1AR1B

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
molecule keywords CYTOCHROME C OXIDASE
total genus 70
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ar1B02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ar1B01
3FYIB 2DY2A 4YSQA 1WAEA 3MX0B 2QDWA 1OE3A 3FQ2A 3HB3B 3CVCA 2PPCA 4DP6X 4DP1X 3AY2A 4YSRA 4BWWA 1HFUA 2TSAA 2YAPA 2YAEA 5IY5B 1KDIA 2W8CA 4AI7A 5B7MA 1NWOA 5B1JC 2FQDA 3T6WA 1PZCA 1AIZA 4DP7X 3FS9A 2FNWA 2IWKA 3ZIYA 3WIAA 2Y69B 3H4HA 1A3ZA 3NJGA 1PCSA 1MZZA 3ABLB 4QLWA 2IDTA 5D4JA 1IBZA 3CG8A 2OCCB 3WG7B 3UABA 4BXVA 3T6ZA 2FQEA 2FQGA 2VM3A 2WO3B 3JT2A 1AOZA 1MDAA 4G7RB 3L45A 2XUWA 4KO7A 1IBYA 4E9VA 3QJRB 4HAKA 3OMNB 3QQXA 3EH3B 1OCZB 1WS8A 5B1AB 4KNTA 4E9SA 5TK2A 3EH4B 1PZBA 3GXUB 2IDFA 4NAJA 4CSZA 5F7BA 2QPDB 4W1TA 2RACA 2ZOOA 5FC9A 1ET5A 3G5WA 5I5IA 3NJKA 2HZHA 2BWDA 2CAKA 1AG0A 1BYPA 3ZX1A 3UGEA 3T71A 4GY4A 1SFHA 4M3HA 1ZV2A 4KO6A 3NSYA 1OCCB 2BP8B 5AKRA 3U25A 3CDZA 2JKWA 2W88A 1ZIAA 1L9TA 5PCYA 1BXUA 4EF3A 2DWSA 4G72B 1FA4A 1JZIA 5I6NA 1HAUA 3NJHA 1SHWA 4AKQA 1M9WA 1AZNA 1J5CA 2X88A 2JXMA 1KV7A 1RKRA 1PY0A 4GXFA 2GHZA 1HAWA 2BW4A 1JZHA 4E9TA 3BVDB 1IKOP 4GYBA 1CC3A 4E9YA 1RZQA 3D12B 4KO9A 2GC4C 1B3IA 3MBWB 1KBWA 2R7EA 1PNDA 2GIMA 4YL4A 5TK4A 5B7EA 4FAAB 3AG2B 1XB6A 2Q9OA 1AR1B 4HIPA 1JERA 2I7SA 2YAMA 1L9PA 2AFNA 2Q5BA 4A67A 5EHFA 1ASQA 3IEAA 4A66A 1GSKA 3NSCA 1AZUA 3X1EA 3T9WA 3UAAA 3UACA 5F7AA 3WKQA 2BZCA 4ZK8A 1TKWA 4A2HA 2VW7A 4KNSA 2CALA 1ETJA 4WTQA 1OF0A 1SDDA 2IH9A 2PCFA 1AANA 3AG4B 2Y1AA 4F2EA 4NB7A 1W6LA 2WSDA 2FJSA 3CDZB 4G70B 5I5JA 1TEGA 2XXFA 1XB8A 3UAEA 2FWLB 1E5YA 2XXGA 5B1BB 1V10A 3IN2A 4UANA 2CUAA 2CJ3A 4YSAA 1J9RA 4YSEA 4F7KA 7PCYA 2GC7C 1MG3C 2YAOA 4K9JA 3C75A 3FPXA 2HXAA 2P80D 3ABGA 4MFHA 3KW7A 3FU8A 4HHGA 1ASOA 2PPFA 5LDUA 2BWIA 1WA1X 3NJMA 2GB2A 2I7OA 5I6LA 2NRDA 1WS7A 2BP0B 3PCYA 2ZONA 3NJFA 1NTDA 3GYRA 2BW5A 1E65A 3QJQB 2I85A 1E30A 4YSPA 4P5SA 4Q8BA 1ZIBA 4FA7B 6PCYA 1L9OA 4UAHA 1JXFA 3NT0A 3CVBA 4RH4A 1BEXA 4WKXA 2J56A 1MZYA 3NP4A 1E5ZA 5A7EA 1CURA 2YAFA 2AZUA 3OQRA 1NDTA 3WNIA 1TEFA 3IBOA 3ABKB 4A2FA 3PXLA 4AKOA 1AZRA 3SBQA 3EHBB 2UXFA 2FTAA 2QPEB 5I5MA 4QKTA 3S8GB 2IDQA 1BQKA 4KOCA 2UXVA 3BQVA 4BXSV 1MG2C 2IWEA 3T6VA 4DPCX 4N4YB 5I6OA 1CUOA 1SJMA 2PP9A 2TSBA 5D4IA 2HX8A 3V9CA 1QLEB 1R1CA 1V55B 1I53A 1NPJA 2N0MA 1UATA 2HLEB 4JHUA 4YSDA 1QNIA 4W9ZA 5I6KA 2PCYA 1W8EA 1M56B 3ZDWA 4TXVB 1FWXA 3SBPA 1OCOB 3TA4D 3QJSB 4DP8X 2OJ1A 1NIBA 2A3TA 2BP0A 4A2EA 5AFAA 3AW5A 4Q89A 5B1JA 2YEVB 1J9QA 1PLAA 1GW0A 4M4RB 3EF4A 1BQRA 1PF3A 3H4FA 2VMJA 3FSAA 3WI9A 3NP3A 3FU9A 2FT7A 2IH8A 1PZAA 1RCYA 2EIJB 2VN3A 2GBAA 5PAZA 1JOIA 2EIMB 3SQRA 1NIAA 2YXWA 5I6MA 3PLYA 2GSMB 1X9RA 3SBRA 4AKPA 1KBVA 1VLXA 2X87A 2PPDA 2H47C 4JHVA 1AACA 1PLBA 7PAZA 5AZUA 3WKPA 4YSUA 3AG1B 4P5RA 4UF7C 2XYBA 4G7QB 2VSMB 4BDVB 2LLNA 1JZFA 1JXGA 3FU7A 3PAUA 2AVFA 1AG6A 2R7EB 1ILUA 1TU2A 4AX3A 1SF3A 4DP9X 1WA0X 1JVLA 2DYSB 1ILSA 2XV0A 4DPBX 1GS7A 2H3XC 3NJIA 1J9TA 3NYKA 2XLLA 1JXDA 3X1NA 5I6PA 1WA2X 1ADWA 4YSTA 8PAZA 3AZUA 4X4KA 1NIFA 2YARA 1ZDSA 3DTUB 3PPSA 4HALA 2PPAA 4YSSA 1KCBA 1OE2A 2HX9A 1NINA 2OV0A 4DP4X 2FT8A 4HHWA 2DWTA 2IDSA 3NJJA 1NICA 3OMAB 4NERA 2MTAA 1XB3A 2GI0A 4HZ1A 5E9NA 4DP5X 2P80A 3KW8A 4HCFA 4HCGA 2XU9A 3FQ1A 3N55A 2FQFA 3X1GA 1L9QA 1J9SA 1URIA 1IC0A 1AS7A 1QHQA 3HEIB 2DYRB 1M57B 3N2JA 1N68A 3TBCA 4KNUA 3QJUB 4YVUA 2UXGA 4A2DA 3X1FA 3S3BB 1NPNA 1L9RA 1ZDQA 1X9UA 2EINB 2BHFA 4HCIA 2UXTA 4E9WA 2J55A 2DV6A 2E86A 2FT6A 2HX7A 2QDVA 3S3CB 2YQBA 3CZUB 4A2GA 1JZGA 9PCYA 1GS6X 4BWTA 2ZWNA 4KO5A 3OD3A 1A65A 1DZ0A 1AS6A 4AZUA 1SF5A 2AANA 1AQ8A 2J5WA 6PAZA 1PMYA 3IE9A 2CBPA 3AG3B 4F2FA 1A4BA 3TBBA 1JZEA 1SNRA 2YAQA 2MRYA 5B3SB 3FYEB 3ABMB 2HRHA 1AAJA 5B1KA 5I26A 1KCWA 4L0PB 4N8UA 2VM4A 1GR7A 3FT0A 3FSZA 3UADA 4BWUA 2J57A 1PAZA 3X1BA 2IWFA 3V9EA 1NZRA 1SDDB 1J5DA 2XVBA 5B7FA 1OCRB 2XV2A 1F56A 2UX6A 1JVOA 1GY2A 4YVNA 3TU6A 2ZXWB 2QT6A 4GP5B 3OM3B 1EHKB 2BP8A 4GP8B 3QPKA 1T5KA 3FPYA 1SHXA 3FSVA 3FU7B 3QJTB 4G7SB 1BAWA 4DPAX 4E9QA 1OE1A 1CYXA 4PAZA 2HRGA 1BYOA 1BQ5A 4E9RA 3T6XA 4PCYA 3OMIB 2EILB 2XWZA 1EZLA 3H56A 2YXVA 1E67A 3RYMA 3IN0A 2B08A 2H5UA 1KYAA 3ZBMA 1NIDA 1ASPA 3TASA 1ET7A 3DIVA 1NIEA 4BDVA 4YSCA 2XV3A 2AZAA 1ET8A 2VW4A 3S3DB 1FFTB 1PNCA 3EH5B 3ASOB 3NSFA 3GDCA 1YLBB 1NWPA 2PP7A 1N70A 3DKHA 2JFCA 2UX7A 3ERXA 5D4HA 3ASNB 2PPEA 3PAZA 3FQYA 1BXVA 2IAAC 3NJNA 1OV8A 1A4CA 1GY1A 2IDUA 1JZJA 3PAVA 4BK5C 1AZBA 3NJLA 1KGYE 1A4AA 4G71B 2VSKB 3X2QB 4KOBA 4A68A 4YSOA 1BXAA 1DYZA 4JKNA 2EIKB 2XX1A 3NSDA 3WNJA 1L9SA 1OOWA 1ZPUA 2BZ7A 3CVDA 2VW6A 4GP4B 4CSPA 2PP8A 2BO0A 1AZCA 4DP0X 1A8ZA 2YAHA 2CCWA 4E9XA 1GYCA 1V54B 3FSWA 5I28A 3QJVB 1XMEB 1RZPA 5ANHA 1SFDA 3S8FB 4DP2X 1PLCA 4ENZA 2PLTA 1CYWA 1AS8A 2XX0A 1ID2A 1GS8A 3JTBA 1KDJA 2B3IA 2WO2B 1W6WA 1IUZA
chains in the Genus database with same CATH superfamily
