1ARCA

The primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACHROMOBACTER PROTEASE I
publication title The primary structure and structural characteristics of Achromobacter lyticus protease I, a lysine-specific serine protease.
pubmed rcsb
source organism Achromobacter lyticus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 1993-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arcA02
3QUMP 1EPTC 1Z8IB 4ABIA 1GMCF 3RXHA 2BYAX 5AF9H 2AMPA 3LT3A 2BZ6H 1GG6C 1QJ1B 5GDSH 4GUXA 4AYYB 1ZMJA 1XKAC 2G4UA 1VGCC 1CO7E 3SU2A 4CREA 2V3OH 2PKAA 1MTNB 5GCHG 2ZHWH 3HK6B 4X8VH 3RXQA 2QIQA 1V2LT 3BTTE 1L1NA 1IQLA 1O3BA 2BXUH 5EG4A 5LPEA 3BG4B 2BDCA 5GPIB 2F9NA 2VB0A 2B8OH 4AFZA 2GT7A 2ANYA 4Y8XA 4IC6A 5K0HA 1MKWK 1WQSA 3SI3H 1AMHA 4FUJA 1V6DA 2XYAA 1CU1A 2VIPA 2RDLA 3PWBA 1FY5A 2VIQA 4ISHH 1K1PA 5JPMH 1DXWA 2QC2A 2ZDKA 4WH6A 1CHOG 1O31A 1YLCA 1W11U 4X8TH 2W26A 3VB7A 4NFFA 1RFNA 4DY7B 1TMBH 1ORFA 2C90B 1LO6A 1MKXK 3ZVGA 3P8OA 3TJVA 3KL6A 5EXNA 4ZH8A 3F9FA 4FUCA 2G81E 3E91A 5GCHF 3VXEH 1VCQA 4CRFA 1P57B 1Z8RA 1V2MT 1EP6A 1GGDB 1JOUB 5F8TA 3ZZ9A 3MI4A 3IG6B 3SJKA 2P8OB 4D7FA 4MNVA 1HJ8A 2A7JA 2QV1A 2VVVA 5FX5A 1O3HA 3RXTA 2BDAA 1E34B 5LPFA 1SGNE 2FTMA 3P8FA 4INHA 1AKSA 1Y5AT 3VGCB 2BD8A 1GWAA 4ZMAH 2ZCLP 1W13U 5E2PA 1BIOA 1ESBA 2EC9H 4NGAH 1S83A 1LHFH 3PTNA 1Z1IA 4UE7H 2THFB 2GV6A 2EI7A 3S7HB 4MNYA 5EW1H 1W3CA 1ZGVA 2Y5FA 4ZXYH 3KN2A 1V2ST 3QLPH 2R3YA 4TYDA 2ZFQH 2BD9A 4ABEA 1IHTH 4FXGH 1RGQA 2G52A 1WBGB 1ANBA 2PKSB 2ZDVH 3KGPA 5AVDA 2BDYA 2H2ZA 2Z9LA 2P3TB 4B76A 1QL7A 2GDDA 2A5IA 1JMOH 3SHAH 3MH6A 3O8CA 5EQSA 2G8TA 3OY6U 1ELEE 3BN9A 1K21H 1JXPA 3D23A 4NIWA 1MU6B 2J38A 1XUJA 3TPIZ 1T32A 3IWMA 1UO6A 5FBIA 1MMJN 1W14U 1J8AA 1ZJKA 2A2QH 3RMNH 1XM1A 1QQ4A 2PHBA 2CV3A 4O3UA 1HAZB 4UFFH 4WJG2 2ZP0H 1O3JA 3ZV9A 4Q2KA 1PQ8A 1SGFA 3K65B 1O3NA 1P06A 2BQWB 4TWYA 1S0QA 2SNWA 2VWMA 1G37A 1INCA 3HKIB 4ZHMU 2GP9B 5DGJA 5T6GA 3ZVBA 5H4IB 1GHWH 1A0JA 5ETXA 3GYMA 2XC4A 1BRCE 2ZDMA 3ZV8A 1PPCE 2OBOA 5CHAB 1MD8A 3T5FH 3MYWA 1H4WA 1MCVA 1O3DA 4IC5A 1LPKB 4B74A 2UWOA 3K2UA 1O2YA 4JYTA 2OTVA 2ZPRA 4D8NA 4A1VA 1EZQA 1ZYOA 1WTGH 1SVPA 3BTDE 2O8LA 4NWKA 1YF4A 4DT7B 3V13A 1K1OA 1SGPE 5DPAA 1P9UA 4GHTA 1LVOA 5CHAC 3RM0H 3B9FH 1BRBE 3STJA 3TGKE 3SNBA 2VWNA 2QXIA 1TA6A 1FONA 1H8IH 2RCEA 3MNBA 1MTWA 1UK3A 3AASA 3H7OA 1WU1A 2A5KA 8KME2 3DD2H 1P03A 1P04A 5AHGH 2O8TA 4ZUHA 3GOVB 1TPAE 3C27B 1SQTA 4IS5A 1EX3A 3TH2H 2FEQH 3EYDA 3SV6A 1RTKA 3SU4A 4LXBH 4VGCC 4MG3A 3F9EA 1C1VH 2QAAA 1E0FD 3ZZ5A 1ID5H 3UNQA 1RD3B 1EAWA 3V7TA 2ANKH 1BMLA 1Y59T 3BTFE 1YBWA 1ABIH 4NIVA 1TGCA 3MNSA 2EI8A 5C3NA 2VGCB 3U98H 1O32A 2TGDA 4K69A 4PROA 4NCYA 3CS7A 4CR5A 1TGNA 1K1MA 2C8YB 3AW1A 2C8XB 4U30A 1T4VH 4AFQA 1P10A 1ZTLA 4BAOB 2V0BA 4MNXA 1TPPA 1GJ4H 5IYTA 1IQFA 1MTVA 1SOTA 1OP8A 1G3EA 2A4GA 3A7YA 2ZZUH 1C1NA 3KQEA 1LHCH 1Q2WA 5EODA 4A92A 1GDNA 1RJXB 1HAVA 3NCLA 3SI4H 3MH5A 1OS8A 1L1JA 1BDAA 2BTCE 2BVSH 2ZTXA 5B6OA 3KEEA 5FBEA 1C4Y2 2ZFFH 1G3CA 1UVOA 2JETC 1A46H 1V2OT 1RTFB 5FPTA 5TCCA 2VIWA 3B23B 2F9VA 5DP8A 3RXOA 3CENA 3SU1A 3ZVFA 2ZPQA 1C2DA 1KYNA 1CA8B 4K1TA 1F5KU 2FS8A 1O39A 2PSYA 1Y8TA 2AEIH 1HJAB 4ESTE 2VU8E 1XUIA 1XX9A 3QZQA 1XMNB 1EQ9A 1UTOA 4TWWA 3FVFB 4LZ4B 1V2PT 2PWXA 3GCOA 4X2XA 7ESTE 3A82A 3S9AA 3BIVH 5GIBA 1FMGA 4KGAA 1AUTC 1LQDB 2PUXB 4UFGH 2BLVA 5E2OA 1THSH 1O2GH 3F9GA 3LGUA 2B7DH 1OX1A 1Y3VA 4UONA 3LU9B 2Y81A 3PROA 3N7OA 2OBQA 4K1SA 3AAVA 1BTZA 1KLJH 2GVFA 3RXKA 2ZI2H 3M7TA 1FN6A 3SNCA 1GBEA 2WPIS 3E8LA 3HPTB 5EW2H 3LH3A 1MTSA 3RXFA 1O34A 5EOKA 1TOMH 1MUEB 5J4SA 5L6NH 3ODFA 4O03A 1ABJH 1L1GA 1N6YA 2Z9IA 1F0UA 1TE0A 1GI5A 3DFJA 4SGAE 3JZ2B 1QCPA 1O2KA 2XXLA 1NS3A 4MDSA 4I7YH 6LPRA 1O3OA 1SGEE 1XKBC 2XWAA 3L33A 3BEUA 9ESTA 2QXJA 4X8SH 1OWDA 1O2TA 1AU8A 1L0ZA 3SHCH 2J9NA 3PWCA 1FAKH 4Z6AH 3M5LA 4AGJA 3P95A 2FOHA 4Y0ZE 2O8MA 1C1MA 1O3LA 2Y7XA 1EAUA 5FCRA 1HIAA 3ZZ8A 3NKKA 1GBHA 5EPNA 2PTNA 4DJZB 1BZXE 1C1PA 1FZZA 1ZHPA 3U69H 1LTOA 2D1JA 2H9TH 3GCTF 2I6SA 4CRGA 1NT1A 3U9AH 3SU3A 4UEHH 1AVGH 3V12A 1KIGH 2SNVA 1VITG 2JH0D 2KAIB 3SV8A 2IN2A 1GCDA 3UR9A 4MPWA 4MPVA 1EB1H 2P94A 2WPKS 4X1QU 8GCHF 1IQKA 1XXDA 4JZEH 4HZHA 2FDAA 1V3XA 1WSSH 4Z0KA 1FPHH 1NRQH 1UTLM 1Y3XA 5DP6A 1O5BB 1P2NA 2SFAA 3OY5U 2BD7A 3URCA 4HTCH 2ZTYA 1TONA 3DT0H 1SGIB 1HFDA 3RP2A 3VFEA 1VCPA 4DCDA 2HVXA 3T28A 1BHXF 4X2VA 1QRZA 1QRXA 2H5CA 4KELA 2YOLA 5FPSA 2AMDA 3M7QA 2ULLA 5DP9A 5GXPA 1ZPBA 3SV2H 3Q3XA 1A0HB 3SJ8A 3LKWA 4FU7A 4CRCA 1HNEE 3O8DA 1O3IA 3Q77A 4CHAB 1HXEH 4AFUA 3U1JB 4OGXA 4Y11E 1D6RA 1KXCA 5A8XA 3A8CA 3RDZA 3EDXB 2ZHFH 1EJNA 1K28D 3PMBB 1KTTB 1GI6A 1OYQA 1ZTKA 3RM2H 1XUHA 1Z1JA 5LPRA 4NSYA 1P01A 3C1KA 1EZUC 1UCYK 2WUCA 5EQQA 1MCTA 3PMJA 2ZNKH 4MLFB 5I25A 2UUFB 2B5TB 3U8RH 1XUKA 4A5TS 2GKVE 1FY1A 4D9RA 3RXAA 5A8YA 5A09A 1BRUP 3BF6H 1TRYA 1T8LA 2QF3A 2WYGA 3SGAE 1GHAG 3CP7A 2H6MA 5A0AE 1XVOA 1RIWC 1AFQB 1SLWB 1Z8GA 1ZPCA 1FV9A 3E16B 2A2XH 1NESE 2GT8A 3KF2A 1EJMA 2PW8H 4ISOA 3SO3A 3MOCA 3EE0B 1YPKH 2TGTA 2PUQH 3HATH 3HGPA 2D8WA 5JB8S 2JH5D 2DE8A 1HAYB 5GWZA 3RXMA 2I6QA 2GCTB 3GYLB 1W12U 1YGCH 