1AR1B

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
molecule keywords CYTOCHROME C OXIDASE
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ar1B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ar1B01
1JZGA 2OCCB 3SBRA 1IC0A 3IEAA 3S3DB 4AKOA 3U25A 4QLWA 4AKPA 1J5DA 1N68A 2QDWA 2BP8A 4BDVB 2XU9A 3PXLA 1V54B 5TK2A 1M57B 2QDVA 5AFAA 4KO7A 2PCYA 1JXFA 2PPCA 2J57A 2CCWA 2FTAA 4UANA 4NB7A 4YSQA 1L9TA 4PCYA 1QNIA 1HFUA 2HX8A 4F2EA 2YAEA 4M3HA 3TBBA 4DPCX 1ASPA 2RACA 1SFDA 2FT8A 5D4JA 1ZIAA 4UF7C 2IWFA 3AG4B 3FT0A 2JKWA 5FC9A 3S3CB 4YSCA 2CALA 2OJ1A 4G7RB 2FT6A 2QPDB 2W8CA 1WA0X 5I6KA 2CJ3A 2EIJB 2GC4C 3MX0B 4BXSV 1N70A 1NIFA 3S8GB 1CYXA 3FU7A 2AZUA 1ZDSA 4G7SB 4HCIA 2YARA 4BWUA 3NP3A 1QLEB 5I6MA 3DKHA 4W9ZA 1ZDQA 6PCYA 3UGEA 1NDTA 4UAHA 5PCYA 1E67A 5I6OA 3T9WA 3NJJA 1L9SA 3FSAA 3WNIA 4AZUA 3ABMB 2HLEB 3ABKB 3T6XA 1FA4A 3TASA 1PZBA 5I5MA 3OMAB 4A67A 1J9RA 3L45A 2R7EB 3C75A 1A3ZA 4YVNA 2JFCA 2VM4A 4HCFA 2H47C 4KO6A 3AG2B 2GC7C 3CDZA 2FJSA 1AG6A 4TXVB 1ASQA 5I5IA 4HAKA 4HHWA 3X1GA 3OD3A 4YVUA 1XB6A 1L9PA 2YEVB 2IDSA 3PAZA 2BP0A 4BWWA 4KOBA 2PP9A 4BK5C 4HZ1A 3QJVB 2FQGA 1PCSA 1AAJA 1BYOA 1DYZA 1A65A 1GY1A 3V9CA 2A3TA 3NSDA 4Q89A 1BXAA 3EH4B 4YSRA 2AFNA 4E9QA 4YSSA 1NWPA 2PLTA 3ASOB 8PAZA 1JOIA 1KDJA 1NTDA 1ZV2A 1AZUA 3T6WA 2E86A 3WI9A 3FQYA 1ID2A 1AS8A 2HZHA 5B1KA 2DY2A 3TBCA 3NJLA 2CAKA 2DWTA 1B3IA 2R7EA 4F7KA 3QQXA 4P5SA 4BWTA 4DP7X 1SDDB 3CVBA 3AG1B 2I7SA 4DPBX 5IY5B 1GR7A 1TEGA 2IDUA 5B1JA 3FYEB 3HB3B 2PPAA 3FPYA 2BP8B 2BWIA 3PLYA 4YSUA 4E9RA 4GP4B 5I6PA 1SF3A 3NSYA 2EILB 3ZDWA 3CVCA 1EHKB 3FPXA 4YL4A 3D12B 4MFHA 4A2HA 1SHXA 1GS8A 2WO3B 1NIEA 3NP4A 4P5RA 4L0PB 4A2EA 5I28A 3WKPA 3QJTB 4E9WA 1PLCA 1GS7A 3SBPA 1NIAA 4AI7A 4W1TA 3MBWB 1JXGA 4KNUA 2XV3A 5TK4A 2AZAA 1BQKA 3PAVA 4KO5A 3GYRA 3NSFA 2IH9A 1OCRB 1L9QA 3AY2A 2YAMA 1KGYE 2YQBA 1QHQA 2J56A 3QPKA 1J5CA 3S3BB 3FU9A 2W88A 4A2GA 1AIZA 3NJFA 1OCZB 1BEXA 1TEFA 3IBOA 3GDCA 3NJIA 2BHFA 2GBAA 2J5WA 1AG0A 1JZFA 3FSVA 2OV0A 4A2DA 4JHUA 1PF3A 1RCYA 3CG8A 1T5KA 2XV2A 1JZIA 1I53A 4A66A 2IDQA 3FS9A 3UAEA 1BQRA 1IKOP 1X9RA 2XX0A 1AZRA 1OOWA 3NT0A 1MG2C 3FU7B 2IWKA 2XUWA 2FQDA 3H4HA 2TSAA 1CUOA 1XB8A 3ABGA 1JVLA 1EZLA 3OMIB 1L9RA 2YAQA 2Q9OA 9PCYA 2YAHA 2VW6A 1PNDA 2PP7A 2VW4A 3ERXA 1SDDA 5I6LA 3WIAA 1WA2X 2Y69B 5B7EA 4DP9X 2Y1AA 1CYWA 1AZNA 1AQ8A 2GSMB 4GP8B 1GYCA 1SFHA 1JZEA 3ZBMA 2XYBA 6PAZA 2GI0A 4YSDA 1XMEB 4M4RB 3T6ZA 3EH5B 1J9SA 4E9XA 2N0MA 3S8FB 2EIKB 1IUZA 2FQFA 3CZUB 3IN2A 2Q5BA 1VLXA 4Q8BA 3T6VA 3EHBB 1XB3A 3ZIYA 4KO9A 1V55B 1JVOA 1AZBA 1PY0A 3TU6A 2DV6A 1NICA 2TSBA 1MG3C 4E9VA 4GXFA 2GIMA 1F56A 3CVDA 4N8UA 1KYAA 1JERA 3AG3B 1A4CA 2BO0A 2IH8A 1AS6A 5AZUA 3N55A 3PCYA 4JHVA 5B3SB 1ILSA 4DP0X 2FT7A 4NAJA 1PLBA 2MRYA 4DPAX 1NINA 1KCWA 3FU8A 3X1EA 4DP8X 3JTBA 3G5WA 5I26A 1M56B 4G71B 2PPFA 1OE3A 3V9EA 2XX1A 4ENZA 4DP4X 2H3XC 4G72B 5ANHA 2HRHA 1SNRA 3NJHA 3NYKA 1MZYA 1NIDA 2ZONA 4A2FA 1AR1B 3UACA 3FQ2A 1W6WA 2BZCA 1NIBA 4CSPA 3JT2A 1BXVA 2EINB 1MDAA 3FSZA 1NZRA 1GW0A 1NPJA 3X1FA 1R1CA 4HALA 3WNJA 1AOZA 1HAUA 1NPNA 1ET8A 4BXVA 3SQRA 1FFTB 1PNCA 2FQEA 1BXUA 3DIVA 3ASNB 5A7EA 5B1AB 2JXMA 4F2FA 2UXVA 3T71A 3NJMA 4EF3A 4BDVA 2PCFA 3QJUB 2HRGA 1KBVA 1JXDA 2HX9A 2PP8A 5B1BB 5I6NA 2I85A 5E9NA 3FSWA 1TU2A 2DYRB 1RZQA 2QPEB 3GXUB 1A4AA 1JZHA 3TA4D 1GY2A 1PAZA 2CUAA 2FWLB 1KCBA 1UATA 2H5UA 3AZUA 2GB2A 2YAFA 1E30A 1X9UA 2YAPA 3H4FA 4KNTA 2ZWNA 2AVFA 1DZ0A 4E9TA 1WA1X 5B7FA 1ILUA 5D4IA 1E65A 5PAZA 1PLAA 2MTAA 1RKRA 1AS7A 2IDTA 4YSPA 1RZPA 1JZJA 1ZIBA 1BQ5A 5B7MA 4AKQA 1AANA 7PCYA 2J55A 2PPDA 2UX7A 2P80A 5F7AA 5LDUA 2IAAC 2IDFA 2FNWA 2VMJA 1IBYA 2GHZA 3PAUA 4FAAB 1W8EA 1ET5A 3X2QB 2XXFA 2ZOOA 4NERA 1BYPA 3FQ1A 1CURA 4RH4A 1IBZA 2CBPA 2UXTA 3IN0A 4G7QB 2VN3A 2DWSA 2PPEA 1PMYA 2EIMB 3BQVA 3HEIB 4K9JA 4HIPA 1E5YA 4X4KA 2YXVA 2X88A 3BVDB 2XXGA 3IE9A 2BZ7A 3NJKA 3QJQB 4DP1X 2BW4A 2XWZA 3PPSA 4KNSA 1KBWA 3QJSB 2XVBA 2VSKB 3CDZB 2VM3A 3NSCA 1W6LA 1SHWA 4YSEA 5D4HA 2WO2B 1WS7A 3KW8A 1OE1A 1URIA 2IWEA 2BWDA 1J9TA 4DP2X 4JKNA 2I7OA 3WKQA 4G70B 3EH3B 2YAOA 1KV7A 1PZCA 4WTQA 4GYBA 2UXGA 1OCOB 3EF4A 4E9SA 4ZK8A 3UABA 1OE2A 3AW5A 2ZXWB 3WG7B 4PAZA 5I5JA 5EHFA 1ZPUA 1BAWA 1L9OA 1PZAA 2VW7A 1V10A 4FA7B 1OV8A 3H56A 3NJNA 4DP5X 1E5ZA 3DTUB 2BP0B 2VSMB 3NJGA 3KW7A 7PAZA 2BW5A 1A4BA 2DYSB 5AKRA 1ET7A 2HXAA 2HX7A 1MZZA 4HHGA 2UXFA 5B1JC 1AZCA 1SJMA 2X87A 4A68A 1CC3A 4N4YB 1GS6X 3N2JA 4KOCA 4YSTA 1HAWA 1OCCB 3FYIB 1GSKA 1KDIA 1J9QA 1ADWA 2AANA 4WKXA 1AACA 4YSOA 3OMNB 1WAEA 1FWXA 3SBQA 1SF5A 2QT6A 4GP5B 2NRDA 1ETJA 3ZX1A 4AX3A 2B3IA 4E9YA 3UAAA 1A8ZA 2YXWA 4QKTA 1OF0A 2XV0A 4CSZA 3QJRB 3RYMA 1ASOA 4DP6X 1YLBB 2P80D 4HCGA 2B08A 3ABLB 3OQRA 2LLNA 4YSAA 3UADA 3OM3B 2UX6A 2XLLA 1M9WA 3X1BA 2WSDA 5F7BA 4GY4A 3X1NA 1TKWA 1WS8A 1NWOA
chains in the Genus database with same CATH superfamily