2BS71 1CTMA 2BVPA 1WTLA 3GBDA 3P0VL 1HH9B 3G5ZA 2ENQA 4JZ2A 1P9MA 2PPCA 4X4XA 4AEEA 3GMRB 2FD6H 2X0VA 3DV6A 4YHHO 1H15A 2YLKA 4B5ZA 1HFUA 1XWVA 4UDUA 4NQSA 3MCLH 4PG2A 2PXYA 3MUZ1 4G8EA 4C56E 4F15C 2WNXA 4ISVB 5TQ0H 3B9KD 1YHQV 5A7BA 5IUSA 1TQCB 4OVVA 3HFML 2NR6A 2HTKD 3TXQA 1WVZA 2LTQC 1F6LL 4YHOL 1T1ZB 1BVZA 3Q5OA 4G8FA 4MTOA 1A6AB 4IM8A 4OCXL 3OKMB 4XBMA 2SEBA 1PCSA 1QTSA 2OR8A 2WXNA 2L7QA 2IDTA 5C08E 5BRZB 1EJOL 4YNYA 1OTUD 2MNJB 1IBBA 3CG8A 1AQKH 3DBSA 3LHAA 1AOHA 1AP2B 4W4LA 3N50A 4KK8C 4I4TA 1J0YA 1QWHA 3QDHA 4W68A 3CHSA 4GT7A 2ATAA 3GD1C 3VWKA 4XMTA 1W80A 1S7RB 5DD0L 2QTEA 2OSWA 1OAKL 5FYLL 5JW4N 3GSQA 3MRMA 4LFBB 3O41B 2J1KA 4YHZH 1IGCL 1A6AA 4I7ZC 1DSFH 5I16A 1NCCL 1FLTX 2Y69C 3QIWB 2DPKA 4P49A 3VO0A 4B9IA 1JG9A 1RK7A 2CWRA 3CX2A 3K06A 3I6LE 1I5XA 5ERWB 1FUNA 5IJKC 5K9KB 3QG5A 2C7UB 4U1NB 3PGDB 2AK4E 3OTOB 3ZJAA 4O02B 4Z7VF 5T3XD 5DD1H 3S5ZA 5IHBA 3GSQB 3MRMB 3FQXB 4PGCA 3T0EC 2IPTL 2HZHA 2QSAA 4X9QA 3BT2L 4MB4A 4WFGA 4PCSA 4ZFZA 3WELA 2F1BA 2WLMA 1HEZB 1I9IL 3QIWA 3EFFB 6FABL 4L3AA 4EZJA 4NQED 5H35B 4CU7A 2O61A 2ZDIC 4KHPO 1CL7L 2CHZA 4UDTA 4JY5L 2GSIB 3FB6C 1OCCB 5J57B 2W88A 2RDCA 4RWHA 1RUAL 4OCYL 1ZIAA 5EZIH 3CC4V 3ULUC 4G72B 2ZT9C 1I1RA 2ENPA 4G8GE 3TEUA 1RVFL 1KPVB 2DLFH 3OVUB 4HWBH 4ONOA 5CFHA 1HAUA 3NRQA 1DVUA 3MRIB 4L9LB 4PW9A 1D5XA 2NNRA 4UT6A 3WFZA 4BFBD 4CBPA 2X7LA 1H5BB 5AKTA 1K8AW 1CJYA 2Y7SA 4KK9C 4TWKA 2VXSH 3GUFA 1QFOA 4DEPB 1SQFA 4FA8A 1FCGA 5KAQG 2F54A 5LA6B 1YPZF 1M05A 3OKNA 4NC1C 1JYXA 4MMZB 4S1RH 1OSZB 2VDRL 4GKJB 4UQ2B 4XOEA 5EC2A 4WWPA 2Z92B 3ZHDA 1WISA 4X0NA 5DRWA 2D2CC 4NUPA 4YL4A 2A0LC 4FAAB 5TDPB 4LO9A 3V6OE 3KWWB 4YJ2B 3QUXD 5C0BE 4MXQC 1LO2H 4Y5VC 3FU5A 3WB0A 2VLRE 3SGEI 1D9KB 1U8QB 2Z65C 3IJSA 1T83C 3ILPB 2NLJC 3Q1SL 3B3BA 1AXTL 2XFGB 2Z92A 4XXCA 3E8UL 4PA3A 4K2UL 5AKVA 3HZ3A 3AWFA 3IFNL 5EF0A 2A9DA 3L4ZA 4LP4A 1RU9H 4CW1A 1JZ6A 4Y1SA 4O58H 1E4XH 3BUPA 3QEQB 1Z32X 4MQ7B 4MMZC 3QCUL 5AOIA 2ZUSA 1ROCA 1Q94B 4MJIB 2IH9A 3MV8E 4MKMA 5D7LD 3J07A 4WNJA 5KYUA 2HFEB 4QHKJ 1FFPB 3IU3A 4B5EA 5E94B 4PRID 4JPRA 1TEGA 1XB8A 4NJ9H 3PJNA 2A4EA 3QHZL 3QI9A 5GS2H 1KTRL 3ZSTA 5T1KD 3G6BA 3GMPB 3IFLL 4P04A 2WZ5A 5CIPA 3UYRH 3ARQA 2NTFB 5E2TL 4ZQKB 5K1VA 4DVBA 1JCKA 4KV5E 2VH5L 4G7VL 2NY1B 4V11A 5LOVA 2KG7A 2OL3B 4YIOA 1WE5A 3H1IH 1NOFA 3TJTA 3OX8B 4E0RA 3G67A 3ZBHA 3E9TA 2YPLD 2XICA 3NJMA 2NRDA 5FYLD 5GSVA 2ENJA 1RJZA 1SM3H 4YZFE 4HIXL 3NACL 2P5EA 2K0RA 1D7FA 4HD5A 3QJQB 4MA8H 4NS0A 4FA7B 1BDYA 5C6TH 3VXSB 2G0LA 4DW2L 3QWQB 4X6CB 4X1YB 1ZHBA 5T3XL 4MBRA 1J87A 3BEVB 3IFOA 3ZTCC 2AHIA 4KXRA 5C2BH 3B4NA 3AACA 5E8OB 1LQSR 2N56A 3GZPA 4PUBL 4QOKA 3MLXL 3M86A 4DR1O 1CURA 3APNA 2YD8A 2C9PA 3QDGA 3VU1A 3LB6C 3OR6C 2E56A 4LASL 4WTWA 3WUWG 3N2KA 1XGTA 3A6OA 3RB7A 4JHWL 3MGOA 4D7SA 3QUYC 3BKCH 1ZVNA 4PV1C 2XPZA 4KNQA 1NQTA 1CIDA 1INQB 2GBTA 3BN3B 4P2OC 3CLEH 4JQVC 2C7UA 2IWEA 3SPHA 5D2NE 3C12A 2YOAA 4RGOH 3A4DA 4MVBD 3ZO0A 1MRFH 1G1XB 1QSEE 1GPOH 4IQHA 3BQUB 1TQUA 4D0BA 5LGYA 1JFFB 1T89A 4M1GL 1SOQA 3RWRD 2YUWA 4EOWH 3ZDYF 1S6NA 5J13B 3MRQB 1BEYL 1ITCA 3CRAA 1P1ZA 3B9KA 3ZZSA 5I6KA 3HNTL 3M7FB 3DV4B 2QR0A 3S5YA 2K78A 3AWEA 3VXRE 1P84F 2WBKA 4K71C 5DUBA 2BVEA 1QTPA 3FAWA 1D5IH 1KF9B 3X3GH 1N0XL 2BWQA 3CQQA 1XGQB 2DQHH 1Z9LA 5L9DH 4MZ2A 4ZTPL 2BP0A 4I87A 1KB9F 3ILQD 1O9HA 3BCDA 4F80A 2EYRA 1FL6B 3QRGH 3FCSA 1J9QA 4K8RC 1WBXA 3MU3A 4BCXA 1BS3A 2BS9A 2QR0B 1Q6UA 4APQD 4OIAA 4UTBH 5SWQB 1V3LA 4JRXB 1I1YA 1CVRA 3UP1A 2FECL 3BGFB 1NZ6A 4AUUA 3MLXH 5LWYH 3MYJB 2P7TC 1E27A 2V33A 1FYTD 3CN1A 3CPLB 5AW2B 3VXMD 4JFEA 2HKHL 4N8CL 1HWWA 4O2EB 3H42H 2CIIA 2VS0A 2ADYA 2JJSC 2AEQH 1IKFH 2QSCL 3MDJA 5LMNB 3X13A 2AEOA 4JFDE 1I9RL 2J8OA 3LKNA 2FJGB 1PDKA 1N12A 3TBTA 1IJ9A 2XQYA 1JD9A 4CAGA 2BOCB 2NY3D 4NBXB 5CLXA 1RJYA 4JN2A 1GC1L 2I9TA 2CR0A 5B4MD 1Q38A 3HG1E 4LDOB 5IB4A 3WIFB 1BG1A 3UDWC 2XC8A 3SDDD 4HK0B 5KVEH 5GIRB 5F21B 5TD4A 1AG6A 4HLZH 2FCBA 1I1AB 4LCCB 2WKOA 2YOCA 1EAOA 1T04B 2MHAB 1GKOA 1F8TL 2AXHA 2F6AA 2Z93B 1R5VA 5D96C 3C08L 5IW1B 2OJZL 4TULH 4HGMA 4G43B 5GGRA 2KMWA 4MW8A 3ARPA 3SE4C 1P5UA 4MZ3A 1B4JH 3D9AL 5F7EH 3TJPA 4QRPD 2JKLA 3BVOA 3TO2A 3WEOA 3VFWB 5D5QA 3KLAA 1LWRA 5DZJA 4EPSA 4F7CA 1YYML 2C9QA 1CF8L 4KJQC 4N2AA 5EEUA 3DETC 4WUUD 2HX9A 5ILTH 2WLYA 3JBG7 4AGPA 4AQ8A 3U0PA 1WA8B 5BVPH 4JZNA 4QAWA 2A0LD 1QOKA 4PJXA 2VXQA 4IMLA 3C60D 2DTMH 3WAJA 4JANB 1I8IB 4LVEA 4MAUL 1JV2A 2XV6B 3EDFA 5FCUL 2AXJA 3VXUE 4LLVB 5I1GL 1MFDH 4PJEF 2VTFA 4A6YB 4ZO6A 5E00B 3SGEH 2OSYA 4BSWB 4GW1B 4PRDB 2NX5D 3VCLB 4JZJB 2L7EA 4G1MB 1BPVA 1JRHI 1PX8A 1TSHA 1WA8A 4P2ZA 2UXGA 1KTDB 2KDYA 5D7SH 3VRIA 1S9VB 2DYRC 3M6DA 2APXA 5GHWL 1TIUA 3DJSA 1F11B 2J55A 4PJAB 1NAKL 2UZYA 3IMRA 1G7QB 2QDVA 4GG8A 4QGPA 1AQDA 4JPSA 2N05A 3T0XA 5CFAA 5ISZB 1FIGL 4G6AD 4G1MA 4H13B 5IW6B 3PNRB 1W0KG 4N8PA 3RWFB 1NT2B 3MRLB 3HKEA 3D09A 4NKQB 3JARB 1RZJH 1USZA 2PO6D 4ODUB 4P46C 3S35L 2GSGA 3ARZA 2Z5UA 3AG3B 3HS0B 4N68A 1NCTA 3QNYA 1OP5K 4JEGB 3ZS8C 4WUUB 4JB9L 4F7TA 3LXCA 1MJ8L 5B1KA 4OCRL 4FQ1L 1HHGB 4OF3A 4EDWL 4X7EC 2CXKA 1LMIA 2GIYA 5GGVH 4KZ0A 4QRPE 5JIMA 3ZEDA 2YIHA 5HI5D 4ADIA 4YHHB 2DW4A 1WP6A 2DWDC 3IGAC 2XJLA 2VR3A 4HXBL 4JY5H 4M9OA 4I0KA 5FF6B 4R2GB 4GRMA 4WGKA 5GGSY 5GRWA 3V9EA 2GSGB 2B0SL 