CA 4L87A 1P4IL 4LRNH 4P2OC 4WEBH 1P6WA 5C0FA 3RWJB 1MQKL 3CSGA 3QDJA 1PZUB 1FYTD 4YO0B 4U1HA 4N28A 3P9LA 2ZNWA 1DBMH 3UTSB 4DO5A 2E7BA 2BP3A 3APFA 4JPSA 2R23A 4PV9A 2VR6A 4P5RA 1CFMA 4IU3A 4GFXA 2J43A 4E0RB 2CBPA 4XP9H 3FRPG 3KBHE 4OF0A 5E1AC 3WDHA 1AR1D 1TNNA 2XSKA 2JV6A 3J2PA 4ZBJA 4KMLB 4MNHA 1WQVT 3ULAB 5GXBB 3KDPB 3UADA 5D6CA 1N8ZB 4JFZL 1YJ9V 1J11A 4FXGC 4MLSA 1A66A 1JBJA 2LHAA 3B2VL 3P9LB 2X10A 3QUMA 3RN4A 2CO1A 5DK0A 2DQJH 4XPBH 1WFOA 4WUUB 2IC2A 1FZKB 5J12C 4N24A 4K3EH 4YK4B 1XH1A 1R73A 2WKOF 3H53A 4AQYB 4JZJA 1QI4A 4K7PY 3TBWA 3GSOB 2BHZA 2VISA 4LF7O 3ESNA 3OC8A 3UTSE 5F7BA 1NAKH 3EJYC 3O3BB 3SYAA 2L04A 4GAGL 3U25A 3O6FB 2BOCC 2JNZA 4U1JB 4HU8A 1TTBA 3Q48A 3QIWC 3AREA 3UTPE 2XN2A 1I1AA 4HEMA 5CIPB 3FHEA 3CRMA 2ZXAA 3KPRD 1C8QA 1XGYL 1BQKA 1N5YL 2A5UA 2HRLA 1BYOA 1I9EA 2OTWA 4R97C 2NY3D 4A7TA 2D0HA 4DWHA 1NTMH 2GJ6A 1B06A 3AEIA 2FJSA 3ML9A 2P5WE 5E1HB 4YLCA 1LUVA 1Y4MA 1EAPB 4FIPC 2W91A 3F7VA 1PIFA 1CDIA 5DJ8B 2PXYD 1Q6UA 4U3JB 3TWYA 4CRPA 3UX9B 1CGXA 4L0YA 2RACA 4Y5XB 3G08A 4FTVA 4F27A 3LNEA 3UAFA 2YEVB 3KEDA 4PJ5B 1DJWA 3FU6A 3VGHA 2WQAA 3MRCB 2N59A 2YWYA 4K3JL 1HU8A 2FHCA 2X05A 1RKRA 3KPRE 3FPYA 2I24N 1J48A 2VW4A 1OF2A 2AK4E 3EO0B 3II1A 3MLRH 1RU9L 4QRSB 4U1NB 3IXTA 3JWNE 2WAHA 2VRAA 1JGDA 1H8EG 2X9WA 3CXHK 2N56A 2WWNA 4HUVB 4DR2O 2R1YA 3DNKA 1SHXA 5E99H 3KLSA 5IB5B 3X3FH 2R8SL 3HCVA 4LSPH 5L0QB 4UYQA 1V8HA 2DH3A 2J8UE 3KYNA 2AJSH 4LF9B 1S7TA 4BELD 5EF1A 2HJLB 2PCPA 5DN6G 3MLPA 2DWXA 2GG1A 3T3ME 2FJHA 1UCBL 5DRXB 1QLEH 2J1WA 1U2CA 2DZEA 3GNMH 3HPJB 4P3CH 3RWHA 4BEIA 1IKOP 5IBTH 2R2CA 1SUHA 3FFDB 1CGUA 2WY3B 4KDVA 4XE0A 1ORQB 3R1GL 4NZFA 5FNVB 2IBGA 1XMWA 1QEXA 4Z1MG 4GRLC 1NPUA 2J1ZA 4L4JA 1FZMA 5LP6C 2DYPA 3EOTH 4OGYH 4Z77B 2FSDA 4MQTB 2CBQA 3NJXA 5I23A 4RESB 4XNMB 3BX7C 4W9FC 2ZE0A 1HILA 2WIIB 2NLJC 3EOAB 1KGUA 1MG3C 4QT5B 1SZTA 4BFOA 2Y7QB 3WSQL 2ICES 1TETL 4PU2A 4NENB 1BQZA 1N0XH 5AW0B 1PJ9A 1BFVL 4QOKD 4D9RD 3MRLA 2WJ5A 3GUFA 2H7WA 3QDGD 1AQ8A 5ABZA 4BFGA 3BUPA 3CVHA 5TFSH 5C92A 5ADPH 1R0AH 1I8KB 2A6IB 4ONFH 1THAA 4ZOEA 1T03H 1MJJA 2IV8A 3DBXA 3ZHLA 4QGPA 2C9SA 3WIHA 3RI5K 4TTDC 3RAJL 2YS8A 2IH3A 5I1HH 3T8XA 2HPTA 1Q9LB 4U1JA 1MJ7L 3GZQA 2K6YA 3PWPB 2CRMA 1IVTA 4NRZA 4G8IA 5D5ME 4H5SB 5FUOL 3RX8A 3EYQC 1K97A 1TQBC 4BZ1A 5IESH 4OXSA 4MXVF 4XNQB 4JG1L 2QSVA 4LO9A 2LFSA 5K59E 2X9YA 1A5FL 4RQEA 2FDBP 3WN6A 1I94B 3FT4B 3KS0J 1QQDB 3S88L 2CRIA 3QFJB 4J6RL 1SLUA 2W0FA 5DHYA 2X87A 4L8DB 4GUQA 5KYNA 4GKZA 5K1PA 2MHAA 4GUPA 4NHCL 1YEFH 1DVZA 4BW9A 5IK3B 4JFPA 4QHMA 4LU5H 4X7FC 4PREB 3MXWH 3VB9A 3TV3H 5BZBA 1NPNA 1E2WA 1VGEH 2XAFA 2E3VA 3N85H 3VWKC 4LCCA 1TTCA 4NKGB 5HHNA 1T5KA 4GUPB 3TC9A 3MRHB 3ULVH 1QG3A 3HS0A 4QHKJ 1ZL8B 5CBEB 4RH4A 1UOKA 1G7JB 4Y1AE 4GW4B 5C6TH 1S5IH 2GUOB 5MENE 3ZE0B 4XBMA 4ODSH 4JDZB 3C5JA 4HKJB 4AENB 4HF5L 1XHZA 3VQWA 4BR6A 2PWFA 5CGYC 2BW5A 2CK2A 2JKSA 2Q7GA 4G2KA 4PI0A 1KBVA 3IJSA 1GM9A 1FHGA 4BIZA 2HFFA 1Q4NX 4NT6A 4X7SH 3UDWA 3CYOA 2J71A 5T8IA 4ETYA 1ZLZA 3OPZL 4LDEB 4WSKA 4X6DA 1J0HA 2P90A 5EO1B 4YSCA 2M83A 4U1MA 3ULUF 1YSOA 1GRWA 5I1HL 3KLQA 3MLTA 5F9DC 4DUYO 1IC4H 3KL0A 3JD1A 1E28A 5ECGA 3W9EB 5I1KL 1I7ZB 4EFEA 2NY0B 5AKVA 4APQB 2EXWC 3GWOA 3N41B 5CN0A 2XT9A 4JI0O 1EPFA 2VYRE 5I75C 4OJCA 2CBMA 1UD8A 3DO3A 1Q1JL 2DWEB 1SQPH 2V4LA 1FZMB 3TPUA 5EORH 4CMMA 3PL6B 2GJ6D 4TPRH 5IHLB 2VRZA 3SOTA 1GKFA 3PGFL 1OCZB 3QQDA 1FFPB 4QCIB 4JFOB 3D30A 5FX3A 2L7EA 4KKAC 3OT7A 2PR9A 4PJHE 5A2LH 3LKNA 1YYCA 1KIPA 3G6JA 3HNSL 5T1JA 3GMRA 1BLNA 5D7LE 1EWHA 3QNXA 1QPKA 1XEDA 4PGBA 2X4PB 2VXTH 2CWRA 3CU1A 2KYIA 2LW1A 1BBJA 1ILUA 2IWKA 1YMME 4JKKA 1B4LA 4KXCA 4Y4FB 2NSQA 3ESOA 1F51A 4XXWA 1SEBB 1ZT4B 2ENSA 2BNRD 4OBRA 1RVFL 4UOQA 3HIZA 3FPXA 1H3PH 5IFHL 4KK5D 4YJ3B 3L4VA 2OBGA 1MY7A 4PJ0Z 3BE1H 1LP9E 3OE7G 2DLIA 3CCSV 2VZ3A 1ZLDA 1A3LL 3RY6A 3BABA 2OMBA 3CFMA 5HVGB 3BZEA 4YXHH 5BRZD 4I9WA 