3DO7B 4HS8L 4I7ZB 4AKOA 4FL4B 3EYSL 4W9EC 2QR0B 4LRIC 1NFIB 4PV1B 4FKHA 5K39A 3CVHH 4DH2A 2XU9A 3P9MA 4N6RB 5TK2A 3DX4A 3RYFB 5DJ2B 3ILQD 2VDQH 3CP1A 3T2NL 1MFEH 3RI5F 5LGTA 4F92B 1S7VA 4N0YH 1G5GA 1NUNB 4X5PA 4G83A 1CB4A 2QELA 2QGEA 5DVNA 4BCYA 4K3HA 3WE6B 3LKNA 1VESA 1OT1A 3OLIA 3CXHK 3U9PH 5F6HI 1NCBH 5I15H 3QR1A 3WJMB 1HNZB 1Q9OA 1QATA 3B2PA 2V7NA 5IYZB 3WS6A 5I1CL 2BRQA 2CLVA 4F6RA 5J2UB 3MNVB 1YHQV 4LVHC 5TE6H 3SE4A 4B95C 2NW3B 3GSQA 3VXUD 1RJYB 2A9BA 3D07A 3EYFB 4JM4L 4YSCA 2CM5A 3QB7C 4I5BB 4GSQA 5I73B 1BG1A 1LWHA 2DWXA 3OHMB 4YUEL 3ZDYE 5J7CC 4YPGB 3VD7A 3POHA 2QPDB 3T0BA 4DGYL 2Z31A 4PW4A 2EIJB 1P9MC 4D0DB 3H1ZA 5SWSA 3DVNB 3WUWA 3U9UA 1KLFA 1G6RB 4BXSV 5IM7A 2LW1A 1GM8A 2F7PA 3WJJA 5DJAA 4FABL 1J8RA 5EG6C 5JPNC 3KPRA 1FFOA 4JY4A 4NRYB 4HCRA 3HLAA 1VPOL 5CBEA 3B8NA 4J3WA 4UV7H 5FCSH 1JDAA 1C08A 4BRVA 4UAHA 1JV5A 3NABH 2NT0A 3QF7A 2CO7A 4G8GD 2HVJB 1RUML 4LSUL 4NYLB 1CGXA 2NY0C 1ACYL 1D2OA 1VEOA 3KGSA 3LZLA 3OKKB 3MYJB 4JG1H 5DJAB 5E8OB 1FA4A 5LNDA 3K5NA 2VXSL 2Z7WA 1BZEA 2YKKA 4JBSA 5I5MA 4NENB 2LR4A 1TJHH 1ZSDA 4U1IB 1BOGB 3OZLA 1NR1A 4E0RA 2YPKB 5E8DL 4LVEA 3KKYA 2GEEA 4FS0A 3ZMUA 3U7AA 1TTUA 2GV9A 1H19A 3MYJA 3OHXC 3DXRB 5DYFA 4TV3A 1EN4A 3K58A 3AFLA 2E9JA 4FA8A 3O3AB 3HAEG 3GFUA 5KUMA 2N7SA 3C6LC 3K4ZA 3WHE1 1N0XL 4CUCA 3F83A 3DXAE 4WWOA 3A6BH 5I1AA 3LPOA 1UWFA 3Q44A 2B3RA 2VLKB 2B15A 2ZCLH 3VD1A 2IDSA 2AQ3A 4IKNA 4XNYL 2QTEA 2N1TE 4KQ4H 1PPJH 5EU7E 3EFFB 1A2YB 4BE5A 1ZK5A 1K8IB 3QJVB 2V0AA 4ODBD 1J8KA 3L1OL 3FFOA 4FX5A 2VISB 3LTVA 4HH9B 5EYPB 2ZOKA 5C0BD 1RK1B 3SN6N 2DWYA 3EH4B 3RVTC 2R9HC 3QEQA 4L4TA 5ADOL 3NH7H 1DJXA 4LGSB 3D30A 1JR9A 5F6IB 1QRND 3FQTB 4P9HH 5CM1A 3Q1EA 3T6WA 1RZIB 1XF1A 4XX1E 2P45B 2YPLD 1XGRB 3LRLA 1MREL 4XWGH 2LW7A 1I1FB 3MRJB 1ID2A 2LU5A 4GEIA 1L0XA 1SOQA 4LCUB 5D4QA 5EZLA 3VRJA 4LMQI 1JPTL 5GGSA 5LNEA 4BFIB 2R23A 5DSCA 2ZX7A 3H1LH 4Z8FH 4HS3B 2ZICA 2R1XB 3BFQG 2QM7A 2W0PA 1Z5VA 2H26A 3RZWA 1MAMH 1IGTA 2BHZA 3NEXA 4LSDA 2PW2B 2GBVA 4AH2A 4ZUUB 3UPRB 2B20A 2R51A 2KUTA 1S3KH 4O2AB 2BWIA 3F64A 4ZMYA 1RK7A 5I6PA 4UV4L 1AP2B 3L2NA 1R5IB 4AVKA 3ETBF 4ZFQA 1XVSA 2LU3A 4NN7B 2OMBA 1TTBA 1X3DA 5D96C 1NCCL 2X0UA 4FG2A 2XN1A 4PRDB 1SHXA 1UXMA 2HPOA 4G9DB 4C57C 2E59A 3HG1D 4EXKA 3JD3A 4O2BB 4BSWA 2HKHH 1BGXH 3BP4B 3GRWA 2ZE5A 2AXJA 4ZMQA 3CQPA 4DUXA 3CNKA 4D0BB 1XCQB 4WI8A 1RZ7H 4Q0XH 1DQTA 4TN9A 3CEIA 1WD8A 1EJOL 3UTTB 2EC8A 2OBGA 2B4CL 1ODUA 4JO4L 1XFPA 4KKLC 4ODVH 2GI7A 3ZDYB 1ENVA 2F18A 2P22C 1CLOH 4HCRL 4BKLB 2DOSA 1YDPB 4GW5B 3LKSB 2NUPB 3QPKA 4JDZA 4RMBA 4X65O 4XE0A 1EZVH 1EV2E 3S3BB 2C9RA 4LF8O 4NQDA 4DKEH 1QW9A 3RWRD 1VFBB 5C07A 4GS7B 3IBOA 3UCRA 4UIMA 2XN2A 3KYKL 5IBTL 4F7PB 4WF7A 2Q86A 4MDJB 4E41D 5D1QA 1ZE3H 3WIIH 1IQDB 1S78C 1F3JB 4JO1H 2DJ4A 4I7ZC 1SKVA 1DQDH 4B3VA 4NXSA 4DVRH 1CZ8H 4GNKB 4R83A 5LHIA 3K2UH 2RQ6A 2HKAA 4XDKA 3IU4H 4NRXA 2DRUA 4OD3L 2ADJB 4NN6C 1T5XB 2Z3YA 2QM4A 3GJFB 2FB4L 2GAZB 4QRRB 2AJZB 2W65A 4LWSA 4XP9H 3BZ4B 3PDOB 4FLHA 1C8PA 3GSQB 3QW9A 4F3FB 4FPPA 1IBBA 3H4HA 2HAZA 5KSBF 5DMGD 1G7QB 3SOTA 2OL3H 3ABGA 4IRJD 3BPCA 2HT2C 2IGLA 3IYLW 2N7AA 1PYWB 2WIIA 4I87A 1SOXA 4FFYA 1UA6H 2VW4A 5EZPA 2EJ7A 2VL5A 3GO1H 5T3XL 1TSRA 1R9FA 4NM4H 2XWCA 1O9VA 1D6VH 5E1AC 1P7KA 4HEME 1RZFH 5E00A 4WUKH 4ACTA 1FZKA 4DP9X 2BE3A 3SDCD 4HIIB 1SJHA 4D6TH 1OAZH 4P46A 4B50A 3B8MA 2Z35A 3EYUH 5DRWB 1BE3H 3OAAG 3FF8A 1JZEA 4WFEA 1KN4H 2NR6C 4K7PH 1Z32X 1A0QL 1KWGA 3TVMC 4YSDA 4GKKO 3VFWA 4Z7OB 4CZZA 1NC2B 1XF5A 4JM0A 1HCFX 4W9KC 3VFSB 5EZIH 5GONB 5I0VA 4AQ1C 3WFHB 1OIOA 3QRBA 3TU6A 1NICA 1DUZB 4WEBL 4LGRB 3HKDA 1MZEA 1BXXA 1NTZH 2HFTA 4N8VB 2GIMA 1JERA 2JTDA 5F8RC 5LWYL 4WHTA 1AS6A 1T1YA 4LNUA 5MP6H 4HJEA 4X99A 5CLXA 4WNSA 3EJYD 1PSKH 2FT7A 4WV1B 1KB5A 1FYTB 1KPRA 4GRLA 1SBSL 1NANH 5H2FZ 1ORQB 4KGLA 5AVQB 2I26N 4PN6A 1XCTA 3CFQA 1D3CA 1HQ4B 2KI6A 3WL9B 5CFAA 3B43A 2VMCA 2Y1VA 4QE9A 3FN0H 4DP4X 1MHPH 3D3VA 3GHEL 3I6SA 4UOW0 4Z7NF 1SNRA 2FWOB 2VSCA 4PGCA 5TDOB 1URFA 5D2NA 2WXPA 5HGDA 3EBIA 4XVOA 5LGKA 5GS1A 1EMTH 4Z7QB 5IB4A 2CGNA 2QV4A 3U2SA 1FGNL 1B04A 2OSLB 1FZJB 5IUSA 3JT2A 1NCWH 4WWPA 4F5CE 3L5WA 1WNSA 4U1SA 1GW0A 4K4KA 4HUVB 3B2EE 4G28B 1A7BA 1QI5A 3IDMB 3MRCA 4NNXB 4QHLB 3R19A 2VDKB 4AJYV 4AQZA 1O7SA 4ELKA 3C3SA 1UOWA 4OZFG 3IRZA 4X4YA 5JOPE 4MJID 3PWJA 1MW2A 1OGSA 3NAAH 1BXUA 1NH6A 1D2PA 2PO6A 1RUMH 4LSUH 2WAMA 3C5JB 5EBLB 5JHDB 5B1AB 2JXMA 2XPYA 2FSDA 5CEZD 2KZWA 4ZYKA 2D0HA 2CLZB 3FQXB 5D70L 3QJUB 5AUMB 4PFEA 5CBAB 1RH8A 3RBSA 1JXDA 4A38A 1IBGH 2PP8A 2VABA 1CLYH 4PA7A 1E27B 1TU2A 4FG6C 3FOLA 3RZCD 4TTDC 4PG9A 2D7OA 1KCUL 5GHWL 5JIPA 4PP2B 2JKSA 5D7LB 4P2OB 2VQUA 1CLCA 3CFNA 3F01A 3CCJV 3QUXC 4ZXBA 4DHLA 4IBSA 2GB2A 4ICGA 1J8HE 2IMNA 4GUPB 4NQCE 1S76D 5D7IF 4DKDC 5AB2A 1S9WA 4WFGE 4LPCA 4G8IA 1JGDA 2ZIDA 5LHGA 1MWAL 1LR1A 2CAZC 4A7QA 1ND0A 5LBSL 4MZRA 4RFEB 2WXHA 3UO2A 1QACA 4X4ME 3ZO9A 5C71A 3LAFA 1GKOA 4XNYH 2NZ9C 1U95B 4KZCA 1FAFA 1WA8B 1N9PA 5IJ0A 5JTWA 4URKA 4O2CA 1T66C 1XBLA 3Q13A 4FAAB 1A7PH 4J4PD 3KPMB 4QT5B 5I23A 2R0KL 2X9XA 2RJMA 3SO3C 3LEXA 3Q2LA 1MCKA 2NZ1A 1CURA 4LU5L 4K94C 2CBPA 3PGFH 1EEQA 3VSVA 3LKSA 1MCFA 1TQCC 3NA9H 1AD0A 5HDRA 1CE6B 4YDVB 3TBTB 5KWYC 4WU5B 2VDPL 2UXBB 4FG4A 2VLJB 4NKMB 1NC2D 4HZ3A 5J5EA 1ZLZA 1HNGA 