3FQWA 4UUJC 4JGUA 5C08D 4RFNC 1GY2A 1FLRL 2XXCB 5E8NA 3M7OA 3CBKB 2VXVL 2QT6A 4KZEH 4JI7B 2EIKC 4FC3E 1EHKB 2JK5B 2WKLA 3DDFA 2LQRA 3H9HA 3D36C 2WBJD 4IYKA 2JELH 3UG4A 1JZ3A 3PWVB 2FSEB 4Z7VA 5F9DC 5J89A 1BZOA 5B1CA 2DH3A 1H38A 1WWCA 3DMMB 3ARDA 4Z0XA 1F3JA 4PAZA 3AG4C 5E8EB 1HXYB 3IC7A 2VR9A 3PDOB 3O0RH 4WCYH 1ZSDB 3FTZA 3ULVC 3G04B 3ABUA 4JN1H 2VR6A 3MCKA 2FH6A 4KKBC 1QQDA 2PO6B 4I3RL 4QTIH 4TNVF 5DC4B 5AB1A 1QMUA 4JM2C 4DUVA 1XNRB 25C8H 4HG4J 1X59A 4BAYA 1NFDB 3PU7A 1KV3A 2EZ0D 2ZPKH 5LHDA 3L2LA 3PABB 1CYGA 1U6AL 3BEWA 4GRWE 4O4IA 4DFIA 4U6TA 5GS2D 2JFCA 2LVCA 3BIAX 1PDKB 4HS8H 5BOPA 4UM9B 4G5ZH 3O45A 5HP5A 4MVOA 1OV8A 1GY1A 5DSCA 2FX8H 3UTSD 5IGXH 1WN7A 2I9TB 1ZVSA 5EO9A 4FFTA 1JPSL 1DQVA 1YJDC 4DRXB 1Z3GH 3NCYS 1B4TA 4L5FL 4LKXA 2XVGA 5C0IB 3WEXB 1NGYB 1W16A 3BPNC 2WA3A 4TQFA 3OJDA 1S7VA 4ZW8A 3VGGA 4JFVA 4R96B 1SEQH 4UT9H 1U42A 3TZVC 1A8ZA 5BJTB 4OUUA 3Q8BA 2E75C 4DV2B 2H6UA 5MI0B 4Y2DB 1IU1A 3O4LB 3WXVH 5AW0B 3Q8CA 3BCFA 3KG5A 3NQIA 3OT7A 1KDJA 1VF5B 3ZJZA 2MOGA 3I9PA 4PW3A 3FB5A 4ZOCA 1KCKA 3CHQA 3ES6A 1FGVH 3JWOC 5EB9A 4NENA 2YGPA 3HKCA 1NEZA 3SKJH 3ABLC 4LCYB 5EIIA 1QFWH 2NY0B 3F04A 3VI3A 1F4YL 1YY9D 4XE5B 4Q0XH 4M43L 1I1AC 4A6YL 3S3XA 4FG2A 4AYFA 2B39A 5BMFL 5C0EB 1NOAA 3KCYA 1C5CH 1TVBB 1WIPA 3RY5A 1FAIL 2FJHA 5AVXB 3MLSH 3VVVA 3C5ZD 3DVNB 4V1DE 3TO4D 2C2AA 2C3XA 2O4EA 4UCSA 2PWFA 5H37A 3UFIA 4BIUA 5A3IC 1LGVA 1XNQB 1VRSA 4Y2DC 1HZHL 1T0OA 3O3DB 1WF5A 4W9GC 3SQBA 4Y16C 1HL8A 5E08H 3H4HA 1Q4NX 1MAKA 3AS3A 2CIKA 5KSBF 4I1NB 4QLWA 4RQQB 3B34A 4FE9A 5D1ZA 3UP6A 2GCYA 3DVNA 2GPZA 4L1DA 2HCZX 1ID5I 3ZRXA 1QI4A 4KH9A 1D5BA 5DA4A 5EZJA 5A6IA 2QADC 3DSNB 4ZMWA 5H2BA 2GEQA 2K9PA 1K4DB 2JXMB 5HHQA 1JOYA 4NZDA 5CJ5A 5IWLC 1A6WL 3HHSB 4HS3B 1OCZB 4KKNA 3K4AA 4JF3A 1FPTH 4F3FA 4HIHA 2Y72A 4E42B 3NCJL 5HGDA 1UGKA 3K4DA 1EMTL 3QTCA 1DTOA 1RZ8B 4L8BB 5LHGA 1A2YB 2HJFB 2DMBA 2H1PH 1H2MA 2WIIA 5I5IA 2DQEL 3SBWC 1XD0A 1U3NA 1KJ3H 1KJ2A 1AG0A 1F5WA 3OXRB 5GSRA 2HLFD 4TSCH 3KGSA 3O6FA 2WN2A 4TLSA 4QRQA 2WVVB 4DKTA 4CJ0A 4M7JL 1KBKA 1YZZA 1J8HD 3IM1A 5BRZA 2QDOA 4LF7B 1YN7A 3L4VA 1FH2A 1MNUL 3QE5A 4XODA 5F7MC 2KPNA 4ONGH 1IILE 5DU7A 1HHHB 2CRIA 2HFFB 4PSPA 5F9AC 1H8OA 4Z7IA 1JHTA 4PRPA 5TF1L 1BBJA 4PWIA 2WLZA 4C56A 2QFRA 4OD2B 4W93A 3K5NA 5CZVL 1CLVA 2V5SA 3W2DL 4AKQA 5LCVA 4QTFA 4I7ZB 5I16B 1XREA 5C0ND 2ED7A 2ETNA 2XN9B 3BPNB 4DOHB 2ADJB 3ESMA 2XWRA 3IF1B 3QA3B 4NN5C 2LT9A 2D7QA 5JHDA 5I82A 4HYOA 5D7IF 4RFNB 1DQJA 3PWJB 1JGLH 1ZT1B 1DBKL 2DM7A 3SDDA 3LZNA 4FFYH 2GC4C 4TLKA 3P69A 5A2KH 2FX7L 4JG1H 4BWAA 4LHUA 4EJ1C 2YC1A 3HJEA 5DHYB 2WC7A 4MQ7A 5AUMB 5E23A 4DZBB 3EYFA 1TJHH 4X8CA 1XB6A 1J1PH 5L3EA 2XN9A 3HC4H 2J20A 3RFZC 1T6VN 2A77L 2H41A 2Z1PA 3BUBA 2AFNA 2UXBO 3DVIA 1F90L 2NPLX 1KIRA 5E2VH 4QXGH 5E5MA 5GJTL 3WFCH 4Q4EA 5CJ8A 3T9WA 1SERA 2O6EA 1M9SA 2PO6C 3PP3H 5K9QI 4P2QE 1IV8A 1D6VL 2DKSA 1G5AA 5ES4B 5IQ7L 3QQ3A 1H9VA 1NR7A 3RL2A 2O6CA 3H2PA 4MX7A 4UCUA 1G1YA 5ANME 2CO4A 3Q5TA 3VFVA 2AI0L 3B5TA 3ZKQD 4KTDH 5E6UB 2X7LB 5MEQA 3V0HA 3AG4B 2B4CH 4YXWG 2KLRA 1PX4A 3CDCA 1AMYA 2X4SB 4DN4L 1QWNA 3MA9H 1J8HE 3CDZB 4E5XB 4RDQF 2ZKHH 5SWSD 5C3IA 2P8LB 2G9HB 5I19L 3AT9A 3ARFD 5AZ2H 1IEBB 1V10A 2XIIA 4YSAA 4X1KA 4B60A 1DVZA 4FFYL 2WTRB 5C0JA 4JR9H 4JMNA 4LCYA 4U1IB 5EIIB 2VMEA 5ENWB 5FNVB 1YN6A 3G4SV 3ABGA 1WC7B 5DJ8B 3GF8A 4XPTL 5D72L 3WLWC 3SSGA 3HNSL 4CN6A 1MWAL 4KKAD 1NKDA 1BOYA 1SDYA 2X2UA 1NTDA 2QKIA 3FTYA 3D52A 3L9EA 4GAYA 1Y76A 2P6JA 4U2YA 1J5EB 1XZWA 3VGAB 5LGUA 4NJAH 1BLNB 2IV8A 3V0DA 1JXFA 1DLHA 4OQTL 5E6IB 3FHAA 1RPQA 2ZUUA 4MA7L 2B4CC 1F6AB 1YQ2A 4G5AA 1OP4A 1LP9E 1J8HA 1ND0A 5DUPH 3UTTE 5I18L 2HFEC 5HI4D 4LEXH 4RFOH 5FYJL 1W0YT 3F58L 2VAJA 5BO1L 4ETQB 3EJZD 1TETH 2BX5A 3E6HB 5F0MB 1AI5A 1VACA 5H2BB 3S5LG 2H32B 4A2FA 1HE7A 2BPBA 2VJ8A 1YDPA 1AHWA 4XCEB 3SJVA 4J1UA 2LAAA 3N2GB 1MI5A 3B9KC 4PJ8A 1GOGA 5E56A 1INDL 3GMNA 3GXIA 5CLWA 1EZJA 3GMOB 1QA9A 3ZHUA 4X9GA 1CS6A 4F7MA 2C5DC 3UJJL 4QJ5B 2ADPA 1LEGB 5EUOA 1MCFA 4J8RA 4D9QE 1I9JH 4QT5A 4PDVA 1WBXB 1QLEB 1SESA 4OGXL 4KTEH 5IBUB 3WFDL 5CEZL 3MJ8B 4JYYA 1V55B 2GJ6D 2N0MA 1RZ7H 5TDPA 2XKUA 3RWHB 3VGBA 3TEWA 5EZPA 2CZNA 1QNIA 2GSIA 4OT1H 1TQTA 2J8UB 1MFCL 1QNZL 1EV2E 1V9PA 2BSSA 3P4MA 3H53A 3RGVD 5CS7A 5AAWA 3IWUA 4JO4H 4XRCB 1KCSH 3TO4C 4D0DB 1OCOB 2ALWA 3ZZQA 2NLJA 4PRIB 2VXUH 4D9RE 2VLJA 4TNGA 3MJ9L 1M90W 4R5TA 3AY4C 4LFAO 3BP5A 2DEWX 3RTLA 5CD5D 1BX2B 2B20A 3FSAA 2RNBA 4DH2A 5LA6A 1TJXA 3WI9A 3ARGA 3EGSB 4DQAA 5KVDL 2QVTA 2V5MA 4NUJB 1PZAA 3QB7C 4KDVA 1HHJA 4PD4J 5DYOB 1WZ1L 4WFHE 3AQYA 1UD4A 4KRNA 2EIMB 3O2WH 4J6RH 2GHYA 5DHYA 4OZIB 4Y2NA 3O3EA 5IWAB 5FK9B 1H3XA 5EK0A 3JAWA 2Q0ZX 2WOYA 3LIZL 3LZQA 3TZVA 3WKPA 4TOIA 1IQWH 2NSXA 4LWSA 2CLZA 2HLAB 2JJVA 2X6VA 4ABWA 2ZINA 5GZNC 5DF0A 1JXGA 4AQAA 2FJUB 3LRKA 3TNNB 1DLFL 1TU2A 1NTMH 2ZE5A 3PREA 5C86A 4RESB 1A7NH 4TUKL 1I8IA 1I5YA 2XACC 3DPBB 3PJLA 4UOW1 2IPUK 2C1OB 2Y0IA 4LWSB 3SYOA 3Q4HA 1ZHBB 5DFTA 3UIZA 1F0LA 3I3DA 1WFUA 1E42A 3DUUB 1ZAGA 4Z7AA 3WU1A 2YXYA 2WAHA 1MREL 4KPHL 5DHMC 5ITFB 1RV6X 3PPSA 