3EA7A 4TY7A 1ZJDA 4YTAA 1Y5UT 3ZVEA 1P2OA 1TMTH 2ZECA 4IMQA 1EAXA 1KXAA 1O5AB 4OGYA 3RXLA 1GHAF 4X1RU 1GMCG 1MBMA 1CBWB 4ABGA 3MO3A 3LGYA 5C1XA 1J16A 3FP8E 1FJSA 4WXIA 1P2IA 1F92A 1CGIE 1LVYA 4B2CA 1C5RA 1O2PA 2XC0A 1SGTA 1C2FA 1ETRH 2QYIA 1EPTB 2XC5A 5JB9S 1A4WH 1Y3YA 3MFJA 4LZ1H 4GHQA 1LPGB 1HAHH 1GG6B 4DG4A 3UOPA 1AUJA 1DXPA 1P2KA 1YM0A 3NUMA 1GJAB 3AW0A 4ISLA 1F0SA 4WMEA 5TCAA 2XCNA 4AYVB 1UHBB 1DSTA 1K1LA 2BLQA 4CRAA 1THRH 1VGCB 2VWOA 1Y3WA 1TQ7B 1QRWA 1J17T 2SGQE 4GCHG 1ELCA 3EA9A 1BTHH 1L4DA 3Q3YA 1DPOA 2BDIA 1O36A 3DHKH 1SLXB 2B0FA 4AG1A 1SHHB 2BMGB 4KTUA 3ATWA 1HUTH 3S9CA 1O30A 2ZIQH 2OC8A 4CRDA 1J14A 3IITA 5L2YH 3TNTA 3M3SA 4R8TB 1C2HA 4AORA 1IQIA 3PMHB 1V2JT 2HRVA 6ESTA 2ZTZA 1GI3A 1SPJA 1C5TA 3GY8A 2P3FH 1FN8A 3UUZA 4ISIH 4DGJA 1ARBA 2H1UA 1CHGA 1SQOA 1RXPA 1CT2E 3P8GA 2HGTH 3GY3A 2WPJS 3LJOA 2FI4E 3B8JA 4ZKSU 1GJ6A 1TBQH 2QXGA 4Y7BA 5BRRE 2DUCA 1G32B 3PO1B 4GCHF 4H6SB 4XDEA 4Y10E 1ARCA 1SG8B 3SZNA 5PTPA 3ZZDA 1C5YB 4B2AA 2BDBA 2RG3A 2ZU3A 1P8VC 1SLUB 2FOFA 4JZ1A 1O2UA 1IOEA 3A7XA 1KXFA 2VWLA 1V2UT 2ZGBH 5F8ZA 5HYOA 2WV5A 2Q6FA 4BXWA 1K9OE 1D3QB 1AZ8A 1ELAA 3SBKA 1A3EH 3SGBE 4DVAU 3BTQE 1WTHD 2BDHA 1K1IA 2XW9A 2F9BH 2XBVA 2R2MB 4HFPB 4ABBA 1MZDA 1RS0A 1ZTJA 1A5GH 3PO1C 1PFXC 1C5PA 2FYRA 4MTBA 4UFEH 1NRSH 3LPRA 3OU0A 1AO5A 4AX9H 1EUFA 5HXFA 2W7SA 1F0TA 1OWHA 1O2XA 3SN8A 1GL1A 5K7RA 1YYY1 1OP0A 5CMXH 4JYVH 3KQBA 3A84A 1S82A 1GMHG 1S81A 4IMZA 1HCGA 3RC6A 1GI2A 1T4UH 3K6YA 1QL9A 1F7ZA 2F91A 2QXHA 2R2WU 3S69A 1IQNA 3UY9A 1UMAH 4DURA 1S0RA 1QL8A 4WVPE 1TRMA 2YNAA 3M61U 1NPMA 4O97A 2ODQA 3DUXH 3ATMA 3HKJB 3EQ0H 4B73A 2W3KA 2BY9X 1YPJH 1AWFH 2ZFRH 1XUFA 3SORA 3U1IB 3UPEA 5C1YA 3SJIA 3RU4E 5I46H 1NFXA 4YOIA 3OYPA 5SGAE 3F1SB 3RU4D 1KLIH 2AYWA 2FMJA 1W8BH 1TA2A 3SJOA 2TGAA 1A7SA 1P2QA 2FX4A 3LGWA 4Q7XA 3V0XA 4ZKOU 1GMHF 1DUAA 1P05A 2OD3B 1AZZA 1MH0A 2ZWLH 1DE7H 2CHAC 2FOGA 1V2NT 1UTQA 2UWPA 3KCGH 3T27A 1ETTH 4Y79A 4OS4A 1OOKB 1O35A 1YLDA 1O2QA 3ODDA 1YKTA 3PTBA 3NK8A 1EJAA 2FODA 4BTIB 1SSXA 1PQAA 3LOXA 1UCYE 2STAE 2P3UB 2Y5HA 3EA8A 3RXCA 5JBAS 4Y0YE 3SW2B 1H9HE 1N8OC 3UREA 4ZKRU 5T3HA 3G01A 4CR9A 3TK9A 4X6MA 1C5MD 3WY8A 2VIOA 1EOLA 4K8BA 3TJOA 3RXBA 4Y76A 1SGCA 4E05H 2XBYA 2NU4E 3JZ1B 2BOHB 1UK2A 2G5NA 3QDZB 5E0GA 1TPOA 1EZXC 5ESBA 3LDXH 3QTVH 1AB9C 1CVWH 1SGFG 3UIRA 1T31A 7LPRA 1CA0C 4XBBA 1CT4E 1CSOE 2OC7A 3PM3A 1CGHA 2H5DA 4A6LA 4MPUA 4XOJA 4O3TA 1MU8B 1FI8A 3O8BA 3RXEA 1DITH 1AY6H 4UFDH 3VXFH 4JK6A 3TGIE 1SGQE 3SNEA 1AIXH 2FX6A 2TRMA 2H9EH 4FUBA 1C9PA 1FIWA 5GJ4B 2OCVB 3UWJH 4I8KA 4JCNA 1DVAH 2Y82A 4GSOA 1C5VA 2F9OA 2ZEBA 2NU1E 3T2NA 3S0NA 4VGCB 4CBOA 4JYUH 2Q6GA 2C8ZB 4Y6DA 1NTPA 3LONA 1SB1H 1ESAA 5JYIA 3MU5A 2FTLE 1MQ6A 2J34A 5C5NA 2A32A 1TX7A 1YCPM 1G30B 2PTCE 3OTJE 1YPMH 4WXVA 1OKXA 2P95A 3MTYA 1NRPH 2BHGA 4FUDA 1P2JA 2UWLA 2AERH 1TGSZ 1Q31A 3TH4H 1LHEH 1WYKA 3ZZ3A 4Y8YA 2ALPA 3BTKE 2ZG0H 2A4OA 2XNIA 1NROH 1C5ZB 2ZHDA 3MNXA 3MH4A 4B75A 2FXRA 3UR6A 1SGRE 2GCHF 4RSPA 1GMDG 4YOGA 2UUKB 1Z8JB 2ZU2A 3A8BA 1HGTH 5DP4A 1DDJA 4I8HA 4NG9H 3I29A 2M5TA 1NN6A 1DOJA 2JETB 9LPRA 3MO9A 5C67A 1GVZA 2FS9A 4NZLA 4KP0A 3O8RA 3KNXA 2ODPA 3P70B 1Y3UA 2HPQH 3BIUH 5EGMA 5FXLA 1MZAA 1O3GA 2HWLB 2V3HH 1B0FA 2AFQB 1RRKA 2Q6DA 3BTHE 3RXJA 1BTXA 5DO4H 1HDTH 2OQ5A 1V2TT 3MHWU 4IW4E 3GDVA 1Z7KA 1C1RA 3QGJA 1KXEA 1P12E 2VJ1A 1ZRKA 2G00A 3TH3H 3GY6A 4WMFA 1GMDF 3GDSA 4FUIA 1GVKB 2VINA 1E37B 1UTPA 1GVLA 1PYTC 2GMTC 2Y80A 4XFQA 1TALA 3GCHC 5LGOA 2R0KA 1GBAA 1THPB 1JRSA 2AGIX 3M3TA 6CHAC 1V2WT 1WV7H 4UD9H 1S6FA 1SMFE 1DICA 1N1LA 2VIDA 1AWHB 3SOSA 1TAWA 3CS0A 1ZMLA 3LC5A 4AGKA 1ESTA 2W7UA 1C5XB 3F68H 4YO9A 4ISNA 1O5FH 3UFAA 1BBRH 1TMUH 4FUGA 2HPPH 2BD2A 3RXSA 1D3TB 1FUJA 8ESTE 2A7CA 1GJ5H 1MAYA 1IHSH 2JH6D 1HXFH 1O3EA 4AG2A 1LMWB 4ZHLU 2FO9A 1BITA 4X1NU 2ZGJA 2KAIA 2OINA 1O2ZA 2ZCKP 2Z9JA 1C4U2 3D49H 1GI9B 5HM2A 2TPIZ 3GCTG 1SLVB 1ELBA 1AHTH 3A7VA 3OSYA 4JK5A 3A88A 1FQ3A 3RMLH 4AN7A 4GAWA 1XVMA 5CE1A 3ATKA 4ABHA 1KDQB 1YCPH 1JWTA 4XBCA 3BEFB 2ZFTA 1BMNH 1D6WA 1OWIA 3BTEE 5G4BA 3PLKA 1C1UH 1O5DH 1GJBB 1HAVB 1MQ5A 8GCHG 1TNKA 3VPKA 1A5HA 3DA9B 2V35A 2A0QB 4I8LA 2C4FH 5DJ7A 3FZZA 1TLDA 3MWIU 2HOBA 1IQGA 3UNRA 1QY6A 2P59A 3RXRA 1WCZA 2PR3A 1LCYA 3UNSA 2GX4A 1P09A 2FOBA 4FVBA 3P6ZB 4YLQH 1BT7A 4NIYA 3A89A 2J4IA 1PPZA 2BZAA 2AGGX 3SV9A 2PSXA 1HAIH 2Y6TA 1VJ9U 1QJ6B 2AMQA 1OWEA 2J95A 2BY6X 5JBCS 3GICB 1DX5M 3GCNA 1IAUA 2STBE 1HRTH 1KLTA 1SQAA 1QJ7B 1DLKB 4YESB 2Y7ZA 4YLUA 2OC0A 4U2WA 1JIRA 2CF9H 1NU7B 1BTPA 2DE9A 1NZQH 2HLCA 1TBRH 2FPZA 3Q76A 1BMMH 2CXVA 3RLWH 1F5LA 2NU2E 3ESTA 1HV7A 1QB9A 1PJPA 3M36A 7GCHF 5IDKA 1P9SA 1OYTH 3KQDA 1QHRB 4X6NA 3TLOA 1TWXB 3U8TH 4RN6A 2XCFA 4H4FA 1QNJA 1QQUA 1EZSC 1NFYA 3ZVDA 1GDUA 3A7ZA 2ASUB 4I8GA 4ABDA 2GD4B 5DP7A 2HALA 1C5OH 1G3BA 1A0LA 3TU7H 1QA0A 1E36B 4YT7H 1RIWB 2VVCA 3BEIB 2F3CE 5AFYH 4YM9A 3GY2A 1BHXB 1ZHRA 5J4QA 3FP6E 1BA8B 1SGDE 1C5WB 3NPSA 3A80A 1HIAB 1L2EA 1EPTA 2SGEE 2K1QA 4BAMB 1QURH 3RLYH 2VVUA 1CT0E 5JBBS 4JZFH 1ZGIA 3BG8A 1C2MA 1UTNA 1PPFE 3KHVA 2RA3A 3S7KB 5ESTE 1AN1E 4X2YA 4ZROA 2BY5X 3RXIA 1T8NA 