4AMKH 2JV6A 4BGDA 2BRRH 4KNSA 2A6JA 2IV8A 4X6DA 5C3LD 2V8MA 2OMVB 3TWYA 3CDZB 2KG7B 2AQ1A 3BAJA 4IEFB 5HHVL 4AM0A 4EOWH 2ADIB 4ESKA 1G1OA 1HXYB 1WZLA 4TKWA 2Y1ZA 2OMZB 2ADFL 4F7CB 2AEOA 1KPVB 3UZQB 3OD4A 3EH3B 2YI9A 1KV7A 2EXYC 3G6JA 3QXVA 4L9LC 4OQ1A 2QKIB 1ZGLM 1X5FA 1UXSA 2R39A 4WTQA 4JFFB 1KJ3L 2Q8VA 1Z9LA 3O4LD 4UVCA 3WB0A 4Y5VB 5LO7A 4JAAA 4PLJC 2DWDA 5J13B 1IILE 4JI2O 2E9BA 4D8PA 1PS3A 4Z0XA 2BTQA 5JNYA 3BP5B 3DJRA 4OJCA 2QSCL 2N1KA 4UMGA 1ZSPA 3GEWB 4JPVL 1K85A 2GJRA 1UXSB 4DR7B 2F54B 3QA3B 1E5ZA 2JIZG 4LRNH 3CPUA 4UZUA 1I7RB 4OT1L 3D0VA 2EVIA 4DETA 1D5MA 5AKRA 5AW7B 3OR6C 2VMEA 1XEDA 1MZZA 3U0PA 2Z35B 4XNAA 4JE0A 1XCQA 2VDPB 2ZKOA 3N2GB 2X87A 4NAQA 5B1NA 4FM1A 2UUCO 1TTRA 3MNWB 3UYRH 3VWKD 1KCSL 1OL0A 2AAVA 4BFKA 1M6OA 5E9DE 3UTSD 4K3JH 5A16A 1A6ZB 3HPLA 5GGTL 5J89A 2O5ZH 3BAIA 1BLNA 4B3TB 1CFNA 1SQFA 3GSVA 4BFBD 1A6WL 4XP5L 4JI1O 1CDIA 3IDXL 3N40F 4I9XA 3UAAA 3ZE2B 4AQ8C 4HDIB 2HVJC 1IGFL 1JZ3A 4CH5A 2XWTA 4HMEA 2ZCEA 2BFVH 1EDQA 4MW3A 3PWVA 3CFKB 1WT5A 1MELA 1OB1A 4HHAA 1R3LB 5AVXB 2VRAA 3EGSB 3ZKND 3UYOD 1OAQL 4HCGA 3WLWC 3L13A 4QRQB 1CL7I 1EFRG 2P43B 3VYPA 5SWQA 3TXAA 1F4XL 2BNUA 3E8HA 4FN0A 5GTIZ 2A6DB 2E27L 1BOYA 1P4LA 5ITFB 4AVIA 2EIJC 1XGUA 3BFOA 3HN8A 3L1GA 2R29H 3NGBC 1OM3H 1DJGA 4FG0A 2ZUQC 1GZHA 1SXAA 2VO8A 4BH7B 1SHMA 5IB4B 2CLRB 3L3HA 3ARDB 5LL6Y 2CO6A 3KH3A 2DMGA 3J2PA 1VEPA 2EXWC 3DVIA 4GW5A 4LHQB 1NDMA 3UC2A 4GG6A 4DV1B 3VQWA 3VSUA 2GQHA 1XCXA 3FB7C 2Y2TA 3EIFA 4FCHA 5D1ZC 1KT2B 3ULVH 3LPWA 4M00A 5DVPA 1MCOH 3PWNA 1QPKA 2ZF8A 3MRMB 1TFHA 4PSPA 1R3IH 3IGAA 4JQXC 1KYOK 3O6MH 3AREC 3QC5X 3U7YL 4ENED 5AVVB 2YKLL 2CBQA 4Z1VA 3W7XA 4MTOA 1HNZO 2DS4A 2K7PA 2O5YL 3DSNB 3VX0A 2O61A 3DX9B 1HDMA 2ALAA 4PRPB 3MMEB 2DQ3A 1RLBA 4U1KB 1JVKA 1QKZL 1HINL 3S9DB 3QR2A 4LGPB 2P5WB 4NXNO 2DJMA 2JJWA 3DTXA 4K3DL 5FC9A 3WAKA 4XT1C 5DECA 1P4IL 2KKWA 4R4ND 3V6ZA 4EIUA 3CK0L 1HL4A 1OCWH 2VWKA 1O7DE 2ZNXA 3PG2A 1FJ1B 5DJ0A 4PGJA 1T5EA 5CLTA 1DQVA 2W8CA 3MJ6A 1CD1B 1JMXA 5D1XE 3TWCH 4YLCA 5C93A 4PJIB 3SDLA 1H0DA 5JYMA 5C8YB 4X7TA 3BZEA 2EKSB 1CGTA 2PWHA 3MLSL 4J12A 3B1UA 2UYLB 5DUML 4A6YL 3UO3A 4HV8B 4N5ED 1W8NA 1HNXB 3UMTA 4OFVA 1JWSA 1GAXA 3FT1A 1CJYA 3ARFC 4J8RA 1S7WB 1ORSA 2DIAA 4WWKC 4ANUA 4K07A 3KMDA 1F86A 2G75A 5IMLA 5L8KB 3DHUA 1SA0B 1NFKA 3CCVV 4NRZA 1RIHL 3AY4C 5IQMA 1KYOF 3ARFA 1AQDA 9CGTA 2HLEB 1ZT1B 3KL0A 3T4YA 2OMXA 3DO3A 2QSQA 3TASA 2Q2EB 1YY8A 1FZJA 4HNAB 1N18A 3CZKA 5ABAA 2XWEA 1KLGB 5JOFA 1UD4A 1S5LZ 2DAVA 1WEJH 2JB6A 1Z6JT 2DIBA 3C75A 3TFBA 3ABUA 4AYID 5AD0B 3I3DA 1YMMD 5I1IL 3KYNB 3HI1B 4KUCD 2HJDA 4LCWB 4PJGE 4X4XA 4DV1O 3GMOB 3N0PB 5CCKH 1A9BB 1VF6C 1JHLH 1W0KG 1DVYA 1TZGH 2OP4L 3DGGA 4HCRH 4NPYA 5FA4A 5CEYB 5JHDA 2Q73A 1MCEA 4BUQA 4TUOB 4JI2B 2LO1A 2XWXA 3HMWL 4PB0L 1HSBB 5E1HB 4MVRA 2G0KA 3MN8A 4DZBB 5JW4Q 1G6RH 2UVFA 4GO9A 2FGWH 5CBHA 1R33A 4WU7B 3KWUA 4DV7B 1EVTC 2E7HA 1GOHA 1HC1A 3BAYA 3EH2A 3MV8D 5CJOH 3WNPA 5JHLL 2P52A 3VFNB 2EBOA 2PP9A 3D39B 1F02I 4JDTH 3II3A 4MB5A 4ETQB 3J7AU 1G1CA 1YUKB 1NCDH 4HISA 1MCSA 4J23A 3MBWA 2IH1C 2C2AA 3ZMVA 3E38A 3GKWL 1P69B 4I0PD 4LDEB 2XAHA 4E9QA 4YSSA 4JI0B 2CO7B 1KDJA 1ETB1 3L9RA 3U30B 3LV3B 2FSEB 1UM5L 2XPZA 4Z3FA 2Q7NA 1U95A 3HB3C 4NQUA 5CJ5A 4XMVA 4OUUB 1XBDA 3WI9A 3ISWA 3L2LA 1F42A 1P5UC 5BO1H 2JH2A 3RVTD 4JAMA 2LU7A 4PTTA 4RZCA 3D0AA 2GFBA 2R0ZH 2TAAA 3FQRA 3GMNA 5EUOF 3EDKA 4DP7X 3VDAA 1LD9A 2C1PA 3GSRB 1YJDL 4KKBC 5ISZB 3ARWA 4FJ6A 1CEZA 2GK2A 3FCBA 3H2WA 4X0KA 4JG0H 3QO0B 3U2JA 1HEHC 4UCSA 5T1KA 4QJ3B 4AMXA 2ITDC 1HR0B 1EK3A 1ZRUA 2X70A 2X9YA 3DROA 1MWAA 4XH2A 3P3SA 2GY7B 2XJKA 3FPXA 1ROPA 1TJXA 4QJ4B 3IJ8A 1YAZA 1DBAH 3D9AH 4YDNA 5BXZA 4ZX5A 3MUY1 1NIEA 2Y7QA 4PRPE 5I28A 3W39B 2WA4A 1HI6B 1MFBL 2X4PA 2YPVA 1U8OB 3D2UD 4BINA 1PG7X 4IGBC 3AITA 3RWJB 2JNZA 2VR3A 2Z7YA 1XGPB 4KNUA 1J5EO 4N2LA 3WS6C 5C0AA 1OALA 1DCLA 1M6UA 3QPQC 5LGYA 4ETYA 4X65B 1W91A 2LT9A 2EZ0C 4ZT1A 1D9KD 2IH9A 1ED3B 3BP5A 5FUOL 5FYJH 4KK6C 2DQFB 3VXRD 1EHNA 1QHQA 2RH0A 3D6GA 4A7TA 3C90A 1EJ8A 1P9MA 3NJFA 4CKVX 1TEFA 3FO2B 5ACMA 3TN0D 3E0GA 3DX6B 2YEVA 2WYZA 4JB9L 3TN0B 2KL6A 4LVNB 1ZLSL 3TH2T 1VFAA 2IAMB 2IV9A 3GIZL 1XMOB 2R29A 4KHPO 3G67A 1RCYA 2PTVA 3MRNA 5DJDA 3CG8A 3RYHA 3DHMA 4R96B 5HBBA 1EEYB 1OSPL 4P5MA 5FGSA 4W6YB 5BVPL 3RTQC 3SJVD 2HB0A 1HCVA 5IB3B 5T8IA 4P3WA 3I85A 4HWEL 5DD0L 1PYWA 1RHFA 3QCTL 3JYBA 5D7KD 3T0EC 3T8XA 2QWPB 4CS4A 1HZHL 2MCPH 2VT0A 3C6LA 3NG5A 2ICWI 1UCBH 4V1DE 3R06A 4HOMA 4LKXB 2GJ6E 2NZIA 5A2LH 1F00I 4DR1O 3BIKB 3VE0B 4XNXH 2RDCA 3TA3B 3D33A 1A1MA 4CMMB 4BFFA 2EDQA 1PTZA 1SS3A 1JDCA 4LF5O 2PP7A 3BE1L 5D8JL 3G5XB 1FFXA 1ZA6A 1JNHB 4UIKL 1Q6UA 4R5XA 5DGRA 4IBTA 4MYWB 1TFPA 2J8UA 4IBQA 3FT2B 1C7TA 2DWEA 5JOEA 4IRJC 2WCSA 2D31B 1BQ0A 4YN3A 2G2RB 4CH4A 2OZ4H 1AQ8A 4GP8B 4ZUTB 1LE9B 3GBML 1OCZC 4IOFC 1QWUA 5AVRB 1DTUA 3Q6GH 4AEHL 3J7HA 4UIMB 1J9SA 4C56A 5EEWA 2XVKA 1WK0A 1IUZA 2VLKE 4TSCL 2ATKC 5HI4D 2VL4A 4HKBB 3ARDA 4EN3D 4B9IA 2AJXH 2QR0A 4H8UA 3P77A 4Z7WF 1MCOL 1NFAA 3LQZB 3QDGB 2TSBA 4E9VA 2ITCB 2J1YA 2BO0A 4KUZH 3T2LA 4ZIBA 