2N04A 1MWAB 3MHSC 1I1FA 1LDPH 1NL0L 4HHWA 1Y74B 4JFFE 2PNDA 4LSSL 4N8VA 2E7BA 1WAAF 4XMPL 2CLVA 4LOFA 4BUGA 3KPRD 1MN4A 5DUJA 1MJUH 4R4BB 3OC8A 3QUYB 4I2XE 3EFOB 3ABTA 4OCLC 4DV2O 1UA6L 5F7FA 1AIFB 5DMIH 2ZWZA 5LDSA 1AHKA 3TYFA 3AK2A 1AO7A 1IFGA 3QJUB 4J3SA 5I2IB 2YEZB 4A2DA 1DJXA 3PWPB 3K8KA 1UYWL 4JG9A 5GS3A 4LEXL 1MH5B 1F3DH 5IROC 2R1YB 4PLNC 2KI6A 4K35A 1S72V 1YTFB 3NCJH 1YEEL 3MRCB 2Q10A 2P1YA 2VDQH 4D9LL 3VJ6A 4F8TA 1JPFA 3CS5A 3L1OL 4GS7B 5K9OB 4PG2C 3N2KB 1XGTB 4XMKL 5JQ6L 3PYCA 3WS3A 4KJWD 1GHFH 1CFTB 4ZUTA 3KCXA 3KD4A 3JCZA 1LK3L 2VIRA 2IW5A 1DQIA 5IDJA 2CBPA 3ZDXE 4R0LA 4N8VG 3L4YA 2C3VA 1Y18B 1QSED 5AZEL 3ZT6A 1NCDH 4WTZA 4ZFQA 4HUVA 2HRPL 3ZMRA 5HJDA 4L0PB 2ARHA 5DEFB 3EBAA 2EZPA 4FX5A 1E2ZA 4AH2B 3RWHA 3FT0A 3E83A 1YEJH 3IJ7A 5D1ZD 4GKNB 1NZRA 2A74C 4ZS7L 2CIIB 1JUFA 2X12A 3DV4A 1BOGB 3NAAH 3BW9A 2AV1B 1KULA 2V9QA 3HE7A 1WIOA 2A83A 2ZXWB 5CBHA 3ARWA 3PHAA 4GP8B 3UEQA 3VH8B 3TESA 3BZ4B 4N2EA 2V5YA 2YD4A 3BA8A 1MF2H 3FPYA 2WQUA 2VLKE 3NFSL 2AAVA 1MNGA 1EFXD 4B3MB 2X4TB 4RNRB 2R56L 4FXKA 3ZHFA 5AB2A 3J80N 3BUYB 1LO3H 1JNLL 4HIIB 4LNRB 5IHUL 1YJDL 1T5WA 2YXVA 1CFSA 1KFAH 2Z0AA 3MA7A 2VLKA 4GMSL 2R1XB 2GW5A 3ZBMA 4O4HA 4P99A 4O2EA 3QFJB 4H8WC 1X7SA 3QIBA 4AGLA 3MNVB 5JPMA 1H3TA 4CW1B 2PXYC 1NBYA 1MCWW 2VW4A 1I85A 4U1JA 3ALWA 1AP6A 2UY6B 4AM0A 1PNCA 4X65B 4TUOB 1NFIB 3MLZH 3Q3GA 4PG9B 1XF4A 4LOVA 2ADQB 5BJTA 3KYOA 2NY4B 3FQYA 4GXUN 4M8QB 3DDGA 3SKMA 5CN1A 1ZHNA 3NIGF 3UJTH 1MUJA 2PW2B 2DN9A 4DEWA 3C2SA 5JPMB 3T04D 2GVYA 1LK3H 2ZUWA 4IEFA 4YO0A 4CMMB 4K8ZA 1BXAA 1NEZB 5ETUB 1KY6A 3K5OA 4BFFA 5GS0D 1WRFA 1OOWA 2EVIA 3NA4A 4QI3A 3RPKA 2DQGH 3CZJA 4CSPA 5C70A 1RURH 5IQ9B 3GJFH 4L5FE 1UQSA 1OGAD 4ANWA 3QZPA 3ABZA 4NFCA 1O7DE 1OQOA 3LNHA 5IB3A 5I8OH 3NZ8A 4PJDA 2CGNA 3S8FB 1S9KC 4BFKA 1JE6A 2EUWA 2AK4A 3V0VA 4BJLA 3BOVA 1OAYL 3OR6B 4OAWB 2JCCF 2R4RH 2FO8A 5KSUB 5KVFH 3MX0B 5BZDB 1IDSA 4MRCA 4B53A 3WBDA 2EIZB 4APQC 4IBVA 1OF2B 3QDAA 1F1DA 2A38A 5DURB 3WHXA 5TQ2H 3VFSA 4B50A 5ABDE 5AB0A 3CSGA 3HS0C 3GSNH 3RUGE 2NOYA 2X89D 3D85B 4FQHB 4QR7A 4W70A 3MUHL 4YSRA 1DO6A 3CJHA 2YUZA 3UC2A 1GZHA 1NR1A 1UZ8B 3CC5B 5FA4B 5IY5B 5HHNA 2OXGA 1EJ8A 1KN4L 4G8GA 3TGXA 1IC7L 5IMLA 3MNDA 1KT2B 1VIWA 3HC0B 1J0HA 3KKYA 4YDKH 2P44B 1AXSA 1ORQA 3IDXH 3MRJA 5FLXN 1FYJA 3VXMB 2Y69B 1A1MB 2A73A 4GSXA 5DJXA 3EYSL 4W9LC 5HHMB 1Q6HA 1D5IL 1RLWA 4JTDB 2HP8A 1Q3EA 3SPVA 1UWGH 1WAPA 1AI4A 3JZYA 2OCCB 3KJ6H 4LU5L 3MJ7B 2FYYA 1QRNE 5SWSE 4N9GA 4RZCB 4WO4C 3V4UH 2WBJA 4ELMB 2XUWA 1G7HB 1W2BU 2VLJE 2Q7YB 2GQHA 4OB5L 2VDKL 4Y1AA 1RIVH 3U2SB 3QJRB 4DV6O 3QQXA 3OKLB 3B7TA 1Y18A 4TV9A 3BSGA 1AD0B 2GIXA 1A6VH 3F6JA 1G6UA 1DVQA 2BSEA 1A25A 3WTYA 2WKGA 4F92B 3GXUB 1M1XA 4AIOA 1MNNA 4JHWH 1EDHA 1ZK9A 3ASWA 1P4LA 2JF1A 4P2RE 1NCBL 1ZOXA 4J41A 5FC9A 3D0LB 3LHPL 3V6BR 3BFWA 1KGUA 3V0WL 1G43A 1LHZA 3W7WA 3LRSA 1W9XA 5L2JB 5EA0H 4I85A 3I9IA 1WCBA 3F7VB 3GI8L 4A63A 4YXHH 1SGKA 2JK5A 2R29L 1K97A 3BZDA 1CFQA 2FB4L 1ZCRA 4N2FA 5DVKA 3TLRA 1SFHA 5F6IC 4RQQA 3W0WB 4NPYB 5BV7C 4ZBMA 4TLTA 1L0LH 5HYJB 3EJYC 4B7IA 3CDYA 3DX7B 4Q9QL 3TA3D 2E9IA 5EUOF 5BVPL 2BP5M 3P3SA 2XPGA 4RZKA 5C0CB 4ODWA 1FA4A 1L1FA 4NWUH 4IHJA 3D5OF 3VXRD 3RJQB 4U1LB 5D96B 4ZS7H 4CGUB 4JVUA 5KVDE 5HYJD 5LVEA 3QHTC 3NBNA 4LLMA 4IGBB 2FX9H 3MJ6A 5DVMA 3NZHH 2XWBA 3CH1A 4GXFA 5HDQH 4GXUM 4N0CD 2GHZA 4AEIL 2RJMA 2FX9L 3OZ9L 4O4HB 4YDJB 1KMGA 3IE4A 2ZE0A 1A7RH 3L16A 4URTB 2QQNH 4YHKH 5C0DA 2B8OT 3UTSE 2MNWA 4LSUH 4KTYA 1B0RA 3R7RA 1KCVH 5JA9A 2DQIH 4RWYL 5CR1A 4Z0BH 1X5KA 4LL4A 4P2YA 4M4PA 1GHFL 4I0PD 2ZG3A 4IGBA 5GGRB 1R0AL 4GSQA 1AR1B 4WDIA 2NXYC 3OWRA 4BIKA 1JR9A 2NY0C 3SKMB 4Y4KA 2A6DA 1J11A 3W5MA 2R72A 3WY4A 4FFYA 4K3EL 4X4ZA 2C9XA 3L1FA 3QORA 4F7PB 4JJ5B 2NX5A 1YEIL 2A9ML 2LE9A 4CVZB 1QZ1A 3HW7A 3HKDB 5JVDB 4I13B 2V17H 3V6ZA 3DGEA 4XXCC 2AHYA 1U3ZA 5IROD 2GDSA 1UA3A 1R1BA 3CCHB 3A2FA 5CA0A 4UTBA 1U8HA 2E76C 1B06A 2PCFA 4YHMH 1RUKL 3ZO9A 3E7JA 4DV1O 2OMVA 3LKQA 3RWEA 5JYLA 1M7XA 1OKEA 1O6SB 4LRIA 4NB7A 5H4ZA 3IBEA 5JDJA 1JS4A 2EXTA 1HDJA 1Q5OA 2Q7NA 1JBJA 1MJUL 3UAEA 2CUIA 4JZJA 3GPEA 5DECA 2JH2A 2YEVA 2PABA 2AJZA 3D25B 2R4SL 1XMQB 2FLBT 4Z7OE 3OHXC 2XTLA 4EKJA 3DJTA 4AGMA 1EXUB 4KDTC 5LNEA 2WLLB 1BF5A 1NL0H 3VRLF 1EWHA 3B9EA 2XAGA 3LQMA 4YBLC 5HFLA 1KZYA 2B5IB 3DX6A 5ITBH 5D2NB 1XMOO 3VQ1C 1DUZB 4N2DA 4MFHA 1BGYH 3CJHB 3P3PA 1E4WL 2LW3A 3L1GA 2QM7A 2RD0A 3I6SA 4IRSD 4PMFA 4HIEB 5DCCA 2YO3A 1QRKA 1UJ3A 1TFPA 1KFGA 1SJVA 4EBQH 4XBGB 1VACB 2DIJA 4H8UA 1M7UA 4UB0L 2FRGP 2X6CA 1MJJA 1GYVA 5CJOL 4ODTL 4PJ8B 4P4KC 4JI4B 4JFYA 5CU5A 5E1QA 4RISL 3ZE1F 4I48A 4Z7UB 5E79Z 2HUHA 1N6QH 5K1JA 5JHDE 4AQEA 1IT9H 1M2OA 1UOLA 3SJCC 4ZYKB 2DE0X 4JI5O 2B1OA 2F7QA 4WW2F 1GH7A 2W65A 5T3ZD 2EO7A 3H3KA 5EZJB 1FSKB 4FYTA 3K2MC 1FPOA 1CI5A 1KPVA 5T5NG 4G8EB 3RIKA 1S77D 1T0MA 4G8IA 5IQ7H 2WQ8A 4M4RA 4AZ8A 2NZIA 3JTTB 1D5ZB 2F08A 2L3BA 2DDQL 2QLVB 4Z7UA 1N0NA 4DK1A 4N6RB 5FHBL 5GRUL 2CKBH 5DN6G 3WS6C 4N5EC 1RZ8A 2AABH 1N67A 4F8QA 1BQKA 5EMYA 3KVDD 3C5JB 2BNQB 1CXZB 4B3VA 5KSBB 1FO0A 3B7UX 4I4TB 3N43F 