5E03A 4QOKB 1O9HA 5IVOA 4X1KA 3MV11 4MW8A 4WFGA 1QBMH 4OFIA 3H7LA 4G7VL 4MJ5B 3RTLA 1T0MA 1MVUA 4LLUA 1J5HA 2XY2A 1YMMD 3AG3C 2DBLH 5BUGA 2NYZA 7CGTA 5J9PA 1OAKL 1MMMA 2HFGL 4XCCL 4D0BB 5LGTA 2WK2A 3LNDA 1FN4A 2Q2EB 5H37A 1IAIL 4ZMYA 2NYYC 2V5RA 4XAKE 4URKA 1W8OA 2X2UA 3F7RA 4AIXA 4NGHL 3EGDB 2FJGB 2AGAA 5M95B 2NRDA 3QZWG 3OZ9L 4ELKB 2OJZL 2VO5A 4ZSOE 1EBOA 2XBDA 2Q7EA 1EFQA 4UIMA 3S5LB 1ZS8A 2EUWA 4FJZA 3FYEB 4E9XA 3S0PA 4F57L 4HOMA 1J5EB 2KB1A 1FFNA 2VISB 4L8SC 4HVBA 1U8HB 1EAOA 3WKPA 2OIEA 5ISZE 1X6NA 3B8YA 1A6PA 3C87A 5CCHE 3LX9A 4QR7A 3GMOA 4G8GE 3SBQA 3LZQA 4WF9V 4CMMB 1H3UA 5T1KD 3VXME 1JFHA 4EN3B 4DQOH 3QCVH 1ZANH 3AU1A 4WU7B 1FVDB 4WGKA 1IAIM 4DP4X 3VD3A 1U8QA 3GI8H 4L3EE 4LSTL 3T6QC 3UH8A 3X1BA 2YSTA 4JQVA 2LU7A 1L9SA 3OL2A 4FHJA 1IBHA 4PS3A 3C5ZD 4LF3A 2KERA 3H3KA 4X6CB 5FKPA 3SQOH 3IMUA 3CC7V 1G9NC 5E8NB 1F23A 2NSXA 1TQBB 4FZ8L 5EZJA 5AKRA 4PI2A 2LR4A 3SCMC 1A7BA 2PKDA 5C0NC 4XOCA 1DBML 5EZYA 1UKTA 1CQKA 2QHLA 1GJUA 2XT1B 1ADQA 25C8L 2OM5A 2XG4B 4DV7B 1R3LB 3VD0A 1S7XB 3HN3A 1TZHB 1J5CA 3F5WB 1VENA 3QJUB 3Q5TA 2QFPA 3AW5A 4QTIL 4P2QB 2D7MA 4J9YB 4N0UB 1SFDA 2X3CA 2FBJH 4JFXA 4NC1E 2YK1H 5AVQB 4YXLL 4TVSa 2JDIG 4KRLB 3AVEA 1AGCB 3RKDD 2VXUH 1HHIA 1BVLA 1P4IH 4LRNL 5JHDD 1DK1A 1P5UB 3RPIA 1G87A 2R4RH 2K7QA 1J9QA 4OB5L 2P5WB 5IIEB 3RYFA 2PYLA 2C9RA 4G5ZH 4ZFQA 1R3LA 1LP9A 3FU7B 1A1NB 1GM8A 2EDEA 5DC4B 4FXLA 4Y8AA 5EOCH 3RT3C 4XNDA 4TLUA 3K6SA 3HUJB 4I7ZC 5LWYH 2QSCL 1IBGH 4PUBH 1O7SA 4JFQB 4YWGL 2GUYA 1KGCD 4IYIA 3MA7B 3FTYA 1NIFA 1YNKH 5ITFB 1I1AC 2F43G 1J1PL 2DDQL 4LF3B 4X6CA 4WI6A 3RZCC 1T1XA 3FH7A 2XUWA 3LH9A 3SIKA 5IQMA 3CXCU 4PHZA 3MO1B 4X62B 4N3UA 2AJVH 3CFEA 5CB4A 4DGIH 4N0UE 1KSRA 3RYIA 4BA8A 1WLEA 1NTZH 1X5IA 3VI4E 4XVSH 2W0FB 1AG6A 3TJEL 2X2IA 4FDWA 4ZXBA 3FFOA 1KYFA 4B6ZA 2Z7UA 4JPIB 3D85D 1GZPA 5DQJB 4ZAKB 5ABAA 1A7PH 3GI9L 4JCWA 4X0KA 1KNOA 1UH3A 4H2CA 4NSKA 4Z7UA 2EDXA 2M7WA 3OZLA 4AQ8A 4DW1A 5I1AB 5I1EH 3UPRB 2H3NA 3CVCA 1H0DB 4QRPD 5FKAA 3PWPA 5JCOA 4N23A 1PG7L 3ETTA 3HNSH 1JZ5A 3WLBB 3QXDB 3K2IA 1SHSA 5E9DB 1TQUA 1J8HA 3LPOA 2Q87A 4JVUA 4JO5A 3WJMA 4X1YA 3CCJV 1KELL 5KAIZ 1S3RA 4KJPD 2F9BT 4NZRH 4BM7A 4ZJ9A 3J7HA 3QIUB 3QB7C 1PS3A 3AXIA 4TUKL 3QO0B 3W7XA 3CFBB 3GSNB 3TA3D 1GOHA 2Q67A 4J7ZA 5CS7A 4LCUB 3MROA 4PLKD 4MJ5A 4HS3A 1QTPA 1I53A 2A3QA 2FJFA 5I6NA 3CE2A 2F95B 1PD0A 4NQDA 4ABVA 4CADB 4AZ8A 1FAFA 3N1PC 6FABH 2OTJV 4BXVA 4J2QA 3HC4L 4H26A 3VD5A 4HCIA 5FCSH 4JR9H 3FFQA 3IMTA 2D2OA 2YZ1A 5DMKB 1HSAB 3CFJA 5F93C 4DW0A 1XUQA 2NY1C 3P2BA 5F9JA 3SJVE 4V1DE 1H15B 1GCFA 4HH9B 5GZOA 1NH2D 4NKOB 4WGWB 2ICWI 5FIEA 3T3MF 4KGJA 2KG7A 3UPRA 2H45A 2FD6H 4GH7B 2Y7LA 4OAWB 5KLVH 4YJZL 2J8UF 3S6CA 5D7IF 2P5ED 1CPYA 4Z7WF 4DV5O 3RX5A 2X89D 3HG0A 4KQ3H 3MUJA 3FB8A 1YY8A 5B3SB 4FFTA 4CDGC 4ZXBB 4YR6A 1ENVA 1DUZB 2EC9T 3RWFB 1SDDB 3VXQA 5JA9A 2E7LA 3RIFK 2J3SA 1NI8A 4P9OA 1AHMA 1H3VA 1JCKA 4UM9A 1RHFA 5JO5B 1CYXA 2OL3A 5HDRA 1K5WA 1E28B 1MSPA 5DJ8A 1MFBL 4TQPA 4DZBA 4AK2A 1EJOH 1URFA 4KO7A 5J8OA 2H3KA 4ODXB 4FS0A 2DQ3A 3OHXA 1PD6A 5INDB 1AVMA 5LGYA 3IETB 1TXKA 1A1NA 4HT1H 5SWZE 2VCOA 3O4OB 1JS4A 4YPGB 2G60L 4GBXD 4OUUA 2Z3YA 1LUWA 4YZWA 5ALCH 1JUFB 3NESA 3MUY1 2QADC 5JJJB 1LK3L 3QJVB 4M5YL 4XPHH 1IVLA 1KCKA 2NPLX 4J8QA 2AI0H 2EO7A 3JAWB 4D94A 3ZDXE 3AS1A 4FZ1A 2VN5A 1RK1B 1G9ML 4XO9A 4KTEH 5IOPB 4JI2O 2RGSA 1ROCA 3L3KB 4NKQB 2YS4A 4F15B 4JGSA 1BX2A 1J10A 4JBSA 4HKJA 2W6IG 3GGWB 2VB5A 1VKXA 4W9JC 4TLKA 4P2YA 2E59A 3DUSB 3E1ZA 1ND0B 2ISDA 1G7JA 3HC4H 4NB5A 3N50A 2BIHA 4JG0L 2CO2A 2QMKA 5EC1B 5KHGA 4B08A 4KVCH 5TF1H 1Z5VA 4MVQA 2CJTA 3UO2A 4NRYB 4F37F 1LHZA 4NQCA 5BZDB 2WUCH 3HMWL 2B15A 5DD1L 2C9PA 1L6ZA 5E2TH 2GCYB 3WE6B 5FLVA 3V5DA 3HG4A 5FKPB 4C4KT 1E2VA 3TNMA 4NKDB 2PYEB 2QHRL 2GTWB 5FDYA 5GRZA 1DP0A 4QXVA 1CBVL 5KZCD 1E7UA 1U8QB 3IDYC 4KVNH 4J5VA 3VXOB 1T7YA 1XGQA 2GBTA 3EJYD 3GO1H 5BVJA 