1ARCA

The primary structure and structural characteristics of achromobacter lyticus protease i, a lysine-specific serine protease
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
263
structure length
263
Chain Sequence
GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The primary structure and structural characteristics of Achromobacter lyticus protease I, a lysine-specific serine protease.
pubmed rcsb
source organism Achromobacter lyticus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ACHROMOBACTER PROTEASE I
total genus 85
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 1993-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1arcA02
2FOAA 2ZGXH 3RC6A 3T5FH 3ZVBA 3PMAB 2VIDA 1QQUA 1RFNA 1HJ8A 2R3YA 1O2NA 5DP7A 3ZZAA 4DJZB 4E05H 1P9UA 1RRKA 1D6WA 1TABE 2BY9X 3SJKA 1SHHB 1KLIH 3M36A 1C1QA 1MTSA 4Q2KA 4Y71A 4X6OA 1VCPA 3FP8E 2WPHS 4HFPB 7GCHG 2F9NA 1EJAA 4JCNA 3LONA 1AZZA 2H5CA 3A89A 5J4SA 3LH1A 1EOJA 1KXAA 1XUFA 2F83A 2ZDAH 1AKSA 1T8NA 1HAZB 1HIAB 2RG3A 1NFXA 4CR5A 4VGCB 3L6PA 3RXRA 1UCYE 3BTQE 4WMFA 2RA3A 1GI0A 1TGBA 2PKAB 1GBIA 1OWJA 3Q3XA 1C1TA 2KAIB 1YCPK 1A5IA 3TK6A 3E91A 1G3CA 2WYJA 3Q3YA 4ABEA 1NU9A 2A2QH 1QR3E 3Q3KA 2W7UA 1PQAA 1C4Y2 5L30H 1EPTA 4Y7AA 1IQNA 2SGFE 5C1YA 2BY6X 3M3SA 1C1RA 1C5TA 2ZHFH 3SV6A 1BRBE 3ATIA 3PLKA 1C1MA 5EG4A 3NCLA 1EUFA 1S6FA 3EE0B 2FS9A 1TMBH 2XTTB 3U9AH 1NZQH 4LK4A 3ZYEA 4FUIA 3JZ2B 4OS1A 2F9UA 2P8OC 3A8BA 2G4UA 4H42U 1Y5AT 3AW1A 1W13U 2PGQB 4AFQA 2B7DH 1GCTB 4XSKU 1TNHA 4UFDH 3T62A 4ISLA 4I8JA 4KGAA 2WINI 1UJ1A 1O2SA 3RXOA 1HCGA 2HNTF 3QLPH 5DK1A 1FY8E 4ESTE 2OBQA 5FPTA 3SO3A 2GMTC 2P93A 1UTKA 2PKSB 2PV9B 4INHA 4Q7YA 1BITA 2ZZUH 3QTVH 1X7AC 2XRCA 2RDLA 5GJ4B 5LPEA 1O3LA 4NSYA 4ABIA 1YCPH 1FY3A 3A80A 3RXAA 2BM2A 1P01A 4AN7A 4XE4A 1TA2A 2H6MA 1QNJA 1U6QA 3KIDU 1J16A 2O8UA 3SJ9A 1RIWC 2HPPH 4JYTA 1A5GH 4GSOA 1XUKA 2GDDA 2H5DA 1KIGH 5FX6A 4WF8A 1LCYA 2VVCA 2FOHA 2ZPSA 3DT0H 2FOGA 2HGTH 1Y3XA 2PTCE 3KEEA 1ZJKA 4UDWH 1YLDA 2B8OH 2BZ6H 3KF2A 1GBTA 3E3TA 4TY6A 1RTLA 2BXTH 3PWCA 3SN8A 1UTOA 4ABAA 4DVAU 4FUCA 4ASHA 1C5RA 2OP9A 1WQSA 1C5YB 1WYKA 4RN6A 4IW4E 3RU4E 1QJ7B 3SZNA 2SGPE 5L2YH 1EZQA 4YO9A 1TGNA 3MU8A 2PHBA 1FAXA 1K1PA 4ZROA 3LGVA 1OYTH 1V2VT 4KELA 3ATMA 1GJAB 1MBMA 1A0HB 1WTHD 1HAOH 2UUYA 3MU5A 2Y5GA 1DT2A 4NIWA 2FI4E 2GCHG 3RP2A 1GMDG 3VFEA 1TOMH 2WV5A 2A7HA 4RKJB 3ATKA 1UTJA 3S7KB 1D3DB 1GJCB 4JZ1A 3OU0A 4B1TA 8KME2 2FODA 3KNXA 1KTTB 1UTQA 1ETTH 3SU1A 8ESTE 1S84A 4O3TA 2GDEH 3ZZ8A 1YPEH 3RXMA 1P2IA 3UOUA 1EP6A 2GCTB 1G32B 5GXPA 1SGFG 2WV4A 1QA0A 1A61H 2Y82A 1C2KA 1AD8H 4BTIB 3HK3B 1G30B 2ALPA 3FANA 4DCDA 4ZHLU 4X1NU 4GHTA 4MPVA 1ANBA 4DW2U 1GL1A 3A88A 5SGAE 3A85A 2UWOA 5FXLA 1FMGA 4DT7B 1ZSKA 2KAIA 5T3HA 5T6FA 1LKBA 2Y7ZA 3TITA 1ZHMA 1TBRH 1YC0A 1GCTC 2OXSA 5E0HA 4J1YA 1FY1A 3V12A 2G81E 1MKWH 2VWNA 3VXEH 1VCWA 4ZKOU 1IHTH 2QXIA 1LVYA 7KMEH 2VIVA 4B2CA 3TVJB 1HIAA 3SU6A 1AKSB 2ZFTA 4BAHB 5JB8S 5HMAA 1QRWA 1MTNC 1HFDA 1QURH 1ZTJA 4BANB 1QIXB 2F91A 1HLTH 1GGDB 2NU2E 3PMJA 1GBKA 3MO3A 1QQ4A 1TIOA 1JXPA 2ZECA 3S69A 3UUZA 3DA9B 4I8KA 4J2YB 3DUXH 3KQCA 4WMDA 1O30A 4U30A 3U8RH 1Q2WA 1DVAH 2P8OB 1AU8A 4H6TA 1GJ4H 4IBLH 1MAYA 1MAXA 1QY6A 1JRTA 2AFQB 3JZ1B 2G5VA 1JWTA 3ZZBA 4CBNA 4O3UA 1W0YH 1T8OA 1IQFA 4YESB 3PYHA 2BQ6B 1ESAA 2Y6TA 2ANWA 1S6HA 3GY7A 4XBCA 2Z9GA 3RC4A 3LH3A 1FY4A 4NIYA 1XKBC 4I8GA 3DD2H 1UVUH 3BN9A 3BIVH 4GAWA 4Y76A 2ZNKH 4Y6DA 3BF6H 4AOQA 3NUMA 4X0WU 2VIWA 2ZIQH 1C9PA 2GX4A 1K9OE 1SLXB 2R3UA 1HAYB 5DP3A 3MHWU 3S9AA 1UTMA 1GDQA 1BTYA 3SNCA 4IGDA 1DUAA 2ZU3A 2CF8H 3RXJA 1FY5A 2CGAA 5I46H 2AMQA 2EEKA 1DX5M 3BTFE 3M35A 3BTTE 1LHFH 2GV6A 3T28A 1GI5A 4CBOA 1ZMLA 1DY9A 1SGEE 1LHGH 2GT8A 1K1OA 2PTNA 2A7JA 4U32A 3GYMA 4Y79A 3BEFB 4Y8YA 4CHAC 5ESTE 4NGAH 1VITG 1ZMJA 3URCA 5DJ7A 1BIOA 1HBTH 1AQ7A 1V2ST 3MTYA 4DIHH 5CE1A 1LVOA 2ZGJA 1HNEE 3Q77A 2RA0A 1ZZZA 4NA9H 4DURA 1GHBF 1T7CA 