1CLZH 43CAB 4ATTA 1CUOA 2F74B 1IFHH 4XVJH 4GRLC 1FIEA 3GBMH 5D4IA 2HX8A 5E03A 3ULAB 2P22C 2GT9A 4DK3A 2IJKA 3QCVL 5GRVK 4XI5C 3V6OA 3HAEH 4ZPTB 3HG5A 4DR4O 2QQNL 3FN9A 5DYFA 3EGSA 2AQ2A 4J3VA 5JPNA 3CVIH 1HK6A 4JI8B 1JZ7A 5IMMA 4MAZA 5I24A 5L88L 1AKJD 5ABAA 5CZKA 1KIQB 1B4JL 1OWRM 3AG7A 2QSTA 2R51A 2PWGA 3O2DA 4Z95L 4QYOB 1QVFU 3O3UN 3G3LA 3GLDA 2HUEA 1A7PH 2IIJA 1P4BL 3LCYA 3OGCB 4QNPE 5IF0B 3RFZA 4JY6B 5IHHA 2O93L 3EUUA 2WMPA 4CC4C 2Q7EA 1ZT1A 2Y07H 3BIBX 3QXAA 4XAKE 4G1EA 3TT1H 4LHQB 3EDJA 5G5DB 4BW5A 4IL6Z 3RYFB 1PD3A 2CJTA 1H3PL 4YHIA 4XOBA 2LFRA 1N59A 4CVWA 3TNNA 1KACB 2ZX6A 2JJUA 1JGUL 2V5TA 3BSZA 1AJPA 1ZWIB 3BLPX 5DLML 1EPFA 4YGVA 3AM8C 3SY0A 3RPIA 2AQ1A 5T5NF 3RWDA 5BPPA 3SIKA 4MWFA 1T5XB 3AB0C 3NIGE 4KVNH 5DJZB 5F1NA 4WHTA 3UZEC 4JHVA 3K79A 1V55C 1KIRB 2P26A 1F41A 1DQDH 3HPJA 4KHTL 5GSVB 3TV3L 1GTNA 3T2QA 5AWNL 4AOFA 1V3JA 3NIFF 5DJ8A 4P5RA 1QLEH 2BNRD 4XB8A 2Q0OC 3US1A 1BVLB 3F7YC 1Q86W 3MV8D 4K94C 2P5OA 5DS8A 1FHNA 2NY3C 1JK9B 4TV8A 2O1AA 3FB5B 2G3ZA 1EDQA 4HF5L 2P7TB 3T2OA 1OM3H 3FTGB 3EJCA 4W6XB 4KRPC 4NUMA 1GJUA 1JTOA 2CLVB 5CJQH 1J95A 3CN0A 4N2NA 3ARRA 4P06A 5D5MA 2YQ2A 2P5WA 4WNSA 4AT6A 5FGRA 1ZWIC 4YDVA 1CICC 3V4UL 3HG1B 2VL5B 3PY9A 3PUCA 1GN2A 3SDAB 4PBDA 4QHMB 2Z35A 1J1XH 3D8CA 2N7SA 1RP8A 1XR9B 1T7WA 2ZJSL 1GGIL 3D25A 1NINA 4PGCB 4IDJL 4EOWL 4HUKB 4V33A 1BG9A 1YMHA 5INDB 4JUSA 4Z7WA 3TYGL 3UGXA 3WJJA 1S9XA 2UXCO 2M6YA 5CF3A 1XF3B 3K1DA 1LP9B 1R24A 2ZKHL 2FQFA 5ID1B 4HEPA 3K6NA 4HOWA 4X20A 4L8JA 1KXTA 4DN4H 4IRZA 4M43H 4JQIL 2RTTA 4X99B 3GSNL 3N2JA 5CUSH 2IM9A 4NQSB 4PVNA 3C8HA 1N68A 5TQ2L 1NMAL 3L3JA 3DX8A 3F12A 1LD9A 4JFUA 4LRNL 1GH6A 2ZUQB 4ZMQA 1TQWA 4DFHA 4DF9A 4N2KA 1XNQO 5LBSH 1GMIA 3D2UA 3IJYB 3VG9B 1VERA 4HS3A 5ECGA 5FO8B 3FONB 1TZGH 3IXAA 1C8PA 4AI8A 3TETA 1GJWA 4N1CA 5TDNA 1XTLA 3QQ9D 1MCWM 4HAGA 4AXWA 1BWMA 1GS6X 3ARBD 2ZCLL 3V5HB 4DCQA 2BCCH 4R6UA 1ZLWK 5GPRA 4A7UA 3VQWA 4LP5A 4DW2H 3OR7C 1OCOC 3APFA 2FHBA 1R3JA 4J3OC 1CTNA 1X6LA 6PAZA 3FB6A 3QH3B 3EVKA 2V8MA 3NCBB 4CC1A 2HHHO 4M56A 4ZNCD 2YAQA 3V95A 2D7NA 4BH8A 2VWEE 2JK5C 2P8MB 2XHNA 4HSAC 1A14H 4PJ5B 3KBPA 2YA0A 5LL6Y 5C07B 3QP3A 5MHSE 1R3KC 3LN5B 5FUOL 3INUL 1Q82W 3E22B 3MV9B 2H9GB 4OCXH 5AVTB 4JI0B 1G7JB 1FFXB 2BMKA 2J57A 2R69L 1XF5B 3LVTA 5BR8O 3VMOA 4X0KA 3T5WA 5T3ZE 4WCEV 1PGRB 4PGBB 5EZYB 1I7TB 4JFFD 3VYOA 3CCMV 3X12B 1IEHA 3I50L 2A4ZA 4PV1B 1C8QA 4Y4FC 3MGTB 1XX9C 3IPBA 1EBPA 4O02L 2R23B 3QIWD 4M6ML 3X3FL 2ODIA 4NQCD 1ZLVH 2EBOA 1MEXH 2A7BA 3KVQA 1O6VA 2ATKC 3K5RA 3PFQA 2XY1A 4QJ3B 5L2KA 3CTTA 5A2LH 1GAFH 3UTQB 4FFZA 1MFAH 4LF8B 1YUKB 3ZKNC 5ICYB 3FSVA 2IG2H 3FT3A 4X2UA 5CBFA 2DQDL 3Q5YA 4QEGA 3VQVA 4DPAX 1JNLH 1P7GA 4PMEA 3KYMA 3C8KA 5FGCB 1Y1UA 3GUTA 1Z5HA 5A43C 4MD0A 5H6RA 3ZX6A 4B27A 2FKXA 5H6QA 1SY6L 2P5WD 3VFMA 2EQDA 3REWA 1WD9A 4C56D 4HV8B 5CJXC 1NH6A 1FLRH 3LPGA 1MA1A 5E6ID 1S3KH 5FFGA 3STLC 4NRYB 2LW7A 1KEMH 4WIQA 4X1IB 3N85H 4PJGF 2AZAA 4ZBJA 1NOLA 4G2AA 2RALA 1FZMB 3EH5B 3DGGA 1K5NA 4NM8L 3GDCA 4HK3N 1NWPA 2ROXA 3DI3B 4CMHB 1JD7A 5HYSG 1GGIH 2BY0A 1BXVA 3V5KA 3NJNA 5KZCD 1MCPL 1SUHA 2NY5L 4GI6A 2IDUA 2OJEA 3HRZA 1S78C 4X6CF 5CHNA 2X6BA 1D2DA 1A4AA 4W4NA 4OF6A 4URKA 1E27B 2GK2A 4CSSA 4MJIE 5GJSH 4JDZB 3W9DA 1A7OH 2DOCA 4NQCB 1C5BL 3CXCU 3HFFA 3JV0A 4RAVB 5IFAH 4X62B 2BO0A 5E6IC 3ORJA 1AGDA 4FQHA 4PJCE 3RL1A 3R65A 1Y6KR 2CR6A 1R3LC 5E9DA 1LWJA 3O8XD 1KXHA 4BM7A 5CP3A 1CL7H 2IH1B 4YEFA 2AMUA 2VLRB 3RWGA 4LLYB 5ESAA 1JX9A 1H8NA 2HFEA 3BPZA 1F3DJ 3JTBA 3LMJH 3TA3B 2R29A 5C0CE 2UV3A 4J28A 2QDWA 3BESR 4U1KA 2XIBA 5DLMH 3B9KB 4AC2A 2X05A 4AG4L 4CC4A 1BCIA 1ZX3A 4K71B 1J9CT 3T2NH 3T1FA 3OTOO 5EWIH 2TSAA 4OR1A 4YFLI 3RHWK 5KS9E 3BSZH 4DV7B 3AY4A 1NVPD 4GT0A 5DJYB 1TQSA 4FQXA 3ZE2E 3A0OA 3ME0B 3L5WB 1HN1A 2OMNA 1AD9A 3Q2LA 4BUQA 1VP7A 2DQ0A 1R17A 3FTXA 4RAHA 3LKOB 2CRMA 1OZUA 4CMMA 1R6KA 2R0ZH 1FC2D 3CPUA 3KPSA 2HWZL 4Q6GA 2EXYC 4TUUA 2YKLH 3ABLB 1NCNA 3Q8EA 2NY7H 4TS6A 1AR1D 2YZ8A 3PGCB 4CRPA 4OTXH 1CLCA 1G7LA 4Z95H 3U1QA 1PX3A 3CVHB 4Z7OB 1XMOB 4GBXB 1GYUA 4P59L 3QG6B 5DC0A 2FQGA 4PREB 5GGTH 2YRZA 1G6RL 4Z76A 1Z5LA 5KOMC 5LXVA 3L3GB 2X4RA 3TBWB 5DD3H 2ED6A 3N1QC 2MCPH 3VE0B 1A14L 2EH8H 1HXYA 4RMWA 1TITA 1IBYA 3EO0A 1IVLA 1YA5A 5C7XH 4HBCL 3KNBA 3M8AA 3MX0A 4JM4L 1T2QH 5BZDA 4O4LA 1DEEB 1V3MA 4ILDA 4X7SH 1VQKV 2LGQA 3MLVH 4OM1L 3T3ME 2VLKB 2B4CL 2KLTA 3FO9A 1E28A 4WHCA 4B9KC 3WO4C 4HAMA 1Q9WA 3CXFA 3BVUA 4QXUL 2RACA 3VWKD 2CGYA 2V3EA 5KSAA 2N0KA 2PTVA 3P0VH 1OHHG 2DIBA 3D18B 4OGAC 4JFDA 2VDPH 3F00A 1DL7H 3DWTA 1TVKB 2CSPA 1RZKH 3EADA 3RWJA 1H8SA 2XG5A 4I18B 2GITB 1FG9C 3W11D 5JHDD 4BIOA 1RL1A 5CILH 3ZT7A 3CXDL 4JFEE 1IM9D 2PW1A 4JYAO 2NT0A 2Q20A 4R6ZA 3CV5A 4DRXA 5DEGA 3QR0A 3Q6GL 4DW0A 2B16A 2DWDB 3DHPA 3EDEA 3GNMH 1M57C 1J1PL 3IGAB 4HCRA 3RKPA 3UO8B 3VW3L 1S76D 2ZOUA 1UWYA 2V9UA 4TUYA 3C2AL 3V0FA 1ZTXH 2UWEE 3WFEH 1H0DA 3V0JA 2LJ2A 3KDMB 4UB0H 3RY4A 5AW4B 3KXFE 4JANA 3CSPA 3MREB 1SBSL 3O4LA 3IU4H 4Q74A 5D7JC 1R5IB 1X5AA 4POUB 4FQ1H 5DUML 1IKOP 2QTSA 4N1HB 3DARA 3MUGA 4LSRH 2MCG1 3Q9QA 1OIOA 