5DJZB 2F1AA 3EAKA 3MPCA 7FABL 1KLFA 2F53D 1KXVC 3LN4A 4P23B 4PJDE 5AD0B 5BUAA 1HNYA 2MPVA 4YBQC 3NFNB 2UYLB 4NO2A 5FK9B 5JIQA 2VOTA 3C8HA 2V33A 2HCZX 2CAZC 3L74H 3L1GA 3MNDA 4PJXE 2PLTA 5JVDA 1I1RA 3TBBA 4W9ZA 3LTVA 1KEGH 2O93L 4RDQG 5CIPH 3RB5A 4WI0A 1G0DA 1A6UL 4YHLL 1ZS8B 4DQOL 2ARWA 2K9PA 2BSED 2UX7A 2OMWB 4OM1L 5K9JH 1DBKH 4C83B 1ID5I 3DX2A 1E79G 1TA8A 3JWDH 1Q9OA 1UADC 2W81C 4PRIE 1FI8C 2WLYA 3GXUB 2BY3A 2OTUA 4LE8A 4XVSL 3TJEH 1DQDL 1A22B 2O61A 1RH8A 1A3ZA 2E5EA 2W9DH 3TYGH 3ZX6A 4F2MA 1AQKL 1ZGLM 1FAIL 4GI6A 3TXQA 4Y9CA 3MLWL 1QKZL 5LDUA 4MNGE 4BV1A 3V4LA 1MCBA 1IL1A 1AP2B 1J12A 2CTQA 1G0XA 2BSSA 4LLYA 1NUNB 1UWGH 2FT6A 3PYCA 4PJXB 1Q90D 4BQ9A 1PKXA 5C0JB 4NNPL 5DA4A 2J5LC 1AR5A 2VWKA 4IBWA 2ADYA 4NO0B 2DF3A 2EILB 5FYLD 1UJ3C 5EN3A 1JZGA 4MB5A 3HE6B 2WMPA 2W5PA 5FO8B 3G4SV 1CTNA 1IGYB 1X9QA 2GBUA 5F89A 4N2CA 3DLQR 1ED3B 1G7QA 2G3MA 3NJLA 5DD0H 3VXNA 3NCYP 4H8QA 1DUYB 1KP2A 4M1GH 3L3GA 1QBZA 4I3RH 1C7SA 1PV0A 4DKEH 1OP9A 4U1NA 2Z1KA 4NO0A 3ABTA 3QF7A 2XJLA 4G5AA 4YS4A 3KCYA 3HAEA 2DEXX 2WCGA 5DUMH 2A2QT 2CKNA 1ZLVH 4LRIA 4ZTPL 3ZDYE 4PRAB 5AVSB 1PZDA 1H8HG 1HNXO 2NTFB 3S5LG 2EVFA 1SRYA 1EV2E 3FT3A 4M5SA 4NO3A 3QI9D 5AYUL 1V7ML 1JF1A 2V37A 3MODH 4U7SA 2XOKG 1U8NA 3JWNH 1AGEA 3GRWH 5CA0A 2ZE8A 1A6TA 4HWBH 5CU5A 1HE7A 4HPYH 3TO2B 5IMLB 1MRDH 3OGIB 1MFVA 1F3DH 4P49A 4Z7NE 3ML8A 3O3EA 1JGLH 2PMZA 1IE4A 3E2HC 5I2IB 1TCRB 5EYPA 2AK4B 4N2AA 1A6AB 3M7FB 4WEBL 1WISA 3KPNA 2Y1AA 3Q1EA 1N32B 1ML0A 4X42A 3SKUD 1HI6B 1R3JC 5D7KD 2YZ8A 5CIPA 1YEJH 3BAIA 2QMJA 5F3HA 3QUZB 2BOBA 2OCJA 4QLRA 4UIKH 5JPNC 2E9WA 3EZJB 1IKNC 1NTKH 1AE6L 1F8TH 1I1FB 8CGTA 3HHRB 1YEDB 4P9PA 4R2GD 5GIRA 4OI7A 2IU0A 3RWCB 2JJSA 4ZUUA 2I9TA 1O9GA 4KXZI 1U93B 5DYOB 5IY5C 2BNQD 5DZJA 1L5GB 2FBJL 2WQXA 5HHME 4L4VD 3ARYA 1LO5B 2OJEB 2QQKL 3VDBA 5TDPA 3IVKB 1ONQA 4D0CB 4BFRA 1BCIA 2VWEC 3E35A 3DROA 3DDFA 4EXPX 4X8JB 3K3QA 2ILMA 4E9WA 1G9EA 2A6KA 4DGVH 2LQRA 5D1QE 1FVEA 4XXCC 3PHAA 1R3IC 3DX1A 3DECA 1R4XA 2X4UA 2GQHA 3QIBC 4JI4B 1JRHL 4NAMA 3GS0A 3VFVB 1SQ2N 1JTPA 5D1ZA 2H0PA 3UTSA 4PCKA 3FT2B 4OJFL 4FE9A 4M62H 1HJBC 2DQIH 5L9DH 3MCKA 5FDWA 3KVQA 4YFLF 1EH9A 4DP6X 4LF4B 1UXMA 1GSMA 1VKXB 5F9WC 1DBJH 1KCUL 4EQ2A 3NH7H 1QRNA 2YBRB 3RGHA 1S2EA 3WTWA 4X6BB 1W9XA 1K73W 2OYMA 4NAQA 4JZJC 2Y4SA 4DK5A 1UCTA 1Y0LA 3O3UN 4JB9L 4PJDA 3I55V 4S1SL 4XP6L 3V52L 2F61A 3MBWA 4GMTL 4JHWH 5ECJE 4FLYA 3CXDL 2QM4A 3MV9E 1SPDA 4WNSA 5K1JA 2CHNA 4IMLB 3EYVB 4WK4B 1RM1B 1BHBA 1YHQV 5EUOB 1FC2D 4OTXL 4GX2A 1QBAA 4JI4O 1MHCB 1QFOA 2H9GA 4I9XA 3ARDB 2HH0H 4JRXE 3CDFA 2HG5C 2CO6B 3BUBA 4YHNB 2IQ9H 5IVXA 3GMMB 4PG2C 3MRLB 2AP2A 3VM5A 1Z9PA 4UCSA 1SOQA 4PJIB 3NN8B 4KKAD 3NDZE 3VMOA 1AQKH 1WZMA 4PGCA 1VERA 3L95B 4Z77A 4L1SA 3QDMD 5GPRA 3QXAA 5CLYA 4Y5YA 1JTTA 4DP8X 3MRBB 1NBYA 3TN0D 1KIUB 4DPBX 5LJYH 1J88A 3GSXA 1I5YA 3GXIA 1U91B 5I6LA 2G3ZA 4BK5A 1U41A 3M17B 4IOSD 4RISH 1OGAE 2HUEA 3GRBA 4G43B 2YXMA 4X7TB 1J9SA 1ZLVK 4EKXA 3SPIA 2XY1A 3ARGB 1IBMO 2FH6A 3CHRA 4B96A 2BZCA 2XWEA 1FRGH 4RWYH 3H9YA 1L8DA 1BJ8A 2IWEA 3HR5B 2O57A 4LF9O 1PZ5A 1MA1A 5F9JB 3N5AA 5DUPH 2WXIA 3ROOA 2N3JA 4MQXD 3SYPA 4OCXL 3G6BA 3KWTA 2VERN 1XEQA 1YJNV 3F6IA 3T1YB 1OT1A 4J27A 5KYYA 3BCFA 3QXTA 3VQXA 4UTBA 1U8IB 1JV2A 2AITA 1H2SB 3KWWB 4AL8H 2BWIA 3T2OA 3JSLA 1JZDC 2ZXEB 3SKOA 5SWQA 1C1EL 3GXPA 4HIEA 3ABUA 1IU1A 2GB2A 3CDZA 2X4NB 4DV6B 2EZ0C 1UT1A 2VH5L 3NJIA 4J8RA 2GFBA 1HH6A 1IB5A 1HW7A 4LCWB 1M57B 3QO0A 4C55A 5KSVB 5FO9A 1TUPA 1FO0L 3VXSD 4TVPL 3T04D 3G6AB 4N6RB 4XE5B 1NPJA 3VCLA 5DHMC 1U96A 2YAEA 2Z4TA 4P23D 4HS6B 4JK0D 1C16A 1H3GA 4WFFA 3KPSA 3FS9A 1PL4A 2X70A 4J3OG 4UQIM 3NK4A 4AW4A 5I66A 4ONGL 3AUWB 3G04A 3WO4C 4Z8FL 1EZVH 5E4EB 1FG9C 2IADB 4G8EB 4I4WB 3H4FA 1WD9A 1NGZB 1OAYH 1UH4A 4HF5H 3SDAA 5JVDB 2LAGB 5GS1B 1NLDH 25C8H 4YNYB 2FCBA 3BT2L 5GRXG 1OHZA 2H1PH 4Z7WE 4DN4H 3EJQA 3NJGA 3QR0A 3PAUA 