1E34B 1AUTC 4BTTB 4D8NA 2ZFRH 1BJUA 2BY5X 4YOJA 5JBAS 2A4QA 2P94A 4JK5A 1YKTA 2G4TA 1ELEE 2ZG0H 3QDZB 2FYRA 2HNTC 3ELAH 4ISNA 3SV9A 2VH6A 3LC5A 1B0EA 1O2WA 1V2OT 3PMBB 4E06H 1EPTB 5AF9H 1HDTH 4I8HA 2PSYA 2C90B 1W7GH 1P11E 1TFXA 1UCYK 5LH8A 1TQ0B 2FTLE 3FZDA 1E36B 1O33A 3NKKA 4YZUA 1DXPA 2ZCHP 1YPLH 1MKXK 2J94A 1BUIA 1LPGB 5EPYA 4HZHA 1W2KH 4KTSA 4DY7B 4AYYB 1FQ3A 1J8AA 1P02A 1TX6A 3RXCA 3P8NA 3I77A 1Y59T 3MH5A 1C1VH 2JH5D 3AAVA 5E8EH 2B9LA 2A5AA 3M3TA 3A7TA 1LMWB 1P9SA 1C2LA 4JZEH 1FV9A 2XBVA 2Z7FE 3O8DA 1DE7H 3KQDA 1RIWB 2QCYA 4OS6A 1S83A 4BAOB 1C5XB 2YNBA 1GJDB 1E35B 1ELGA 3SJIA 1HAVA 2OBOA 5HXFA 2QY0B 3BTDE 3LGUA 5EW1H 1ZPZA 1V3XA 2ZTXA 1QA7A 1A4WH 1YPHC 1SOZA 2G51A 1NTPA 5C1UA 1PFXC 3UR6A 3A7VA 1UTLM 1E0FD 1TRMA 2SFAA 1O35A 3HKIB 3K9XB 1ESTA 1TE0A 3K6ZA 1E37B 1IQKA 1OKXA 1O3GA 1ESBA 1YPMH 2FMJA 1KXCA 3ATLA 3ITIA 1BTWA 1BA8B 1TYNA 1XUJA 1C9TA 1YGCH 4MDSA 3UY9A 2BLQA 3A7ZA 1VCQA 5BPEA 3KHVA 1AVXA 2BLWA 2OINA 2SGQE 3M7UA 4X1QU 2D1JA 4GPGA 2P3FH 5FCRA 1MZDA 1SGCA 1CA0B 5CMXH 3TU7H 2AH4X 4I7YH 1O3NA 2WYGA 1DXWA 4UFEH 3UTUH 2BVXH 3TK9A 2F3CE 1GHXH 1SBWA 4ZHAA 1DDJA 3GCTF 1JIRA 1QRXA 1O39A 3BTKE 4ABHA 4A6LA 4ISHH 1LHDH 3SBKA 4FXGH 1MMJN 4B73A 1UK3A 1IQEA 1O2OA 4ABFA 1DITH 1ZPBA 4AYVB 1P2JA 4K69A 3LT3A 3NK8A 9LPRA 1AZ8A 3SNEA 1BDAA 5JYIA 4GHQA 1F0UA 4SGAE 1D3PB 1ZRKA 2OQ5A 1CT0E 3ZVCA 2XXLA 1GHYH 1SGFA 2NU3E 4X8UH 3M3VA 1THPB 2Y5FA 4FU9A 1BTZA 1FUJA 1OWHA 1EAIA 2VIOA 1GPZA 4D7FA 2Z3DA 2ZO3H 3TH4H 1BOQA 1F92A 1IQHA 2XC4A 1XVMA 1P2QA 1QHRB 4INKA 4AG2A 5AFYH 3RXLA 3UR9A 3P17H 4FUHA 4CRAA 2FX6A 1V2QT 5A8ZA 5JDUB 1XKAC 4ABBA 4IC6A 2BY8X 4IS5A 2UWLA 1W0ZU 1DY8A 3AW0A 2BDHA 4R8TB 5F8ZA 1AFQB 1EATA 2BZAA 1W8BH 2ZFFH 3GCHC 4NFFA 4BAQB 1SGQE 1K1JA 1C2JA 3GY5A 2J38A 2VH0A 1ZGVA 2DE8A 1S85A 3ENSB 1FJSA 8GCHG 3EA9A 1ZPCA 1ELCA 3LC3A 2O8WA 1NRNH 1TNGA 2LPRA 1C5QA 1OWKA 4NZQA 2R0LA 1C1SA 3MU0A 5G4BA 1INCA 2NU0E 3GY6A 2GZ9A 1EB2A 3LOXA 2BXUH 2BX3A 1L2EA 2R2WU 2CJIA 4D76A 1DM4B 1TOCB 6CHAC 2EI7A 1NRQH 1IQLA 2BD8A 1GMCG 3K2UA 2AERH 1UVSH 2ZHWH 1QCPA 1CT2E 1WUNH 3M61U 1UVOA 2TGAA 4I31A 1C5OH 3RXDA 1OWEA 4XOJA 1N8OB 1KDQB 1O34A 1ACBE 1T4VH 4AX9H 1GBEA 1T8MA 4UE7H 3VB5A 5DP5A 3R3GB 2FYQA 3E8LA 5AHGH 1AE8H 3F9EA 1P04A 1L4ZA 1Z1JA 1SMFE 3KQEA 3E0PB 1C5VA 2BQWB 3IG6B 1O2PA 1TALA 1O5DH 2V3HH 3HK6B 6CHAB 1A0JA 2R0KA 1PPFE 3MH4A 4O97A 3UWIA 1F2SE 4JZDH 4KTUA 1BBRE 1QB6A 1MD8A 3SW2B 3M5LA 1SR5C 5EXMA 2GVFA 3TLOA 9ESTA 2BD9A 2B5TB 3ZYDA 1MUEB 2BD4A 3DFJA 1PQ8A 3RXEA 4HTCH 1YCPM 2P16A 1C2DA 3RDZA 1PYTC 5GWZA 2EA3A 1SC8U 3FZZA 1KLJH 2D8WA 2ZGHA 1DWEH 2HRVA 3WY8A 1G3DA 3DHKH 2H9EH 1MZAA 1SPJA 1W14U 2OCVB 1J14A 1W12U 1DFPA 2OC8A 4FUFA 4MG3A 3O8RA 3STIA 3OY5U 1IAUA 1XUHA 3U8OH 2ZTZA 5JBCS 4X8SH 1A1RA 5A2MH 4ISOA 1OWDA 2J4IA 1LQDB 3S9CA 1AO5A 1N6XA 1GHAF 2ZQ1A 3IWMA 3URDA 1ELAA 2ZU5A 1GHWH 3PM3A 2FESH 1G3BA 3OYPA 1GG6B 3ZZ9A 2ODQA 1J9CH 1QRZA 2QGRA 2ZHDA 1C2MA 1O2RA 1V6DA 1O2LA 4K1TA 6GCHF 1GDNA 2SNWA 4CH8B 2CV3A 3SV2H 5TCAA 2TGPZ 1UCYH 2FXRA 2BD2A 5C67A 3D65E 1GI8B 1LPZB 4MNXA 1TBZH 4BOHA 1TB6H 4MPWA 1C5PA 1G2MA 4JYUH 3RU4T 5EPNA 4ZXXH 1ZSLA 1K21H 3A84A 4UFGH 1NT1A 3SNAA 2W3IA 4X1SU 1AUJA 3GDUA 4ISIH 4MVNA 4MNYA 1GJ8B 3RMOH 1CQQA 2C3SA 1NM6A 1TLDA 5ESBA 4D9RA 1VZQH 3T26A 4CHAB 2H9TH 1P0SH 4ZKRU 3CS7A 2WPJS 2O9QA 3TJVA 4TYDA 1NROH 4INLA 1HAHH 1TMTH 1SFIA 1GL0E 2EI6A 4A1XA 5IYTA 1YLCA 1Z6EA 1ZHPA 1P2MA 4BTUB 1TWXB 1WTGH 1MCTA 2Z3CA 1W3CA 1EJMA 2BDCA 4BAMB 4PROA 4Q80A 1PPCE 1GVKB 2SGAA 1Z8RA 2CHAB 3P8OA 2IPHA 2A1DB 3TH3H 3SI3H 2O8LA 1HAXB 3VEQB 1D9IA 1CGIE 2HWLB 1IQMA 5C1XA 4Y0YE 4Y11E 1ELDE 4KTCA 2Y81A 2FLRH 5DP6A 7GCHF 2ILNA 1BTPA 3RXUA 1XMNB 3E0NB 5C20A 1MBQA 4TPYA 1BBRK 1GJ6A 4WH8A 4JYVH 1XX9A 1J15A 3UOPA 1SLVB 1P06A 2ANKH 2J34A 2ZEBA 4B75A 3RXKA 2BLOA 4Q7ZA 1EAUA 3PROA 1O3DA 2BVRH 4YLUA 2VWLA 1O2HA 1QJ1B 2BLVA 2FIRH 1YPKH 4AB8A 1W10U 3ZZCA 4DGJA 1GMCF 3S0NA 1VITH 