2P4AB 1JV5A 1IURA 1FZKA 1TQBC 4LQFH 2Y6TE 4U6XA 4M1GH 4OIFA 2BNUB 5IB2A 5J3HD 2F43G 2DI7A 3AG2B 3BUTA 4P2QB 4AGQA 4MW3A 1RK1A 4P23A 1QSZA 5IWAO 2E74B 3CSFA 4UT7H 5K9JL 4LEEA 1M1SA 2YAMA 4HX1A 1FIGH 2OKMA 4IMKC 3DPDA 1LEKA 2JCCB 3LY6A 4XB7A 1VQ7V 1GSKA 3HE6C 4MBOA 5EOCJ 2LFSA 3TN0A 2AXGB 2BVQA 2KKQA 3APCA 4OLVL 1HL4A 5LBVA 2A7WA 2O57A 5LG6A 4PJAF 5AWNH 3QYMA 1QFWM 3D0VA 4JZGA 3D3VB 4XPFL 4KHTH 5HVHB 5FAAA 2PCPA 2VZTA 3B8YA 2JI2A 3V9FA 4OZHA 1BVKB 2MCMA 3PF2A 3PWNB 1TETL 3VMNA 4BGLA 2BOCC 3CMEV 1QI3A 3VXUD 1XL4A 2QPSA 1SDDA 5IJ0A 1P5VB 3G6JE 1WIUA 3RJDA 2EJ1A 4Y5YC 1RD6A 3EFOA 4BSJA 1MFDL 4IGBC 4XC1L 4H40A 2JWYA 4J4PD 4PJEB 3LH8A 5CSBA 3VWJC 3R4DA 3LPPA 5I5JA 1H6UA 5G2NA 3I6GB 4HWZB 1BXXA 5F89A 4WI3A 4F4LA 4ZOAA 3FB7A 3GMLA 3ZKXC 3DTDA 4LCIH 4Z3IA 3UT5B 4JI3O 3UERA 3VFSB 5AALA 4HWNA 5KAFZ 1C5DB 4ZXBD 2ZAHA 2C9VA 4F8NA 2R1YA 3ZRWA 2K6WA 2OSXA 1XIWB 5F9OL 2A9AA 2ZUTA 3KXFD 3FPXA 4PJXB 4B3SB 1E9PA 2NXYB 1IB5A 4P5TC 3MV11 1R34A 1J5OL 1Q90A 3MNZA 3TXAA 3FRUB 3SOTA 5IGXL 3TEXA 3PXHA 4QE7A 3CCUV 4U0RB 1KENH 3B9AA 2JE8A 4LDEB 1KJ2B 2IH1C 2GKIA 3E8HA 3CVIL 5L4IA 1OAJA 2IH3A 3F5WB 2NYKA 1X5XA 1T2XA 3HHMA 3OAYK 5CEYA 4RA3A 1U6AH 3N40P 1UD5A 3OXSA 5KSBA 2F5AL 3CVBA 3ISYA 4GI8A 25C8L 2OWOA 1O6TA 2NY6D 3CMOL 3N41B 4JPKL 3WE1A 3VFRB 1DSYA 2OW6A 4TRPH 1BIHA 4ELDA 5J2UA 4PGDB 4WCYL 4LOUC 2IBZX 1DJZA 2WQSA 4LLUB 4R50A 2AKRB 4FLXA 2KDGA 4U1GC 2OSLA 1B6QA 4X6FB 3KCWA 4I77H 5AOMA 5DMJB 5JPNC 2XZQH 2UXFA 3JSSA 3NRPA 4Y5XA 1AE6L 1KIQA 3IB4A 4ABQA 4DR3B 4LK4A 5E2VL 4JZJC 4WFBV 1JYNA 2ZICA 2X6AA 2K3TA 2QHRH 4ZMLA 1BD2D 2NY1D 5GS1B 3EFDH 5TGBB 3T0EE 2QQLH 3D39B 4J8QA 2WNKA 4L05A 4AENA 2QZ5A 4DGVL 4ZFOL 4YZFF 1RIVL 3OSVA 5HPMA 1IC5H 2WXQA 4R96A 3RKDD 5BZZA 3CFJB 1THCA 2AW2A 5E5MB 2CDFA 2BS8A 5D7HA 4KI5C 4XO5A 1K7DA 3DX7A 3NQKA 2A5UA 4H26A 1F7YA 5IB4B 3ATBA 3CSTA 3IXTA 1VHPA 1K5WA 2A3TA 4KP4A 3P30L 4X6DF 3QJFB 5B1JA 1FAKT 4XWGH 5JVDA 3HKCB 3V6ZB 3JWOL 4YXLH 3ZUCA 3MLPA 2Z7UA 4XNDA 1GZHC 4M4RB 2J5LB 5MEQB 4PRNA 4YDKL 5E8DH 3FFDB 4F33B 4PJBF 3VD4A 1VCBC 2VQUA 1BD2A 1QATA 1XT5A 1NC2B 4N6RA 1CLOH 4PJXE 2IH8A 4I18C 1RCYA 4FCHA 4JZOB 4Y9BA 2VN3A 4R2GC 3IT8D 5KA6A 3RT3C 3MRGA 3S5LA 4CDHA 3E8GA 1JOIA 4H8QA 4U6VH 1XEDA 3DOIA 2KZBA 2L4OA 2YXWA 3PGFL 3QZLA 4K7PX 1HSAA 2SODB 4R9HA 4JL2A 4PRNB 2DQEH 3RWIB 5KYXB 3ARBA 5SWZB 4AVIA 1AY1H 5D7SL 4HWUA 1VFMA 1XH1A 3P11L 3THMH 4PHZA 1I1AD 4HX1B 1UB6B 2ADJA 3GSVA 3U1SL 4LVHB 2BSDA 2J5LC 1OAXL 2CHXA 5GXBB 4H8HA 5BXFB 4HU2A 2GHWB 2PTUA 3FU7A 4I0PA 5IKCB 1A9VA 1NCCH 2NSMA 4OZGE 3EIFA 1E4HA 1JGEA 2EE2A 1KN2L 2ADIB 1QW8A 1WH0A 4YQXL 4NN6C 1EBAA 3ZT5A 1K4DC 3TL5A 2JGDA 2VWKA 1WBYA 3FAVA 3ECVA 3K74B 2UVFA 1U8LB 2K7QA 4JFYB 5CN0A 1RPOA 3KLHC 3ESOA 4OLXL 3ML8A 4JAAA 1YDXA 4RGNC 3V55A 1N5YL 1BREA 3SO5A 1KLFA 5HHNB 1RQ5A 2HJFC 3LDCA 2HMID 2W0FB 5BW7C 2C1PA 2DWTA 4FMTA 1CFMA 2OL3L 4EN3A 2VQTA 2EC9T 5ALBL 1VQNV 3SJVE 4F1ZA 5EBMC 1U8LA 4MWFB 2R9RB 2DLEA 1L9QA 2A3QA 4M3JA 1CICD 3ZE0B 5B38B 1VGKB 4LPVA 1NMBH 1EO8L 4PJ9B 1KJ2H 2CJUL 3HEIB 5D7JD 3S36L 3UTTA 3ZHRA 1MSDA 1LE9B 5EC2C 1L8DA 1ZT7A 5HGBB 4O02A 2NY3B 3HMWL 2NSQA 3QAZB 1IMHC 4Z78B 4MQSB 4FULA 2HFGH 1ZAUA 4O58L 1ZDQA 4FLRA 4H44C 4NUQA 5LXTB 2JKIS 3SYCA 1UM5L 4J27A 1TEYA 5ENWA 3FUNA 4C83A 4E9WA 2HEPA 3NDZE 3B4SA 4HWEL 3G5YB 3S3CB 1OZTG 4S2SA 1LNUB 4MCYA 4K7FB 5FA3B 2DTML 2IANA 2IC2A 3OAUL 3HKZA 3OHMB 4CNIB 1OZ0A 1S7RA 1U33A 5I74C 4KKPA 4KO5A 1BF8A 1IGIL 4NQEE 1ZY9A 3CCQV 1QEXA 3QULB 4MVZA 1NEUA 2GUOA 1EUTA 3ZIAG 2X4PA 1A4BA 3HC3L 4FQXD 3QJHA 3RFZB 2BNQA 4KBPA 4UV8A 3ABMB 1AAJA 1XGRA 1B90A 4K73A 4JAMB 4ES9A 3QYCA 3TCUA 5J6HA 1KCWA 2IALB 4ELMF 1AGCA 2X2IA 3TH2T 3RTQD 1PTZA 2AQNA 1GW6A 4X20B 2DICA 2IADB 2OMZB 4X5RA 1XCQA 4JRXE 2W95A 3BP4A 1FV1B 1KTLB 2BY3A 2VE6A 4P5TB 5DVOA 1GGCH 4WBNB 1J5DA 3CNKA 3G6DH 1NCAL 4Y5VB 4ZSOB 2W0LA 1HZKA 1CGXA 4LLMB 1UB5B 4FFBB 3O3BB 3PJSA 4GKJO 2DZEA 3HPLB 1U97A 3WNOA 3HE6D 2X0LA 1PYWB 5E6ZA 4DV4B 3W7UA 3QZNA 4NRXB 5T1KB 3QNZA 3DX2A 3L08A 3B1TA 2K70A 5EEVA 1RSFA 5BUGA 3CPWU 2XZZA 1T1YB 1IEBA 4WFEA 3P73A 3QCTH 4HDIB 4NZRL 1TXKA 3S0PA 4CL7A 1CYXA 1XSIA 2CO6A 4BYHA 1MCRA 4F57H 3IVKA 3K4ZA 3GHEH 5BRZD 3S35X 3L2NA 4TNEA 4CN4A 5KSAD 4GH7B 5G4OA 4XNUL 4MVMA 3PHOB 3IN0A 3LPOA 2FBRA 4JE4B 3WJJC 4P9PA 1M3JA 3OKNB 2CLRB 7FABH 2Y3NA 4TSBH 5C93A 4EUPG 2RA1A 1A6ZA 3P2TA 2NDGA 4HXAH 5KN5B 1T0PB 4WHTB 2CA4A 1SXCA 1MCBA 3EJUA 5JOEA 3KPLB 1HKLH 3DKHA 4HXBH 4FZ8H 3DHJA 3RWEB 4GFXA 2EDFA 3MXWL 5H8DA 3OKKA 2LTQB 3MV8A 3VTMA 5H4YA 1SM3L 1VQLV 1VSCA 4N87A 3UC0L 2K6ZA 4NBYB 4WI8A 1K85A 4JVWA 1I8UA 2OK0L 4LSVH 2OX5B 4YJ3B 3MGOB 1D7BA 3BA9A 4JRLA 3DROB 1UASA 4JKNA 5J56B 4J2XA 3BAXA 3G6JF 4NQEB 3FDWA 1MRFL 4Y4FA 5DJDB 3IYLW 5KVMC 4AQOA 5EDSA 1AZCA 2VQ1B 4MA1C 2A74A 2YAHA 3WEBA 4W9FC 3ELAT 3LVEA 3POHA 1ED3B 3HAEA 4FN0A 3OJVC 3CIAA 3BQUA 4MNHB 5GZOC 4XH2A 1D5BB 1YNTA 3GSOB 1X4TA 5ITZB 4JMXA 3OKDB 5F8RC 5DQ9A 1AR5A 1OLLA 4JKPL 1HZLA 1FHGA 3WNLA 4H4NA 2OYKA 1MZEA 2YPLA 1LEIB 4NNYB 4ZUSB 4ZZKA 2EDNA 3FQ2A 4DVRL 2PYEA 4Y4HA 3TM6A 4QRUB 3A6CH 4ONHA 