4AC2A 3QRGL 1A0QL 4KQ4L 3IT8D 1WB8A 1KLFB 2Q68A 4A7GF 4KUMA 4UQ2B 2ETWA 3VQ2C 4JNXA 4PJBE 2AJUH 4RQQB 1AZCA 4LMQE 2FX9L 3GMNA 4I0PD 2F66C 1JMZA 4P5KA 2LP7A 2W94A 2AKRB 4AYFB 3FUJA 1W80A 1IC7L 4GXVH 1MEXH 4MXWH 4NCDA 4J3UA 4OR1A 3DI3B 3HFML 3JT0A 4QRFA 4ILDA 2A9AA 3FN0H 1KBBA 4PV9B 1I9JL 1HHJB 1OTTC 1ZJAA 4PG2A 4BSJA 2R69A 3TWCL 2ITDA 3H1LH 1F58L 1QLEL 2P5WA 3QYMA 4NQDE 1IO4C 1JHKL 2ALWA 3D08A 1NC2D 5JW4M 4FG2A 3EH2A 4AI7A 3O0RH 4Z1VA 2QQKH 4F5CE 4ZMZA 3L1OH 4UV7L 4X80L 3SGDH 4N0UA 1BAWA 3ARDD 3MA9H 4GG8B 1QSED 2ADIB 3IFNH 5TQ0H 3WTXA 4NYKA 3ZT7A 4LLAA 1XB6A 5I0DA 4CW1B 3QO1B 2H4EA 5LBSA 1FFXB 3OC5A 3L3JA 4TSCH 1SQFA 1KBWA 3ZHNA 5K39A 4BSVB 4EUPB 3CIQA 1AE6H 1F8TL 2O6DA 5ETUB 4ONGH 3BCDA 3O6LH 4O2BA 4N2DA 2DIAA 1NICA 1BZDA 4K3GA 3O45A 2F53A 3QI9B 4NI3A 1TNMA 5DHVH 1ZE3H 2C3HA 5IB1B 2IQAB 4WZ9A 3MBXL 4F2EA 4LP8A 2Z0AA 5AOMA 1IC5H 2N7BA 5EOQL 3SBRA 3OD4A 4IOFC 1DVFD 5E8PA 1G7HB 1FG2B 3PQYE 4FMVA 3UXFA 3CUPB 4YR6B 5HHOA 3V6FA 1RP8A 1P53A 3VA2C 4KI5C 1JHLL 5D9SA 1KYAA 1M1SA 1KY7A 3UTTB 4TNVK 1CG9A 4PDLA 5TTRA 1LR1A 1GVIA 3THML 3OZKA 3VU2A 2LJ2A 1W72H 3U4KA 4XMPL 1NR7A 3DXAD 3LIZH 2F8IA 5JOEA 3S88H 3O9OA 1HHKA 4EMZA 4Z7VA 3AFLA 2X0UA 4ZS7L 2ITCA 3UABA 3NH7L 4N0RA 1ZPUA 2K70A 4FNLH 4OZHF 1QFWL 4YBLC 5T1DL 1XZWA 1FNAA 4K8RH 2ADJB 4X4XA 4WHTB 2YD7A 1U92A 2CM5A 2HWZL 3K46A 4GQQA 2YAFA 1BPVA 3AXLA 1HOCA 4Q4EA 1MNUL 3RVZA 3QR2A 4MB3A 1ZT7B 2Q7YB 1T0MB 3WFDL 3WIIH 2OI9B 3TFBA 1DE4A 2XBTA 4M6NL 1KJVA 2WIMA 3KXFD 2IXQA 1E9QB 2BSBA 4MA7H 2Z8VC 3S35H 1E4HA 3GSRA 3FTWA 4NLAA 4CSZA 1H9DA 3F04A 4M5TA 3LZLA 1NH6A 4FYRA 2YPVA 1FNEB 3OQ3B 1OE1A 3H3BC 1JPST 3DTUB 2FUTA 4HXAH 4TF4A 4OD2A 1MJ8L 3CCMV 4K5NA 1MUJB 3CX5J 5JH7A 3CZKA 5A6LA 4P30A 1SEQH 5DO2D 3HZ3A 3DGDA 2BOCB 1CYGA 4WFHA 1DL7L 1TKWA 4DKTA 1Q0YH 5J2TA 4OF7A 3US1A 5EBLB 5DMIH 1UD6A 1JXFA 4L8SA 5HHQB 3KXFE 2OZNA 4JFDD 1BW8A 4TUOB 1MCQA 1NGXA 2XNAB 4PJXF 1CFVH 3TEYA 3JD0A 4NM4L 3B77A 2NXYD 4GRLA 1OHQA 2KLSA 3ZKXC 1KPUB 3RHWK 3KKYA 4TSFG 1M56C 2KZWA 1BZEA 4YN3A 1Z9OA 2A9CA 3IJYB 2IBZH 3RYCA 4L9LC 1S9VA 1VFBA 2F58L 2FBRA 2EDRA 4F7KA 4DP7X 4NTYA 3FU5A 5AB1A 5EF2A 1TYRA 4PIBA 1BMZA 1B0RB 1TENA 2D2CC 3C75A 3KCPB 4ACPA 4BKLA 5I15L 3AG2C 3QQ9C 1ZMYA 5AW5B 5BO1H 3FT9A 5I0VA 1YMMA 3NJNA 2GUZA 4JFQA 5FB8B 4OQTL 4QJFB 4FTVE 3RLSA 4P4KC 4HCRL 4FI8A 2Y22A 3Q3GA 2H1PL 2RNBA 1FFTB 2J1KA 1K8IB 3QUZC 4U2ZA 1QLEC 1ECYA 2BP8B 2AK1L 2GTQA 2R56L 2CR3A 1UZ6E 3NQKA 1TGOA 4P5SA 4QYOA 1NAMA 5BQ7B 2Y36L 3K08A 4EOWL 1DQJB 3ETDA 1GPOH 4MA1C 1ITBB 4NZ8A 5AL0A 1XF2A 3BVOA 5GW7A 3IJ4A 3TGUH 1I8LA 3D39E 3VW3H 3SO5A 2DEWX 2IJIA 3FRPB 2UV3A 3VD9A 3TWCH 3CC5B 2B4CL 4QRRA 5T1KB 4ZYKB 1VZIA 2DJMA 1YC8A 2HJDA 3PWVA 4JN2A 3TFKC 3Q4HB 4BQ6A 2CJUL 2OJZH 2QZQA 1ZHLB 5DD6A 3ZHFA 3UYRL 3MLXL 3SB3A 1U2HA 3SPVA 1RUML 4FA6A 1S7XA 4OV5B 3FB5A 3M7OA 2FYYA 5CR8A 1U8JA 4Z7QF 2Q4PA 1WP6A 3FRUA 3EOYG 4HCFA 4NP4H 4X0NA 4MSWC 1OAKH 4TNWF 5JQHC 1YTFD 1GC1H 2JF1A 3BZFA 4FFVC 3U4BH 3WHXB 4F24A 4E41E 1DVFB 1CR9H 4GSDL 4WV1A 1M7DB 3VWKA 3QJZA 2E9IA 3ES6B 2CDEA 4LP4A 5ICYB 1N4CA 3FTUA 5J4MA 2QJ1A 3OLIA 3RL2A 3ZRVA 1NCAH 4PCSA 5ICZB 1F4MA 3T77B 2B2XH 1A4BA 5FA3B 2WKLA 1IT9H 2VERA 1EEYB 4KO9A 4L4TD 4R7DB 2EJ7A 1WIUA 3M45A 4RIRA 3DXAB 3ZL2A 5CGTA 4ZMAT 2J1YA 1B3IA 5DFWH 43CAB 3I9GH 1GGBL 5TQ2H 3BOVA 2OMYB 4HIJA 5K59F 1IQDB 1RM1C 4NXMB 1I8AA 1M2VA 2VGLM 3FQ1A 3S8FB 3F12B 1TSHA 3T4AB 2IADA 2P8LB 4G8EA 4I4WA 4G6FD 3D0VA 4GUOA 2ARJA 1CC3A 3NFSL 4QYAA 3RNQA 2L6LA 2G3NA 2MNUA 4JKPL 4ICGA 2B3RA 3D6GA 4OZ4A 3CLFH 2VAAA 4PJCA 1QRNE 3SSGA 1W6WA 2BIQA 1JHKH 4PVNA 4U31A 3SYOA 4WW2F 1HR0B 2QR0A 1NIBA 3D33A 4M6ML 4UINL 3LZFL 1MJJB 4LGSB 4PJ9B 1JYNA 4G8GB 4YDVA 4HWZA 4JAAA 4JM2B 3BIBX 3ARFA 3BHBB 4ODUA 3IDJB 2YKLL 4S1DC 5FS5A 4B53A 4MD5A 5BS0B 5KVEL 4UT6H 4OGQB 3SJAC 4JQVC 3FN0L 3RI5F 4AIOA 5FO9B 1I8MA 3J8F7 1A14L 5L8LB 1GYCA 5HY9A 2SODB 2I85A 