2GZ9A 3LH1A 2Y5GA 2FESH 1KXBA 1UHBA 2ANMH 4XBDA 2R0LA 3MH7A 1NRNH 3LGIA 1P0SH 1O3CA 2QCYA 1LKAA 1LHDH 4X6PA 3F6UH 4WWYA 2XBWA 1C5QA 4MVNA 3QWCH 2AGEX 2WV4A 4FU9A 1QR3E 2PGBB 3W94A 2O8WA 1O3KA 2ODYB 1MAXA 1TOCB 1DANH 1ZRBA 4Y7AA 4B71A 1EP5A 5E0JA 2IOTA 1TNIA 3TK5A 1H1BA 1H8DH 3L3TA 1O2RA 1DWCH 1GPZA 2A5AA 4X8UH 3F9HA 5C5OA 1DWDH 3I77A 3VB3A 4BNRA 3PV4A 1QBNA 4WY3A 3TVJB 3MO6A 6GCHG 2C93B 1DLEA 1SC8U 1G36A 3RXVA 1LKBA 1NFUA 1DFPA 4KTCA 1SL3A 1MD7A 1GI1A 2GZ7A 4D7GA 1O33A 1QB1A 5DG6A 1HAGE 2VH6A 2NWNA 1O3FA 3W95A 1ZSKA 2ILNA 1AQ7A 5A2MH 3BTME 1BRAA 3ZYEA 2ZC9H 1BOQA 1AE8H 2ZQ1A 1ZR0A 1F2SE 1C1OA 3QGNB 4ABAA 4AFSA 2Q1JA 4J2YB 2BDGA 2CGAA 7KMEH 3SNDA 1HAPH 3SQHE 4BOHA 6GCHF 1FXYA 3T29A 1FDPA 2GZ8A 4OS1A 4KTSA 2Z7FE 4ZAEA 5AFZH 3SJ9A 1VCWA 1GHZA 4AB9A 1TRNA 4WMDA 1G3DA 2C3SA 1BTWA 3R0FA 2FZZA 1GHYH 2R3UA 1EB2A 1C2LA 2A7HA 1TIOA 3S9BA 1K1JA 2GDEH 1TQ0B 1UK4A 1V2RT 3L6PA 1EOJA 4H42U 1ZZZA 4LOYH 1BJVA 1O5EH 1NO9H 1W7XH 5EQRA 5EPYA 2CF8H 3E3TA 2SGAA 3KIDU 2ZGHA 2J92A 1L4ZA 2IPHA 1GHXH 2FLBH 2RA0A 3M3VA 1HLTH 2OC1A 2ALVA 4B2BA 3VB6A 2D26C 2SGFE 5A0CA 1TX6A 1TX8A 1LDTT 3BTWE 3SU6A 3BSQA 5E8EH 1OPHB 1DSUA 4FUFA 1K1NA 1DM4B 2BD4A 1S6HA 1H9IE 1O2WA 2BB4A 1WUNH 3Q00A 2ZF0H 1QGFA 1MTNC 4I32A 1PYTD 1J9CH 1O37A 2ZDAH 3ZYDA 2XWBI 1LPZB 4LK4A 3UOUA 3UQOA 2ZGCA 5DKMA 3EAJA 1O0DH 3BG4C 4QT8C 1LHGH 3A8DA 1O2HA 1NC6A 2BQ7B 4WF8A 2ZKSA 1AD8H 2ZDNA 3ENSB 1UVSH 1YPEH 5FCKA 1O2NA 1QB6A 1F0RA 3D65E 4IGDA 2CHAB 2FWWA 4I8JA 1C1SA 1QIXB 1LQEA 1CGJE 4K5ZA 2EEKA 1KSNA 1NY22 2CN0H 1C9TA 3MMGA 3TGJE 4KKDA 2PKAB 1J15A 1C1WH 1BUIA 1ZLRA 1FAXA 1AGJA 1CHOF 1QFKH 4D9QA 3A7WA 1EASA 1G2MA 3LC3A 5HGGA 2SGDE 2UUYA 1U6QA 4JMYA 3KQCA 3GY7A 1GJCB 1E35B 1UVPA 1VITH 1GGDC 1GBCA 2G55A 1BTUA 2P8OC 3U8OH 2G4TA 1Z6EA 1N8OB 1GBKA 2P16A 1ELFA 1EXFA 5EU8A 1T8MA 1GL0E 4J1YA 5TJXA 3VGCC 1LVBA 4RKOB 4F4OC 1HBTH 1OWKA 5C1UA 2GGVB 1O3PB 1JIMA 4Q80A 4BAQB 1ANEA 1GCTB 1O38A 1MKWH 2Z9GA 4OS2A 1C2EA 3SQEE 1HYLA 1CE5A 1AB9B 2OLGA 1PQ5A 2J2UA 2R9PA 1CA0B 2QF0A 4YT6H 3ITIA 1SR5C 2ZHEH 1MKXH 1NRRH 1C4V2 2FI3E 4Y8ZA 2FYQA 8LPRA 1ZSLA 2AS9A 1DY8A 2F83A 1ZHMA 2PKSC 3RC4A 1AI8H 3QX5H 1GCTC 3GISB 1BB0B 1ETSH 2EA3A 4XSKU 1AKSB 5EXMA 3BTGE 1UVTH 2TBSA 1SOZA 1GI0A 2ZPSA 3A7TA 3SV7A 4CBNA 1AVWA 1F5RA 1TB6H 1AVXA 2BVXH 2ZU4A 4K60A 2ZO3H 3ZZAA 3GY5A 2FM2A 2CMYA 3TITA 1GBFA 3STIA 4BANB 2WINI 4ABJA 3H7TA 3RXUA 4MQAA 3QTOH 1PQ7A 1VZQH 1KXDA 4FVDA 1EAIA 1EATA 4HI3A 4NWLA 3RC5A 4D76A 1C1QA 1C2GA 3TIUA 2GCHG 1G2LA 4X2WA 2VNTA 2A4QA 2P93A 2BLWA 2WPHS 1YP9A 4A1XA 3DFLA 4AOQA 4JZIA 1TNHA 3RMMH 3A8AA 5FPYA 3QK1A 2FP7B 1A1RA 3P92A 1EKBB 1UVUH 2H9HA 2J94A 1O2OA 1O3MA 1GJ8B 3T62A 1KTSB 5A0BA 1BBRK 1OXGA 4ZHAA 5FX6A 2BX3A 3SU0A 4X0WU 2GTBA 1FLEE 3A86A 3A83A 2B9LA 5E0HA 3SU5A 4U32A 2A4RA 1C5SA 2VIVA 1S85A 2C8WB 2ESTE 4HGCA 4B1TA 3Q3KA 4I33A 3URDA 3VEQB 1QTFA 1G9IE 5DK1A 1D9IA 4TPIZ 4E06H 2FI5E 1B0EA 1A5IA 3K6ZA 2QGRA 1FY4A 4DOQA 1HAOH 2GMTB 1D3DB 4X1PU 3GCHB 3UQVA 1YCPK 2A1DB 1VJAU 1YPHE 1GBDA 2BD3A 1P2MA 4GLYA 4NIXA 6CHAB 1UTKA 2BQ6B 1CQQA 3E6PH 4NSVA 3FFGA 1H9LB 1OP2A 4E7RG 1UTJA 1P02A 1ZMNA 2BOKA 3TJUA 1ELVA 1O2MA 2A31A 3GY4A 2OQUA 1KDQA 4TPYA 1P3EA 4XE4A 5F8XA 3SGQE 4DIHH 1IQHA 2Z9KA 1FPCH 1WAYB 3GDUA 5F6MA 2VGCC 3P8NA 1ELTA 1P3CA 1PPHE 1ZOMA 3MU4A 3SNAA 1GI8B 2IJOB 3FANA 1DY9A 3UTUH 4YOJA 1IQJA 2LNCA 1BTYA 2A45B 3TJNA 1GI7B 1XUGA 1TABE 2QA9E 1UTMA 4NA9H 5FAHA 1DS2E 2BY8X 1V2VT 3SUGA 3M37A 3M5OA 2HNTE 1GHVH 1BCUH 1O2SA 5A8ZA 2ZGXH 1C5UA 1NU9A 2ZFPH 3T26A 3E0NB 3BV9B 1GBMA 3A81A 4A7IB 3MU0A 5ABWA 1K2I1 2NU0E 3ATLA 1T7CA 1QBOA 5DP5A 1JBUH 3LGVA 4OS6A 2FOCA 1O5CB 1FY3A 4Q7YA 1SHYA 4FUEA 1W2KH 2V6NA 1S84A 4GVUA 1RTLA 3E90B 2OP9A 1C5NH 3ZZ7A 2BX4A 3R3GB 4I31A 3ZZBA 1PPGE 1GHBG 2OXSA 1SGYE 1Z71A 4JZDH 1HJAC 2W3IA 1KY9A 1SI5H 1JRTA 2CJIA 1QA7A 4INKA 3ZZ4A 1LVMA 5T6FA 1YC0A 1D3PB 4INLA 4GPGA 3ZVCA 3FAOA 1AE5A 4NZQA 4Y71A 1C5LH 2Z3CA 1IQEA 2BLOA 2XRCA 2EI6A 2O9QA 3M5NA 1OWJA 1DWBH 1V2KT 1UJ1A 2BY7X 2NU3E 3PMAB 4CRBA 3LGTA 3RXDA 4BTTB 3RUOA 3VB4A 1ACBE 5JBTA 4NFEA 1A3BH 1OSSA 2D2DA 4OS7A 4R0IA 7GCHG 1A2CH 3SUDA 4YZUA 5L30H 4DIIH 4K1EA 3RU4T 1GHBF 2GV7A 4OS5A 2PV9B 3SUFA 1O2IA 2BVRH 4NA8A 3I78A 2PGQB 2FOMB 1C1TA 2UUJB 4O9VA 1ANCA 4AB8A 5HMAA 3AAUA 1W0ZU 3ZZ6A 1O2VA 3PLPA 1TNGA 4FUHA 1MTUA 2ZFSA 3MNCA 1C2IA 2Z94A 3QN7A 3K9XB 1B7XB 4UDWH 2ZDLA 1V2QT 1BJUA 1WQVH 4X6OA 3MU8A 1DUEA 2W5EA 2YNBA 4U01A 1M9UA 1Q3XA 3LJJA 1O3AA 5EXLA 2ZCHP 1N6XA 1VR1H 3ZVAA 4ABFA 4MNWA 1W10U 1MBQA 1SFQB 3ATIA 4BTUB 2G51A 4ASHA 3TK6A 4K8YA 1TGTA 3ELAH 3M35A 3OX7U 4X1SU 4IBLH 4AZ2B 3HK3B 3PYHA 2XTTB 3FP7E 2WUBA 2WPMS 3A85A 1W7GH 4NA7A 4F49A 5T6DA 1ELGA 2PLXA 3M7UA 1AFEH 1BMAA 1VITF 1FNIA 3EGKH 3RXGA 1GJ7B 3PLBA 2TIOA 1QBVH 1HPGA 1IQMA 3M5MA 1GBTA 4MPXA 5JDUB 3A87A 2ZHQH 2Z3DA 3TNSA 3QO6A 3FZDA 3ZZCA 2ZU1A 2F9UA 2QY0B 2AIPA 1XXFA 3RXPA 1A61H 2VH0A 1O5GH 2O8UA 1HAXB 1ANDA 1YPLH 1BBRE 2ANWA 5FHTA 1TPSA 2FIRH 4M7GA 1D4PB 1GBIA 4RKJB 1GJDB 1TYNA 4WH8A 2BXTH 4THNH 2HNTF 2F9PA 5BPEA 2BD5A 2AH4X 3NXPA 2FLRH 1WOFA 4CHAC 4H6TA 3QZRA 1Z6JH 4K2YA 4BAHB 1GJ9B 1PPBH 1S5SA 1TNJA 2JKHA 2Z3EA 1E38B 1W0YH 3T25A 4FU8A 3PB1E 1YPHC 3MU1A 1C2KA 2WPLS 1TGBA 2LPRA 3P17H 1ZPZA 2XBXA 3D62A 3UWIA 3AVZA 1C2JA 1NM6A 1FY8E 3E1XB 3VB5A 1TBZH 1HJ9A 1TNLA 1DWEH 1SBWA 1ELDE 1O2LA 2QN5T 4A1TA 1ZSJA 1PPEE 3RMOH 2BM2A 2ZQ2A 3E0PB 4K3JA 1AFQC 1SFIA 1O2JA 2Z6BD 4ZKNU 4E7NA 2ZA5A 2PFEA 5L2ZH 2SGPE 1GI4A 1NFWA 5LH8A 1DT2A 2FOEA 3NZIA 1P11E 1Y5BT 4DW2U 2WYJA 3LIWA 2OUAA 4TY6A 2ZU5A 3H5CB 4IN1A 3HGNA 1BQYA 5DP3A 4ZXXH 2HNTC 4CH8B 1TFXA 3NWUA 2GCTC 1HB0B 2TGPZ 5F03A 4CH2B 1GBLA 2G5VA 5C2ZA 4Q7ZA 2AIQA 5HM9A 1T8OA 4IN2A 1UCYH 1GDQA 3SUEA 1YPGH 1GBBA 5C20A 4BXSA 1CBWC 1FIZA 4BAKB 1GBJA 3V3MA 2FOAA 4SGBE 1X7AC 1K22H 1B5GH