1Y3WA 3LKWA 5HM2A 2GTBA 1EX3A 2W5EA 1O3HA 3W95A 1TRYA 4B2BA 1GDUA 1V2PT 4MQAA 3PLPA 3UQOA 2O8TA 4H6SB 3M37A 5E2OA 4R0IA 3ZZ4A 5DP8A 1TONA 5ETXA 1MTWA 3HPTB 3F1SB 2AIQA 1QBVH 1ZGIA 4DIIH 4NIVA 4NA8A 1C2GA 4FUGA 4UONA 2JH6D 3EDXB 5BRRE 1CT4E 3MI4A 4TWYA 3OY6U 2VWOA 3UNSA 5CHAB 1F7ZA 2QC2A 3SNDA 4Q7XA 2ZPQA 3LDXH 1BHXF 3T25A 1NRSH 4I32A 3ZVAA 1YYY1 1LHCH 1O5AB 1P3CA 4O03A 1N8OC 2ZU4A 2QAAA 3QX5H 5FCKA 4A1TA 2JKHA 1HJAC 1BMMH 2BDGA 2ZF0H 1NN6A 1SGRE 1AN1E 5LPRA 4RKOB 3SUEA 1VJAU 3GISB 2A7CA 2FLBH 5GCHF 1FPCH 1CU1A 1ZRBA 3VB4A 4CRGA 3GOVB 3SOSA 3FAOA 2BHGA 2FZZA 3U98H 1HXEH 1SGDE 3PMHB 3D62A 3ZV8A 1O36A 3BG8A 3RXPA 2NU4E 5DP4A 2BVSH 4Y8XA 1F0RA 1Y5UT 4TY7A 1H4WA 3A87A 1G36A 4GCHG 4X1RU 4FU8A 4X6NA 3NXPA 1A2CH 5C2ZA 3MO9A 1PQ5A 2OC1A 1CBWC 4YOGA 3PTBA 1QBNA 1V2NT 1S5SA 5L6NH 3SORA 3CENA 4H4FA 2GT7A 1AWHB 4YM9A 2C8ZB 1A5HA 1WAYB 1V2RT 1NFUA 2P95A 3SHCH 1T31A 1SGTA 1NFWA 1CHOG 4TWWA 1FPHH 3OTJE 4YT7H 4UEHH 1PQ7A 1TA6A 2PKAA 1NFYA 1O5BB 4IC5A 3SQHE 1THSH 1OS8A 4HI3A 1JBUH 1KDQA 2ZFQH 1CHGA 1HAVB 2GD4B 2VVUA 4F49A 3QZRA 1FLEE 4AFZA 4ZHMU 2H2ZA 4B76A 3VB6A 1CA0C 4NZLA 1DWCH 1SL3A 3MNXA 1GBJA 1QTFA 2FI5E 3R0FA 5E2PA 5JB9S 3QTOH 2BDIA 1RJXB 3F6UH 3SU4A 1NY22 1ANEA 4ZKNU 1GBAA 1P12E 3SUDA 2QV1A 1BZXE 3VPKA 3BTGE 2SGDE 1VR1H 2Z3EA 1GI7B 1C5WB 1P2KA 5T6GA 1Z7KA 3I78A 2F9OA 1K28D 2ZCKP 2F9BH 1YPGH 3GICB 1O2VA 5EQQA 5EQRA 2B0FA 3N7OA 1Y8TA 1BMLA 4JMYA 3UIRA 1UMAH 1GBCA 5PTPA 4CRDA 1W11U 2BOKA 4THNH 1ZSJA 3C1KA 1C5LH 2PUQH 1ZR0A 4NCYA 1UHBB 3RXGA 1SLUB 2I6QA 2UWPA 3I29A 1MKXH 2ZI2H 3EQ0H 5A8YA 3TGIE 3P70B 1ABJH 2FP7B 1V2WT 2ZHEH 2A5KA 4YT6H 1V2TT 1H9LB 2AIPA 2AS9A 1NPMA 5B6OA 3U1JB 3L3TA 3SU3A 2ZC9H 1EXFA 1TNJA 5C5OA 1VGCB 2BD3A 1SHYA 1C2IA 5TCCA 3SQEE 2ZCLP 1TRNA 3LGWA 1XUIA 3RUOA 1MTVA 5FPYA 2FOBA 4FU7A 5FBEA 1C5UA 1NRPH 4BNRA 1Y5BT 3LJOA 1AFQC 3GCHB 1NO9H 4XFQA 2P59A 4MLFB 2ZFPH 1W7XH 3QZQA 3VB3A 3ODDA 2TRMA 2C4FH 4NA7A 3TJNA 1O3OA 1P2OA 1O5FH 1D6RA 2F9VA 4OS5A 3ODFA 3GYLB 4WXVA 4CRBA 4YLQH 4IMQA 3A82A 4ABGA 3OX7U 4QT8C 5TJXA 3TNTA 3FP7E 1YPHE 1GMHG 4K8YA 3K65B 3PWBA 2ZFSA 3RXHA 4LZ4B 1O3AA 2ZDKA 4ABDA 1WV7H 3AVZA 1UHBA 2OC0A 3PO1B 4WH6A 4X2XA 4NFEA 2IJOB 2J95A 2PSXA 3RXBA 1F0TA 1NC6A 3E90B 1O2YA 2C93B 4AGJA 1KY9A 1OP8A 3C27B 4WMEA 1Z8GA 2PLXA 3PO1C 4DG4A 3M5NA 3VB7A 1RGQA 2CXVA 5GCHG 1CVWH 4XBDA 3TJUA 3UFAA 5HYOA 1O3FA 1C2EA 3SGAE 1FN6A 4AFUA 1OXGA 1PPBH 3M7QA 1C1OA 4A7IB 1A3BH 2GZ7A 4WY3A 3KL6A 1C1NA 3E1XB 2WUBA 3Q00A 4GCHF 3DFLA 5J4QA 1SOTA 3BG4B 1QB9A 4Y7BA 1DPOA 2A4GA 3LGYA 2AEIH 3OSYA 4MTBA 3RMLH 2PFEA 1VITF 2OUAA 3O8CA 2JETB 3U1IB 1MCVA 2HLCA 2ZWLH 1EAXA 1G37A 4YOIA 3ATWA 3ZV9A 3V3MA 1ZYOA 5K7RA 2VB0A 5HM9A 3U8TH 1YPJH 3K6YA 3T29A 1EKBB 1GHBG 1Z8IB 3MMGA 2J9NA 2ODYB 3L33A 4WVPE 2VU8E 1SGPE 3VGCB 2QA9E 4LOYH 2AMDA 1SB1H 3LJJA 1HRTH 1GI9B 3PB1E 1MH0A 3T2NA 2VIQA 3LIWA 3B9FH 3H7TA 4I8LA 2ZU1A 4JZFH 3ZVFA 1GJ7B 1WU1A 4BXWA 3P92A 2VVVA 4M7GA 2A2XH 2GMTB 1P2NA 4Z0KA 2XYAA 2STBE 3UWJH 1H9IE 1MTNB 1C1UH 2STAE 4FVDA 1Q3XA 1LQEA 1AB9C 2ESTE 4GVUA 1M9UA 4BAKB 1K2I1 2AGGX 2OQUA 2DE9A 1O3PB 3MU1A 3FFGA 1SQAA 3PLBA 1Z71A 2WPLS 2XWBI 1WCZA 1C2HA 3ZZ3A 1ABIH 2PW8H 2ZA5A 1SGNE 1LO6A 7LPRA 2FM2A 2VNTA 4ZH8A 1HYLA 1Y3UA 2H9HA 4K8BA 1C1PA 1AB9B 1GCDA 2UUKB 5I25A 1P10A 5A0AE 3RLYH 1H9HE 5DGJA 1B0FA 1GGDC 1AE5A 4IN2A 4B2AA 3QUMP 3O8BA 1XXFA 1GBLA 1DICA 2AYWA 1GI3A 2ZDMA 1NESE 2BMGB 2W3KA 1ANDA 4U01A 6LPRA 4AORA 2FPZA 1KXDA 3EA8A 1MQ5A 1EOLA 5EXNA 2FX4A 1MTUA 3PTNA 2Q1JA 2TBSA 4FVBA 3LU9B 2G52A 1DANH 3BTWE 3KGPA 1Z1IA 1EJNA 2QXHA 4MNVA 2OLGA 2HPQH 3H5CB 4K2YA 4KP0A 1KXBA 3RXQA 5F03A 1IHSH 1V2LT 5A0CA 1IOEA 1SG8B 2FO9A 3KCGH 4X1PU 3H7OA 1NU7B 4XDEA 1ZMNA 5FX5A 1UO6A 2XC0A 1XVOA 4RSPA 5A8XA 1AIXH 4X2YA 3V7TA 1AHTH 4MPXA 1DLKB 1Y3VA 3GY8A 7ESTE 4ZKSU 1ELVA 2FEQH 1O2IA 4B74A 2RCEA 5JBTA 2VGCB 4WJG2 2HOBA 1F5RA 2VINA 1OPHB 2P3UB 1IQJA 4X2VA 1AI8H 5C3NA 3VXFH 1FI8A 2V0BA 