5D1QA 2FECL 1QYGL 4FQ1L 4Y1TA 5HDBE 1A6ZB 4ZNEE 4Z7WA 4CU8A 4AW7A 1A4CA 4MAZA 1I82A 4KRPB 1KOAA 3I56V 3U0PB 4BFNA 1GW0A 3LVTA 4M6NH 1UWYA 3BSZH 4KKLD 4G71B 1O6SB 5JDSA 4YXKH 5LN4A 5EUOF 4CVXA 5KYYB 1FH5H 4NOFA 4PWJA 4F7TA 1F02I 4GZRB 1YITV 1HHGA 2WAQA 4POZD 1WC7B 2VMEA 2D7QA 4DV0O 2TSAA 2EE3A 1WBZB 4WWPA 3RVTD 2JB6A 3MRJA 3DPBB 2BCKB 4LWSB 1I8IB 2B59B 1UOLA 4NQEB 3QPQD 4L8BA 4K0OA 1DJHA 2XWJA 3BI9X 4OFYD 5DT1L 2WLLA 3IEAA 3UP6A 1QSEB 1JGDB 3H1JH 5EBWC 1ZA6A 2AHZA 3T6VA 3M1BA 4R84A 3VFOA 1IBKB 3TX4A 3D0LB 4IL6Z 4O2AA 4QY8A 5JDJA 2D3VA 3TBTA 1T0NB 4NDMB 3HI5L 3D69A 2ZQKA 4I5BB 3GTTA 4PJEF 3TESA 1KGIA 1X4ZA 3DRQA 4IRZH 4WKXA 1XQ4A 3STLA 4HXAL 4PGCB 5HI4C 3LKSB 1OWRM 4M93C 1CJYA 1Z9NA 1OCCC 1RZFH 2JK5A 2CKBA 4RX4D 4TTDD 4UOZA 5BUPA 1T0PB 1T4WA 1EHLH 4PJGF 5I1JH 4B0MM 5DSCA 5T1LB 4FLQA 3BDYH 3ZGIA 4EXKA 3CXHJ 4NQXA 4Z3TA 1EAPA 3T2QA 2BVUA 2VSMB 4U0RC 1CBVH 3EO1A 5H4YA 2ZUQC 3PF2A 4OZHA 4CH5A 4LHUD 3OFNG 5D7LA 3VRJA 4I9WD 1A4JB 3F65A 1Z9LA 3ZKXB 2EO9A 2P5EB 2QVKA 5AVTB 3DETC 5KG9A 3GIZH 3IGUA 4G8AC 3A2FA 2M6YA 2MPAH 3ENEA 5KVGH 5K9KA 2WWKO 3QIUC 1GPOL 5SX4I 3GXTA 4WFEE 4ZXBD 3VTMA 2WP3T 4RMBA 2WNWA 3O6MH 2XIIA 2K0RA 1KGYE 1H2MA 4FC3E 4XC1L 1FJ1A 4BZ1H 3BYTA 2VMFA 4HUNB 5D7EA 5DR5H 4BFBD 1MCWW 4M7LT 4A2FA 2PPAA 3JV4B 4G70B 1OCRC 4ZO9A 5DJAB 5MEOA 4MCMA 5J2UA 4C7UA 1N68A 3FB7B 5GGSA 4JI0B 1H2GA 4YHIA 4PRPB 4GAFB 1O6VA 1P7BA 3TV8A 3OXSA 5MI0B 4ZOLB 1FNFA 5A3ID 3CLEL 4Z7VE 1SKVA 3D8CA 1LK2B 5IHHA 5JOFA 3MJWA 1U3HC 1DN0B 3QS3A 1GS8A 4ZO7A 1R3LC 5IFAL 1P5VB 1ONQB 4D0CA 5KSBB 3FD9A 2AEPH 5DWUL 4J41A 3JWNG 3OV6A 4DKEL 4Q9BA 3SHSA 2A06H 3BVXA 3N40F 4AXWA 4AMXA 5IE9A 4LVOB 5CM1A 4PJ8B 3LQAC 5DMIL 5I1KH 2JQMA 5AW9B 3UZVB 3EJUA 1Y6MR 4KO5A 1IBFA 4H1LA 5INCB 1G6VK 3FQNA 1KZQA 5DUBA 4C54A 4F8QA 4M8QB 4GQZA 1NQTA 4GT1A 1XI1A 4KQ3L 4JHBA 4LSPL 1X4XA 3QUZA 2FIKA 1QAWA 3IFOA 3QFDB 4PQXA 3GMQA 1RIHH 1VF6A 3FQWA 3HKBA 3ECQA 5TE7L 2X09A 1MCJA 2ZPKH 5I6OA 2B1OA 2CU9A 4TLSA 2P24A 3AAZB 3OAZK 1X5ZA 3SE9L 3DGEA 4Z23A 2RFXB 4Y16C 5H2BA 4C59B 2ENPA 3ZPDA 3B9DA 3P4MB 1JZIA 1D5RA 2AQQA 5E6ID 1KG0A 3S4SA 1ET7A 5I1DB 3ARSA 4R7NA 5IWLC 1BOYA 4HT1L 1YDPB 4ZUTB 3O2WL 3ZVVA 3EDFA 1XDTT 3BMWA 2FB4H 2EDWA 3KL5A 1J18A 4X6CE 4FTDA 1I75A 4ONHB 2DQHH 5HI3D 2Z8WC 4Y9EA 4HAGA 2A6DB 5LXTA 1Z2KA 2Z31A 3ARTA 3WY1A 5A9GA 4AQ1B 4N86A 2E7CA 4H0HB 4NRXB 4PJ9C 3BPCA 4N1HB 5H94B 3LHPL 1P6FA 1W0JG 2V8MA 1GW6A 2XXFA 5DYFA 4Z78A 3LYRA 3NCYS 1OM3L 3BPLB 4GP5B 5CLZA 2ZYHA 1NCNA 4ASUG 3ZTEA 3D50A 1SLWA 4HETA 1B9KA 3ZTJH 3WENA 1IM9A 3PV7A 2NW2B 3SDXE 3SKJH 3UJTL 1I5XA 2BSTA 5EU5B 2D3LA 1WS7A 4UVCA 2C9VA 3EDDA 3ZYJA 4MZRA 1GGBH 1Q9KB 3SGIA 4ZUVB 4JPQA 2I27N 4K7FA 4D0DB 1H3PL 4R4NC 2JCWA 5C0AB 1QI5A 4TOIA 4V33A 3ZRFC 2DQIL 1IAMA 1U8MB 1ZD6A 5SWZA 1XIWB 3LNHA 4CMHB 4YHHB 3X1FA 3ASWA 4KOBA 2D8KA 2H8PC 1XMEB 1ODUA 1WWBX 4N9GB 1OVZA 3ABZA 4P23C 3EYOA 5FC9A 1UT9A 4WEUD 4FLTA 2N0KA 5LGKA 2DQTL 1CO1A 2WB7A 5CD3B 4QF1A 1AGFB 4UQAA 4A2DA 1ET8A 1JNLL 1YUHB 3FCGA 1CS6A 1KIQB 1NCTA 1AZRA 1VA9A 1UOVA 4MYPA 4X9GA 5IGXL 5ISZD 4G3YL 5D1ZD 1RZJL 4AQAB 4ZFFA 4M5ZH 1NOFA 4A2MA 1L3NA 4LSVH 3LDEA 1FV1B 4PW4A 1IAKA 3IDUA 1K6QL 2P3YA 4QGTA 2HWZH 4U1GC 5EIIG 3VXMD 1QR1B 2A83A 3TO4C 1HXYA 3ETQA 3O11A 4B95C 5B5EZ 1M93A 2YRLA 1A7RL 4PGZA 2OMWA 4R6ZA 3D06A 5GZOC 1RLWA 5L3FA 4JRYB 4ODSL 1CGVA 4M56A 5L4IA 4EAEA 4JYAB 2BOBC 2R2BA 2LW7A 1ET5A 3DGGA 1CIUA 3F7PC 4MXQD 4QTHA 5JXAH 4M29A 3K91A 1YNTF 3FFCB 2VDOH 5CKGA 4X9BA 2NY2C 3FO2B 3AC0A 1A9BB 3VFTA 2VO8A 1JZEA 3FQ2A 1R6VA 4NGHH 4YH6A 2VN6A 1J5IA 2BTQA 2KQMA 2PTMA 1FWXA 3HKFA 3LHPH 3E6HB 3Q8CA 4OF5A 5C0CB 1DJYA 4AQZA 2HMID 1GSKA 2CG9X 3KL3A 3T1FB 5DHXB 4GLRI 1XGQB 2XV3A 5BS0D 5JHLH 4ZT1A 4U1KB 5FYLH 1VACB 3QAQA 3L7FA 2FO1A 3S36H 3MGTB 3MREB 2WXKA 2IH3C 1Z3RA 4I0XB 3M1OA 4HP5A 1XMQB 1JGEB 4NHUB 5KYWB 3BLKA 3HLKA 1TZ8A 4ZTPH 3E8UH 5TDNB 4N0CC 1FL5A 