chains in the Genus database with same CATH superfamily
3QUMP 1EPTC 1Z8IB 4ABIA 1GMCF 3RXHA 2BYAX 5AF9H 2AMPA 3LT3A 2BZ6H 1GG6C 1QJ1B 5GDSH 4GUXA 4AYYB 1ZMJA 1NBME 1XKAC 2IJD1 2G4UA 1VGCC 1NBMD 1CO7E 3SU2A 4CREA 2V3OH 2PKAA 1MTNB 2W6ID 5GCHG 2ZHWH 3HK6B 4X8VH 3RXQA 2QIQA 1V2LT 3BTTE 1L1NA 1IQLA 1O3BA 2BXUH 5EG4A 3WWBA 5LPEA 3BG4B 2BDCA 5GPIB 2QF5A 2F9NA 2VB0A 2B8OH 2HLDD 4AFZA 2GT7A 2ANYA 4Y8XA 4IC6A 5K0HA 1MKWK 1WQSA 3SI3H 1AMHA 4FUJA 3CNRA 1V6DA 2XYAA 1CU1A 2VIPA 2RDLA 3PWBA 1FY5A 2VIQA 4ISHH 1K1PA 5JPMH 1DXWA 2QC2A 3KQ5A 2ZDKA 4WH6A 1CHOG 1O31A 1YLCA 1W11U 4X8TH 2W26A 3VB7A 4NFFA 1RFNA 4DY7B 1TMBH 3SZEA 2RFKC 1ORFA 2C90B 1LO6A 1MKXK 3ZVGA 3P8OA 3TJVA 3KL6A 5EXNA 4ZH8A 3F9FA 4FUCA 2G81E 3E91A 5GCHF 3VXEH 1VCQA 4CRFA 1P57B 1Z8RA 1V2MT 1EP6A 1GGDB 1JOUB 3OEHD 5F8TA 3ZZ9A 3MI4A 3IG6B 3SJKA 2P8OB 4B6FA 4D7FA 4MNVA 1HJ8A 1EFRD 2A7JA 2EY4C 2QV1A 2VVVA 5FX5A 1O3HA 3RXTA 2BDAA 1E34B 2QF4A 4YXWD 1SGNE 5LPFA 2FTMA 3P8FA 4INHA 1AKSA 1Y5AT 3VGCB 2BD8A 1GWAA 4ZMAH 2ZCLP 2J5UA 1W13U 5E2PA 1BIOA 1ESBA 1YWUA 2EC9H 4NGAH 1S83A 1LHFH 3PTNA 5C94A 1Z1IA 4UE7H 2THFB 2GV6A 2EI7A 3S7HB 4MNYA 5EW1H 1W3CA 1ZGVA 2Y5FA 4ZXYH 3KN2A 1V2ST 3QLPH 2R3YA 4TYDA 2ZFQH 2BD9A 4ABEA 1IHTH 4FXGH 1RGQA 2G52A 1WBGB 1ANBA 2PKSB 2ZDVH 3KGPA 5AVDA 2BDYA 2H2ZA 2Z9LA 3N99A 2P3TB 4B76A 1QL7A 2GDDA 2A5IA 1JMOH 3SHAH 3MH6A 3O8CA 5EQSA 2G8TA 3OY6U 1ELEE 3BN9A 1K21H 1JXPA 3D23A 4NIWA 1MU6B 2J38A 1K0HA 1XUJA 3TPIZ 1T32A 3IWMA 1UO6A 5FBIA 1MMJN 3F2HA 1W14U 1J8AA 1ZJKA 2A2QH 3RMNH 1XM1A 1QQ4A 2PHBA 2CV3A 4O3UA 1HAZB 4UFFH 4WJG2 2ZP0H 1O3JA 3ZV9A 4Q2KA 1PQ8A 1SGFA 3K65B 1O3NA 1P06A 2BQWB 4TWYA 1S0QA 2SNWA 2VWMA 1G37A 1INCA 3HKIB 4ZHMU 2GP9B 5DGJA 5T6GA 3ZVBA 5H4IB 1GHWH 1A0JA 5ETXA 3GYMA 2XC4A 1BRCE 2ZDMA 3ZV8A 1PPCE 2OBOA 5CHAB 1MD8A 3T5FH 3MYWA 1H4WA 1MCVA 1O3DA 4IC5A 1LPKB 4B74A 2UWOA 3K2UA 1O2YA 4JYTA 2OTVA 2ZPRA 4D8NA 4A1VA 1EZQA 1ZYOA 1WTGH 1SVPA 3BTDE 2O8LA 4NWKA 1YF4A 4DT7B 3V13A 1K1OA 4RT1A 1SGPE 5DPAA 1P9UA 4GHTA 1LVOA 2YMSB 5CHAC 2JDID 3RM0H 3B9FH 1BRBE 3STJA 3TGKE 2L6OA 3SNBA 2VWNA 2QXIA 1TA6A 1FONA 1H8IH 2RCEA 2F4LA 3MNBA 1MTWA 1UK3A 3AASA 3H7OA 1WU1A 2A5KA 8KME2 3DD2H 1P03A 1P04A 5AHGH 2O8TA 4ZUHA 3GOVB 1TPAE 3C27B 1SQTA 4IS5A 1EX3A 5EJLA 3TH2H 2FEQH 3EYDA 3SV6A 1RTKA 3SU4A 4LXBH 4VGCC 4MG3A 3F9EA 1C1VH 2QAAA 1E0FD 3ZZ5A 1ID5H 3UNQA 1RD3B 1EAWA 3V7TA 2ANKH 1BMLA 1Y59T 3BTFE 1YBWA 1ABIH 4NIVA 1TGCA 3MNSA 2EI8A 5C3NA 4TT3D 2VGCB 3U98H 1O32A 2TGDA 4K69A 2CK3D 4PROA 4NCYA 3CS7A 4CR5A 1TGNA 1K1MA 2C8YB 3AW1A 2C8XB 4U30A 1T4VH 4AFQA 1P10A 1ZTLA 2J98B 4BAOB 2V0BA 4MNXA 1TPPA 1GJ4H 5IYTA 1IQFA 1MTVA 1SOTA 1OP8A 1G3EA 2A4GA 3A7YA 2ZZUH 1C1NA 3KQEA 1LHCH 1Q2WA 5EODA 4A92A 1GDNA 1RJXB 1HAVA 3NCLA 3SI4H 3MH5A 1OS8A 1L1JA 1BDAA 2BTCE 2BVSH 2ZTXA 5B6OA 3KEEA 5FBEA 1C4Y2 2ZFFH 1G3CA 5HIYA 1UVOA 2JETC 1A46H 4FETA 1V2OT 1RTFB 5FPTA 5TCCA 2VIWA 3B23B 2F9VA 5DP8A 3RXOA 3CENA 3SU1A 3ZVFA 2ZPQA 1C2DA 1KYNA 1CA8B 4K1TA 3N7EA 1F5KU 2FS8A 1O39A 2PSYA 1Y8TA 2AEIH 1HJAB 4ESTE 2VU8E 1E1QD 1XUIA 3WW7A 1XX9A 3QZQA 1XMNB 1EQ9A 1W0KD 1UTOA 4TWWA 3FVFB 4LZ4B 1V2PT 2PWXA 3GCOA 4X2XA 2KFWA 7ESTE 3A82A 3S9AA 3BIVH 5GIBA 1FMGA 4KGAA 1AUTC 1LQDB 2PUXB 4UFGH 2BLVA 5E2OA 1THSH 1O2GH 3F9GA 3LGUA 2B7DH 1OX1A 1Y3VA 4UONA 3LU9B 2Y81A 3PROA 3N7OA 2OBQA 4K1SA 3AAVA 2RDEA 1BTZA 1KLJH 2GVFA 3RXKA 2ZI2H 3M7TA 1FN6A 3SNCA 1GBEA 2WPIS 3E8LA 3HPTB 5EW2H 3UB0A 3LH3A 1MTSA 3RXFA 1O34A 5EOKA 1TOMH 1MUEB 5J4SA 5L6NH 3N7DA 3ODFA 4O03A 1ABJH 1L1GA 1FX0B 1N6YA 1F0UA 1TE0A 1GI5A 2Z9IA 3DFJA 4SGAE 3JZ2B 1QCPA 1O2KA 2XXLA 1NS3A 4MDSA 4I7YH 6LPRA 1O3OA 1SGEE 1VKYA 1XKBC 2XWAA 3L33A 3BEUA 9ESTA 2QXJA 4X8SH 1OWDA 1O2TA 1AU8A 1L0ZA 1E79D 5T1VA 3SHCH 2J9NA 3PWCA 1FAKH 4Z6AH 3M5LA 5KGOA 4AGJA 3P95A 2FOHA 4Y0ZE 2O8MA 1C1MA 1O3LA 2Y7XA 1EAUA 5FCRA 1HIAA 3FOAA 3DSPA 3ZZ8A 3NKKA 1GBHA 5EPNA 2PTNA 4DJZB 4P02A 1BZXE 1C1PA 1FZZA 1ZHPA 3U69H 1LTOA 2D1JA 2H9TH 3GCTF 2I6SA 4CRGA 1NT1A 3U9AH 3SU3A 4UEHH 1AVGH 3V12A 1KIGH 2SNVA 1VITG 3FKSD 2JH0D 3NRLA 2KAIB 3SV8A 2IN2A 1GCDA 3UR9A 4MPWA 4MPVA 4AC9A 3PV2A 1EB1H 2K8IA 2P94A 2WPKS 4X1QU 8GCHF 1IQKA 1XXDA 4JZEH 3F2GA 4HZHA 2FDAA 1V3XA 1WSSH 4Z0KA 1FPHH 1NRQH 1UTLM 1Y3XA 5DP6A 1O5BB 1P2NA 2SFAA 3OY5U 2BD7A 3URCA 4HTCH 1W0JD 2ZTYA 3F0PA 1TONA 3DT0H 1SGIB 1HFDA 3RP2A 3VFEA 1VCPA 4DCDA 2HVXA 3T28A 1BHXF 4X2VA 1QRZA 1QRXA 2H5CA 1QZ8A 4KELA 2YOLA 5FPSA 2AMDA 3M7QA 2ULLA 