1YNTF 5DEFA 3QEQE 5C2BL 3J8F7 1PPIA 3L3IA 3H55A 3HUJF 1O9ZA 4NQXB 4ONFL 2DD8H 3S36X 3NFSH 1Z5LB 4D0DA 2YAPA 2DIAA 3L3OB 3L95B 1HWGB 3TPUA 3LEVL 4LE8A 4EKXA 5A2CA 3ZYZA 4FFZH 2MKWA 2O26U 3T3MF 5LN8A 3D2UB 2OMYB 4I0XA 1GGBL 3RWFA 3GBLA 5DR5L 3C5ZC 5CEZD 2ZIDA 4JDZA 1UD2A 3ARXA 2HH0H 3LPWA 1A3ZA 1L9NA 3CMGA 5BS0E 4W4KA 1ZLDA 2CJUH 4K23H 4OJFL 2A79B 3ARGB 1IBZA 4AIXA 2MQGA 3AMLA 3ZIMA 3P0YH 5J1AA 4QOKB 3V6FA 5JW5B 2CHWA 1W72H 4WI0B 4RGNB 4GKSA 2VUYA 4TF4A 4LLYA 2PN5A 4M5ZH 5ESAB 2VDLH 2O5ZL 3QEQA 4I3SH 2YEZA 3LXUX 3CN4A 3CRCA 3O4OC 4MJID 1GXEA 1SJHA 3EO1A 2PYEE 3VI3E 5FDWB 1IGYB 5JR1L 4PJGB 3ESNA 3GSUA 3H1ZA 2LFEA 2YSUB 4IBYA 3S37H 3SDDB 4KNTA 3QUXA 4YE0A 3QVNA 4HK0A 2NN4A 1U95A 2ENYA 1PZBA 2X28A 3EH4B 5IVZB 3ZMNA 1B9ZA 3QZBA 3AMKA 4G2KA 4ANKA 2DQTH 3FU0A 5KVGH 1MZFA 4L23A 3MOAL 1CICA 2N74A 2Z7WA 1JZ4A 4BFIB 1EAPB 4LDLB 3QG7H 4V1DB 3GSUB 5F7UA 4HH9B 3BC9A 3CFBB 5I1DB 4EVNA 4HOMA 1OAXH 3VXME 5EC1A 1R5IA 1BQHA 5LWYL 4GYCB 4JI8O 2BCMA 3P77B 3HRZB 5MEPB 2BIOA 3AITA 4HJGA 4XRCA 3K6SB 3U9UB 2YD9A 1IC4H 1Y74A 2ZWYA 5J12C 1VF6A 3SDDC 5C3LD 5E24E 3GMQA 2DI9A 4AEHL 2GTZB 2NXZD 2IPUG 3CFBA 5E1AC 3K46A 5DVPA 1S7UB 5E0FA 5I1DA 3A22A 3BYTA 2OS7A 5HXMA 5DJAA 1RKRA 4NSKB 1JZHA 4MJ6B 4P5TD 4QRSA 4ZOLA 1LUWA 2B5UA 4WFGD 1CFNA 1ZS2A 3STZC 1B3IA 3FT4B 5IJCC 1XEUA 3MBWB 4KQ3L 5A1AA 3W11C 3SYQA 4KUZL 1OJHA 1QPPA 2R1WA 2RB8A 5IIEB 2GG1A 3GSNB 3ETSA 5K69A 3MODH 4L29A 4O4YL 3LKRB 4WUKH 4XWOC 4PVLA 1JERA 3EGXA 5I19H 4MXVE 1L9PA 4HFWA 4YAQA 2ZIOA 2VAAB 4RMVA 1BGXH 1RUML 4BV1A 1ZVYA 1S5HB 4XO3A 3LV3B 3VB9A 3BAIA 1BZ9A 3ULUF 4KFMA 3VFNA 3VVWA 3U0ZA 4O9HH 4FMKA 3O6MH 3AWGA 4LIQL 1KJVA 4Z7UE 1CDBA 2ZUYA 3STBA 4K4KA 4LF4B 1SOXA 4LASH 1MFVA 1P5UC 1FNGB 1OF0A 3CCSV 2EILC 3FOLB 3DUHA 4IBWA 4QRRD 3A67L 4WENB 1FN4B 1KXTB 1W6LA 3WENA 3S88L 1G9MC 1ETB1 2VN6A 1WT5A 1MRCL 3D3QA 5EEZA 2VL4A 4YGAB 8CGTA 5IUCA 4ALAH 2XXGA 4QNPF 3MUUA 3OV6A 4Y5XC 5ISZA 1UM4L 2AERT 5JQGA 2BJML 3U0PB 3BISA 4PJ8C 4O2AB 3L3KA 3VRJA 1BOGA 2Q8AL 3VI4A 1UJWB 3QUZA 4MB1A 2EEXA 4NNYA 4RFEA 4ZUSA 7PCYA 1YF2A 2R27A 2ZXWC 1MIEH 1NGPH 1JV2B 4AQYB 4JI5B 4X5LA 3CX5K 2HVJA 3OZLA 4NXKA 3OTTA 1WA1X 4HBCH 3UTPE 4CVXA 4H7VA 4PRDA 1TVDA 1QO3B 4KUCD 4PGDA 4NQVB 5EO0A 1MFCH 3AC0A 3IPFA 4Z7VE 2XT1B 1VARA 4OGQC 4BQCA 5BUAA 4JFDB 2OIEA 3EBGA 3HUJE 4P5SA 5DXWA 1ZIBA 3PGCA 3CN3A 4LFCO 1A4KA 3HI5L 4GX2A 3ULVD 4R8WL 4PJ5A 5C07A 3GT6A 1QUNA 1YMMB 3LNNA 3BUIA 1KYOF 1FNLA 3NP4A 3F7LA 2KH2B 5AVRB 1KPRA 2ICEA 5I1AB 1FO0H 3CSYB 5FUCE 1OY3B 4RAUB 3KNBB 2ZKYA 1YEGH 4OFYD 2KPWA 2UY6A 4AE0A 4UM9A 5HYEA 3OPUA 4LFAB 2FECI 3PE9A 4Q20A 1SJHB 3EO1B 3FW6A 4TPRL 4PWJA 1CFBA 3PXLA 4WEUD 5IJKA 3L9YA 4TSAH 4QIRA 2D7TL 2I24N 4FXLA 1GN3A 4AG4H 1X5YA 4GUQA 3DHUA 4XN2A 3KLAB 4F7CB 5H9CA 1HINL 3VSQA 2H3OA 4IJ3B 1S7QA 3STLB 1SEBB 2NYYD 3QG7L 3QJFA 3BUQA 2XWJB 3X11B 3W39B 3OSKA 1U8JA 4KK5C 5EN2B 1I53A 2Q86A 2HLEB 1YEGL 4IRJB 1ZANH 3G6AA 4ODVL 4W9DC 4YSDA 2B1IA 1FO0L 1JUFB 4NHCL 1K33A 3VXUB 1N19A 3DXAD 3DX3A 3ZDWA 3REWB 3SKOB 3HCVB 4A2LA 4RIRB 2WW8A 2QVFB 1KYOJ 1NBQA 3P77A 5K9JH 4RDBA 1N34O 1X5LA 2VXSL 3DO7A 4J4PA 4A2EA 5GJSL 3MYJA 1JHKL 3FTUA 3D3VA 4HJ0D 2X6MA 4NZ8A 4YDIH 1UURA 4AILC 1HDMA 4P23C 4K3HA 3VXUA 3H4FA 2J8UE 2VMJA 1KUMA 1O6SA 1N5AB 5F6IB 1MW0A 2KC0A 2LU4A 2MNUA 3EOTL 1ZHKA 3N42F 4BBWA 1PY4A 5T33H 5J13C 1BECA 1P4UA 1T1WA 2HSIA 3LKSA 3NABL 3K3WA 3UBFA 1G7IB 3VBBA 1T0NB 2VLMD 1E6JH 1WP8A 4ASUG 1WFTA 2X10A 4HCRH 3WUWA 4ABMA 3VWJB 5C0GB 3SQRA 3A6BH 1F4YH 2JKXA 3QDMA 4ODWB 1BVNT 1X9RA 1JWSA 3BKML 3FFCB 5K1XA 1KBVA 1T21B 2ZNIA 4U1JB 2V2TB 4I4WB 4Z1VA 5FO9A 4QTHB 4JYBA 1IAOA 3D8MA 5FHAL 4BQ8A 4HFWB 2WWOA 1P49A 4A55A 2WINB 3BXNB 3BLBA 1G7IA 2P48B 1R47A 1QTYT 3FFCD 4UF7C 5EO9B 4ANVA 2VSMB 4X8JA 2CHDA 2WZPA 1OP3K 4QHNB 4HKJA 3CRQA 2XZAH 2PGGA 3ARYA 2AVFA 4FQ2H 1A21A 2DQFA 1MJJB 4X7DC 4XXWA 1ILUA 1R3KA 3LQAC 2EAEA 4G9DB 1KIUA 4C58B 2KHAA 1H6FA 2R0LL 2AP2A 4GSUA 2DYSB 1VQ6V 1OP9A 1Z2GA 3CE1A 3VG0L 3CCLV 5FNVA 5J4MA 5HHOD 2XLLA 3L74H 4J9YB 1JXDA 2IAMA 4AQ1A 1JYWA 3NK4A 1RUMH 1RAMA 4YSTA 4IBLT 4X4KA 4G8IB 1KYDA 2YARA 1DN0B 4WV1B 1J8RA 4AITA 1ETA1 3ATDA 3DTUB 2PPAA 3ILQC 3WFBH 4U7OA 4DP4X 1ML0A 2YKKA 4QRRA 3O41A 4K0KB 2QADD 2WP3O 2F15A 3CFEA 3BMWA 3DX4A 3N41F 4YIQB 2P80A 3GM0A 1IBHA 3HFMH 5ESQA 1AGBB 3NSJA 3K71B 3KLQA 4PV9B 1CQYA 2CPCA 3BAEL 1LILA 1ZTMA 2J4WH 4NYLB 3TWCH 1MABG 3VG0H 1P7QA 2YKLL 4MZIA 1EFQA 4GKNA 5F7WC 3OR7B 3A24A 3ARDC 3TTYA 3IMBA 4CILA 4R7CA 3MLRL 4XPAH 3MBXH 5HJ3A 1KT2A 2PF6A 2B5IC 4EZMA 1J48A 1UZGA 3FO1B 3K81A 3Q6FA 2VRKA 4XAWH 1G84A 1RUQL 3P54A 2P5EE 4XWOD 2AJYH 2DV6A 2FT6A 2XZCH 4Q52A 2L0DA 3QUMA 3AREA 2YQBA 4NCDA 1SUJA 4HAFA 4M7LH 4RRPM 4QRBA 3SE9L 3UOAB 3JAKA 1AJ7H 1KTJA 3IDNA 4GUCA 3ETGA 1EDYA 4ZMXA 2D4FA 4RZCA 3BKMH 1HP8A 2Q67A 3OD3A 1IL1A 3ZL4L 1SXAA 4ELMA 3MNMA 1F58L 1CGUA 3QJOA 1A5FL 1CU4H 1WWWX 1KELL 1HNWB 2ENSA 2X3AA 1BFOB 4P46B 3V8CA 1NKRA 4HJUA 4YHIB 3KPQA 5GS1A 4CS2A 3OTFA 3RVVD 3MSPA 3S37L 4AVJA 4CADA 2V1DA 2DJ4A 3D1MC 5IEHB 3HI1B 5DRWB 4OI7A 4RLDA 5CEZE 2XT9A 2VLJB 4K7PH 1F23A 