2DQGL 2IWGA 4YDKH 3JARB 4KMTL 4P3DA 2V7NA 5C0RH 4JI1B 4XC1H 4PDRA 3EFDL 4RGNE 5DZNA 2JGDA 1UWEL 2IAAC 3APOA 4LSTH 3FTZA 1JNNL 3MRQA 4MMZC 5CJQH 2VIRA 1NJIW 3SJVB 4JRWA 5TD4A 5KAFZ 3UO8B 3TVMC 3TYFB 2ZP8A 1LNUB 1U8KB 1I1AD 2X6AA 3LQAH 4YZFF 5F72S 4JRYA 2NSMA 2FSEB 2ZAIA 1OAZH 5L88H 1OW0A 2WQ8A 3LS5H 4YBHA 2BVPA 4GFTB 1DFBL 2PTVA 3SKMA 4YDMA 4BQBA 1HXYB 3SDYL 3ML0A 1FH2A 5C0DB 3RWIA 1ACCA 1KJ2A 2Q0AA 3STLC 1WAAA 1MHPH 5F9OL 5LP6A 2BO0A 3V9FA 2UZYA 4PGDA 3C6LB 5GGTH 1SY6A 4H0GA 5DVLA 1QATA 3NIFB 4KKQA 4MDJA 4UDUB 1KB9J 5T1LD 3GLAA 2DWTA 4LBEB 1AD9A 2PWHA 2V5MA 5B21A 2Q10A 1DUZA 2DI8A 2O30A 4HHAB 5I5IA 3VMPA 2OZ4H 3COOA 1QD0A 4LP5A 4L2LA 1JVLA 1DQQB 2CDGB 4NOBA 5B7MA 2VR9A 3MLSH 3OR6A 2FYVA 1F13A 3ZKQD 4AYID 5HYJB 1R46A 3PIQA 1KPVA 3C8DA 1D5IL 2HG5B 5LXGH 2B1IA 3IKCA 4KKPA 4JI7B 3LKOB 4FHKA 4PY8J 3NA9L 3I02B 1YPZF 4FFYL 4U6HA 5D2NB 4H25B 4E9QA 4OGAC 2IDCA 1R0AL 3RTQC 2LFEA 1VQ9V 2V3DA 5KSUB 5J6HA 3C09C 3VM7A 2FECI 2FMLA 5IEKA 4KHPB 1MJUH 4FADA 4NYLB 1R1BA 2VXTL 4PELA 3K6FA 4H33A 2H94A 3QIBB 1H5BC 1J9CT 3BA9A 3IRZA 4NBXB 4P8QA 4HJGB 2RALA 4MJ6B 5DWUH 2O5YH 1PCSA 1S77D 1NT2B 2Z31B 3UAEA 4KRPC 1N59A 1HHHB 5HJDA 4PG9B 1KMIZ 1T1WB 5C7ZA 5IMOA 3QWRD 4LLWB 3T1HO 3UZQB 1TJGH 1L9PA 1UA7A 4ADGA 3T1WA 1D5MA 5DO2C 4BE6A 4O02L 1VQNV 4W9GC 1UXLA 3QIUA 5J3HD 3B8SA 3SPHA 3BVDB 3CZUB 4M6OH 1SOXA 4Q6IC 5D1QD 2P22C 4JJ5B 5F88A 1BF8A 4LHQB 4HWNA 3PHOA 4GI9A 1NAKL 4MAYA 5C3IA 2PPEA 1VLXA 3FQTB 3MV7E 4XMKL 1DLHA 4OFYA 3BH9B 3EYUL 5J1SC 4V11A 4Z3JA 1XO8A 2V5YA 1BS3A 1KXTB 3W2DH 1NIDA 2DYSB 5T5FA 1AILA 5A2IH 1H0DA 3RUGF 3ZZ1A 3PDOB 2DQJL 2CKBL 4MS8D 2YFOA 1F3JA 1OARL 2AK1H 4CSTA 2QEXV 2NX5A 4MTGA 4H8WH 4OJFH 2OAAA 1ZEAH 2Y5QA 1XXFC 4J3OF 3HZMA 1S5IL 4NXMO 3JV0A 3QQ9D 4YSQA 5JZ7D 4OGXH 2VXSH 5FPRA 4KPHH 4LL1A 3SGEH 4F7MB 3EYFA 1AIFA 2DM2A 3Q06A 1A6WL 4YFEA 2R1XB 3CWGA 1GN6A 4XPGL 1W0KG 4ABQA 3PP3H 3CCEV 2QGEA 1W72L 4DH2A 2E74C 4KZDH 1ZDSA 3DMMD 2NR6C 2D9QB 4JFYA 5IQ9B 5E2JA 2P26A 1ZSHA 3BDYL 1M2OA 3E22A 2EJRA 3EF7A 4N8VA 4TVPD 2D7TL 3C5SB 3CCVV 1USQA 5CCJA 4E2LA 2JELH 3VTTA 3ZRSA 1LQBC 2RCSH 2YXWA 4NKMB 4X5RA 3VXUD 1KUQA 5F6HI 3WTUA 2F0CA 3OKDB 2R0LH 3FCUB 1K8DA 4HS8L 2Q9OA 1D5ZA 3DOHA 4JQIA 4ZUWB 5ACZA 3K6SB 2VDOL 2J88L 2VT0A 3LY6A 4GG6E 5ACLA 5CN2A 5TGBA 1AI6A 1IQWL 3DTXA 3VWJB 5E95B 3WS3A 4DF9A 1CDCA 1RSYA 4YHZH 5JNYB 3DJ9A 5HVHB 3DBSA 5LQBL 3MRNB 4P07A 1UM4H 4NN5B 1FD9A 1KFGA 5CWSA 4FFVD 2PWGA 1DZBA 2Z0BA 4P2QD 3AT8A 3C60D 2EH8H 4LAQH 4PLJD 2ZM6O 5EEXA 4QE7A 1QEWA 2NY3B 4Y7MA 1F0LA 1KB9K 2UUAO 4AT6B 1RZGA 2QSQA 2FB5A 3WB2A 5MI0C 2LGNA 5F97E 3H4HA 2B39A 5IB4B 3OGCC 4M5YH 3N04A 3PPEA 5IJ9A 4IOIB 2AABH 4A55A 1N0XL 2PWEA 4NQXB 4BWUA 1TVKA 4KH9A 3ABMB 4JPKL 4OX9O 3GXNA 3UQ8A 4LKCA 3QNYB 4OIAA 3N1QC 1R1CA 4B41A 5B8CC 2JK5B 1PZCA 3WNJA 3CQPA 2C3WA 2LGQA 3IPEA 2B1GA 3HE7B 4AILC 2H0JA 4WU7A 5KVEH 4MX7B 2GJZB 3ZW3A 5CJXA 2IH1B 1DCLA 1RZ8B 1PKOA 4N20A 1GH6A 4PTUB 3IC9A 3HKDA 4HUUA 1HKFA 4NC2B 4P0DA 5DFVC 1SFHA 3TH4T 1C7TA 3ORJA 1A02N 4G6KH 2PO6A 4GCZA 3FU0A 2KPWA 2B7DT 5DD5L 2I60H 2EIDA 1JZJA 3NIFF 1XR9A 2MMXA 5GS2H 4X2UA 3R7QA 3E6FA 3WN5A 2WBJB 4K4KA 4WKZB 4FMTA 1E4KC 3HG1D 4JY4B 2CCWA 2DLFL 4QHUA 2WVTA 5I6MA 4LF5O 1OOAA 2Y36H 4HJTA 3EH4B 2OZ4L 1CD9B 1HJCA 1MCSA 1S5HB 4PAZA 2W8CA 1OP3H 2C5DC 2WUBH 4LEBA 3C60A 4UQBA 1OHHG 1CVRA 2VUOA 3KNBB 4AM0Q 1A6VL 4J7RA 1TIUA 1HEZB 1F97A 1NL0L 1M1XA 2J6EH 4WFEA 3HI6H 3L13A 5HJBA 1NM9A 3P73A 3HOGA 4F80A 3ZYOA 2X6UA 1YQVH 5CKAA 1TPXB 3ZT5A 3JWDL 3LSUA 2OV0A 4QNHB 1MFBH 2APFA 3MLVL 3FQYA 4L5FE 4L1BA 1HCVA 3ARFB 3PFQA 5GS3A 3K8LA 3S9DB 4QNPE 1QUNB 4KAQL 3PABB 4K0KO 4XP4H 3EUUA 1LE5B 1XAKA 1EEZA 3H42L 5EIQA 3V7MA 1GKEA 3I6LE 1CP9A 4B3TO 4O4YH 3NJMA 4XHQA 5AG2A 2F4VO 2I9LB 2C8NA 2WVVA 5DD0L 3KPQB 3H56A 3NJHA 4WCYL 3V5HB 1Y6XA 4LMQI 4AH2B 2VABA 3W5NA 3HUJF 2VQ1B 3VACA 3FCSA 2X1WL 2WHVA 2ZOLB 1TO5A 2FIRT 