5DP9A 5CHBA 5GXPA 1ZPBA 3SV2H 3Q3XA 1A0HB 3SJ8A 3LKWA 4FU7A 4CRCA 1HNEE 3O8DA 1O3IA 3Q77A 4CHAB 1HXEH 4AFUA 3U1JB 4OGXA 4Y11E 1D6RA 1KXCA 5A8XA 3A8CA 3RDZA 3EDXB 2ZHFH 1EJNA 1K28D 3PMBB 1KTTB 1GI6A 1OYQA 1ZTKA 3RM2H 1XUHA 1Z1JA 5LPRA 4NSYA 1P01A 3C1KA 1EZUC 1UCYK 2WUCA 5EQQA 1MCTA 3PMJA 2ZNKH 4MLFB 5I25A 2UUFB 2B5TB 3U8RH 1XUKA 4A5TS 2GKVE 1FY1A 4D9RA 3RXAA 5A8YA 5GNDA 5A09A 1BRUP 3BF6H 1TRYA 1T8LA 2QF3A 2WYGA 3SGAE 1GHAG 3CP7A 2H6MA 5A0AE 1XVOA 1RIWC 1AFQB 1SLWB 1Z8GA 1ZPCA 1FV9A 3E16B 2A2XH 1NESE 2GT8A 3KF2A 1EJMA 2PW8H 4ISOA 3SO3A 3MOCA 3EE0B 1YPKH 2TGTA 2PUQH 3HATH 3HGPA 2D8WA 2F43B 5JB8S 2JH5D 2DE8A 1HAYB 5GWZA 3RXMA 1S6LA 2I6QA 2GCTB 3GYLB 1W12U 1YGCH 3EA7A 4TY7A 1ZJDA 4YTAA 1Y5UT 3ZVEA 1P2OA 1TMTH 2ZECA 4IMQA 1EAXA 1KXAA 1O5AB 4OGYA 3RXLA 1GHAF 4X1RU 1GMCG 1MBMA 1CBWB 4ABGA 3MO3A 3LGYA 5C1XA 1J16A 3FP8E 1FJSA 4WXIA 1P2IA 1F92A 1CGIE 1LVYA 4B2CA 1C5RA 1O2PA 2XC0A 1SGTA 1C2FA 1ETRH 2QYIA 1EPTB 2XC5A 5JB9S 1A4WH 1Y3YA 3MFJA 4LZ1H 3MQKC 4GHQA 1LPGB 1HAHH 1GG6B 4DG4A 3UOPA 1AUJA 1DXPA 1P2KA 1YM0A 3NUMA 1GJAB 3AW0A 4ISLA 1F0SA 4WMEA 5TCAA 2XCNA 4AYVB 1UHBB 1DSTA 1K1LA 2BLQA 4CRAA 3DSOA 1THRH 1VGCB 2VWOA 1Y3WA 1TQ7B 1QRWA 1J17T 2SGQE 4GCHG 1ELCA 3EA9A 1BTHH 1L4DA 3Q3YA 1DPOA 2BDIA 1O36A 3DHKH 1SLXB 2B0FA 4AG1A 1SHHB 2BMGB 4KTUA 3ATWA 1HUTH 3S9CA 1O30A 2ZIQH 2OC8A 4CRDA 1J14A 3IITA 5L2YH 3TNTA 3M3SA 4R8TB 1C2HA 4AORA 1IQIA 3PMHB 3EE7A 1V2JT 2HRVA 6ESTA 2ZTZA 1GI3A 1SPJA 1C5TA 3GY8A 2P3FH 1FN8A 3UUZA 4ISIH 4DGJA 1ARBA 2H1UA 1CHGA 1SQOA 1RXPA 1CT2E 3P8GA 2HGTH 4RT0A 3GY3A 2WPJS 3LJOA 2FI4E 3B8JA 4ZKSU 1GJ6A 1UW7A 1TBQH 2QXGA 4Y7BA 5BRRE 2DUCA 1G32B 3PO1B 4GCHF 4H6SB 4XDEA 4Y10E 1ARCA 1SG8B 3SZNA 5PTPA 3ZZDA 1C5YB 4B2AA 2BDBA 2RG3A 2ZU3A 1P8VC 1SLUB 2FOFA 4JZ1A 1O2UA 1IOEA 3A7XA 1KXFA 2VWLA 1V2UT 2ZGBH 5F8ZA 5HYOA 2WV5A 2Q6FA 4BXWA 1K9OE 1D3QB 1AZ8A 1ELAA 3SBKA 1A3EH 3SGBE 4DVAU 3BTQE 1WTHD 2BDHA 1K1IA 2XW9A 2F9BH 2XBVA 2R2MB 4HFPB 4ABBA 1MZDA 1RS0A 1ZTJA 1A5GH 3PO1C 1PFXC 1C5PA 2FYRA 4MTBA 4UFEH 1NRSH 3LPRA 3OU0A 1AO5A 4AX9H 1EUFA 5EJ1A 5HXFA 2W7SA 3PRDA 1F0TA 1OWHA 1O2XA 3SN8A 1GL1A 2KCPA 5K7RA 1YYY1 1OP0A 5CMXH 4JYVH 3KQBA 3A84A 5C0UA 1S82A 1GMHG 1S81A 4IMZA 1HCGA 3RC6A 1GI2A 1T4UH 3K6YA 1QL9A 1F7ZA 2F91A 2QXHA 3WWFA 2R2WU 3S69A 2AHME 1IQNA 3UY9A 1UMAH 4DURA 1S0RA 1QL8A 4WVPE 1TRMA 2YNAA 3M61U 1NPMA 4O97A 2ODQA 3DUXH 3ATMA 3HKJB 3EQ0H 4B73A 2W3KA 2BY9X 1YPJH 1AWFH 2ZFRH 1XUFA 3SORA 3U1IB 3UPEA 5C1YA 3SJIA 3RU4E 5I46H 1NFXA 4YOIA 3OYPA 5SGAE 3F1SB 3RU4D 1KLIH 4ACBA 2AYWA 2FMJA 1W8BH 1TA2A 3SJOA 2TGAA 1A7SA 1P2QA 2FX4A 3LGWA 4Q7XA 3V0XA 4ZKOU 1GMHF 1DUAA 1P05A 2OD3B 1AZZA 1MH0A 2ZWLH 1DE7H 2CHAC 2FOGA 1V2NT 1UTQA 2UWPA 3KCGH 3T27A 1ETTH 4Y79A 4OS4A 1OOKB 1O35A 1YLDA 1O2QA 3ODDA 1YKTA 3PTBA 3NK8A 1EJAA 2FODA 4BTIB 1SSXA 1PQAA 3LOXA 1UCYE 2STAE 2P3UB 2Y5HA 3EA8A 3RXCA 5JBAS 4Y0YE 3SW2B 1H9HE 1N8OC 3UREA 4ZKRU 5T3HA 3G01A 4CR9A 3TK9A 4X6MA 1C5MD 3WY8A 2VIOA 1EOLA 4K8BA 3TJOA 3RXBA 4Y76A 1SGCA 4E05H 2XBYA 2NU4E 3JZ1B 2BOHB 1UK2A 2G5NA 3QDZB 5E0GA 1TPOA 1EZXC 5ESBA 3LDXH 3QTVH 2WPDD 1H8HD 1AB9C 1CVWH 1SGFG 3UIRA 1T31A 7LPRA 1CA0C 4XBBA 1CT4E 1CSOE 2OC7A 3PM3A 2KZ4A 1CGHA 2H5DA 2WSSD 4A6LA 4MPUA 4XOJA 4O3TA 1MU8B 1FI8A 2J98A 3O8BA 3RXEA 1COWD 1DITH 1AY6H 3F3BA 4UFDH 3VXFH 4JK6A 3TGIE 1SGQE 3SNEA 1AIXH 2FX6A 2TRMA 4Z1MD 2H9EH 4FUBA 1C9PA 1FIWA 5GJ4B 2OCVB 3UWJH 4I8KA 2HVYB 4JCNA 1DVAH 2Y82A 4GSOA 1C5VA 2F9OA 2ZEBA 2NU1E 3T2NA 3S0NA 4VGCB 3OAAD 4CBOA 4JYUH 4TSFD 2Q6GA 2C8ZB 4Y6DA 1NTPA 3LONA 1SB1H 1ESAA 5JYIA 3MU5A 2FTLE 1MQ6A 2J34A 5C5NA 2M2AA 2A32A 1TX7A 1YCPM 1G30B 2PTCE 3OTJE 1YPMH 4WXVA 1OKXA 2P95A 3MTYA 1NRPH 2BHGA 4FUDA 1P2JA 2UWLA 2AERH 1TGSZ 1Q31A 3TH4H 1LHEH 1WYKA 3ZZ3A 4Y8YA 2ALPA 2JJ2D 3BTKE 2ZG0H 2A4OA 2XNIA 1NROH 2KCAA 1C5ZB 2ZHDA 3MNXA 3MH4A 4B75A 2FXRA 3UR6A 1SGRE 4I86A 2GCHF 4RSPA 1GMDG 4YOGA 2UUKB 1Z8JB 2ZU2A 3A8BA 1HGTH 5DP4A 1DDJA 4I8HA 4NG9H 3I29A 2M5TA 1NN6A 1DOJA 2JETB 9LPRA 3MO9A 5KEDA 5C67A 1GVZA 2FS9A 4NZLA 4KP0A 3O8RA 3KNXA 2ODPA 3P70B 1Y3UA 2HPQH 1H8ED 3BIUH 5EGMA 5FXLA 1MZAA 1O3GA 2HWLB 2V3HH 1B0FA 2AFQB 1RRKA 2Q6DA 3BTHE 3RXJA 1BTXA 5DO4H 1HDTH 2OQ5A 1V2TT 3MHWU 4IW4E 3GDVA 1Z7KA 1C1RA 3QGJA 1KXEA 1P12E 2VJ1A 1ZRKA 2G00A 3TH3H 3GY6A 4FOUC 4WMFA 1GMDF 3GDSA 4FUIA 1GVKB 2VINA 1E37B 1UTPA 1GVLA 1PYTC 2GMTC 2Y80A 4XFQA 1TALA 3GCHC 3DSGA 5LGOA 2R0KA 1GBAA 1THPB 1JRSA 2AGIX 2V3MA 3M3TA 6CHAC 1V2WT 1WV7H 4UD9H 1S6FA 1SMFE 1DICA 1N1LA 2VIDA 1AWHB 3SOSA 1TAWA 3CS0A 1ZMLA 3LC5A 4AGKA 1ESTA 2W7UA 1C5XB 3F68H 4YO9A 4ISNA 1O5FH 3UFAA 1BBRH 1TMUH 2KCYA 4FUGA 2HPPH 2BD2A 3RXSA 1D3TB 1FUJA 8ESTE 2A7CA 1GJ5H 1MAYA 1IHSH 2JH6D 1HXFH 1O3EA 4AG2A 1LMWB 4ZHLU 2FO9A 1BITA 4X1NU 2ZGJA 2KAIA 2OINA 1O2ZA 2ZCKP 2Z9JA 4DT4A 1C4U2 3D49H 1GI9B 5HM2A 2TPIZ 3GCTG 1SLVB 1ELBA 2KCOA 1AHTH 3A7VA 3OSYA 4JK5A 3A88A 1FQ3A 3RMLH 4AN7A 4GAWA 1XVMA 5CE1A 3ATKA 4ABHA 1KDQB 1YCPH 1JWTA 4XBCA 3BEFB 2ZFTA 1BMNH 1D6WA 1OWIA 3BTEE 5G4BA 3PLKA 1C1UH 1O5DH 1GJBB 1HAVB 1MQ5A 8GCHG 1TNKA 3VPKA 1A5HA 3DA9B 2V35A 2A0QB 4I8LA 2C4FH 5DJ7A 3FZZA 1TLDA 