3FT9A 2GHYA 4NRXB 1KJMA 2F0CA 4OM1H 5B3SB 2A0LD 4I0PB 4QD2E 1G0YR 2Y22A 4K23H 3ZL4L 3VRIB 1A3LL 1HDJA 2IIJA 3FU8A 5HJBA 1R3LA 2IBZX 4JZNA 4C58B 4ASUG 2DMHA 4Z7WB 3KLHD 2GSIB 3FO0L 1RZKL 2E8ZA 2ENQA 4PRPA 4ALAC 3QEUB 1M56B 4CSSA 2R0WH 3I6GA 1BBDL 2ESVD 4KFZC 4M6AA 1WPBA 4OLEA 3MV11 3QJFA 5DMKA 3PL6C 4XMLL 1YTFD 3NCEB 3FF7A 2YIHA 5FA3B 3ROOA 3KLQA 3QXAA 1PJWA 3VMOA 3MJ9A 1EM1A 3GXTA 3V0JA 1H8EG 3UACA 1QSEB 1KEGH 2DQEH 4PELA 1IGML 3RNKA 4CSPA 1KY6A 3Q4HA 4FD0A 1LEKB 4PJCF 4ZYKB 4YQXH 1XH2A 4TVPL 4HALA 5HVFB 1JDDA 3UFIA 4ZO7A 4P5TD 3MRHB 5TTRA 3PWNB 4ZOCA 3ESNA 4MNHA 1KXTA 5ACZB 1P2CB 3ULUD 3ZO0A 4RGOL 1WYJA 1X4ZA 4ZMWA 2FBJL 3CCSV 4D7SA 4JPIB 4S2SB 1U8NB 5IHWA 4JPVH 3AG2C 3QHZH 3REVA 4X9GA 4JFEA 2GTQA 2JVUA 3KBPA 4HWZB 5DJYB 4PLOB 3WY4A 1WD9A 1IFHH 1KCVH 1YNKL 1QSFB 2X4NA 1EUTA 1YEJH 4CS2A 2D7PA 4O58L 5CJXC 3VM5A 4YK4C 4KXZI 4PGEA 5TJWK 5KHIA 4MMZB 1YJWV 4KH9A 3BEWB 4YHKL 5F0MB 4D0CA 1KGXA 4MJJA 2Z7UA 3CC1A 1ZTXE 5CWSB 5T1KB 3C09C 5EEUA 5AD0A 3Q8CA 2DBLH 4Z3TA 2H0EA 1OY3B 4O2CB 4LASL 2PYFA 2EDRA 4IU2A 4Y5YC 5I19H 5KBPA 2GEQA 5IYZA 4XPHL 3H9SB 1RKRA 1A25A 2C3GA 4DK3A 4MQXC 3ULSB 1B3JA 4Z7WE 5CGYD 4QRTA 1B6QA 2CKBB 2J55A 3OVUB 3JTTA 3MRBB 3MV9A 2CG9X 3QUXA 4YHNB 5AKSA 4JPKL 1EXUA 3TXQA 3A67H 2V2WB 3TBTA 2Z31B 3RIKA 3UZVA 3FQ1A 1UH2A 2OMUA 4OGQB 3B7YA 4X7SL 4TLSA 3S4SG 4WJKB 1Z3RA 2DWSA 4P46C 5LMNB 3KR3L 3L73H 2EADA 3DX0A 4HIPA 3CFDA 5E6SB 5AVTB 2JXMB 4Q9RH 3GQFA 3QNFA 3Q5YA 3FKSG 4LLUA 2KH2B 3VXPA 1CFQA 3WEBA 2PWDA 3PQYD 1UQSA 2Q20A 4S11A 4N2IA 1RPRA 3ECVA 4KQ0A 3UP6A 1CG9B 5DMJB 5F1IA 5KVDL 3V5DA 1JZ6A 2BOCC 4ONOA 5DK3A 1CXHA 1TNNA 4PUBL 2YMOA 2Q67A 4E2OA 1HOCA 2ZT9B 1TVBB 4GPVA 4ADJA 1F0LA 4WUUA 4K8RD 2W9DL 2IM9A 2ZWLT 3BT2H 2DH3A 2YPKA 1XR8B 1D2DA 1Q90A 2NNCA 2UXDO 1MVFA 3DETC 4O5LL 3AQYA 4UTAA 4Y9FA 5DFVD 1P4BL 1OE2A 2VRKA 4QXVA 5BS0D 5ITBL 1RLWA 2WB1A 4XXDB 5B22A 1MSDA 5K9QI 1JUFA 2BDNL 4H8QA 4R0LC 3R06B 1FFPA 4FNLL 4ETQA 2AQRA 1BAWA 1HS6A 2IMMA 1FLRL 5IVXE 3VYOA 2GTAA 4FQ2L 4UFZA 1M05B 1L6PA 3F85A 4LLVB 3PXHA 5I0XA 3DTUB 2FHCA 1YEDA 3VSQA 3CRCA 1ZE3C 2BP0B 3D18B 2DYSB 4HQQL 3W38A 3EFFK 1NS1A 4WI3A 1K72A 4BSWB 5GGSY 3N2KA 2FYYA 4HEMA 2NY4D 5BZWB 1CYGA 3A6CL 4KK5C 5KG9A 4L4TB 5EN2B 2EYTB 2CTQA 1YEDB 4J6IA 3ILPA 3GK8L 4I4WA 4XBFA 5A7BA 2BSSA 1QVOB 3EZJB 3M6DA 4BKLA 2F5BH 3L6FA 3BVTA 4UV8A 3OMNB 1OB1B 4G6JH 1N2RA 4HHAB 1FXHA 2XAJA 3SDCC 2VB5A 4FXGC 3QQ3A 3OLDA 3BXNB 2XFXB 5DRNA 4ZO9A 1IBLB 3WJMA 1FAKT 4GKJO 1ZHNB 1LXMA 1I7TB 4CSZA 1QEXA 4DW1A 3CCQV 2BNQB 4PBXA 3MV7A 1FH5L 2YPLE 3R1GL 4ZXBC 2AK1H 2KLRA 3GBDA 3NEEA 4R96A 5CZKA 4OX9B 5TFSL 4AOFA 3QRLA 3ARPA 4LSRH 4PR5B 2XLLA 4EEEA 2AXTZ 1DQML 4WFHD 2J6WA 4X6FB 1NCJA 1FVDB 3GZKA 4JHWH 2ZXAA 3GHPA 2XG5B 4OF3A 2C9QA 4QHUB 1NGXB 1U4EA 4X80H 3F5WA 3LKQA 2X3AA 4GQQA 4ZOBA 4D94A 1YO4A 5CJBA 3A6BL 2FD6L 1H5BB 3JWDH 4JO2H 1KMIZ 1T20A 4WENB 3S96A 1IX9A 4XGZB 1R17A 3BPOB 4WHYG 3HFFA 3TCLB 1NR7A 4OIIH 2BP8A 3ZN1A 2A9AA 1M57B 3NMEA 2VXTH 3OAUH 4YHIA 4N0UB 1X5KA 1IM9D 4ZMLA 2VLJD 3B56A 4WTZG 4ALAL 1XR9A 2BLFA 2Y7SA 4B3MB 2CCWA 4K7FB 5IY5C 3D09A 4XBEL 5T1DH 4C47A 1HX0A 1U8NA 4U3FH 3M1BA 3T08A 1J5OL 1B90A 1C5DB 1B2WL 3T2QA 2CCLA 5SX5K 1T03L 3TT1L 2BERA 4N0CC 3TBBA 1JYXA 1IE5A 1HOEA 1ES0A 1XZWA 3IXAA 5E2TL 3BKYL 3HAEH 2AGAA 5EU6D 5F9DC 5HHNB 3AM8C 4X7TB 1ZIAA 2D7TH 5CD3B 3FT0A 3CXHJ 3LZOA 3GZPA 1GTFA 4OJDH 2CJUH 1F23A 2O5NA 5C0CD 1GGBH 4IIZA 4UT9L 5D5MA 5DC2A 3QQ9D 2IPTH 1CD9B 3OAZK 3L3KA 3EYSH 4GUQA 5EZJB 5GJTH 5I8EB 5E2JA 4JZGA 2UWEE 5T5FH 1BBJB 4KRPC 1GZQA 4AE0A 4DAGH 1WTGT 1SQXH 2J6EL 5FNVA 3VUAA 1DLFL 3GRBA 4HJTA 4LPXA 3TOPA 4XHJC 4OSUL 2VE6B 2EAEA 1JHKL 4G82A 3QHFL 4AQEB 2O4EA 4XBGB 4NZJA 4I9WE 4BWUA 4E5XA 1N6UA 4AIZA 1OTSD 4NUJA 1KEGL 4FYRA 1Y76A 1RZJH 4X6DE 5HHOB 1LEIB 1NDTA 4N6RA 3CAFA 4U1GC 2ADGB 2VDKL 4U1HB 4XN9A 1GOFA 2XN0A 3B9KD 3OAZH 2W60A 2HKHL 3BD3A 3K6IA 4L5FH 3IETA 3RIFF 3R7QA 1VQ9V 4RAVB 3QWNA 2H9GB 2OJZH 3PHOB 1RZ7L 3R0NA 3PPEA 4N87A 4ZO6A 4NTWA 3RIAF 1GTNA 2ICWA 1TGOA 4DR5O 1Y6MR 1YEFL 2DLFL 4K94L 5DJXA 3UAJD 2R23B 2B4CH 1QTYT 2C1OA 4HBCH 4N20A 4UTCA 5AW0B 1SOKA 3VAEA 3O65A 4UOJA 1EEUA 3W9EB 5KYWA 2GC7C 5MEPA 1B4TA 1NAMH 1RQ5A 2B39A 4D3CL 2FJSA 4HGWB 1EANA 1P84J 3GUFA 4JZNB 2E56A 5I5IA 1DUZA 4RQFA 3ZIAG 2WJ7A 4BZ1H 3HUJB 1ZJBA 3MUUA 4I8DA 1PX4A 4WEUD 1GRWA 2GCYA 1AJNA 3NK3A 3JVFC 4QCIA 2KLSA 1JJUA 3FFCD 5JQGA 4OPAA 3VD3A 3SJAC 4IIJA 4ODHL 5IFHL 2ATPA 4MMZA 1EEZB 1XGTA 2FQGA 3FQNB 4NQCA 4MYPA 2P06A 1II4E 2YPVL 4N26A 1K9MW 1UM4L 2QQKL 3ECBB 5E03A 3EG9A 3MAQA 2GTWA 5CAYB 1BFTA 4ZMPA 4ZTEA 1OSYA 4DV4B 3VH8G 3GI8H 1V8HA 4XOCA 3KEDA 4V11A 4NP4L 1IVTA 3U6XA 3MA9L 1D5ZB 1M2OA 4ONHA 5FM8A 4QY8B 4X5WB 3ZN6A 2GBUA 3JTSA 5EC1A 5L2KB 4JFDE 4K71C 5F44A 3GO1L 4P23C 4UILL 5JWPA 4CBZA 5DO8A 4G9FD 2J3SA 2X70B 4JN1H 2YD5A 5L8LB 1DE4B 1KCRL 5DU7A 4BFEA 5F7EL 3U9WA 3VDBA 1HHHA 2B0SL 2UXNA 3T2OA 3CSTA 1BX2A 2NY7L 4WI5A 5GGQH 1N12A 4OM0H 4LOUD 3RGVA 5KSAC 4L8DA 5KVDH 1TQUA 4IHJA 2V7HB 3ARXA 3CN4A 3GBMH 4OJFH 5CZRA 4YHZL 5EUOA 3CH1B 1FORH 4M29A 4A37A 2K4AA 