2AMPA 2XC5A 1Q31A 2Z9JA 5FAHA 1O3JA 1ZTLA 2TPIZ 1YF4A 2OTVA 1YP9A 4K5ZA 3Q76A 1O2XA 5E0JA 4OS2A 2ANMH 3A8CA 1TAWA 1GI6A 1BB0B 5F6MA 1O31A 1UTNA 2XWAA 1CA8B 1O3CA 2OC7A 2XBYA 2QIQA 4E7NA 1GMHF 2G5NA 3NZIA 3MFJA 2BD7A 3RXIA 3G01A 1LTOA 2FOEA 2XNIA 3F9FA 1O3IA 1FAKH 1L1GA 1V2JT 1YBWA 1QBOA 2A5IA 1AVGH 3NPSA 1DS2E 1HJAB 2H1UA 2XCFA 1HB0B 1LHEH 4SGBE 4OGXA 2C8XB 2ODPA 1ZOMA 1QL8A 1OSSA 1RTKA 1O32A 3TPIZ 1OOKB 1GBDA 1Y3YA 1RD3B 2ZTYA 3QWCH 1JIMA 4NIXA 3SNBA 1C5SA 5CHAC 3A81A 3TNSA 3QGJA 1O3KA 4O9VA 3NWUA 1C5ZB 1O2UA 1ORFA 3QGNB 3BTEE 2WPIS 2DUCA 3TH2H 3RLWH 1O3EA 3SV8A 1LKAA 2LNCA 1C5NH 2V35A 4CH2B 2A31A 2CN0H 2Z94A 3ZZ5A 3QK1A 2G55A 4E7RG 1OP0A 3HGPA 2Q6GA 1O3MA 1KTSB 3RM0H 2FWWA 1TGCA 2YNAA 5IDKA 8GCHF 3UNQA 5EU8A 1K1MA 5FBIA 1GVLA 4X6PA 3D23A 4ZXYH 2F9PA 4K1SA 3MH6A 4FUDA 1PPEE 5A09A 3S7HB 3UNRA 1IQGA 1TMUH 3SJ8A 1EASA 4D7GA 3PV4A 3QO6A 2WPMS 3CP7A 2CMYA 2ZDNA 2O8MA 2VIPA 1O2MA 1HJ9A 4KKDA 2M5TA 1P05A 1LPKB 1T8LA 1DWDH 2FOFA 2HALA 4NWLA 1UTPA 3MH7A 4IN1A 1ARCA 2JETC 1ZHRA 1H8IH 2VWMA 3IITA 1TPSA 1THRH 2WPKS 4Y0ZE 2PWXA 1BRUP 1WOFA 5A0BA 1NS3A 1QJ6B 2V6NA 1DSUA 4NG9H 1FIWA 1TNLA 1O37A 3QN7A 1BJVA 1O2JA 2AGEX 1JOUB 1A3EH 5EW2H 3A7XA 2ULLA 3V0XA 1BHXB 2Z9KA 3S9BA 3SU5A 5DG6A 3V13A 2QYIA 1KLTA 2TGTA 3ZVGA 5DP9A 1UK2A 3SHAH 1GBFA 1AWFH 1O2KA 3MYWA 2Z6BD 3RXTA 1V2KT 4LZ1H 3SV7A 2ANYA 3KN2A 4CR9A 5EXLA 2V3OH 1SFQB 4A1VA 2FOCA 1N6YA 3A83A 3TIUA 4WXIA 1WBGB 1EZUC 1D3QB 1HGTH 1O5CB 1EB1H 5FPSA 2XW9A 3EAJA 2SNVA 3SUFA 2TGDA 1GI1A 1L0ZA 3E16B 5EOKA 3F9HA 2OD3B 1GWAA 1DWBH 3GDSA 4FUJA 2BYAX 1FZZA 1XUGA 1O0DH 1RS0A 2NWNA 1WSSH 2FI3E 4CREA 1BRCE 1SI5H 2XBWA 2TIOA 1A46H 5H4IB 5JBBS 4NWKA 4WWYA 2BB4A 6GCHG 3MOCA 2BD5A 1O5EH 2EI8A 1ETRH 3LGTA 1S0RA 1XXDA 4JK6A 2FDAA 1QFKH 2Y5HA 4X8TH 4ZMAH 2A4RA 4ABJA 4FUBA 2A32A 3F9GA 1V2MT 1L1JA 2D2DA 2IN2A 1EZSC 1CE5A 1GG6C 4GLYA 1VGCC 1BTXA 3CS0A 2SGEE 1ETSH 2QF3A 1C5MD 1IQIA 1CO7E 1PPHE 5L2ZH 2G8TA 2CF9H 3UREA 1QL9A 2QN5T 4ZAEA 4Z6AH 4AZ2B 1PYTD 1BRAA 1DSTA 1HPGA 1G9IE 1O2ZA 4AGKA 3EYDA 4GUXA 1TNIA 2FTMA 2PGBB 1HV7A 2ZGCA 1AFEH 1OP2A 2W26A 2XCNA 1N1LA 3FP6E 3MNCA 1F5LA 3RC5A 4UD9H 3ZZ6A 5F8TA 4Y10E 2K1QA 3BSQA 3ZZDA 3A86A 3AASA 1TBQH 1GBHA 1EZXC 1GJ9B 3A8DA 2UUFB 3RM2H 1O38A 3GCTG 1SSXA 2BY7X 1L1NA 1KXFA 5HGGA 1EAWA 2JH0D 2A0QB 3M7TA 1XM1A 3M5MA 2ZGBH 2Y7XA 1K22H 2THFB 1HAIH 1UVPA 5GIBA 3GDVA 1FDPA 3D49H 1P09A 3LGIA 1HXFH 3T27A 2GP9B 1J17T 1FNIA 3AAUA 1C2FA 2J92A 1KXEA 3B8JA 5GDSH 1D3TB 1HAGE 1PPZA 5FHTA 3EA7A 1TQ7B 1OX1A 1TX7A 1A0LA 4X6MA 3ZZ7A 1ARBA 2G00A 1HUTH 3RXVA 1MU6B 3STJA 4OS7A 1F5KU 1C4U2 2GZ8A 3P8FA 3VGCC 2HNTE 1JMOH 3RXFA 1GHZA 2Q6DA 4LXBH 5DO4H 3TJOA 5ABWA 2EC9H 3MO6A 4ZUHA 1C4V2 3SGBE 4IMZA 3ZVDA 1MU8B 2ALVA 1BCUH 4MNWA 3SJOA 2Y80A 3MNBA 2GCTC 1F0SA 2BOHB 1B5GH 1GBMA 1ZJDA 5DPAA 1FN8A 3ZVEA 4CRFA 1NRRH 1TPPA 4YTAA 1P3EA 3LPRA 1TPOA 1GJBB 2YOLA 1O3BA 1SQTA 2ZU2A 1K1NA 4K3JA 1UK4A 2PUXB 1BTUA 1DLEA 1DUEA 1AY6H 1BQYA 3HKJB 1O5GH 2ZDLA 2BTCE 1L4DA 4JZIA 2C8YB 1Z6JH 3GY3A 3SU2A 3ESTA 1RTFB 1GI4A 3M5OA 2ZP0H 1QL7A 1AGJA 3BEUA 3KQBA 1C1WH 1G2LA 3SI4H 5E0GA 1SQOA 3UQVA 1MQ6A 2BDBA 4K60A 1BT7A 1GI2A 1ANCA 1QB1A 2ZDVH 3A7YA 1G3EA 3FVFB 2ZKSA 5LPFA 1YM0A 4Y8ZA 3BTHE 1D4PB 1SVPA 2QXGA 5JPMH 4UFFH 3RMMH 3E6PH 3EGKH 4B71A 1KSNA 1P57B 1V2UT 1EQ9A 4FUEA 1P8VC 1O2TA 3BTME 4AG1A 1LDTT 1CGHA 3SUGA 1MD7A 2BDYA 1BMAA 1AVWA 3HGNA 1TNKA 1TPAE 2A4OA 5F8XA 2GV7A 1TGSZ 1OWIA 3U69H 1K1IA 3GCNA 3BV9B 1BTHH 1P03A 3P95A 5EGMA 1PPGE 5EODA 5EQSA 2VGCC 2AGIX 1GHVH 2BDAA 3BIUH 2I6SA 3TGKE 1FONA 4A92A 1GBBA 1T32A 1CHOF 2PR3A 4DOQA 1H8DH 1VJ9U 1O2GH 1TX8A 2QF0A 4I33A 2WUCA 1ELFA 2FS8A 1O2QA 4CRCA 5T6DA 1WQVH 3MU4A 2W7SA 8LPRA 3GY4A 1ZTKA 3SGQE 2P3TB 1S81A 4U2WA 2XBXA 1ELBA 3RXSA 3P8GA 5AFZH 4MPUA 2BX4A 3P6ZB 4F4OC 1UVTH 2QXJA 2NU1E 4X8VH 1FXYA 5GPIB 1GHAG 2J2UA 2PKSC 2R9PA 5DKMA 2ZQ2A 5C5NA 1K1LA 1HAPH 1S82A 1H1BA 1B7XB 2FOMB 3RMNH 3TGJE 2A45B 2IOTA 1TGTA 4NSVA 3RU4D 3SU0A 4AB9A 6ESTA 2GGVB 4BXSA 1FIZA 3A8AA 1DOJA 2ZPRA 5K0HA 2GKVE 1RXPA 2Z9IA 1OYQA 2D26C 4A5TS 1AMHA 1QGFA 2ZHQH 1LVMA 1MKWK 2C8WB 2Q6FA 4XBBA 3B23B 3A7WA 2CHAC 2UUJB 3UPEA 1CGJE 2HVXA 1T4UH 2VJ1A 1BMNH 4AFSA 3F68H 1S0QA 4X2WA 1GJ5H 1ZLRA 1A7SA 1ELTA 1Z8JB 1GVZA 1SGIB 1PJPA 4TPIZ 2BQ7B 4D9QA 3GCOA 3BEIB 2R2MB 4VGCC 3GY2A 3MWIU 4OS4A 5AVDA 3TK5A 5LGOA 1JRSA 3W94A 1LVBA 1EPTC 1BBRH 3BG4C 1SLWB 1ID5H 1CSOE 4K1EA 1EP5A 2GCHF 2Z9LA 2ASUB 1GMDF 3HATH 1CBWB 4HGCA 1E38B 1KYNA 1SGYE 3MNSA 4OGYA