3MWIU 2HOBA 1IQGA 4XD7D 3UNRA 1QY6A 2P59A 2JJ1D 3RXRA 1WCZA 2PR3A 1LCYA 3UNSA 2GX4A 1P09A 2FOBA 4FVBA 3P6ZB 4YLQH 1BT7A 4NIYA 3A89A 2J4IA 1PPZA 2BZAA 2AGGX 3SV9A 2PSXA 1HAIH 2Y6TA 1VJ9U 1QJ6B 2AMQA 1OWEA 2J95A 4RI0A 2BY6X 5JBCS 3GICB 1DX5M 3GCNA 1IAUA 2STBE 1HRTH 1KLTA 1SQAA 1QJ7B 1DLKB 4YESB 2Y7ZA 4YLUA 2OC0A 4U2WA 1JIRA 2CF9H 1NU7B 1BTPA 2DE9A 1NZQH 2HLCA 1TBRH 2FPZA 3Q76A 1BMMH 2CXVA 5DN6D 3RLWH 1F5LA 4F55A 2NU2E 3ESTA 1HV7A 1QB9A 1PJPA 3M36A 7GCHF 5IDKA 1P9SA 1OYTH 3KQDA 5C17A 1QHRB 3OFND 4ZCNA 4X6NA 3TLOA 1TWXB 5HIZA 3U8TH 4RN6A 2XCFA 4H4FA 1QNJA 1QQUA 1EZSC 1NFYA 3ZVDA 1GDUA 3A7ZA 2ASUB 4I8GA 4ABDA 2GD4B 5DP7A 2HALA 3F2FA 1C5OH 1G3BA 1A0LA 3TU7H 1QA0A 1E36B 4YT7H 5FL7D 1RIWB 2VVCA 3BEIB 2F3CE 5AFYH 4YM9A 3GY2A 1BHXB 1ZHRA 5J4QA 3FP6E 1BA8B 1SGDE 1C5WB 3NPSA 3A80A 1HIAB 2V7QD 1L2EA 1EPTA 2SGEE 2K1QA 2KM0A 4BAMB 1QURH 3OEED 3RLYH 2VVUA 1CT0E 5JBBS 4JZFH 1ZGIA 3BG8A 1C2MA 1UTNA 1PPFE 3KHVA 2RA3A 3S7KB 5ESTE 1AN1E 4X2YA 4ZROA 2BY5X 3RXIA 1T8NA 2GZ9A 3LH1A 2Y5GA 2FESH 1KXBA 1UHBA 3OTPA 2ANMH 4XBDA 2R0LA 3MH7A 1NRNH 3LGIA 1P0SH 1O3CA 2QCYA 1LKAA 1LHDH 4X6PA 3F6UH 4WWYA 2XBWA 1C5QA 4MVNA 3QWCH 2AGEX 2WV4A 4FU9A 3F0OA 1QR3E 2PGBB 3W94A 2O8WA 1O3KA 2ODYB 1MAXA 1TOCB 1DANH 1ZRBA 4Y7AA 4B71A 1EP5A 5E0JA 2IOTA 1TNIA 3TK5A 1H1BA 1H8DH 3L3TA 1O2RA 1DWCH 1GPZA 2A5AA 4X8UH 3F9HA 5C5OA 1DWDH 3I77A 3VB3A 4BNRA 3PV4A 1QBNA 4WY3A 3TVJB 3MO6A 6GCHG 2C93B 1DLEA 1SC8U 3PRBA 1G36A 3RXVA 1LKBA 1NFUA 1DFPA 4KTCA 1SL3A 1MD7A 1GI1A 2GZ7A 4D7GA 1O33A 1QB1A 5DG6A 1HAGE 2VH6A 2NWNA 1O3FA 3W95A 1ZSKA 2ILNA 1AQ7A 5A2MH 3BTME 1BRAA 3ZYEA 2ZC9H 1BOQA 1AE8H 2ZQ1A 1ZR0A 1F2SE 4M9FA 3UAIC 1C1OA 3QGNB 4ABAA 4AFSA 2Q1JA 4J2YB 2BDGA 2CGAA 4F48B 7KMEH 3SNDA 1HAPH 3SQHE 4BOHA 6GCHF 1FXYA 3T29A 1FDPA 2GZ8A 4OS1A 5EJZA 4KTSA 2Z7FE 4ZAEA 5AFZH 3H09A 3SJ9A 1VCWA 1GHZA 4AB9A 1TRNA 4WMDA 1G3DA 4ASUD 2C3SA 1BTWA 3R0FA 2FZZA 1GHYH 2R3UA 1EB2A 1C2LA 2A7HA 1TIOA 1SQRA 2IPQX 3S9BA 1K1JA 3FO8D 2K0QA 2GDEH 1TQ0B 1UK4A 1V2RT 2YMSD 3L6PA 1EOJA 4H42U 2OK5A 1ZZZA 4LOYH 2PP6A 1BJVA 1O5EH 3OE7D 1SKYE 1NO9H 1W7XH 5EQRA 5EPYA 5KECA 2CF8H 3E3TA 2SGAA 3KIDU 2ZGHA 2J92A 1L4ZA 2IPHA 1GHXH 2FLBH 2RA0A 3M3VA 1HLTH 2OC1A 2ALVA 5C0TA 4B2BA 3VB6A 2D26C 2SGFE 5A0CA 1TX6A 1TX8A 1LDTT 3BTWE 3SU6A 3BSQA 5E8EH 1OPHB 1DSUA 4FUFA 1K1NA 2WZQA 1DM4B 2BD4A 1S6HA 1H9IE 1O2WA 2BB4A 1WUNH 3Q00A 2ZF0H 1QGFA 1MTNC 4I32A 1PYTD 1J9CH 1O37A 2GJGA 2ZDAH 3ZYDA 2XWBI 1LPZB 4LK4A 3UOUA 3UQOA 2ZGCA 5DKMA 3EAJA 1O0DH 3BG4C 2WHXA 4QT8C 1LHGH 3A8DA 1O2HA 2WV9A 1NC6A 2BQ7B 4WF8A 2ZKSA 1AD8H 2ZDNA 3ENSB 1UVSH 1YPEH 5FCKA 1O2NA 1QB6A 1F0RA 3D65E 4IGDA 2CHAB 2FWWA 4I8JA 5CDFE 1C1SA 1QIXB 1LQEA 1CGJE 4K5ZA 2EEKA 1KSNA 1NY22 2CN0H 1C9TA 3MMGA 3TGJE 4KKDA 2PKAB 1J15A 1C1WH 3U28C 1BUIA 1ZLRA 2KX4A 1FAXA 1AGJA 1CHOF 1QFKH 4D9QA 3A7WA 1EASA 1G2MA 3LC3A 5HGGA 2SGDE 2UUYA 1U6QA 4JMYA 3KQCA 3GY7A 1GJCB 1E35B 1UVPA 1VITH 1GGDC 1GBCA 2G55A 1BTUA 2P8OC 3U8OH 2G4TA 1Z6EA 1N8OB 1GBKA 2P16A 1ELFA 1BMFD 3AK5A 1EXFA 5EU8A 1T8MA 1GL0E 4J1YA 5TJXA 3VGCC 1LVBA 4RKOB 4F4OC 1HBTH 1OWKA 5C1UA 2GGVB 1O3PB 1JIMA 4Q80A 4BAQB 1ANEA 1GCTB 1O38A 1MKWH 2Z9GA 4OS2A 1C2EA 3SQEE 1HYLA 1CE5A 3W1EA 1AB9B 2OLGA 1PQ5A 2J2UA 2R9PA 1CA0B 2QF0A 1MABB 4YT6H 3ITIA 1SR5C 2ZHEH 1MKXH 1NRRH 1C4V2 2FI3E 4Y8ZA 2FYQA 5EIYA 8LPRA 1ZSLA 3SYJA 2AS9A 1DY8A 2F83A 1ZHMA 2PKSC 2XOKD 3RC4A 1AI8H 3QX5H 1GCTC 3PV5A 4HG6A 3GISB 1BB0B 1ETSH 2EA3A 4XSKU 1AKSB 5EXMA 3BTGE 3VG8A 4XRNA 1UVTH 2TBSA 1SOZA 1GI0A 2ZPSA 3A7TA 3SV7A 4CBNA 1AVWA 1F5RA 1TB6H 1AVXA 2BVXH 2ZU4A 4K60A 2ZO3H 3ZZAA 3GY5A 2FM2A 2CMYA 3TITA 1GBFA 3STIA 4BANB 2WINI 4ABJA 3H7TA 3RXUA 4MQAA 3QTOH 1PQ7A 1VZQH 1KXDA 4FVDA 1EAIA 1EATA 4HI3A 4NWLA 3KYGA 3RC5A 4D76A 1C1QA 1C2GA 3TIUA 2GCHG 1G2LA 4X2WA 2VNTA 2A4QA 2EQNA 2P93A 2BLWA 2WPHS 1YP9A 4A1XA 3DFLA 4AOQA 4JZIA 1TNHA 3RMMH 3A8AA 5FPYA 3QK1A 2FP7B 1KMHB 1A1RA 3P92A 1EKBB 1UVUH 2H9HA 2J94A 1O2OA 1O3MA 1GJ8B 3T62A 1KTSB 5A0BA 1BBRK 1OXGA 4ZHAA 5FX6A 2BX3A 3SU0A 4X0WU 2GTBA 1FLEE 3A86A 3A83A 2B9LA 5E0HA 3SU5A 4U32A 2A4RA 1C5SA 2VIVA 1S85A 2C8WB 2YMSC 2ESTE 4HGCA 4B1TA 3Q3KA 4I33A 3URDA 3VEQB 1QTFA 1G9IE 5DK1A 1D9IA 4TPIZ 4E06H 2FI5E 1B0EA 1A5IA 3K6ZA 2QGRA 1FY4A 4DOQA 1HAOH 2GMTB 1D3DB 1YY3A 4X1PU 3GCHB 3UQVA 1YCPK 2A1DB 1VJAU 1YPHE 1GBDA 2BD3A 1P2MA 4GLYA 4NIXA 6CHAB 1UTKA 2BQ6B 1CQQA 3E6PH 4NSVA 3FFGA 1H9LB 1OP2A 4E7RG 1UTJA 1P02A 1ZMNA 2BOKA 2VBCA 3TJUA 1ELVA 1O2MA 2A31A 3GY4A 2OQUA 4P00A 1KDQA 4TPYA 1P3EA 4XE4A 5F8XA 3SGQE 4DIHH 1IQHA 2Z9KA 1FPCH 1WAYB 3GDUA 5F6MA 2VGCC 3P8NA 1ELTA 1P3CA 1PPHE 1ZOMA 3MU4A 3SNAA 1GI8B 2IJOB 3FANA 1DY9A 3UTUH 4YOJA 1IQJA 2LNCA 1BTYA 2A45B 3TJNA 1GI7B 1XUGA 3DCLA 1TABE 4OM9A 2QA9E 1UTMA 4NA9H 5FAHA 1DS2E 2BY8X 1V2VT 5HKKD 3SUGA 3M37A 3M5OA 2HNTE 1GHVH 1BCUH 1O2SA 5A8ZA 2ZGXH 1C5UA 1NU9A 2ZFPH 3T26A 3E0NB 3BV9B 1GBMA 3A81A 4A7IB 3MU0A 5ABWA 1K2I1 2NU0E 3ATLA 1T7CA 1QBOA 5DP5A 1JBUH 3LGVA 4OS6A 2FOCA 1O5CB 1FY3A 4Q7YA 1SHYA 4FUEA 1W2KH 2V6NA 1S84A 4GVUA 1RTLA 3E90B 2OP9A 2J97A 1C5NH 3ZZ7A 2BX4A 3R3GB 4I31A 3ZZBA 1PPGE 1GHBG 1SGYE 2OXSA 