4DR5B 2HTKC 5GTHZ 3V4VH 1MIMH 4KKBD 5BV7C 3P3TA 1EHLH 1C8QA 2VLRD 1YY9D 5TE4L 1XQ8A 2OL3B 3EFFA 4KUMA 3JAWA 2QLYA 4H5SA 3ZKQD 3OR7B 4QPEA 1X5IA 2CMRH 4F7CA 4HEPA 4BGLA 1NIAA 4F7EB 1T1ZA 3VJ6A 1ML0A 5EIVA 4KKPA 2WOYA 1RK1A 1GYVA 4OH2A 1N5AA 3RWFB 1RFDH 2VRQA 4X64B 3DUHA 5HHXH 5JHLA 1YNLH 4YWGH 1SJXA 3LYRA 5E70A 4BRJA 1A3LH 4V1DD 4X5LA 5ES4B 4LF6O 1XTMA 2XXMB 3Q01A 4PJEE 5B8CC 1T6BX 3C5SB 1GVIA 3OX8B 1FZOA 2F9BT 1VJSA 3KYMA 5TF1L 3S6CA 5G5DA 3TPKA 3ZR6A 2XN9A 1JF5A 1IGIH 4FYQA 2AK4E 3OL2A 3FU3A 4E4EA 4JRYE 4ZUWB 4QGTA 5I30L 3VMNA 1FE8H 3H7LA 3VH8B 5LQBH 1W8OA 5C2UB 4G43B 2D0FA 4A2DA 1THZA 1IGJA 4PJCE 3ZDXF 2RJZA 2FR4A 2Z8SA 3DX7B 1VIWA 4N8VA 3UPRA 1HE7A 4UT6H 2PTMA 4YXLL 1BQHA 4B41A 3LDCA 3OXSB 4XVTH 2BSKB 3MGAA 1FDLL 4LE8A 4TVPE 1J1XL 2VC2B 1OPGL 4C59B 1AZRA 3P73A 1ONQA 1FYTA 4GRLB 2JQZA 4ENEC 5JR1H 4OLVL 4QWWC 3HZYA 3QQ4B 3CZJA 2GBTA 2XUWA 4X98A 1AHMA 3FT4A 3I9PA 1CDHA 3IMBA 2WZ5A 3Q6FA 5L4MA 5IWAO 1H6EA 1FJGB 3H0TB 3ALWA 1L3NA 2B1OA 4OLXH 4JRLA 4MJ6B 3W2DL 3RE0A 1LE9A 3ZTNH 2BOBB 3N6YA 1YRKA 3P0VL 4OJEH 2ZYRA 4JANA 3UJTL 5JDJA 1U8KA 3GLZA 2OR9H 3RTLA 2Y69B 4YH6A 3SE9L 5C08B 1S7VB 3CZEA 5DK2A 2FRGP 4P8QA 1U92B 4DW0A 3W0WB 5IDJA 4RLDA 3RWEA 1M9NA 1M3JA 4LFHG 2A4CA 1A6TB 5ECJE 1YMMA 2F15A 4X7EC 2FYVA 3VXMD 4X4YB 2HEPA 2N0MA 4XXWA 5HY9A 1U8KB 5ICXA 5C07E 5KVFE 4LKCB 3QZWG 4WGVB 1GO3F 2JE8A 5IROD 2WQRA 3OHXA 4UT7H 3WDJA 3ZKXC 1RMFL 5K33A 4UB0L 4W9FC 3AREA 1N59A 1G1YA 5CMUA 3ZRWB 1KBKA 1Q0XH 2AGJH 2IH8A 1PNMA 1SN5A 1Z5YD 1R6NA 1WGOA 2HUHA 3OUFA 3IDJA 1SF9A 5CA1B 1KLFB 3N9GL 4XMWA 2VR8A 4F2MB 1U4FA 4DP8X 4HKXB 3FK3A 4NM4L 4RMRA 2OTWA 3VW3H 1AKJA 4PTUB 2PCPA 4XZUB 2JKJA 4R4FL 5D7IA 1R24B 3OKDB 5AL8A 2BVQA 1MJUH 4HDIA 2XX1A 5F71A 4AENA 3D8MA 1XZ0A 3KCXA 4L4TD 3GLAA 1TCRB 4AQYO 3D52A 3ML8A 2WQVA 3MRKB 4ZFZA 1CGSL 1HL8A 5AW9B 5EIIA 1V3JA 4X6EB 3HR5A 3OJDB 4GX5A 3I50L 3CFCL 3D69A 4JREC 4PRAA 3DMMB 1NIBA 3KPSD 4TSAL 4F7TA 1KB9F 5ENWB 4CN6A 1EO5A 3QUMH 4LF4O 4F93B 4BFOA 1VQMV 3T04D 4NBYB 3FUFA 1AOZA 4GG8B 3K5MA 1X5MA 3ECWA 1FJGO 4QY8A 1TMCB 4ZFGH 1RSOB 4I2XA 4FG6D 4XAWL 1J87A 2FH6A 1OCRC 4KHTL 3QJZA 2YBRB 3S5LG 3GWOA 4E5XB 3CGTA 2L0DA 1OT2A 1EZUA 3EDJA 3FCSA 3M1BB 4FQ2H 4EUPG 3NJMA 1ZL8A 2WQUA 1GK9A 4FXLA 4DEWA 1FNHA 2W92A 4H44B 1VP7A 3OJ2C 3VGEA 4ABQA 5KHKA 3OEEG 2UUAO 1H8SA 1V27A 2JF1A 1RZQA 2VR9A 3HB3D 1NMAH 1NUDA 4HNAA 3BFRA 1NJIW 1K3ZA 2PYJA 4IHJB 4FZ0A 4JZJB 2HP4A 4MNQD 1ZANH 5I1GL 2QKIC 3MRLA 4B53A 3CXCU 1QLNA 3FB8B 2DJVA 3DTDA 3VFRB 1KSRA 3QUZA 2C4XA 2UU9O 4FZEH 2QQLL 3SGJA 4B9GA 1AANA 4Q52A 4JEGB 2L3BA 1SMDA 2CK0H 2P80A 4TPRL 3O3EA 3BGMA 3EGDA 1G7PB 2OSYA 4PJEB 3PAUA 3GTNA 4RRPG 3HZKB 3MLZL 1ET5A 3VRJB 3X17A 3MUJA 3LS5L 1AIFB 3FH7A 3NN8B 1H0DB 2MCAA 3D0VB 3FTWA 3ULAB 4Z78B 2ATPB 4H0GA 2Z8WC 3WV0A 5I1EH 3FJTA 3R1GH 2DWEC 3RJOA 1VFMA 5IFJA 2XKUA 4O2FB 5C0CA 3WS3A 2B2XH 2PPEA 6FABL 3HW7A 2XT9A 2GTWB 3EFDH 4KJPD 2YXVA 4FFZA 4Y4HC 4AIOA 2VDNH 3ULVE 3COOA 1E4HA 1VDGA 2G75B 1N32O 1H3PL 3E80A 4HIQA 1NSNL 5K9OA 5A16B 3ZXAC 4ZBMA 1QLEC 4ZTOL 1D9KC 4B3EA 2CH7B 4JN1L 3B2DC 2NCMA 3MV01 3QIWB 3QO1B 4FQQB 4IHBA 4XTRC 3TONA 4HU8A 1KQSU 3TGXA 3C5ZC 4L1SA 2B5IB 4LSSH 3EJZC 4WCYL 1I9EA 2VWEE 4GYBA 1T4WA 4YBLC 1OCOB 2Q8AH 2A1WL 1OEZW 2AJUH 5JQGB 3TA3D 1J0YA 4O51A 3D36A 1UD3A 3GBEA 3ZK0A 3THOA 4N1CA 4QDGA 4G7VH 1X5XA 1FO0B 3C12A 2G4EA 3MJGX 1A66A 2Y69C 1G9HA 3PGFL 1BP3B 3OZ9H 1PDKB 4K8RC 2DE0X 4AL8C 4YHNA 2BP5M 3OGCC 4I3RH 4FQCH 1M4KA 2CGRL 5ADPL 4G5ZH 3AWEA 4PJIF 4B7IA 2JKTM 3LSOB 3BSGA 4UTBH 5LCVL 1CTNA 7PAZA 4WY7L 3DDGA 2L7JA 3HE6B 1M56C 2VQTA 5FYKE 4JZOA 4M6NL 3RWGA 3LN5B 4HHGA 4LLDB 1MCHA 2FX7L 4PRID 1QFWI 3JTSB 2A83B 5C09E 2GUOB 2JJVA 1FNGA 2D2CC 3PL6A 5T5FL 5C1MB 3QUGA 1ZTMA 3AG7A 1R1BA 3ECQA 4QRPD 2Y5EA 4X6CF 5KYUA 4P2ZA 2W07A 3CFJB 4WO4C 4ONFH 5HI3D 1IBKB 2G5RA 2X0LA 1FL3B 1S8DB 2XBZA 2V37A 1M1XA 4FQ1L 2Q0OC 1HXKA 2J4WH 5F9AC 1IZJA 3WXVH 4ODXA 1LK2B 2YXWA 4U1KA 5FUZH 1TYJA 2KB1A 1BZ7B 3GMNB 4X6CA 1FZMA 1JRHL 1KV3A 2QKIA 1UACH 4HJSA 1B0GA 5HI4C 1FVEB 5BO0D 3LS4H 3GSWB 5H6QA 3KJ6H 5DMIL 2ARJB 3Q2CA 4TVSa 5DZAA 4Z3EA 1KCLA 1NEZG 1K5NA 4PRNB 3KCYA 1NUGA 3MLRL 4I1PA 5DJCB 1T1ZB 3VJ6B 3X1BA 5D1XC 4RDQG 1OF2B 3O2WL 3TX4A 4G6ML 2A0LC 4UTAL 1SY6L 1WE5A 2YMXH 1VQ5V 4GRWE 2DW4A 4ZX6A 4LARL 1IEBA 4X7DC 3AXLB 2WVTA 5BR8B 3KPSA 4G8EA 35C8H 3S3DB 5K1XA 1KIPA 1QLEL 1Y4MA 4DO2A 4PS4L 3W5MA 2KQXA 4HZLA 3NCWA 3PXLA 2DQTL 8CGTA 1A6WH 1G0DA 1HEZA 2E74C 3LH2H 1F8TL 1LUWA 4G3YL 2LQTA 1KELH 1P4UA 3JV6B 5E94B 2UUAB 1L9NA 4U6VH 3SYQA 3KCWA 4JR9H 1ORQA 3OWEA 1CDBA 2K9PA 1FH2A 1HKFA 3A23A 2WLMA 4MXWL 3V55A 4DSYA 1KC5L 2MW2B 1WFOA 4DV3B 4HBQA 2CDYA 2LFSA 1NGWA 4M03A 5F88B 5JQ6H 3DK2A 1PAMA 1IC7L 3RNQB 3TVMA 4QRUB 5CINL 2X1OA 3SD5A 3HZYB 3QQ4A 2DD8H 2R4SH 1JFQH 3JAKA 2YBGA 4G7RB 2F4VB 4UMSA 4WU7A 2BNUB 2BVEA 2X89D 1BV8A 4N2OA 3VXMA 4LCYB 2B1AL 2ADGA 4U1HA 1UD5A 3RIFK 2R69L 4WF9V 1MJUL 1VHPA 3QULA 3T0XA 2FCBA 4GIAA 2NYYC 2OTWB 4G7SB 2PO6B 4ZODA 5EBLA 4DK5A 1E5BA 4X6BA 3T3PF 1FUNA 1AJQA 3BIKA 3QJHB 3UDWA 5D7JC 2A5UA 3VI4B 1UENA 3DUSA 