chains in the Genus database with same CATH superfamily
2FOAA 2ZGXH 3RC6A 3T5FH 3ZVBA 3PMAB 2VIDA 1QQUA 1RFNA 1HJ8A 2R3YA 1O2NA 3EE7A 5DP7A 3ZZAA 4DJZB 1YY3A 4E05H 4OM9A 1P9UA 1RRKA 1D6WA 1TABE 2BY9X 3SJKA 1SHHB 1KLIH 3M36A 1C1QA 1MTSA 4Q2KA 4Y71A 3OEHD 1VCPA 4X6OA 3FP8E 2WPHS 4HFPB 7GCHG 2F9NA 1EJAA 4JCNA 3LONA 1AZZA 2H5CA 3A89A 5J4SA 3LH1A 1EOJA 1KXAA 1XUFA 2F83A 2ZDAH 1AKSA 1T8NA 1HAZB 1HIAB 2RG3A 1NFXA 3VG8A 4CR5A 4VGCB 3L6PA 3RXRA 1UCYE 3BTQE 4WMFA 2RA3A 1GI0A 1TGBA 2PKAB 3F2GA 1GBIA 1OWJA 3Q3XA 1C1TA 2KAIB 1YCPK 1A5IA 3TK6A 3E91A 1G3CA 2WYJA 3Q3YA 4ABEA 1NU9A 2A2QH 1QR3E 3Q3KA 2W7UA 1PQAA 1C4Y2 5L30H 1EPTA 4Y7AA 1IQNA 2SGFE 5C1YA 2BY6X 3N99A 3M3SA 1C1RA 1C5TA 2ZHFH 3SV6A 1BRBE 3ATIA 3PLKA 1C1MA 5EG4A 3NCLA 1EUFA 1S6FA 3EE0B 3WW7A 2FS9A 1TMBH 2XTTB 3U9AH 1NZQH 4LK4A 3ZYEA 4FUIA 3JZ2B 4OS1A 2F9UA 2J98B 2P8OC 2G4UA 3A8BA 4H42U 1Y5AT 3AW1A 1W13U 2PGQB 4AFQA 2B7DH 1GCTB 4XSKU 2KCPA 1TNHA 4UFDH 3T62A 4ISLA 4I8JA 4KGAA 2WINI 1UJ1A 1O2SA 3RXOA 2GJGA 1HCGA 2HNTF 3QLPH 5DK1A 1FY8E 4ESTE 2JDID 2OBQA 5FPTA 2GMTC 3SO3A 2P93A 1UTKA 2PKSB 2PV9B 1SKYE 4INHA 4Q7YA 1BITA 2F43B 2ZZUH 3QTVH 1X7AC 2XRCA 2RDLA 3CNRA 1K0HA 5GJ4B 5LPEA 1O3LA 4NSYA 4ABIA 1YCPH 1FY3A 3A80A 3RXAA 4FOUC 2BM2A 1P01A 4AN7A 4XE4A 1TA2A 2H6MA 1QNJA 1U6QA 3KIDU 1J16A 2O8UA 3SJ9A 1RIWC 2HPPH 4JYTA 1A5GH 4GSOA 1XUKA 2GDDA 2H5DA 1KIGH 5FX6A 4WF8A 1LCYA 2VVCA 2FOHA 2ZPSA 3DT0H 2FOGA 2HGTH 1Y3XA 2PTCE 3KEEA 1ZJKA 4UDWH 1YLDA 2B8OH 2BZ6H 3KF2A 2JJ2D 1GBTA 3E3TA 4TY6A 1RTLA 2BXTH 2AHME 3PWCA 3SN8A 1UTOA 4ABAA 4DVAU 2VBCA 4FUCA 4ASHA 1C5RA 2OP9A 1WQSA 1C5YB 1WYKA 4RN6A 3DCLA 4IW4E 3KYFA 1QJ7B 3RU4E 3SZNA 2SGPE 5C94A 5L2YH 1EZQA 4YO9A 1TGNA 3MU8A 2PHBA 1FAXA 1K1PA 4ZROA 2CK3D 1OYTH 1V2VT 3LGVA 4KELA 3ATMA 1GJAB 1MBMA 1A0HB 1WTHD 1HAOH 2UUYA 3MU5A 2Y5GA 1DT2A 4NIWA 2FI4E 2GCHG 3RP2A 2J98A 1GMDG 3VFEA 1TOMH 2WV5A 2A7HA 4RKJB 3ATKA 1UTJA 3S7KB 1D3DB 1GJCB 4JZ1A 3OU0A 4B1TA 8KME2 2FODA 3KNXA 1KTTB 1UTQA 1ETTH 3SU1A 8ESTE 1S84A 4O3TA 2GDEH 3ZZ8A 1MABB 1YPEH 3RXMA 1P2IA 3UOUA 1EP6A 2GCTB 1G32B 5GXPA 1SGFG 1QA0A 1A61H 2WV4A 2Y82A 1C2KA 1AD8H 4BTIB 3HK3B 1G30B 2ALPA 3FANA 4DCDA 4ZHLU 4X1NU 4GHTA 4MPVA 1ANBA 4DW2U 1GL1A 3A88A 5SGAE 3A85A 2UWOA 5FXLA 1FMGA 4DT7B 1ZSKA 2KAIA 5T3HA 5T6FA 1LKBA 2Y7ZA 3N7DA 3TITA 1ZHMA 1TBRH 1YC0A 1GCTC 2OXSA 5E0HA 4J1YA 1FY1A 3V12A 2G81E 1MKWH 2VWNA 3VXEH 1VCWA 4ZKOU 1IHTH 2QXIA 1LVYA 7KMEH 2VIVA 4B2CA 5FL7D 3TVJB 1HIAA 3SU6A 1AKSB 2ZFTA 4BAHB 5JB8S 5HMAA 4YXWD 1QRWA 1MTNC 1HFDA 1QURH 1ZTJA 4BANB 1QIXB 2F91A 1HLTH 1GGDB 2NU2E 3PMJA 1GBKA 3MO3A 1QQ4A 1TIOA 1JXPA 2ZECA 3S69A 3UUZA 3DA9B 4I8KA 4J2YB 3DUXH 3KQCA 3KQ5A 4WMDA 1O30A 4U30A 3U8RH 1Q2WA 1DVAH 2P8OB 1AU8A 4H6TA 1GJ4H 4IBLH 1MAYA 1MAXA 1QY6A 1JRTA 2AFQB 3JZ1B 2G5VA 1JWTA 3ZZBA 4CBNA 4O3UA 1W0YH 1T8OA 1IQFA 4YESB 3PYHA 2BQ6B 1ESAA 2Y6TA 2ANWA 1S6HA 3GY7A 4XBCA 2Z9GA 3RC4A 3LH3A 1FY4A 4NIYA 1XKBC 4I8GA 3DD2H 2KFWA 1UVUH 1H8ED 3BN9A 3BIVH 4GAWA 4Y76A 2ZNKH 4Y6DA 3BF6H 4AOQA 3NUMA 4X0WU 2VIWA 2ZIQH 1C9PA 2GX4A 3NRLA 1K9OE 3GS9A 1SLXB 2R3UA 1E1QD 1HAYB 5DP3A 3MHWU 3S9AA 1UTMA 1GDQA 1BTYA 3SNCA 3MQKC 4IGDA 1DUAA 2ZU3A 2CF8H 3RXJA 1FY5A 2CGAA 5I46H 2AMQA 2EEKA 1DX5M 3BTFE 3M35A 3BTTE 1LHFH 2GV6A 3T28A 1GI5A 4CBOA 1ZMLA 1DY9A 1SGEE 1LHGH 2GT8A 1K1OA 2PTNA 2A7JA 4U32A 3GYMA 4Y79A 2M2AA 3BEFB 4Y8YA 4CHAC 