3AU1B 5BS0D 2RFXB 4IRJA 2UX6A 1U58B 4PDRA 1JVOA 4PCTA 1VKXA 5DC2A 1HI6A 2FGZA 2N4IA 5FFOA 3RHWF 2HJDA 1MPAL 4A7VA 1QSVA 3W7XA 3B2PA 4YMPA 3V8OA 1BHGA 2JV6A 1P4IH 1KELH 3L7EA 1FL3B 5FYKL 1EIBA 2CO7B 3NEEA 4KJQD 1J05B 5AW7B 4MAYD 1FVEA 1YTFD 5H37G 2UXBB 4E4EA 3KYKH 1NGXB 1NTKH 2W59A 1Z6JT 2GBVA 2Z4QB 3SKJL 4R5XA 2D03H 4M6OL 1WBYB 3HMXH 1SBBA 3WLWD 3N27A 3NFNB 3GRWH 2V9TA 1GYAA 2XFXB 3ZRVA 1X4YA 5IMMB 1KLFB 4XNQA 4P9ML 4XP4H 2ZOWA 3FO2B 3GHPA 3DROA 5JORA 2HFGL 3IJ9A 2E7DA 1W8NA 2E9JA 5ANHA 3KWTA 4XPHH 1UXLA 1V54C 2P8LA 4EN3B 5I8CB 3L72H 2XRAH 2QKSA 1MXDA 2VQ1A 4YC2B 5D4HA 5FYKU 1H2GA 2EEFA 2PPEA 4L37A 5DRNA 1ZLWH 1S7VB 5GS0H 2V2TA 4B9JA 2ZAIA 3GINA 5DTFA 3PQYE 3QISA 1NLBL 4WDIB 5BXFA 1WUNT 5T8IA 5MEOB 2C9SA 1YY9C 2XN0A 1TUEB 1PPJH 3CSXA 5DI8B 2XTAA 3PIQA 4U0RC 3X2QB 4UINL 3K0DA 1TO4A 3VXMA 1QLRA 3L4UA 2YPLB 1D5ZA 2M83A 2CK2A 2HFTA 5E6SB 3CGTA 3ES6B 1U9KA 3QXDA 2YFOA 2BZ7A 1WSST 3VXSA 1BQLH 2VW6A 5JQHC 2AMGA 3RU8L 2FK9A 1U8CA 3LQAL 4GI9A 3FZUD 1N64L 1CDGA 4J3OG 1DCEA 1ZV9A 3WN5C 1OARH 4MHHG 2E3CA 4GINA 4OVUA 2W80C 2JJ2G 1SYVB 1XVSA 4DP2X 1MIEL 5EBLB 2ARJB 2PLTA 2XX0A 3QGVA 3PGDA 1KB5L 3QCVH 4ENZA 2EYSB 3LZFH 2GJ6B 1E50A 2R0LH 2WO2B 4TNWK 1CK0H 1W6WA 5D1XA 4JI2O 2E6PA 3ARUA 2BSSB 4FMVA 5B3JE 4FXGB 4LF4O 4JRWA 4ONFH 4LBEA 3P0GB 5C0AA 4ELKA 4YDZA 5H35A 3A6CL 1E6OL 3VWKB 4TQEH 4XMVA 4LPUA 3F6IA 4FNLH 4L8DB 5AVYB 1MHHA 4WI2A 4R4ND 3WNKA 4F7MB 1KTLA 4P5TA 1KKCA 2AQ3A 4DP7X 1BL8A 2FNWA 4WV1C 5I0YA 4PJ7A 1EN4A 1FFRA 1G9NL 3PDDA 4G6KH 4ZS6D 3A6BL 4XTRC 4LBEB 3UMTA 4Z7WB 4L18A 4LLQA 1JK8B 5FA3A 1YYLL 1ES0A 1RZGB 1BGXL 3VNZA 3WG7B 3BP6A 1I7UA 5L9DL 4PJAE 4FXKC 3V6OC 5SX5H 2DTSA 2WO3B 3HN8A 3QI9C 4G7RB 4BA8A 4ZYKA 3IDNB 3QULA 4PS8A 3OHXB 5TFSH 1CG9B 4HUNB 3KLHD 2N59A 4UB8Z 3F12B 3D50A 4MXWH 1VF7A 3ALPA 4IDJH 4PEEA 4PWFA 2ZJSH 4MNGA 1DVFB 3GJFB 5ID0B 1GPOL 2JB5L 3EH3B 3T0AA 3T3PE 3UC0H 4OGAD 5B1AB 3HBPA 2E7HA 4X9IA 2QHLA 2KT6A 2Z0UA 3K6SA 4FPPA 4EQ3A 1YN7B 1YNKH 5A6MA 2NQ3A 3LD8C 5LNGA 2QKCA 2YRLA 3HE6A 1A47A 3G5XB 3WKNA 4F8OA 1SXZA 3MRIA 3ULSA 1EK3A 4FXTA 3ZDXF 4HFUH 1WZLA 2BWDA 4JPWH 2GYSA 4FXKB 3ZE2B 2LHAA 5FYJD 4BW9A 3V5KB 1YN6B 3B8MA 2PF4E 1NJ9A 2VABA 2WUCL 2J6EA 4TQEL 4MJ6A 4O00A 5FUZH 1V7MH 3QEQD 1JWUA 4JRYA 1OPGH 4KMLB 5CSZB 3BKJL 1WWBX 4CVZA 1FZJB 1L9TA 1JF5A 1QR4A 4I77L 4PJIA 5PCYA 4FKEA 1E7UA 4EF3A 1PG7H 1FVEB 4JRYD 4J7JA 4ORGB 2Z1KA 5LQBL 3QHFL 5IJDC 2ZKOA 1MCCA 3TTSA 4LVNC 4FI6A 4Y4FB 5GISH 4TUOA 4AIZA 3EGXB 5DZVA 5A9GA 3JASA 2LV4A 1CR9L 2YGOA 5LAXA 5B8CA 4GUPB 4JRYB 3MHHC 3FU6A 4L3EE 2Y4TA 1BZ9B 1G6VK 3BVDB 4ICGA 3AG1C 2RMKB 3VFNB 5TTRA 3RU8H 1PEZA 2FYVA 1YVLA 4DQOH 4LF3B 2Y7OA 3GKWH 5ICYA 1Z5YD 3NZSA 4ADGA 1KUQA 5ALBH 1N59B 1U93A 2IBZY 1J7VR 1Z0MA 4O2FB 4BK8A 2OJZH 3NMEA 1MCQA 2OI9B 2F4VB 2PYED 3N3EA 5IREA 4PJCA 3SD2A 5KX5A 1BVNP 3MRFA 4Z2WA 4A67A 4MAYB 2R0KH 4FQXB 1ASQA 4ZODA 1NGQL 3B56A 4NCC1 3AFLA 5E8OA 2YICA 3ECUA 3X1EA 1ZLZA 5E8PB 2WJ7A 3KAAA 4G6JH 5D5PA 1WNSA 1T22A 1AO7B 2C4FU 5LHHA 1FYTA 2PYFB 5IYCO 4TOYL 1T2JA 3WMPA 3A4EA 1E5BA 1FQ9C 4NNXB 4Y16B 4F9LC 5I5RA 4QCIB 3RNKB 4C4BA 3CXHJ 4WFHD 5SX4H 5T1DH 1SQGA 1B2YA 4D7BA 3IETB 5F6HJ 5KUKA 1ZT7B 3NPSB 4OBRA 2D7OA 3SE6A 3V0WH 2FWLB 1IM3D 5HYQA 4YR6A 5JXEA 4ZW3A 3P3TA 4XO9A 3WFVA 3FOMB 2EDDA 2X2YA 1VFBB 4GSDH 2BHUA 1A4KB 2WKOF 2LU3A 1KB9K 3O6ML 4PHXA 1KBGH 3BZ4A 1R3LB 4B97A 3C5JA 1P4IL 3TPUB 3KPOA 4R83A 5D1XD 2GK0B 2HR3A 1KD1W 3HG1D 2XBZA 3O9WA 4UZUA 1MI5D 2ICEC 4X8GA 1AGFB 5KVGE 5KSAB 4ODSH 3CFMA 4XCNA 1E0OB 2ZCZA 3GLAA 4OFKA 1XI1A 4IU2A 5L8LB 1R5WB 4WAFA 2XG5B 1E65A 4I18A 3ML0A 5IVOA 3S96B 4OV5A 4PVMA 2ESVD 3O6LH 4HUXA 4XAKD 4QYAA 5FOBB 1AHWB 2W0XA 3LEYH 1QPXA 5CLYA 5DUMH 3HZYA 2OAAA 4J39A 3RX5A 4DV5B 4X5XB 2BXYA 3B37A 4R7LA 3W37A 4NKMA 1I0HA 4OX9O 5TDNB 4WFFA 4BD4A 1E4KC 1KN2H 1FRGL 2PI5A 3MV7D 4ZUTB 3S96A 2EZOA 3ZMSA 1FZMA 3IBOA 3WNIA 5TDOB 3ZVVA 1RIUH 4AJ0A 1ZT4B 4FL4C 3DX9B 3KYNA 3QUZC 4AKOA 4IS6B 1AJ7L 4G28B 4K0KO 4LH6A 3BE1H 3BUYA 4DGUA 4E41A 4LCCC 5I5MA 1CPUA 3DUSB 4TYUA 4DKDC 3MCKB 3VOUA 1A7QL 1LTXA 2X1WL 3VQXA 4Y7OC 1M05B 3X17A 4LESA 1SJMA 1KP3A 5SWZD 1SS3A 1MLCA 4QD2E 3HG2A 1W0WB 2XN9E 4TOYH 1UQSB 4YHZL 3GSNA 3WCYA 3L2MA 1MAJA 1U3HA 1ZHKB 3QUYA 3WO3B 4WEBH 2NW2B 5KHHA 2PCYA 3OGOE 2RCVA 1KB5H 3LDBB 2VAAA 4AV4A 1FWXA 4CU8A 4CJ1A 1NGQH 1UEYA 2F5AH 3PV6B 1JZDC 3IGFA 4HS6A 4KROB 3HZKB 1OHZA 3U10A 1OF2A 4Y4KC 2YD2A 5B1NA 2H3KA 3FKUS 3ARFB 2LVEA 4FLTA 2VH5H 5JO5B 3TO4B 1TUBA 2BOBB 4A7SA 2VDLL 3UTZB 4JO5A 3SGKA 4UVAA 3H8NA 3O9OA 3OZ9H 3U83A 1SZTA 1SHMA 2X4OB 1EHXA 1P9MC 2EDOA 1QLEC 3GSXB 2X4QB 4DQOL 2EC9U 2D2OA 1UJTA 5F97E 1IC5L 4G59C 4GPVA 2KSDA 3Q2CA 3SCMC 5BRZE 4OU3A 2JKSA 2R0ZL 5DMYA 1NC4B 2BFGA 4X83A 1CR9H 1P53A 3SBRA 2B77A 4WWID 3A0HZ 4CBCA 3NCXA 4DSYA 5HHVL 1OQXA 1A3QA 3IRCA 4IGGA 3GWOA 1YG9A 4IRJC 1QEWA 2DEXX 4HUMB 3CHPA 5FFLA 4LVNB 5EWIL 5A2IH 1RZKC 5AW9B 4F7TB 1PEWA 4G11A 3ZKMC 2MK3A 4BHUI 1PNLA 5C0CD 1YMMD 1LO3L 4YLQT 2F5BH 2XAFA 3DXAB 3F62A 1QBLL 3BKJH 4RIRA 4H8VA 3IWVA 3E9UA 4M29A 1BP3B 4N25A 3K0YA 4DR6O 4BZ2L 1GGTA 4ZNEA