3ESMA 5ENWB 2E6JA 4HWEL 4X9QA 4HW6A 4P05A 4DUXA 1AXSA 2GAZA 2ZOKB 5EOQH 5FF6A 4BKSC 5MERB 5E99L 2XAHA 2IH1A 2YIDA 4RISL 2WJ7A 1F4YL 5B22A 3HMWH 2EXSA 1TVBB 4HDIA 1EX0A 3CSFA 3REVB 1KPRA 4M3KB 5D5MA 2Y72A 4M6AA 1Z9SB 1U4FA 3IAQA 1EO8L 3CDGA 3PS6A 3TO4B 4PMEA 3WFHA 1DQIA 2IPKB 3ZTJG 5FV2A 1LWJA 3WHXA 5I1CL 5IJ9B 4IOIA 1QR8A 3KM1A 1I85C 1MIEH 1X5FA 1RL1A 1ZEAL 3O2VL 4LLVB 5T5FL 2AV7B 3QPXL 2JVDA 3TBYA 1OP5H 4PJHA 2JEXA 2P8MB 3DV4A 4FQXC 3WIAA 4DPCX 5C97A 1CDBA 1FO0A 1MJ7H 1QFWH 4YY3B 2JH2A 1SXSA 4NP4L 3K1KC 4UIKL 3M8OH 4RBPH 3W0WD 2JS5A 4G2AA 2VDQH 4E9VA 3ZTNH 4B9IA 1GA2A 2E8ZA 1S5JA 4MJ4A 3NRFA 4OKDA 2NCMA 5EBMA 4FP8L 5A3IC 1MJ8H 5CEXB 3JCUZ 3ILQC 2H6PA 3CBKB 3ZR5A 4DTGL 3ULUL 1SJEB 5B39A 4ENED 1X5JA 2NX5E 2IIJA 4FNUA 2YC1A 1QLEB 4S1SH 5FYLL 5TH2B 4AV4A 1FXKA 1T21A 4G9DB 4S0SD 3UTQB 2QEJA 2P5PA 1D5ZB 5ACZB 2BW4A 1B0IA 3SD2A 1Z6JT 1S7UA 3N44B 4FD0A 3OR6C 5AQ0A 1DJGA 1IGJA 2VITB 2A7WA 1M57C 2CGYA 2VM4A 4IHBA 5F8RC 3BD4A 1ZT1B 4QNPF 3DX7A 3SE8H 1VEMA 4XCYA 2MQ3A 4HD9A 5T3XE 4W1TA 1M9WA 4RO2A 2L4OA 3PWLB 4JFUA 5E2WL 1GGUA 2HZHA 1ZTXH 2CA4A 4H88H 3HI1B 3L2MA 5L8KB 4JZOA 4DKAA 5KANI 3FX7A 3VGBA 4OH2A 2J8UB 3WO4B 3DIFB 2C7FA 4HYTB 2F54E 2FHFA 2FQDA 4FULA 3T3MB 1THZA 5F7NC 2BLFA 2DW5A 3ATEA 1S3KH 2HKOA 2K3HA 5C9KA 2XPZA 2ZKHH 4ZOBA 4KHPO 4AZUA 4G8IB 1JGIA 2KPNA 4RETB 5D2LB 4CNIB 3EO9L 3ZZSA 4LVNB 5MHSD 5CJ8A 2CNYA 4XWOC 1S9KC 3VJ6A 3PN1A 1YZBA 4NTXA 3EADA 3ZMVA 1N64L 2XWTA 4XVTL 2KH2B 4LC1A 4DP0X 4EJ1C 2OSXA 4XPAH 2FL5A 4P4KB 3DX9B 2DWSA 3FTXA 2YIBA 2YPLA 4HS8H 5G4MA 1UD2A 5EU3A 4B50A 3NP4A 4U6TA 3ZMEA 1FPOA 1BD2B 3V4UL 5ACMA 2GSGA 5E2UH 1YLBB 1IM3A 2Y2YA 5ADOH 5MHSE 4LPUA 3NPSC 4KKCD 4O58H 2ZD9A 4FK5C 2EXYC 2ZCLL 1DFBH 1ZK5A 2VKWA 3WGVB 2VXQH 3S98A 5I8KL 4KHTL 3U7YL 2WD0A 2DLEA 2OP4L 4TS6A 2MK3A 3RGVB 2J57A 3WBDA 5FA4B 1JZFA 2FLMA 5DS8B 3WNMA 1I1YB 3ULUC 4XNZB 4BIUA 1BWMA 2XQBL 3FK3A 3MRIA 5KJRL 3EHBC 1IILE 4KUCD 3MJ9A 5C0BD 4ZPTB 4AVJA 1UWFA 1JPTL 3EJCA 4OY9A 2QQQA 4WO4D 5EEUA 1YSCA 1RU9H 4KROC 1CK0L 2P49B 1TMCB 1BF5A 2UU9B 1EDQA 4NQVA 2B5IC 1HSBA 2EZ0D 1ZLSH 2R1YB 4W6YB 4WHDA 5FM5M 3GZOA 2DEYX 1I4FB 4OLUL 5DVOA 4PRNB 4DR7B 3MHSC 2KDGA 1VESA 2VSCA 3UTPD 3D9AH 3IN0A 4F7EB 5D9SB 4Q2ZA 2OYPA 1MWAB 2B9BA 1GJWA 2E7DA 2GIMA 4M3JA 3OW2U 2I07A 4UV9A 2UWEB 3GUTA 3TO4D 3EUDA 4WJ5A 5JW3H 1UD3A 4H7VA 4WIQA 3KW7A 5D7JC 3VD2A 2ZNJA 1XMQO 1QTSA 1E4WL 3F01A 1MLBB 3BUIA 4E41D 2H5UA 3CMAV 1A14H 4ZBMA 4LLDA 4F1SA 5IQ7L 3M88A 1SJHB 3ZHQA 4Y1SA 1P2CA 2Z1PA 1U36A 1JP5A 4KVPA 4XPAL 5K39B 3VE0B 3X13A 3WXWH 3H01A 1MCIA 5AG9A 5EEYA 4N90D 4OI9A 1BM3H 2UZXB 4OZGB 5JHDB 1E30A 2AK4D 4AEHH 4TTGA 2QM8A 1DBJL 1PBYA 2IH8A 2WZAA 2P80D 3KXFA 1S72V 4OCYH 4OLXL 2MCPH 4P04A 5C1MB 1OTUD 3N06B 1OQOA 4B3MB 1TQCB 2BFGA 2IMMA 3LXCA 4WWOA 5FCUH 1N18A 3SJVA 2YD2A 1M6UA 4TWKA 3BZ5A 3EFFA 4ZTEA 4U6XA 3LH8A 1XL6A 4I1NB 5CR1A 4GT7A 2O5XL 4XRCB 1AO7A 2JKJA 3MNZB 1R5VB 2KHAA 4YGVB 1WBXA 1OTTD 2FWOB 2VR5A 4FXGA 4JANA 4JI8B 3VSQA 4GKKB 1F3DJ 1MCPH 1URZA 3G6EV 3JTBA 4YSRA 4OLWL 3GWKC 3HW7A 2XV0A 3WKNA 3FN9A 3UC0H 2IF7A 3GMLA 3VQMA 6PCYA 1ASPA 2NXZD 4JTDB 3RVYA 2AEQH 3DJRA 4IK7A 2J20A 4AYSA 1XSOA 1YJDH 2IVFC 2GITB 1E9OA 2EDFA 4FP8H 3Q2VA 3S37X 3LH2H 2APVA 4NN5C 4FQQB 2Q0OC 4QPEA 1VQ7V 4OPAA 2G30A 2ZX8A 3OLDA 1O7VA 3EFOB 1YPZE 5DT1H 4TNFA 4UAOB 3NZHL 4F7MA 1QFUH 3K0WA 3HB3C 1Y76B 1J05A 4R4BA 1HH9B 2R83A 4ELDA 3ZIAG 3RILA 4EKWA 1RUPH 3FFCA 5FGRA 3STZC 2X4OA 4YAQB 3A67L 3CP1A 2YD3A 3G5VA 3ZDZE 1XCTB 4KP4A 3MA9L 4K5PA 2A79B 2KSDA 2K6WA 2XU9A 4Y9FA 4Z7UE 3LEXA 5EBWA 3G04B 1U21A 1PQZA 4QLWA 5IVXE 2EVJA 2IDUA 4HX1B 1A3RH 3HC0A 4KUZH 5E24E 4QRUB 3F8UB 2Q8AH 1MCWM 1BOGB 4F58H 5LYJA 3CCHA 1F6FB 2RD0A 1BM3L 3F00A 1OE3A 4HXBH 1S7QA 4HJIA 3ZJZA 3V6ZA 1R3JB 1AAJA 2DWDA 1CICB 5ITZB 3FL7A 5HDOA 3RQ3A 4IRJB 4CC4A 1II4E 3WDJA 5JHLA 5SWSD 5DTFB 3ZE1F 1K4DB 3E80A 3BRDA 3VXPA 2H0EA 4G1EA 