3MVSA 2OK0L 1ZWIB 4KMLB 4FJZA 1MIML 4U1NB 5K1VA 5GZOA 1CU4H 2E46A 3O6LH 5HHME 2IVFC 4JPRA 3D69B 4PRAB 3MJ8B 2VDLH 5D7LA 3Q4HB 1R3HB 3FB5C 4FFWD 2GFBB 1P1VA 1A3ZA 4PM1A 3FUIA 5D7SH 1PW3A 1KB9K 5L3EA 2GCYB 4HCFA 2H47C 4JQVA 2LP7A 4HC1A 5E08L 3IXTA 4Q0XL 3QIBD 2YBRA 1DDHA 4OLUH 4P46D 5INCA 5C09B 5I75B 4WWID 1UJTA 5C08E 3BW9A 5IESL 4LLQA 2QFRA 2Z8RA 5BZDA 3AWGA 3JALB 1RJLB 4J7KA 4L4VD 3VX1A 1ROCA 3A5VA 2LFRA 2W5PA 4MXQD 2ED8A 2IANA 1TYRA 3V4PL 4I0PA 4S1DD 1DDHB 1MH5A 2JJTA 1XH0A 4RMUA 4JPSA 4TNEA 5C6WH 3QI9C 4CILA 4FLVA 3MCKA 4X9BA 3TYFB 1WB8A 5CP7B 4PA3A 1AGEA 1DQKA 5E4EC 5DWPA 2A3TA 2R1YA 2OT5A 1ZMYA 3IF1A 3WG7C 4W4LA 4LBEC 1BXAA 1XGPA 1X5LA 4NWTL 4PJGF 1I9IL 2BS9A 3MRRA 1SVCP 1BWMA 2ZUWA 3HC3L 4ICXA 4PSRA 3DETD 5DFVC 4FEMA 3KG5A 4LBEA 2Y07H 1OWRM 4PRPD 1DBJL 3EXLA 1BLIA 2ODMA 3P2BA 3MXVL 2YXYA 3Q48A 4NXNB 3KPRB 4TF4A 5AB0A 4AE1A 4JDEA 4DF9A 2DKSA 4PS3A 1JSYA 3CLWA 3BDYH 4TQ8A 2VLRA 4GLXA 4ZFFB 3F5WC 3QQXA 1VQ6V 4DUVA 1KJVB 3UGUA 1IDSA 4NZRH 1BM3L 2PI5A 1M1XB 4I88A 5CJOL 4JUSA 5MI0B 1RY7B 4G5AA 2NY4C 4JI5B 2WLNA 5B1JA 4OJAA 1ACZA 3CFDB 3FYEB 3QIUC 1NU1H 5EOTB 3HB3B 1UT1A 4KK5D 4ORZC 3IJEA 1N8OE 3CZNA 5CKGA 4B9JA 1SF3A 1IBMB 3C60C 3H1KH 4PJ8B 1DVFA 3H9SE 5AKTA 3T8XB 1QLFA 4HIXL 2A77H 3LPPA 43CAB 2HT3C 1R6TA 1GPOH 1G4YB 1T0OA 1T04A 4NT6B 4O2EA 4YE4H 5IVZB 2EDTA 4FFBA 2HT4C 4J3XA 1BJ8A 3BH4A 2D4FA 2DQHH 5K9KB 4W1TA 3MBWB 1DBML 3NH7L 3VO0A 1BECA 2N59A 4XPFL 2HG5A 3LZNA 1FNSL 4MBOA 4WI0A 3AXLA 5AAMA 3RVWD 3T1FA 5DQ9B 3GYRA 4N90E 3WTXA 5JW5B 4IOIB 4KXAA 2NQDA 1NCGA 2DLHA 3L7FB 4O2FA 1KGYE 3OMZA 4MAZA 3IGAC 4JQXA 1LLAA 4UQ2B 2H2PD 2LTQC 1G7JB 4U1GB 4YX2L 2V1DA 4JM2A 2UUDH 3DNKA 3GDCA 4PJAA 5KAFZ 4Z8FL 5AVYB 2X6BA 3CFBB 2QQQA 2XASA 1AG0A 3CDFA 2ZZUT 1BMFG 4Z7UF 3BKMH 4HUXB 5AOJA 1VADA 4QXTB 4DV7O 3RIAK 4JZOB 1YYCA 4F58H 1KGJA 4NIKB 4MTGA 2E7BA 2YPLA 4ELMA 3RDTB 3DIFA 3FS9A 3BKCH 5TPWH 1MAKA 3SODB 3L5WB 4GMSH 4U1SB 5DRZA 3V0EA 3QORA 4OGXL 5JXEC 1AYRA 2B1GA 3L81A 3GMMB 4OPHA 1YN6A 3ARQA 1RJYA 3CCHA 1GIGL 4LAJH 2F1BA 4YHPB 3SDDD 3V4VA 3M8OL 4L1HA 4PS7A 5EU3B 3QEUA 2EDMA 3BUTA 3KCPA 3MR9B 5DRZB 5DZNA 4ODXB 2V8LA 3SE3C 3G4SV 1FGVL 2DQ6A 4JFYA 2ADJA 3W0WA 4LAQH 1UB5B 1NGZB 5DZ9A 3AC0A 2QTSA 1MQKL 4FABH 1WHPA 2F58H 1XR8A 2DB8A 3QXWA 3H1IH 1YN6B 2PTUA 2A79B 4JO4H 5FUCE 1B6UA 1VA9A 2YJLA 4XE5B 2HMIC 1WIPA 1I94O 3SOBL 5DHMC 1FCCA 3T4ZA 4E5XG 4DR7O 1ZGLA 2Y1AA 3LNDA 3EOAA 5AVSB 2R2BB 4CMHB 2G60H 3L16A 4TUYB 2WVUA 1VGEL 2WIIB 3K7UA 1E7UA 2FECL 5BMFL 5BVPH 2XN9B 2CDFB 2XYBA 2P5WE 3JUZA 4XPBL 1BHBA 4KU1A 5GS2H 4B0MM 5HHPB 1M71B 4G9FB 1WIUA 5DC9B 5ICZB 2Y2YA 4DR2B 3RRQA 4JI6O 3KM2A 5IIEA 1I1AC 1N0LB 3ZY7A 4L8SB 2APFA 1HEJC 3CQFA 3VXNA 4H20H 3MLZH 3VXQA 5BJTB 1F56A 1MLBB 1UOKA 2NNFA 3KPMA 5C07B 5C6PB 3MCLH 4APQD 4KXRA 2BSSB 1ILSA 1F11A 1XD0A 4XBPA 4XP9L 1WICA 4DP0X 3KR3H 3L7EA 1PLBA 4AQOA 4QGPA 1C5DA 2X2UA 1T2XA 1H9VA 1QHOA 1IKNA 1XSKA 1YITV 1I9RH 2WM0A 3FQUA 2DTML 3MREA 3OR6B 4PJDB 5KVDE 2JGDA 3TNNB 4YHLL 5TGBB 2YRZA 4X99B 5HYQA 2C9VA 3PWPE 2FBOJ 2Z5UA 1P7HL 5MERA 3HVNA 4PGZA 2OTUB 5D2LB 2WN3A 5AKVA 1K4DA 3DV6B 4NQED 4XCCH 3DURA 2ZWKA 5CJQL 1K2DA 3J81N 2R69H 3VMPA 3ULUC 4W93A 2JJUA 5TQ0L 1BD2E 3VNZA 1MCNA 1P5VA 1O7VA 3U30C 4U1MA 4MA7H 2NXZC 3T5WA 5ITBH 5EU4A 3FFDA 4I48B 1NGXA 2KC0A 5IREA 4HFUL 3BHBB 3ZE0F 5IF0A 4LK4A 1EO8L 4WFHA 4LRIA 5JHDD 2O6DA 1TZIB 4K5OA 2QKCA 1NAMA 1NC4B 3MBEA 4F2FA 2VLRB 4F9LA 3QCVL 3O2DA 5CEZH 2M2DA 3EFOA 5BY1A 3WGVB 3WD5L 3MRCB 4JZJA 4PJ6A 1Z9SA 4JFFD 3B9KB 3QORC 1BBDH 2XJLA 1PSKL 3P3UA 2DYRB 5BMVA 2CO4A 2KERA 3CXDL 1CE1H 1A4AA 1ANUA 4HGKC 3V10A 3QXUA 5LOVA 5CA1A 3N41F 4F2MA 1KCBA 5CGYC 2YAFA 2W0FC 3HZ3A 3UO1H 1Z5LB 2YAPA 5JZ7C 4ZOLA 1QFHA 2A4ZA 3GM8A 1FBIL 4OLYH 1CBVH 4QYAA 3KE0A 4E9TA 1CICC 5EF1A 1ES0B 2XICA 4XVUC 5DRXA 3UYRL 4TV9B 1CR9H 1VF5C 4J4PA 2BK8A 3GXDA 1Q4NX 5L2KD 1XIWB 2W0XA 1Y74B 2NNXA 3Q0HA 3WNMA 4Q7DA 1HJCA 2IWGA 2CUGA 3L5XL 5SWZA 1ZLWK 1Z9OA 5H4YA 3UBFA 3PREA 5IQ9B 4FJYA 3I9IA 1TSHA 2FH8A 3CZFB 1JGDB 4QRRE 5JHMA 4DKFL 1BQLL 1S72V 4B5ZA 4MQ7A 1NI8A 1AQKL 5EBWB 4ZSOB 4OGYL 1EEZA 1XGTB 3FB5B 4ANWA 5DMIH 2BHUA 1T7VA 1QNMA 1DJYA 4JHWL 5JDSB 4NN5B 2HVBA 3IF1B 3RURA 2NY2D 5SWQB 5GGVL 2OIEA 4F80A 4ZMZA 4ZMOA 1QPXA 3IMSA 2F1MA 1MIEH 2WXFA 1BOGA 3WYRA 5EBWA 2H94A 1NBQA 4ZSOA 4GAFB 3ZHVA 4M8VA 2OZNA 4LBEB 3RU8L 3JWDL 4JO2L 3T2PA 2OS7A 1QRNE 5DJYA 3GMRA 2VSKB 1OP3H 5E99L 1DBKL 2VM3A 3PWJB 4ELMB 1I1AB 3SPHA 1KXQE 4KDWA 1QLEH 1MRCH 2Z93A 3P9WB 3NQIA 2I7OA 3P1VA 4DP2X 4G70B 3ETGA 1U8OA 3ABMC 4M1CC 3UCQA 2Q5ZA 2XWRA 4JPKH 4G8AC 1YMHA 2EIEA 1OB0A 4ZBJA 1CQYA 3MRGA 1UA7A 1KPUB 4ABUA 1ZX3A 3O6KL 4WTWA 5AOZA 5EOTA 3ETBJ 3C5ZD 5HHQB 1QTSA 1T3FB 2ZOWA 4MB1A 1RZJC 3HZKA 5H94A 4WUKL 4H8HA 1SEBA 1WFMA 3UZVB 4AYGA 3FB7B 3JAWB 1N4XH 3Q7JA 5AAPA 1IXMA 4MSWC 2BMKB 2D3LA 4O4JA 1Q1JL 4MJ5A 5IR1A 1R4XA 3QYMA 5DJDB 5KVEL 2J6EH 3ARDC 5H37H 1QEWA 3D39E 4KV5F 3T9WA 2GVYA 3MOQA 4MVBD 1JF1B 4ZQTA 4NN7C 2CGYA 4H13B 2R4RH 3Q8AA 1MFMA 2E9GA 3DSFH 4PJBF 5EO9B 3WKML 3U4AA 2QVTA 2GJ6A 3UOAB 4OGAD 3AK2A 1N5YL 