1Z71A 4JZDH 1HJAC 2W3IA 1KY9A 1SI5H 1JRTA 2CJIA 1QA7A 4INKA 3ZZ4A 1LVMA 5T6FA 1YC0A 1D3PB 4INLA 4GPGA 3KYFA 3ZVCA 1E1RD 3FAOA 1AE5A 4NZQA 4Y71A 1C5LH 2Z3CA 1IQEA 2BLOA 2XRCA 2EI6A 2O9QA 3M5NA 1OWJA 1DWBH 1YLNA 1V2KT 1UJ1A 2BY7X 2NU3E 3PMAB 4CRBA 4Q4LA 3LGTA 3RXDA 4BTTB 3RUOA 3GS9A 2LP6A 3VB4A 3FN8A 1ACBE 5JBTA 4NFEA 1A3BH 1OSSA 2D2DA 4OS7A 4R0IA 7GCHG 1A2CH 3SUDA 4YZUA 5IK2D 2W6JD 5L30H 4K1EA 4DIIH 2XNDD 3RU4T 1GHBF 2GV7A 4OS5A 2PV9B 3SUFA 1O2IA 2BVRH 4NA8A 3I78A 2PGQB 2FOMB 1C1TA 2UUJB 4O9VA 1ANCA 4AB8A 5HMAA 3AAUA 1W0ZU 3ZZ6A 1O2VA 3PLPA 1TNGA 4FUHA 1MTUA 2ZFSA 3MNCA 1C2IA 2Z94A 3QN7A 3K9XB 1B7XB 4UDWH 2ZDLA 1V2QT 2QE7D 1BJUA 1WQVH 4X6OA 3MU8A 1DUEA 2W5EA 5B6LA 2YNBA 4U01A 1M9UA 1Q3XA 3LJJA 1O3AA 5EXLA 2ZCHP 1N6XA 1VR1H 3ZVAA 4ABFA 4MNWA 1W10U 1MBQA 1SFQB 3ATIA 4BTUB 3ZIAD 2G51A 4ASHA 4B6EA 3TK6A 4K8YA 1TGTA 3ELAH 3M35A 3OX7U 4X1SU 4IBLH 4AZ2B 3HK3B 3PYHA 2XTTB 3FP7E 2WUBA 2WPMS 3A85A 1W7GH 4NA7A 2JIZD 4F49A 5T6DA 1ELGA 2PLXA 3M7UA 1AFEH 1BMAA 1VITF 1FNIA 3EGKH 3RXGA 1GJ7B 3PLBA 2TIOA 1QBVH 1HPGA 1IQMA 3M5MA 1GBTA 4MPXA 5JDUB 3A87A 2ZHQH 2Z3DA 3TNSA 3QO6A 3FZDA 3ZZCA 2ZU1A 2F9UA 2QY0B 2AIPA 1XXFA 3RXPA 1A61H 2VH0A 1O5GH 2O8UA 1HAXB 1ANDA 1YPLH 1BBRE 2ANWA 5FHTA 1TPSA 2FIRH 4M7GA 1D4PB 1GBIA 4RKJB 1GJDB 1TYNA 4WH8A 2BXTH 4THNH 2HNTF 2F9PA 5BPEA 2BD5A 2AH4X 3NXPA 2FLRH 1WOFA 4CHAC 4H6TA 3QZRA 1Z6JH 4K2YA 4BAHB 1GJ9B 1PPBH 1S5SA 1TNJA 2JKHA 2Z3EA 1E38B 1W0YH 1WDIA 3T25A 4FU8A 1WXRA 3PB1E 1YPHC 1OHHD 3MU1A 1C2KA 2WPLS 1TGBA 2LPRA 3P17H 1ZPZA 2XBXA 3D62A 3UWIA 3AVZA 1C2JA 1NM6A 1FY8E 3E1XB 3VB5A 1TBZH 1HJ9A 1TNLA 1DWEH 1SBWA 1ELDE 1O2LA 2QN5T 4A1TA 1ZSJA 1PPEE 3RMOH 2BM2A 2ZQ2A 3E0PB 4K3JA 1AFQC 1SFIA 1O2JA 2Z6BD 4ZKNU 5DSFA 2LELA 4E7NA 2ZA5A 2PFEA 5L2ZH 2SGPE 1GI4A 1NFWA 5LH8A 1DT2A 2FOEA 3NZIA 1P11E 1Y5BT 4ACAA 4DW2U 2WYJA 3LIWA 5F53A 2OUAA 4TY6A 2ZU5A 3H5CB 4IN1A 3HGNA 1BQYA 5DP3A 4ZXXH 2HNTC 4CH8B 1TFXA 3NWUA 2GCTC 2L74A 1HB0B 4Q63A 2TGPZ 5F03A 4CH2B 1GBLA 2G5VA 5C2ZA 4Q7ZA 2AIQA 5HM9A 1T8OA 2KR7A 4IN2A 1UCYH 1GDQA 3SUEA 1YPGH 1GBBA 5C20A 4BXSA 1CBWC 1FIZA 4BAKB 1GBJA 3V3MA 2FOAA 4SGBE 1X7AC 1K22H 1B5GH
chains in the Genus database with same CATH topology
3QUMP 1EPTC 1Z8IB 4ABIA 1GMCF 3RXHA 2BYAX 5AF9H 2AMPA 3LT3A 2BZ6H 1GG6C 1QJ1B 5GDSH 4GUXA 4AYYB 1ZMJA 1XKAC 2G4UA 1VGCC 1CO7E 3SU2A 4CREA 2V3OH 2PKAA 1MTNB 5GCHG 2ZHWH 3HK6B 4X8VH 3RXQA 2QIQA 1V2LT 3BTTE 1L1NA 1IQLA 1O3BA 2BXUH 5EG4A 5LPEA 3BG4B 2BDCA 5GPIB 2F9NA 2VB0A 2B8OH 4AFZA 2GT7A 2ANYA 4Y8XA 4IC6A 5K0HA 1MKWK 1WQSA 3SI3H 1AMHA 4FUJA 1V6DA 2XYAA 1CU1A 2VIPA 2RDLA 3PWBA 1FY5A 2VIQA 4ISHH 1K1PA 5JPMH 1DXWA 2QC2A 2ZDKA 4WH6A 1CHOG 1O31A 1YLCA 1W11U 4X8TH 2W26A 3VB7A 4NFFA 1RFNA 4DY7B 1TMBH 1ORFA 2C90B 1LO6A 1MKXK 3ZVGA 3P8OA 3TJVA 3KL6A 5EXNA 4ZH8A 3F9FA 4FUCA 2G81E 3E91A 5GCHF 3VXEH 1VCQA 4CRFA 1P57B 1Z8RA 1V2MT 1EP6A 1GGDB 1JOUB 5F8TA 3ZZ9A 3MI4A 3IG6B 3SJKA 2P8OB 4D7FA 4MNVA 1HJ8A 2A7JA 2QV1A 2VVVA 5FX5A 1O3HA 3RXTA 2BDAA 1E34B 5LPFA 1SGNE 2FTMA 3P8FA 4INHA 1AKSA 1Y5AT 3VGCB 2BD8A 1GWAA 4ZMAH 2ZCLP 1W13U 5E2PA 1BIOA 1ESBA 2EC9H 4NGAH 1S83A 1LHFH 3PTNA 1Z1IA 4UE7H 2THFB 2GV6A 2EI7A 3S7HB 4MNYA 5EW1H 1W3CA 1ZGVA 2Y5FA 4ZXYH 3KN2A 1V2ST 3QLPH 2R3YA 4TYDA 2ZFQH 2BD9A 4ABEA 1IHTH 4FXGH 1RGQA 2G52A 1WBGB 1ANBA 2PKSB 2ZDVH 3KGPA 5AVDA 2BDYA 2H2ZA 2Z9LA 2P3TB 4B76A 1QL7A 2GDDA 2A5IA 1JMOH 3SHAH 3MH6A 3O8CA 5EQSA 2G8TA 3OY6U 1ELEE 3BN9A 1K21H 1JXPA 3D23A 4NIWA 1MU6B 2J38A 1XUJA 3TPIZ 1T32A 3IWMA 1UO6A 5FBIA 1MMJN 1W14U 1J8AA 1ZJKA 2A2QH 3RMNH 1XM1A 1QQ4A 2PHBA 2CV3A 4O3UA 1HAZB 4UFFH 4WJG2 2ZP0H 1O3JA 3ZV9A 4Q2KA 1PQ8A 1SGFA 3K65B 1O3NA 1P06A 2BQWB 4TWYA 1S0QA 2SNWA 2VWMA 1G37A 1INCA 3HKIB 4ZHMU 2GP9B 5DGJA 5T6GA 3ZVBA 5H4IB 1GHWH 1A0JA 5ETXA 3GYMA 2XC4A 1BRCE 2ZDMA 3ZV8A 1PPCE 2OBOA 5CHAB 1MD8A 3T5FH 3MYWA 1H4WA 1MCVA 1O3DA 4IC5A 1LPKB 4B74A 2UWOA 3K2UA 1O2YA 4JYTA 2OTVA 2ZPRA 4D8NA 4A1VA 1EZQA 1ZYOA 1WTGH 1SVPA 3BTDE 2O8LA 4NWKA 1YF4A 4DT7B 3V13A 1K1OA 1SGPE 5DPAA 1P9UA 4GHTA 1LVOA 5CHAC 3RM0H 3B9FH 1BRBE 3STJA 3TGKE 3SNBA 2VWNA 2QXIA 1TA6A 1FONA 1H8IH 2RCEA 3MNBA 1MTWA 1UK3A 3AASA 3H7OA 1WU1A 2A5KA 8KME2 3DD2H 1P03A 1P04A 5AHGH 2O8TA 4ZUHA 3GOVB 1TPAE 3C27B 1SQTA 4IS5A 1EX3A 3TH2H 2FEQH 3EYDA 3SV6A 1RTKA 3SU4A 4LXBH 4VGCC 4MG3A 3F9EA 1C1VH 2QAAA 1E0FD 3ZZ5A 1ID5H 3UNQA 1RD3B 1EAWA 3V7TA 2ANKH 1BMLA 1Y59T 3BTFE 1YBWA 1ABIH 4NIVA 1TGCA 3MNSA 2EI8A 5C3NA 2VGCB 3U98H 1O32A 2TGDA 4K69A 4PROA 4NCYA 3CS7A 4CR5A 1TGNA 1K1MA 2C8YB 3AW1A 2C8XB 4U30A 1T4VH 4AFQA 1P10A 1ZTLA 4BAOB 2V0BA 4MNXA 1TPPA 1GJ4H 5IYTA 1IQFA 1MTVA 1SOTA 1OP8A 1G3EA 2A4GA 3A7YA 2ZZUH 1C1NA 3KQEA 1LHCH 1Q2WA 5EODA 4A92A 1GDNA 1RJXB 1HAVA 3NCLA 3SI4H 3MH5A 1OS8A 1L1JA 1BDAA 2BTCE 2BVSH 2ZTXA 5B6OA 3KEEA 5FBEA 1C4Y2 2ZFFH 1G3CA 1UVOA 2JETC 1A46H 1V2OT 1RTFB 5FPTA 5TCCA 2VIWA 3B23B 2F9VA 5DP8A 3RXOA 3CENA 3SU1A 3ZVFA 2ZPQA 1C2DA 1KYNA 1CA8B 4K1TA 1F5KU 2FS8A 1O39A 2PSYA 1Y8TA 2AEIH 1HJAB 4ESTE 2VU8E 1XUIA 1XX9A 3QZQA 1XMNB 1EQ9A 1UTOA 4TWWA 3FVFB 4LZ4B 1V2PT 2PWXA 3GCOA 4X2XA 7ESTE 3A82A 3S9AA 3BIVH 5GIBA 