2DQ6A 1HINH 3WIHL 2OX5B 3MRFB 3SKOB 1N6UA 4BQ8A 5IQOA 2QLYA 1G9HA 4BWWA 4Z1PA 3IDGB 3BP6B 2H8PA 3A0BZ 1U8IA 4JG5A 2PW1A 2R72A 1OWWA 4D9RE 2HLAA 2QGCA 4LSSL 4G9FD 4Q9RL 5KOMC 3ULVD 3D3VB 5FECA 4MDIA 5IMMA 5KBNC 1HCFX 5ISZB 2PZSA 5D4QA 5GHWH 1H3XA 2J2ZB 3CJHA 3WNLA 2F54A 2N7AA 3CX5F 3GLZA 1D6EB 3IDIB 3VVWA 3WMQA 3RFZB 5D7IB 5ESQB 1CIDA 1CFQA 3MNVB 4OBSA 3QEUB 2BJML 3NJKA 3LSSA 3BP4B 4WDIA 5EPMA 2HLAB 4XN4A 3W2DL 2Y0SA 3AROA 3BIKA 3MRBA 5KMGB 4LVOC 4KK9D 2A9HA 2ZCZA 3T0ED 5L2JB 1RPUA 1KGJA 2J25A 4IDJH 3B7UX 3Q9PA 4XZ4A 5FEBA 2CUMA 3KPTA 3DA0A 2DI7A 1K4DA 3AY4A 4IGBC 1TUEB 5I76A 4ZPVB 4B9PA 3BSGA 3CRCA 1JN6A 3V6ZB 1GOFA 1MWAL 5T1DH 4DKFL 3FUNA 4OPHA 2HUHA 4X98A 4OCRL 4NWUH 2ZKHL 3KPSE 3CZEA 3DX9A 4E42B 4TV8A 5I18H 2KBGA 3HMXA 2ZIMA 3MRKA 1P7KB 1G5GA 2FLRT 4URTB 4V2CB 4YHNA 4A1RA 1AR1B 4B3SB 3IN2A 4AEEA 4UT6L 1MWOA 1LO3L 1OSPH 2QQLH 5EBWB 1YY9C 2QWPB 3V4VA 1AKJB 4OFPA 1DDHA 1I85A 4R26L 3UBXG 1VQKV 3L1EA 5K1XA 4ZW6A 1YA5A 2BSEA 1FVCA 1Q86W 4PS7A 1SYVA 1WS8A 3NUKA 4WUUD 5AVYB 4ANVA 4EOWH 4ZW5A 3K2UH 1N6QH 1DVYA 4WI3A 4JM4H 1FZOB 1BBDH 3V0WH 2CJSA 4NFBA 5BV7L 1LD9B 1RJLB 4HIQA 2D7OA 4OGQC 3OAWA 1OOWA 2WB1A 4XN7A 1C8PA 4W4KA 3OJVC 1HZHH 1V9PA 3IFPB 3QHZL 4XNBA 5D1ZB 5B39G 3WJJC 5M7QA 3Q43A 5K9QG 4X4YA 4WW1A 5BW7A 1LO4H 5AOKA 1OAJA 1E5BA 4I0XA 4UF7C 3KPLB 2QELA 3EJJX 1BXVA 2EH7H 3H6AA 5KANG 4LFAB 4JFZH 2BC4B 2J5LB 1DJSA 3BPNC 3MV8D 4B5ZA 3PXLA 1N0LA 4G6AC 3WDIA 3JT2A 4JHAH 4B3EA 2YARA 1BVKB 2O72A 1CR9L 2R0ZH 3QSKB 1J95A 4RGOL 3KPRA 4F93B 1AQDA 4X5WA 3EFFB 2DWDC 4WFHE 4DV2O 3PPSA 2AQ1A 2Q86B 3WU1A 3AK1A 1CF8L 5E6RB 1A9EA 5JPNA 2Y23A 1SM3L 4RMSA 4AX3A 4DTGH 1JPGA 4ZX5A 3RDTC 1DCEA 1Y07A 1P9MA 3AS2A 4IKLA 4O2CB 5F1KC 4HUCA 5AEAA 2GC4C 5D7LD 3DO7A 2EXWD 3DHUA 1NCCL 1NBVH 5JW5B 4HZ3A 4A7GA 2W9EH 3FBQA 3L9RB 4L4TE 1HZLA 4KJYB 1XBRA 5C9JB 5B1BC 4GLXA 1UXSB 3B3BA 1A6AA 3QORD 3VFSA 4NKIL 4TV8B 3LH2L 3LXBA 2DL9A 1LEGA 1VFUA 2VKXA 3KGTA 2DD8H 2O5YL 2QSTA 2XLLA 2EDMA 3IJHA 3QEHA 4HJ0D 5LCVA 3I6GA 5I17A 4B3VA 4G80A 4NN6B 4HBCL 1ICTA 2X2YA 4ATWA 2TRYA 5HPMB 3H0TA 2VLRA 2YGPA 2XN9D 5J9PC 3DRQB 3RJOA 1UPGA 3LKRB 3GRGA 1S9XB 1CD8A 3QQ4A 2XHNA 4A67A 4FXKB 1IC0A 3L5WB 3Q6FB 4EDXA 4CJ1A 2BVYA 5AYUH 1LMIA 5AZUA 3WXVH 3KPMB 4U3SB 1SQBH 3CVDA 2ITFA 4LOVA 3Q9QA 4D0DA 3UP1A 5DLLA 2LVEA 1B6QA 1EHAA 3WO3B 4ATTA 4XMKH 2IOMA 4EBQH 4G6JH 5MEPB 5KVFH 3GHBL 3MLVH 4L8BB 4GMSH 4H0LB 3BGFB 2A73A 3GEFA 1KCWA 1FH5L 3P9MB 4GQ9H 4Y16B 4R0LA 3L81A 3TT3L 3GHEL 4CU7A 1Y6NR 5E2WH 4PRHA 5GZND 3P4LA 1KYUA 4D8PA 2P06A 5C8YB 2VSKB 3DURA 3V0AC 3MX0A 1T5EA 3PWPD 2YOCA 3EXJA 2QTVA 2YEZA 4H4NA 3P3RA 5KAQG 3DMMA 2WXMA 3X1EA 3ZE1E 4K07A 3J07A 3QNZB 3FN3A 4B9CA 3HZKA 4PJXA 1MCOH 1W0WB 1PX4A 3P30L 5IR1A 1F7YA 5GQBA 3JBG7 1RJZA 1ZHKB 4L1DA 5BV7C 1BG1A 1MPAH 4TQEH 3GMPB 4ZFZB 2HFEA 1TVDA 5EO9A 4AQ8C 5HY9B 4M43H 3KNBA 4QXUH 3RFZC 1MFEH 1WT5C 3QNZA 3VXRB 2H3XC 2Q76A 5BS0A 2BK8A 1NEPA 2RAMA 2BIIA 4HV8B 1W6LA 4ES8A 2VLMD 3JCZA 5J5EA 1A6WH 4Z7NB 4FLHA 2UXFA 4GAYA 3J27A 4HGMA 1NSNH 35C8H 4YHKL 1JFFB 4TYUA 5JIHA 4OZIE 2F74A 2ITDC 4P46A 5JOPE 1KMGA 2Z7YA 2EDOA 4WEEA 5AW2B 5IF0A 1UUSA 1NFDB 1AROP 3T4AA 5SX5H 3F12A 2X4OB 5BZWA 2F23A 4OD3L 3HG2A 3L3OB 4LEOA 3ZKND 1KLUA 2AJ3B 5LOVB 4HOZA 3SKJL 3UJTH 1CYWA 4L0PB 4NQEE 4CC5A 2NY6C 3GHPA 1KC5L 3HKDB 3B7TA 4HUUB 2VLME 2C1OB 1S9XA 5FHBL 4TQDA 4PA4A 3CX2A 1KN4H 5TDOB 1VGEL 2EIBA 5HPMA 3RDTA 5GONA 1E4WH 3FDWA 3PAYA 5JYMA 3OJ2C 1OB1A 1PLGL 3EOBA 3IFNL 3O4LB 4HSQA 5TQ0L 3T0XA 3DX7B 5SWSB 3B9KC 1X7TA 5JORA 1AI5A 3SDDD 5CN3A 1CVSC 1O0VA 2HT4C 4PJEA 4RSVA 4X5PA 3NEXA 1B4RA 1U3YA 1MQ8A 4G42B 3FOMA 1TDQA 2WC7A 3ZKMD 3OMNB 3UG4A 3AQDA 3NG5A 2DOSA 5IB4A 2HLFD 2OCCB 3D9AL 5TH2A 4ANXA 5C9JA 5GS0D 4MQ7A 4YBLB 5ANME 5I1IL 4UT9L 3BZDA 4P9HC 1PNCA 5IQNA 4UOW0 2UUCB 3DRTA 1EBAA 1R3IH 4JKLA 4HALA 4IEFA 3ZHTA 1QTYT 12E8L 3OX8B 4S2SB 3PL6D 4WI9A 1AXTL