2CHDA 1JWSB 4GP5B 3H8NA 1LNUA 2WY3B 3IFPB 2HLFD 4J8RB 1EZSA 1N8ZB 4XVSH 3RUGF 3ZE2F 3QVNA 4KKAC 3L74H 4WVRA 4XN2A 1NH2B 2WSPA 3PRZA 1Y6KR 4MCNA 1NM4A 3BLPX 2H32H 2D2CB 1RZ8B 3VXTA 3GMPB 2H8PC 3GIVB 1WC7A 5CNHA 1JPEA 3OXRB 2VDLL 1MABG 3ABLB 4QJ5B 1E5CA 4HQQH 3HG1B 4NEHB 4RESB 2HCZX 1BQHB 5FXCH 5EZJA 1M9WA 3RGHA 4KZEL 3Q1SL 4GRWB 2EJ1A 1HHKB 4MT8A 2F7QA 2R15A 1RZ8A 2M26A 3BPNC 3V8CA 1UYWL 3TNMB 3D51A 2N01B 4H0IA 4PJDE 4UZGA 5HGDB 2NY3D 1MQKH 4X1KA 3SBRA 3IJHB 4JGNA 3PHQB 1RURL 3TV3H 1MCPL 2YSTA 1UXLA 5KA5A 1N68A 3VFGL 1P7QA 3SQBA 4BDVB 4OI7A 3LKNB 3U4EA 3PQYB 4A55A 2EZOA 1IM3B 4N0CD 1JWMB 2ROYA 4P9ML 5EBWC 4GKOA 4PJIE 3VBBA 3RNQA 2DQGH 4P2AA 4KKZA 1TZIA 2D3OW 1SYSA 5IB2B 2P9RA 4Y2DB 3GI8L 2O5XL 2F8OA 3F12B 5F70A 4ZUVB 4MX7B 1IM3A 1AXTL 4DPCX 5FHBH 3KAAA 5CXPA 5GRJH 2J25A 1S9YA 2EDLA 2XOKG 4MJHA 4DN3H 1R3KA 2VDLB 3O4LE 1XILA 1ETZA 4F37K 3OKLA 4K73A 4OR1A 4XNMA 3RGBA 2CUHA 4FZ1A 3ASNC 3V7AE 4GUPA 2C7FA 5E8PB 1K5NB 3OV6A 1MW3A 1LE5A 4HSCX 4M7JL 3H9SD 2PYEB 3C6EA 3N50A 4WCEV 1A47A 1OAXL 1RUKH 4JI5O 2C26A 3PWVB 3CFTA 2G3NA 3VFVB 1E28B 1N70A 3M17A 3ULVF 5L88H 5IYCO 3GSUA 3OC5A 2P26A 3K1KC 3KGRA 4M6MH 4HCIA 2J44A 4L8BA 4A7GF 2X1XR 4BH8A 2IAMC 5FL7G 4EUPA 1I8LC 3S35L 4LF9O 4QT5A 4NUGL 5CJQH 3D4CA 4RFNC 1IGYA 3G6EV 1ZS8A 3BZEB 1KP2A 3NJJA 1GA2A 2EEXA 1U6AH 2CMRL 2E7LA 4YDZA 2Y7MA 3ABKB 4RO2A 2KPNA 3UIYA 6CGTA 5IIEB 1QBZA 1GC1C 3HR6A 1CGWA 2WBJC 4OBSA 2DQHL 3V0HA 1J8HD 1SDYA 4LP4A 3WFHA 4NZUL 4K5PA 2YD3A 4ANVA 5F8QC 3P11L 3EDFA 3UTOA 5IGXL 5GJSH 5JOPD 5CBFA 2OMVA 3LNIA 3LSQA 2AHYA 3MDJA 4YUEH 3P9LA 5T1LD 4AQ1A 2K8QA 3SJVA 3WNNA 1UKQA 1Y6NR 3B7SA 4I0XA 2PO6D 4PA9A 4J9ZB 1UT9A 3HHSB 4FFWC 4NN5C 3V5HA 1NOLA 2KSDA 3QHFH 4FIPC 4MRCA 4RNRA 2M6YA 3HKCB 2D3JA 4LEOA 3O8XB 1TVHB 3OAWA 1RU9H 4YVUA 1L7IH 2YEVB 3TN0A 4XC3H 1F6AA 4H0HB 3QDMB 4OV5B 4BK5C 2BVPA 2FJFA 2TRYA 5LGNA 1F4MA 4B3RB 3V6ZB 4HS6A 1YECH 5D1QC 3ECUA 5CZXC 4CS3A 1CGUA 3QZWA 4GI6A 4PJBA 3MZTA 2PXYC 4JI3B 1NWPA 3E6FB 4GXVL 4M9PA 1JOIA 1XIWA 2J21A 1ZA3B 3PV7A 3TBYB 1Q81W 1QTPA 2BMKA 2W60B 3KH4A 5IR1B 2ZIMA 4NJ9H 5KS9F 3HCVB 4M1GL 3O9WD 4J3TA 4OLXL 5F7DA 5AW3B 3N2GA 3K5LA 2WYTA 3LB6D 4IRSA 2JKNA 1IBDA 5GGTH 5BXFA 4DKAA 3ARBB 4JM2D 4QLRA 2BCKB 4KRPB 1RSOA 3W5NA 2PR4H 1U97A 3CMAV 2I27N 4EQ2A 5ERWB 3RVVD 1A7RL 4PIRF 4H33A 5F3BA 4GW1B 3MJ7A 3PLYA 3PV6A 5AOMA 4UB8Z 5BXFB 4BQ6A 4FLYA 1QLRA 2MFNA 4RBPH 4MD4A 1LD9B 1Q7YW 2JLLA 3TEUA 3AB0C 3UTTA 3BT0A 4DKTA 3RHWK 4FZ8L 3RBZA 2V2TB 4HJ0D 4YHOL 4FXGB 5ILTL 3E8UL 1A14L 2A9MH 4JDZB 3S88L 2BIPA 4P5TB 5EBMA 2P90A 2A7BA 4TOYL 4WW1B 5KG9B 1K34A 1TPXC 1Y18B 3Q9PA 5GRVK 4R3SA 2FTKA 4MDJA 2Q86B 4X1KB 4TNGA 2HN7A 5BUGA 4ODWB 5EBLC 1IQWL 1OCRB 1QSED 4CNIA 4ZX4A 5LXGH 2X12A 1J86A 4LQFL 5FYLE 4LVHB 3R7RA 2RCVA 2COQA 3NJIA 4B3RO 1AO7A 2QFPA 2R0WL 5DEDA 1Y07A 4HAGA 1BF8A 1UA3A 1FXVA 1FORL 1SEQH 3CCEV 3QUML 4HA1A 3PDOA 3ZZQA 4JI3O 4ILDA 4UV4H 2XV2A 1IAII 2HFFB 4HEPG 2GUOA 2V5RA 4PD4K 3LZPA 1TJIL 4JY5L 1TZHA 5BRZA 4G80A 5T1JA 1IEHA 4LLYA 4LDLB 3SQOL 1E8ZA 3BDBA 1EDHA 4PV9A 1OOWA 2DDQL 3LEVH 4OLZL 1GGIH 2V5MA 4HK3N 2FEEI 3H55A 3OKKA 1XL6A 4XN7A 4XNMB 3W0WE 1J1OH 1AGFB 2AJVL 3RKPA 5LXTB 1A6AA 2XG4A 3ESMA 4G2AA 4KTGA 2EH8L 2PCPB 1VQ7V 5CD5C 1XB8A 5CFHA 3AADB 2P3YA 3BD4A 3P3RA 5DRWA 5HHQA 3OMIB 4TUYA 3ATDA 9PCYA 5IUCA 3GRWH 4ZHQA 4Z7VF 4A6YH 4Z95L 3IC9A 1TCRA 3LZFH 4IJ3C 1IT9H 1OAKH 1A7NL 2RA1A 5C0FB 3APFA 1K73W 1WA2X 5D93B 1QA9A 4JFHD 5HYSA 1PDKA 3N41B 3QIBA 2AXFA 4PJEF 5C0GA 1K4CB 3ZBMA 4LHJB 2YFOA 4GG8A 2QQLH 1AB3A 3SPIA 3T6ZA 2GUZA 1CDUA 4FQJL 3K6FA 3LSOA 4E9XA 4YJ2B 2FQFA 3BP7B 4Q8BA 4XHQA 3VH8A 5LGJB 5I6XC 4RGNC 1YY8B 3L5XH 4NTXA 4EKWA 4OLVH 1EFXB 1C12B 1E79G 2K8MA 1DEEB 2FB4H 1MG3C 4AYEC 2V2WA 2JGDB 2GUZB 1RM1C 1G7HB 5I1EL 3PCYA 3G6JE 4DN4L 2CPUA 1YYLH 3CFJA 4TUKL 1KFAL 4PJ7F 5B39B 4H8WC 3K5SA 5DD3H 2H0PA 4X64O 1NKOA 3LCYA 1NINA 5D5MF 3EGSA 4EO5A 4NQXA 1XTLA 2E76C 3PU7A 4ZI7A 3ZT5A 1S3RA 4MMZC 4R2GB 1MFUA 4BFIA 2JJ2G 3GB7A 3QXTA 3U4KA 3GJEB 2MTPA 5C6TH 4X6CB 4TNVF 4BSJA 3IDMA 1Q6IA 4NNXA 2BXYA 2WXLA 3OKLB 2H26B 3V5DB 3EYUL 1XF2B 1TLMA 2XI9A 2WGNB 3NFPA 5JJJB 1Q6HA 2CM6A 2CO6B 2BZCA 1YAIA 2PI4A 2GW5A 3EGDB 3K71B 4LSQH 2ZOTA 5T1LB 4M6ML 2N3JA 1G9EA 3STZA 2WO4A 3RYCB 2YXHA 3SCMB 2UZIH 4Z78A 1YMMB 1G6RA 3PXJA 1ZWIC 3RL2B 4RQQA 4ZHQB 5KMGA 1V5JA 1A6VH 1A8JH 4TOIA 3D2UB 4G1MB 4MCZB 3BQUA 3V0VB 1U6AL 4LCIL 4OZGF 2M1KA 3W7TA 1JGLL 3UC0L 1I3RA 4KJWC 1T22A 2BOCB 4D0BA 5KTEL 2NXZD 2V9RA 2VKWA 4NVPA 1IO4C 4FGMA 1E5UI 4OD2B 3BI9X 4EIZC 2I85A 3ZUCA 5E9NA 4HOZA 1HR0O 2QPEB 1YG9A 1J8HA 3E35A 4MCMA 3EDDA 1UJ3A 3KYOB 4FJCC 3TA4D 4YS4A 4XN8A 1JPST 2CUAA 5IHZA 1R0AL 3NTCH 4TMPA 3KDPB 5G4MA 4ZKIA 2EVJA 1JXFA 4E0RB 5HFLA 3MREB 3D9AL 3OR6A 4U7MA 2EYTA 3ZHDA 2XWJB 3O41B 1RIUH 4Y4KB 4BSVA 2IANE 3S37X 4PGEB 1R5WB 1J5EB 1RZPA 2HRPL 1NKDA 1HI6A 1E4KC 2UYLA 2X4PB 4FXGA 4PJXF 4A7VA 4AKQA 4NO3A 4W4NA 4HSQA 3TZVD 3ARZA 4ODSH 1KXVC 3S37H 5SWSD 2Z8VC 3CMOH 1MCDA 2AI0L 3AY4A 3LS4L 4NHUB 4RISH 5DR5H 4WU5A 4BSVB 3VVWA 2LLGA 4JI8B 1O9HA 1A2YA 1KXVA 4HG4K 