5ESTE 4NGAH 1VITG 4I86A 5EJ1A 1ZMJA 3URCA 5DJ7A 1BIOA 1HBTH 1AQ7A 1V2ST 3MTYA 4DIHH 5CE1A 1LVOA 2ZGJA 1HNEE 3Q77A 2RA0A 1ZZZA 4NA9H 4DURA 3PV5A 1GHBF 1T7CA 1E34B 1AUTC 4BTTB 4D8NA 2ZFRH 1BJUA 2BY5X 3OFND 4YOJA 5JBAS 2A4QA 2P94A 4JK5A 1YKTA 2G4TA 1ELEE 2ZG0H 3QDZB 2FYRA 2HNTC 2WZQA 5C17A 4ACBA 3ELAH 4ISNA 3SV9A 2VH6A 3LC5A 1B0EA 1O2WA 1V2OT 3PMBB 2L6OA 4E06H 1EPTB 5AF9H 1HDTH 4I8HA 2PSYA 2C90B 1W7GH 1P11E 2YMSB 1TFXA 1UCYK 5LH8A 1TQ0B 2FTLE 3FZDA 1E36B 1O33A 3NKKA 4YZUA 1DXPA 2ZCHP 1YPLH 2K8IA 1MKXK 2J94A 1BUIA 1LPGB 5EPYA 4HZHA 1W2KH 4KTSA 4DY7B 4AYYB 1FQ3A 1J8AA 1P02A 1TX6A 3RXCA 3P8NA 3I77A 1Y59T 3MH5A 1C1VH 2JH5D 3AAVA 5E8EH 2B9LA 2A5AA 3M3TA 3A7TA 1LMWB 1P9SA 1C2LA 4JZEH 3F2FA 1FV9A 2XBVA 2Z7FE 2QF5A 3O8DA 1DE7H 3KQDA 1RIWB 2QCYA 4OS6A 1S83A 1S6LA 4BAOB 1C5XB 2YNBA 1GJDB 1E35B 1ELGA 3SJIA 2WHXA 1HAVA 2OBOA 5HXFA 2QY0B 3BTDE 3LGUA 5EW1H 1ZPZA 1V3XA 2ZTXA 1QA7A 1A4WH 1YPHC 1SOZA 2G51A 1NTPA 5C1UA 1PFXC 3UR6A 2V3MA 3A7VA 1UTLM 1E0FD 1TRMA 2SFAA 1O35A 3HKIB 3K9XB 1ESTA 1TE0A 3K6ZA 3F0OA 1E37B 1IQKA 1OKXA 1O3GA 1ESBA 1YPMH 3KYGA 2FMJA 1KXCA 3ATLA 3ITIA 1BTWA 1BA8B 1TYNA 1XUJA 1C9TA 1YGCH 4MDSA 3UY9A 2BLQA 3A7ZA 1VCQA 5BPEA 3KHVA 1AVXA 2BLWA 2OINA 2SGQE 3M7UA 4X1QU 2D1JA 1FX0B 4GPGA 2P3FH 5FCRA 1MZDA 1SGCA 1CA0B 5CMXH 3TU7H 2AH4X 4I7YH 1O3NA 2WYGA 1DXWA 4HG6A 4UFEH 3UTUH 2BVXH 3TK9A 2F3CE 1GHXH 1SBWA 4ZHAA 1DDJA 2KCYA 3GCTF 1JIRA 1QRXA 1O39A 3BTKE 4ABHA 4A6LA 4ISHH 1LHDH 3SBKA 4FXGH 1MMJN 4B73A 1UK3A 2XOKD 1EFRD 1IQEA 1O2OA 2J5UA 4ABFA 1DITH 1ZPBA 3UAIC 1P2JA 4AYVB 4K69A 3LT3A 3NK8A 9LPRA 1AZ8A 3SNEA 1BDAA 5JYIA 4GHQA 1F0UA 4SGAE 1D3PB 1ZRKA 2OQ5A 4B6FA 4XD7D 1CT0E 3ZVCA 2XXLA 1GHYH 1SGFA 2NU3E 4X8UH 3M3VA 1THPB 2Y5FA 4FU9A 1BTZA 1FUJA 1OWHA 1EAIA 2VIOA 1GPZA 4D7FA 4Z1MD 2Z3DA 2ZO3H 3TH4H 1BOQA 1F92A 1IQHA 2XC4A 1XVMA 1P2QA 1QHRB 5CHBA 4INKA 4AG2A 5AFYH 3RXLA 3UR9A 3P17H 4FUHA 4CRAA 2FX6A 1V2QT 5A8ZA 5JDUB 1XKAC 4ABBA 4IC6A 2BY8X 4IS5A 2UWLA 1W0ZU 1DY8A 3AW0A 2BDHA 4R8TB 5F8ZA 1AFQB 1EATA 2BZAA 1W8BH 2ZFFH 3GCHC 4NFFA 4BAQB 3F0PA 1SGQE 1K1JA 1C2JA 3GY5A 2J38A 2VH0A 1ZGVA 2DE8A 1S85A 3ENSB 1FJSA 8GCHG 3EA9A 1ZPCA 1ELCA 3LC3A 2O8WA 1NRNH 1TNGA 2LPRA 1C5QA 1OWKA 4NZQA 2R0LA 1C1SA 3MU0A 5G4BA 1INCA 2NU0E 3GY6A 2GZ9A 1EB2A 3LOXA 2BXUH 2BX3A 1L2EA 2QE7D 2R2WU 2CJIA 4D76A 2KM0A 1DM4B 1TOCB 6CHAC 2EI7A 1NRQH 1IQLA 2BD8A 1GMCG 3K2UA 2AERH 1UVSH 2ZHWH 1QCPA 1CT2E 1WUNH 3M61U 1UVOA 2TGAA 4I31A 1C5OH 3RXDA 1OWEA 4XOJA 1N8OB 1KDQB 1O34A 1ACBE 1T4VH 4AX9H 1GBEA 1T8MA 4UE7H 3VB5A 5DP5A 3R3GB 2FYQA 3E8LA 5AHGH 1AE8H 3F9EA 1P04A 1L4ZA 1Z1JA 1SMFE 3KQEA 3E0PB 1C5VA 2BQWB 3IG6B 1O2PA 1TALA 1O5DH 2V3HH 3HK6B 6CHAB 1A0JA 2R0KA 1PPFE 3MH4A 4O97A 4TSFD 3UWIA 1F2SE 4JZDH 4KTUA 1BBRE 1QB6A 1MD8A 3SW2B 3M5LA 1SR5C 5EXMA 2GVFA 3TLOA 9ESTA 2BD9A 2B5TB 3ZYDA 1MUEB 2BD4A 3DFJA 1PQ8A 2V7QD 3RXEA 4HTCH 1YCPM 2P16A 1C2DA 3RDZA 1PYTC 5GWZA 3DSOA 2EA3A 1SC8U 3FZZA 1KLJH 2EY4C 2D8WA 2ZGHA 1DWEH 2HRVA 3WY8A 1G3DA 3DHKH 2H9EH 1MZAA 1SPJA 1W14U 2OCVB 1J14A 1W12U 1DFPA 2OC8A 4FUFA 4MG3A 3O8RA 3STIA 5EJZA 3OY5U 1IAUA 1XUHA 3U8OH 3ZIAD 2ZTZA 5JBCS 4X8SH 1A1RA 5A2MH 4ISOA 1OWDA 2J4IA 1LQDB 3S9CA 1AO5A 1N6XA 1GHAF 1NBME 2ZQ1A 3IWMA 3URDA 1ELAA 2ZU5A 1GHWH 3PM3A 2FESH 4RT0A 1G3BA 3OYPA 1GG6B 3ZZ9A 2ODQA 1J9CH 1QRZA 2QGRA 4F55A 2ZHDA 1C2MA 1O2RA 1V6DA 1O2LA 4K1TA 6GCHF 1GDNA 2SNWA 4CH8B 1BMFD 2CV3A 5TCAA 2TGPZ 3SV2H 1UCYH 2FXRA 2BD2A 5C67A 3D65E 1GI8B 1LPZB 4MNXA 1TBZH 4BOHA 1TB6H 4MPWA 1C5PA 1G2MA 4JYUH 3RU4T 5EPNA 4ZXXH 1ZSLA 1K21H 3A84A 1E1RD 1NT1A 4UFGH 3SNAA 2W3IA 4X1SU 1AUJA 3GDUA 4ISIH 4MVNA 4MNYA 1GJ8B 3RMOH 1CQQA 2C3SA 1NM6A 1TLDA 1WXRA 5ESBA 4D9RA 1VZQH 3T26A 4CHAB 2H9TH 1P0SH 4ZKRU 3CS7A 2WPJS 2O9QA 3TJVA 4TYDA 1NROH 4INLA 1HAHH 1TMTH 1SFIA 1GL0E 2EI6A 4A1XA 4RT1A 5IYTA 1YLCA 1Z6EA 1ZHPA 1P2MA 4BTUB 1TWXB 1WTGH 1MCTA 2Z3CA 1W3CA 1EJMA 2BDCA 4BAMB 4PROA 4Q80A 1PPCE 1GVKB 