1FMGA 4KGAA 1AUTC 1LQDB 2PUXB 4UFGH 2BLVA 5E2OA 1THSH 1O2GH 3F9GA 3LGUA 2B7DH 1OX1A 1Y3VA 4UONA 3LU9B 2Y81A 3PROA 3N7OA 2OBQA 4K1SA 3AAVA 1BTZA 1KLJH 2GVFA 3RXKA 2ZI2H 3M7TA 1FN6A 3SNCA 1GBEA 2WPIS 3E8LA 3HPTB 5EW2H 3LH3A 1MTSA 3RXFA 1O34A 5EOKA 1TOMH 1MUEB 5J4SA 5L6NH 3ODFA 4O03A 1ABJH 1L1GA 1N6YA 2Z9IA 1F0UA 1TE0A 1GI5A 3DFJA 4SGAE 3JZ2B 1QCPA 1O2KA 2XXLA 1NS3A 4MDSA 4I7YH 6LPRA 1O3OA 1SGEE 1XKBC 2XWAA 3L33A 3BEUA 9ESTA 2QXJA 4X8SH 1OWDA 1O2TA 1AU8A 1L0ZA 3SHCH 2J9NA 3PWCA 1FAKH 4Z6AH 3M5LA 4AGJA 3P95A 2FOHA 4Y0ZE 2O8MA 1C1MA 1O3LA 2Y7XA 1EAUA 5FCRA 1HIAA 3ZZ8A 3NKKA 1GBHA 5EPNA 2PTNA 4DJZB 1BZXE 1C1PA 1FZZA 1ZHPA 3U69H 1LTOA 2D1JA 2H9TH 3GCTF 2I6SA 4CRGA 1NT1A 3U9AH 3SU3A 4UEHH 1AVGH 3V12A 1KIGH 2SNVA 1VITG 2JH0D 2KAIB 3SV8A 2IN2A 1GCDA 3UR9A 4MPWA 4MPVA 1EB1H 2P94A 2WPKS 4X1QU 8GCHF 1IQKA 1XXDA 4JZEH 4HZHA 2FDAA 1V3XA 1WSSH 4Z0KA 1FPHH 1NRQH 1UTLM 1Y3XA 5DP6A 1O5BB 1P2NA 2SFAA 3OY5U 2BD7A 3URCA 4HTCH 2ZTYA 1TONA 3DT0H 1SGIB 1HFDA 3RP2A 3VFEA 1VCPA 4DCDA 2HVXA 3T28A 1BHXF 4X2VA 1QRZA 1QRXA 2H5CA 4KELA 2YOLA 5FPSA 2AMDA 3M7QA 2ULLA 5DP9A 5GXPA 1ZPBA 3SV2H 3Q3XA 1A0HB 3SJ8A 3LKWA 4FU7A 4CRCA 1HNEE 3O8DA 1O3IA 3Q77A 4CHAB 1HXEH 4AFUA 3U1JB 4OGXA 4Y11E 1D6RA 1KXCA 5A8XA 3A8CA 3RDZA 3EDXB 2ZHFH 1EJNA 1K28D 3PMBB 1KTTB 1GI6A 1OYQA 1ZTKA 3RM2H 1XUHA 1Z1JA 5LPRA 4NSYA 1P01A 3C1KA 1EZUC 1UCYK 2WUCA 5EQQA 1MCTA 3PMJA 2ZNKH 4MLFB 5I25A 2UUFB 2B5TB 3U8RH 1XUKA 4A5TS 2GKVE 1FY1A 4D9RA 3RXAA 5A8YA 5A09A 1BRUP 3BF6H 1TRYA 1T8LA 2QF3A 2WYGA 3SGAE 1GHAG 3CP7A 2H6MA 5A0AE 1XVOA 1RIWC 1AFQB 1SLWB 1Z8GA 1ZPCA 1FV9A 3E16B 2A2XH 1NESE 2GT8A 3KF2A 1EJMA 2PW8H 4ISOA 3SO3A 3MOCA 3EE0B 1YPKH 2TGTA 2PUQH 3HATH 3HGPA 2D8WA 5JB8S 2JH5D 2DE8A 1HAYB 5GWZA 3RXMA 2I6QA 2GCTB 3GYLB 1W12U 1YGCH 3EA7A 4TY7A 1ZJDA 4YTAA 1Y5UT 3ZVEA 1P2OA 1TMTH 2ZECA 4IMQA 1EAXA 1KXAA 1O5AB 4OGYA 3RXLA 1GHAF 4X1RU 1GMCG 1MBMA 1CBWB 4ABGA 3MO3A 3LGYA 5C1XA 1J16A 3FP8E 1FJSA 4WXIA 1P2IA 1F92A 1CGIE 1LVYA 4B2CA 1C5RA 1O2PA 2XC0A 1SGTA 1C2FA 1ETRH 2QYIA 1EPTB 2XC5A 5JB9S 1A4WH 1Y3YA 3MFJA 4LZ1H 4GHQA 1LPGB 1HAHH 1GG6B 4DG4A 3UOPA 1AUJA 1DXPA 1P2KA 1YM0A 3NUMA 1GJAB 3AW0A 4ISLA 1F0SA 4WMEA 5TCAA 2XCNA 4AYVB 1UHBB 1DSTA 1K1LA 2BLQA 4CRAA 1THRH 1VGCB 2VWOA 1Y3WA 1TQ7B 1QRWA 1J17T 2SGQE 4GCHG 1ELCA 3EA9A 1BTHH 1L4DA 3Q3YA 1DPOA 2BDIA 1O36A 3DHKH 1SLXB 2B0FA 4AG1A 1SHHB 2BMGB 4KTUA 3ATWA 1HUTH 3S9CA 1O30A 2ZIQH 2OC8A 4CRDA 1J14A 3IITA 5L2YH 3TNTA 3M3SA 4R8TB 1C2HA 4AORA 1IQIA 3PMHB 1V2JT 2HRVA 6ESTA 2ZTZA 1GI3A 1SPJA 1C5TA 3GY8A 2P3FH 1FN8A 3UUZA 4ISIH 4DGJA 1ARBA 2H1UA 1CHGA 1SQOA 1RXPA 1CT2E 3P8GA 2HGTH 3GY3A 2WPJS 3LJOA 2FI4E 3B8JA 4ZKSU 1GJ6A 1TBQH 2QXGA 4Y7BA 5BRRE 2DUCA 1G32B 3PO1B 4GCHF 4H6SB 4XDEA 4Y10E 1ARCA 1SG8B 3SZNA 5PTPA 3ZZDA 1C5YB 4B2AA 2BDBA 2RG3A 2ZU3A 1P8VC 1SLUB 2FOFA 4JZ1A 1O2UA 1IOEA 3A7XA 1KXFA 2VWLA 1V2UT 2ZGBH 5F8ZA 5HYOA 2WV5A 2Q6FA 4BXWA 1K9OE 1D3QB 1AZ8A 1ELAA 3SBKA 1A3EH 3SGBE 4DVAU 3BTQE 1WTHD 2BDHA 1K1IA 2XW9A 2F9BH 2XBVA 2R2MB 4HFPB 4ABBA 1MZDA 1RS0A 1ZTJA 1A5GH 3PO1C 1PFXC 1C5PA 2FYRA 4MTBA 4UFEH 1NRSH 3LPRA 3OU0A 1AO5A 4AX9H 1EUFA 5HXFA 2W7SA 1F0TA 1OWHA 1O2XA 3SN8A 1GL1A 5K7RA 1YYY1 1OP0A 5CMXH 4JYVH 3KQBA 3A84A 1S82A 1GMHG 1S81A 4IMZA 1HCGA 3RC6A 1GI2A 1T4UH 3K6YA 1QL9A 1F7ZA 2F91A 2QXHA 2R2WU 3S69A 1IQNA 3UY9A 1UMAH 4DURA 1S0RA 1QL8A 4WVPE 1TRMA 2YNAA 3M61U 1NPMA 4O97A 2ODQA 3DUXH 3ATMA 3HKJB 3EQ0H 4B73A 2W3KA 2BY9X 1YPJH 1AWFH 2ZFRH 1XUFA 3SORA 3U1IB 3UPEA 5C1YA 3SJIA 3RU4E 5I46H 1NFXA 4YOIA 3OYPA 5SGAE 3F1SB 3RU4D 1KLIH 2AYWA 2FMJA 1W8BH 1TA2A 3SJOA 2TGAA 1A7SA 1P2QA 2FX4A 3LGWA 4Q7XA 3V0XA 4ZKOU 1GMHF 1DUAA 1P05A 2OD3B 1AZZA 1MH0A 2ZWLH 1DE7H 2CHAC 2FOGA 1V2NT 1UTQA 2UWPA 3KCGH 3T27A 1ETTH 4Y79A 4OS4A 1OOKB 1O35A 1YLDA 1O2QA 3ODDA 1YKTA 3PTBA 3NK8A 1EJAA 2FODA 4BTIB 1SSXA 1PQAA 3LOXA 1UCYE 2STAE 2P3UB 2Y5HA 3EA8A 3RXCA 5JBAS 4Y0YE 3SW2B 1H9HE 1N8OC 3UREA 4ZKRU 5T3HA 3G01A 4CR9A 3TK9A 4X6MA 1C5MD 3WY8A 2VIOA 1EOLA 4K8BA 3TJOA 3RXBA 4Y76A 1SGCA 4E05H 2XBYA 2NU4E 3JZ1B 2BOHB 1UK2A 2G5NA 3QDZB 5E0GA 1TPOA 1EZXC 5ESBA 3LDXH 3QTVH 1AB9C 1CVWH 1SGFG 3UIRA 1T31A 7LPRA 1CA0C 4XBBA 1CT4E 1CSOE 2OC7A 3PM3A 1CGHA 2H5DA 4A6LA 4MPUA 4XOJA 4O3TA 1MU8B 1FI8A 3O8BA 3RXEA 1DITH 1AY6H 4UFDH 3VXFH 4JK6A 3TGIE 1SGQE 3SNEA 1AIXH 2FX6A 2TRMA 2H9EH 4FUBA 1C9PA 1FIWA 5GJ4B 2OCVB 3UWJH 4I8KA 4JCNA 1DVAH 2Y82A 4GSOA 1C5VA 2F9OA 2ZEBA 2NU1E 3T2NA 3S0NA 4VGCB 4CBOA 4JYUH 2Q6GA 2C8ZB 4Y6DA 1NTPA 3LONA 1SB1H 1ESAA 5JYIA 3MU5A 2FTLE 1MQ6A 2J34A 5C5NA 2A32A 1TX7A 1YCPM 1G30B 2PTCE 3OTJE 1YPMH 4WXVA 1OKXA 2P95A 3MTYA 1NRPH 2BHGA 4FUDA 1P2JA 2UWLA 2AERH 1TGSZ 1Q31A 3TH4H 1LHEH 1WYKA 3ZZ3A 4Y8YA 2ALPA 3BTKE 2ZG0H 2A4OA 2XNIA 1NROH 1C5ZB 2ZHDA 3MNXA 3MH4A 4B75A 2FXRA 3UR6A 1SGRE 2GCHF 4RSPA 1GMDG 4YOGA 2UUKB 1Z8JB 2ZU2A 3A8BA 1HGTH 5DP4A 1DDJA 4I8HA 4NG9H 3I29A 2M5TA 1NN6A 1DOJA 2JETB 9LPRA 3MO9A 5C67A 1GVZA 2FS9A 4NZLA 4KP0A 3O8RA 3KNXA 2ODPA 3P70B 1Y3UA 2HPQH 3BIUH 5EGMA 5FXLA 1MZAA 1O3GA 2HWLB 2V3HH 1B0FA 2AFQB 1RRKA 2Q6DA 3BTHE 3RXJA 1BTXA 5DO4H 1HDTH 2OQ5A 1V2TT 3MHWU 4IW4E