1YSOA 3K6SA 1LWRA 1NLBL 4KXCA 4OCYH 5CP7A 3T4YB 4J11A 1PD0A 2KZBA 2OMYA 5D2NE 2YEZA 4UU9B 2WUBL 4CMHC 5KVEE 1XMOO 5D7EA 4NJ9L 1NAMB 1NC4A 2A4EA 2RIKA 1YF2A 3BUIA 3LH9A 3QHZL 5AVWB 1UWXK 5TFSH 5BOZG 4U05A 4N9GA 5BW7A 2JB6B 1AZZC 2XXGA 3HS9A 3MXWH 3NJKA 4XR8C 5IBUG 3CRMA 3T0VA 3ZRSA 2QWRB 1KBWA 4QPKA 1QFWM 4JFFA 2C9UA 2V6HA 2Y24A 4WEEA 2HFGH 1U3HC 1WCBA 5EZLB 3RY6C 1NJ9B 2HJLA 3B4NA 1G4MA 4JKNA 4NO5B 2JMRA 5FM4A 3WLBB 1JPSH 5CBEB 2BSED 4LL9A 3LXCA 3EGXA 3PFUA 4XWOD 3GHBL 4FLQA 3VI3E 3CFMA 4JR9L 4NKOB 1OT4A 3KGUA 4M7LH 2DQGL 4P2QA 5J3HC 4BZYA 1SQBH 4D9RD 4JFUA 3K2IA 4MS8D 2CTPA 1DSYA 3RDTC 1WP8A 4ADGA 1E43A 3I2CH 3KXFD 4M1CD 2BPBA 4M5SA 4OFQA 4FA7B 1OP9A 1OV8A 5JXED 3TGUH 4WFFD 1BT8A 4DP5X 1W0VB 1UVQA 4NZ8A 4LLMB 4WFEE 4YO0B 5DEGB 4JYAB 1NH2D 2PWFA 3D08A 4O2EB 3IJ4A 1UA6L 2HXAA 3ULSA 1WBZB 3KL5A 3RVUD 1UD6A 1SN2A 4X8JB 3EHBC 1WIOA 5L7XH 2UXFA 2JS5A 3E22B 1HQ4A 3M46A 5EBMB 4FL4C 5AAMC 3MGOB 2CJUL 5D71H 3VG9B 5IB1A 3OAYK 4YSTA 2YUVA 3BJLA 4ZMXA 5I1LA 2E3CA 4APQA 5I71C 5BOJA 1WP7A 3CQQA 5D7KE 5J9PC 1MW1A 4WQOA 4YR6B 2YQ3A 3ZTEA 4DAGL 1HXMA 1GAFH 4NB5A 2DH2A 3P0YL 4AJ0A 3KG2A 3LDBC 4X8XA 1G7MB 2IU0A 1QI3A 1SF5A 2ZOKB 4ODUA 2GJ6D 4D9QD 1NGWB 1YEGH 2YQ2A 4GW1A 5A9GA 5CO1A 3JYCA 1A8ZA 5HDQL 3WEOA 3OLGA 2X4QB 4WFFE 3ZRXA 4NC1C 4YBLB 1S0VA 2FAUA 3RB7A 5DHDA 1G9NC 4G6AD 2P80D 5GS0C 2EO1A 4BH7A 1NDGB 5H37A 2CKNA 1AZVA 4QRSB 2R72A 2UX6A 3CJHB 5D1QE 4B60A 5LVEA 4F7MA 2CXKA 2CD0A 3HC4L 1IC4L 3HC2A 1FC1A 3BWUC 3VXMB 1CK0L 2JJSC 2CRZA 4WO0A 1OLLA 2VXQH 3TJTA 5DHXB 4K8ZA 3MROA 4POZD 2BY1A 4PHXA 3FN0L 4X8GA 5FX3A 2DQCL 2JKRM 5EO1A 5C0NC 4RDBA 3EYVA 5ICYA 2DYPB 2W1NA 3H2PA 3WJJC 2DQIL 4KMTL 2R8SL 1MJ8H 2QDWA 4O2AA 2RBLA 4LIQH 3DUSB 1VF5B 2O61B 2W91A 3KLLA 5DD6B 2IXQA 1UZ6F 3E9TA 2NY3C 3LKRA 5IJBC 5F96L 4MD5B 4X4ZA 1PG7H 4PY8J 2J57A 1FZKB 2VR7A 5GRZA 2GYSA 1I3RB 1QBLH 1MCWW 4NB7A 4CKQA 5IFHH 1FQ9C 1KLUB 3HC3H 2C7UB 3QRFM 2QZ5A 1ZEAH 3L3OA 3VD2A 2VR5A 2Y72A 4JN2A 3OTOB 1FPTH 2DJSA 1LP9F 1UM4H 2QQKH 5D70H 4NSKA 4UT6A 4FFZH 4GXVH 1MNGA 4DZ8B 4XO5A 3AABA 4ONHB 2EILC 1KYDA 5D1ZI 1CLYL 2RGSA 3MOBH 4JCLA 4LL1A 4PRHB 2LFEA 3EJJX 4YC2C 5EIIG 3HE7D 4HOXA 2VCOA 3QAQA 1TMQA 3SPGA 5CGMA 1SXZA 2FT6A 4AEFA 1HQRB 1UT2A 3BAAA 3FRPG 5H6RA 2R1WA 3IGLA 3TFKD 5I6KA 3JD4A 4WHDA 2K0RA 4IOFD 3QH3B 4KI1A 2DQTH 4Y5YA 5BZZA 1TTAA 4TTDD 1MWAH 5DUPH 5KYXA 3ZKSD 3PGCB 5DFWH 4QHMA 4GKNB 3CCHB 4HJGB 2KG7A 1F3JA 2DIJA 1ZT1A 3U1SH 4AM0B 5A43C 1B9KA 2UUBB 2G3MA 5ABDE 2G2NA 3TNNA 5JZ7D 3MACH 3WTUA 4N68A 4PJCB 3QH3A 1SMAA 1CICB 5I6OA 1N36B 3EYQD 3QEQE 4OCXL 4R8WH 3TLRA 1IXBA 2B16A 2WIMA 1PVHA 4DQOL 4C4KO 1UGKA 4CGTA 1N0JA 2FYUH 2RN9A 3PP4H 3QFJA 2R59A 4IRJA 5J2TA 4OF7A 3QG5A 2DQ0A 4H2CA 3UTQA 5CINH 3N1FC 1T20B 2O6PA 5A3ID 1PZBA 1G7QA 2J8UF 5E1AA 3SE8H 5DZOA 3BVXA 3TT1H 1MOEA 3C8KA 1T0NB 5CIPB 1KGWA 4NZTL 2B59A 4LNRA 4IMLA 5C0JA 4XB7A 4MLIA 2CK2A 4MXQC 4XPGH 3CMEV 3DXAA 1D6EB 5HHOD 3OGCA 1L7TL 3MBED 1AG6A 4ECNA 2X2IA 2G5UA 4JI4O 4WHCA 3WMPA 2IG2H 1GM7A 5BR8O 2DMKA 5JW3H 4JFXA 3P54A 4WJG3 1EAQA 3S0PA 1QNZH 1N3NB 2H3NB 2OKMA 4GT1A 1X6LA 2P42B 2LJ2A 3G6DH 5GZNC 1HN1A 3ILEA 4B9PA 5AZEH 1SQPH 4LBAA 3U9UB 2H0FA 3MJ9L 4D9LH 4P2OA 5HTSA 3QEGH 3WN5A 5GONA 1AAJA 5DD1H 4QJFB 3NFPB 4PLNC 4EFBA 2XTSA 1UXWB 2WP3T 1FYTD 3GXIA 2BSKA 2LAAA 3MFFA 3CD4A 1ZK9A 4DTGH 3S37L 2OTUA 5D2LA 4O4LB 4XVTL 1MQ8A 4NJAL 25C8H 1FPOA 1AZUA 2OTPA 2X4RA 3TURA 4JFHE 4NO3B 3KD4A 2ADPA 4B96A 2A74B 4FQQA 2XPGA 5DQJA 5IESH 2ZCKL 4PJDF 5SWSE 4L4VE 1TZGL 2R7EA 1VQLV 2GSGB 3BWSA 3MOAH 4CC1A 3AG1B 3EH1A 4B7LA 4GBXA 3MXWL 3F5TA 3MCG1 3RFRA 3L3HB 4O51B 2JCWA 5IY5B 3F04A 5D7LD 3SGJC 4NI6A 4O02A 2J2ZB 2ICWB 4UYQA 3IB4A 2WXGA 2HT4D 4J3SA 4XP1H 4MZ3A 4DUZB 4HUVA 2VUKA 2JQMA 2ICEB 2IEPA 3TTYA 2RMKB 2CHNA 2ISDA 4GKZA 1G5AA 3RVVC 4YFDB 2IC2A 4A2HA 4OBRA 4XPAH 3TO4B 1H3XA 1TNMA 2E9WA 5EWIL 4E9WA 1HH6A 1P84F 4FQXA 4E9LA 4K3EL 3VU2A 5JQIB 3D4YA 4KK9D 2PABA 3SDDB 5EF2A 3DX9A 1S9WB 1BSMA 3NFNB 4HK3J 1JGIA 3MRRB 4XOAA 1TQWA 1R3KC 1JCVA 4PIBA 3LKQB 2XTJE 5BS0E 2X89A 1SQQH 3QNYA 4PG9B 3ZZLA 2R29L 1S7XB 2EDDA 3CSYB 2EE3A 5EZYB 2NW2B 3T09A 4X42A 4PD4F 1FFRA 3AY2A 4L2YA 5DC4B 3SDDA 4ELMF 2J56A 5D72H 4DQAA 2LW3A 5TE7L 3OKDA 5J12B 1GYUA 2FEJA 1YJDH 3WFDL 4NCDA 3QZLA 4E41B 1CWVA 4WW2C 4MQ7B 5DSCB 5GSRA 4G80B 15C8H 2DQUL 3ARBA 4YEEA 3AS3A 1T03H 5G4NA 4EB6A 2NY4B 5KSBA 4KH2A 2HKOA 1H8LA 5CN3A 3HAEA 1AILA 5DHEA 1JGUH 3AG1C 5F21B 2O1AA 1HYRC 1L4IA 4PREB 5I73C 4HXAL 1ZVNA 3GMRB 5IEKB 1VSCA 5TE4H 1H6FA 2ILLA 4NO0D 3R8QA 1S77D 5I0ZA 3AU0A 2ERJB 5C7ZA 1LNUB 1FSKB 3IFPA 4UAOB 4FFTA 4HPHA 3CFEA 5MEQA 2P49B 1DL7H 4XCYB 4PI0A 5LAXA 3EO9H 4JO3L 4IHOB 1ADQL 5C0GB 3S5YA 1K4CA 1CGVA 3B7TA 2QVKA 4PJ8D 4P3DA 3REVB 5L9DH 3W9DB 1SDDA 3C87A 1CPUA 4YE0A 1CK0H 1PQZA 2ZNJA 2X6VA 4P4RA 4LESA 1J1PL 5BZWA 4H8WL 4PJCA 5GZOC 4R90H 1YYMH 3WY3A 5C8JB 1IE4A 4J3OD 3FN3A 3NK4A 1OGTB 1WZMA 4PV1C 3SKJH 4IRJB 3CZUB 1D5MB 3S3XA 2XN9E 3OLEA 5L4JA 1OARH 3WO4C 3P30L 4KO9A 1TTFA 1V55B 4JDVB 4LFCO 3STLC 2UXCO 1FZOB 1XBRA 3LDEA 1I82A 1X5HA 4R97C 2CIKB 4WWKD