2SGAA 1Z8RA 2CHAB 3P8OA 2IPHA 2A1DB 3TH3H 3SI3H 2O8LA 1HAXB 1COWD 3FO8D 2XNDD 3VEQB 1D9IA 1CGIE 2HWLB 1IQMA 5C1XA 4Y0YE 2IJD1 1ELDE 4Y11E 4KTCA 2Y81A 2FLRH 5DP6A 7GCHF 2ILNA 1BTPA 3RXUA 1XMNB 3E0NB 5C20A 1MBQA 4TPYA 1BBRK 1GJ6A 4WH8A 4JYVH 1XX9A 4XRNA 1J15A 3UOPA 1SLVB 1P06A 2ANKH 2J34A 2ZEBA 4B75A 3RXKA 2BLOA 4Q7ZA 1EAUA 3PROA 1O3DA 2BVRH 4YLUA 2VWLA 1O2HA 1QJ1B 2BLVA 2FIRH 1YPKH 4AB8A 1W10U 3ZZCA 4DGJA 1GMCF 3S0NA 1VITH 1Y3WA 4Q63A 5C0UA 3LKWA 5HM2A 2GTBA 1EX3A 2W5EA 1O3HA 3W95A 1TRYA 4B2BA 1GDUA 1V2PT 4MQAA 3PLPA 3UQOA 2O8TA 4H6SB 3M37A 5E2OA 4R0IA 2OK5A 3PRDA 3ZZ4A 5DP8A 1TONA 5ETXA 1MTWA 3HPTB 3F1SB 2AIQA 1QBVH 1ZGIA 3N7EA 4DIIH 4NIVA 4NA8A 1C2GA 3OAAD 4FUGA 4UONA 2JH6D 3EDXB 5BRRE 1CT4E 3MI4A 4TWYA 3OY6U 2VWOA 3UNSA 5CHAB 1F7ZA 2QC2A 3SNDA 4Q7XA 2ZPQA 3LDXH 1BHXF 3T25A 1NRSH 4I32A 3ZVAA 1YYY1 1LHCH 1O5AB 1P3CA 4O03A 1N8OC 2ZU4A 2QAAA 3QX5H 5FCKA 4A1TA 2JKHA 1HJAC 1BMMH 2BDGA 2ZF0H 1NN6A 3OE7D 1SGRE 1AN1E 5LPRA 4RKOB 3SUEA 2WSSD 1VJAU 3GISB 2A7CA 2FLBH 5GCHF 1FPCH 1CU1A 1ZRBA 3VB4A 4CRGA 3GOVB 3SOSA 3FAOA 2BHGA 2FZZA 3U98H 1HXEH 1SGDE 3PMHB 3D62A 3ZV8A 1O36A 3BG8A 3RXPA 2NU4E 5DP4A 2BVSH 4Y8XA 2QF4A 2KCOA 1F0RA 1Y5UT 4TY7A 1H4WA 3A87A 1G36A 4GCHG 4X1RU 4FU8A 3FKSD 4X6NA 3NXPA 1A2CH 5C2ZA 3MO9A 1PQ5A 2OC1A 1CBWC 4YOGA 3WWBA 3PTBA 2HVYB 1QBNA 1V2NT 1S5SA 5L6NH 3SORA 3CENA 4H4FA 2GT7A 1AWHB 4YM9A 2C8ZB 1A5HA 1WAYB 1V2RT 1NFUA 2P95A 3SHCH 1T31A 1SGTA 1NFWA 1CHOG 4TWWA 1FPHH 3OTJE 4YT7H 4UEHH 1PQ7A 1TA6A 2PKAA 1NFYA 1O5BB 4IC5A 3SQHE 1THSH 1OS8A 4HI3A 1JBUH 1KDQA 2ZFQH 1CHGA 5C0TA 1HAVB 2GD4B 2VVUA 4F49A 3QZRA 1WDIA 5EIYA 1FLEE 4AFZA 4ZCNA 4ZHMU 2H2ZA 4B76A 3VB6A 1CA0C 4NZLA 1DWCH 1SL3A 3MNXA 3DSPA 1GBJA 1QTFA 2FI5E 3R0FA 5E2PA 5JB9S 3QTOH 2BDIA 1RJXB 3F6UH 3SU4A 1NY22 1ANEA 4ZKNU 1GBAA 1P12E 3SUDA 2QV1A 1BZXE 2YMSD 4FETA 3VPKA 3BTGE 2RFKC 2SGDE 1VR1H 2Z3EA 1GI7B 1C5WB 1P2KA 5T6GA 1Z7KA 3I78A 2F9OA 1K28D 2ZCKP 2F9BH 1YPGH 3GICB 1O2VA 5EQQA 5EQRA 2B0FA 5EJLA 3N7OA 1Y8TA 1BMLA 4JMYA 3UIRA 1UMAH 1GBCA 5PTPA 4CRDA 1W11U 2BOKA 4THNH 2PP6A 1ZSJA 3C1KA 1C5LH 2PUQH 1ZR0A 3PRBA 4NCYA 1UHBB 3RXGA 1SLUB 2I6QA 2UWPA 3I29A 1MKXH 2ZI2H 3EQ0H 5A8YA 3TGIE 3P70B 1ABJH 2FP7B 1V2WT 2ZHEH 2A5KA 5B6LA 4YT6H 1V2TT 1H9LB 2AIPA 2W6JD 2AS9A 1NPMA 5B6OA 3U1JB 3L3TA 3SU3A 2ZC9H 1EXFA 1TNJA 5C5OA 1VGCB 2BD3A 1SHYA 1C2IA 5TCCA 3SQEE 2ZCLP 1TRNA 3LGWA 1XUIA 3RUOA 1MTVA 5FPYA 2FOBA 4FU7A 5FBEA 1C5UA 1NRPH 4BNRA 1Y5BT 3LJOA 1AFQC 3GCHB 1NO9H 4XFQA 4Q4LA 2P59A 2K0QA 4MLFB 2ZFPH 1W7XH 3QZQA 3VB3A 3ODDA 2TRMA 2C4FH 4NA7A 5HIZA 3TJNA 1O3OA 1P2OA 1O5FH 1D6RA 2F9VA 4OS5A 3ODFA 3GYLB 4WXVA 4CRBA 4YLQH 4IMQA 3A82A 4ABGA 3OX7U 4QT8C 5TJXA 3TNTA 3FP7E 1YPHE 1GMHG 4K8YA 1UW7A 3K65B 3PWBA 2ZFSA 3RXHA 4LZ4B 1O3AA 2ZDKA 4ABDA 1WV7H 3AVZA 1UHBA 2OC0A 3PO1B 4WH6A 4X2XA 4NFEA 2IJOB 2J95A 2PSXA 3RXBA 1F0TA 1NC6A 3E90B 1O2YA 2C93B 4AGJA 1KY9A 1OP8A 3C27B 4WMEA 1Z8GA 2PLXA 3PO1C 4DG4A 3M5NA 3VB7A 1RGQA 2CXVA 5GCHG 1CVWH 4XBDA 3TJUA 3UFAA 5HYOA 1O3FA 1C2EA 3SGAE 1FN6A 4AFUA 1OXGA 1PPBH 3M7QA 1C1OA 4A7IB 1A3BH 2GZ7A 4WY3A 3KL6A 1C1NA 3E1XB 2WUBA 3Q00A 4GCHF 5DSFA 3DFLA 5J4QA 5DN6D 1SOTA 3BG4B 1QB9A 4Y7BA 1DPOA 2A4GA 3LGYA 1YWUA 2AEIH 3OSYA 4MTBA 3RMLH 2PFEA 1VITF 2OUAA 3O8CA 2JETB 3U1IB 1MCVA 2HLCA 2ZWLH 1EAXA 1G37A 4YOIA 3ATWA 3ZV9A 3V3MA 1ZYOA 1W0JD 5K7RA 2VB0A 5HM9A 3U8TH 1YPJH 3K6YA 3T29A 1EKBB 1GHBG 1Z8IB 3MMGA 2J9NA 2ODYB 3L33A 2HLDD 4WVPE 2VU8E 1E79D 1SGPE 3VGCB 2QA9E 4LOYH 2AMDA 2KX4A 1SB1H 3LJJA 1HRTH 1GI9B 3PB1E 1MH0A 3T2NA 2VIQA 3LIWA 3B9FH 3H7TA 4I8LA 2ZU1A 4JZFH 3ZVFA 1GJ7B 1WU1A 4BXWA 3P92A 2VVVA 4M7GA 2A2XH 2GMTB 5KEDA 1P2NA 4Z0KA 2XYAA 2STBE 3UWJH 1H9IE 2WV9A 1MTNB 1C1UH 2STAE 4FVDA 1Q3XA 1LQEA 1AB9C 2ESTE 4GVUA 1M9UA 4BAKB 1K2I1 2AGGX 2OQUA 2DE9A 1O3PB 3MU1A 3FFGA 1SQAA 3PLBA 1Z71A 2WPLS 2XWBI 1WCZA 1C2HA 3ZZ3A 1ABIH 2PW8H 2ZA5A 1SGNE 1LO6A 7LPRA 2FM2A 2VNTA 4ZH8A 1HYLA 1Y3UA 2H9HA 4K8BA 1C1PA 1GCDA 1AB9B 2UUKB 5I25A 1P10A 5A0AE 3RLYH 1H9HE 5DGJA 1B0FA 1GGDC 1AE5A 4IN2A 4B2AA 3QUMP 3O8BA 1XXFA 1GBLA 1DICA 5F53A 2AYWA 1GI3A 2ZDMA 1NESE 2BMGB 2W3KA 1ANDA 4U01A 6LPRA 4AORA 2FPZA 1KXDA 3EA8A 1MQ5A 1EOLA 5EXNA 1VKYA 2FX4A 1MTUA 3PTNA 3SZEA 2Q1JA 2TBSA 4FVBA 3LU9B 2G52A 1DANH 3BTWE 3KGPA 1Z1IA 1EJNA 2QXHA 4MNVA 2OLGA 2HPQH 3H5CB 4K2YA 4KP0A 1KXBA 3RXQA 5F03A 1IHSH 1V2LT 5A0CA 1IOEA 1SG8B 2FO9A 3KCGH 4X1PU 3H7OA 1NU7B 4XDEA 1ZMNA 5FX5A 1UO6A 2XC0A 1XVOA 4RSPA 5A8XA 1AIXH 4X2YA 3V7TA 1AHTH 4MPXA 1DLKB 1Y3VA 3GY8A 7ESTE 4ZKSU 1ELVA 2FEQH 1O2IA 4B74A 4RI0A 2RCEA 5JBTA 2VGCB 4WJG2 2HOBA 1F5RA 2VINA 1OPHB 2P3UB 1IQJA 4X2VA 1AI8H 5C3NA 3VXFH 1FI8A 2V0BA 2AMPA 2XC5A 1Q31A 2Z9JA 5FAHA 1O3JA 1ZTLA 2TPIZ 1YF4A 2OTVA 1YP9A 4K5ZA 3Q76A 1O2XA 5E0JA 4OS2A 3UB0A 2ANMH 3A8CA 1TAWA 1GI6A 1BB0B 5F6MA 1O31A 1UTNA 2XWAA 1CA8B 1O3CA 3WWFA 2OC7A 2XBYA 2QIQA 4E7NA 1GMHF 2G5NA 3NZIA 3MFJA 2BD7A 3RXIA 3G01A 1LTOA 3W1EA 2FOEA 2XNIA 3F9FA 5HIYA 1O3IA 1FAKH 1L1GA 1V2JT 1YBWA 1QBOA 2A5IA 1AVGH 1OHHD 3NPSA 1DS2E 1HJAB 2H1UA 2XCFA 1HB0B 1LHEH 4SGBE 3AK5A 4OGXA 2C8XB 2ODPA 1ZOMA 1QL8A 1OSSA 1RTKA 1O32A 3TPIZ 1OOKB 1GBDA 1Y3YA 1RD3B 2ZTYA 3QWCH 1JIMA 4NIXA 3SNBA 1C5SA 2KZ4A 5CHAC 3A81A 3TNSA 3QGJA 5CDFE 1O3KA 4O9VA 3NWUA 1C5ZB 1O2UA 1ORFA 3QGNB 3BTEE 2WPIS 2DUCA 3TH2H 3RLWH 1O3EA 3SV8A 1LKAA 2LNCA 1C5NH 2V35A 4CH2B 2A31A 2CN0H 2Z94A 3ZZ5A 3QK1A 2G55A 1NBMD 1W0KD 4E7RG 1OP0A 3HGPA 2Q6GA 1O3MA 1KTSB 3RM0H 2FWWA 1TGCA 2YNAA 5T1VA 5IDKA 8GCHF 3UNQA 5EU8A 1K1MA 5FBIA 2KR7A 1GVLA 4X6PA 3D23A 4ZXYH 2F9PA 4K1SA 3MH6A 4FUDA 1PPEE 5A09A 3S7HB 3UNRA 1IQGA 1TMUH 3SJ8A 1EASA 1H8HD 3DSGA 4D7GA 3FN8A 3PV4A 3QO6A 1YLNA 2WPMS 3CP7A 2CMYA 2ZDNA 2O8MA 2VIPA 1O2MA 1HJ9A 4KKDA 2M5TA 1P05A 1LPKB 1T8LA 1DWDH 2FOFA 2HALA 4NWLA 1UTPA 3MH7A 4IN1A 1ARCA 2JETC 1ZHRA 1H8IH 2VWMA 3IITA 1TPSA 1THRH 2WPKS 4Y0ZE 2PWXA 1BRUP 1WOFA 5A0BA 1NS3A 1QJ6B 2V6NA 1DSUA 4NG9H 4P00A 1FIWA 5IK2D 1TNLA 1O37A 3QN7A 1BJVA 1O2JA 2AGEX 1JOUB 1A3EH 5EW2H 3A7XA 2ULLA 3V0XA 4AC9A 1BHXB 2Z9KA 3S9BA 3SU5A 5DG6A 3V13A 2QYIA 1KLTA 2TGTA 3ZVGA 5DP9A 1UK2A 3SHAH 1GBFA 1AWFH 1O2KA 3MYWA 2Z6BD 3RXTA 1V2KT 4LZ1H 3SV7A 2ANYA 2LP6A 3KN2A 4CR9A 5EXLA 2V3OH 1SFQB 4A1VA 2FOCA 1N6YA 3A83A 3TIUA 4WXIA 1WBGB 1EZUC 1D3QB 1HGTH 1O5CB 3OTPA 1EB1H 5FPSA 2XW9A 3EAJA 2SNVA 3SUFA 2TGDA 1GI1A 1L0ZA 3E16B 5EOKA 3F9HA 2OD3B 1GWAA 1DWBH 3GDSA 4FUJA 2BYAX 1FZZA 1XUGA 1O0DH 1RS0A 5KECA 2NWNA 1WSSH 2FI3E 4CREA 1BRCE 1SI5H 2XBWA 2TIOA 1A46H 5H4IB 5JBBS 4NWKA 4WWYA 2BB4A 6GCHG 3MOCA 2BD5A 1O5EH 2EI8A 1ETRH 3LGTA 1S0RA 1XXDA 4JK6A 2FDAA 1QFKH 2Y5HA 4X8TH 4ZMAH 2A4RA 4ABJA 4FUBA 2A32A 3F9GA 1V2MT 1L1JA 2D2DA 2IN2A 1EZSC 1CE5A 1GG6C 4GLYA 1VGCC 1BTXA 3SYJA 3CS0A 2SGEE 1ETSH 2QF3A 1C5MD 1IQIA 1CO7E 1PPHE 5L2ZH 2G8TA 2CF9H 3UREA 1QL9A 2QN5T 4ZAEA 4Z6AH 2RDEA 4AZ2B 1PYTD 1BRAA 1DSTA 3OEED 4B6EA 1HPGA 1G9IE 1O2ZA 4AGKA 2JJ1D 3EYDA 4GUXA 1TNIA 2FTMA 2PGBB 3FOAA 1HV7A 2ZGCA 1AFEH 1OP2A 2W26A 2XCNA 1N1LA 3FP6E 3MNCA 1F5LA 3RC5A 4UD9H 3ZZ6A 2J97A 5F8TA 4Y10E 2K1QA 3BSQA 3ZZDA 3A86A 3AASA 1TBQH 1GBHA 1EZXC 5KGOA 1GJ9B 3A8DA 2UUFB 3RM2H 1O38A 3GCTG 1SSXA 2BY7X 1L1NA 1KXFA 5HGGA 1EAWA 2JH0D 2A0QB 3M7TA 1XM1A 3M5MA 4DT4A 2ZGBH 2Y7XA 1K22H 2THFB 1HAIH 1UVPA 5GIBA 3GDVA 1FDPA 3D49H 1P09A 3LGIA 1HXFH 3T27A 2GP9B 1J17T 1FNIA 3AAUA 1C2FA 2J92A 1KXEA 3B8JA 5GDSH 1D3TB 1HAGE 3U28C 1PPZA 5FHTA 3EA7A 1TQ7B 1OX1A 1TX7A 1A0LA 4X6MA 3ZZ7A 1ARBA 4P02A 2G00A 1HUTH 3RXVA 1MU6B 3STJA 2KCAA 4OS7A 1F5KU 2WPDD 1C4U2 2GZ8A 3P8FA 3VGCC 2HNTE 1JMOH 5GNDA 3RXFA 1GHZA 2YMSC 2Q6DA 4LXBH 5DO4H 1QZ8A 3TJOA 5ABWA 2EC9H 2F4LA 3MO6A 4ZUHA 1C4V2 3SGBE 4IMZA 3ZVDA 1MU8B 2ALVA 1BCUH 4MNWA 3SJOA 2Y80A 3MNBA 2GCTC 1F0SA 2BOHB 1B5GH 1GBMA 1ZJDA 5DPAA 1FN8A 3ZVEA 4CRFA 1NRRH 1TPPA 4YTAA 1P3EA 3LPRA 1TPOA 1GJBB 2YOLA 1O3BA 1SQTA 2ZU2A 1K1NA 4K3JA 1UK4A 2PUXB 1BTUA 1DLEA 1DUEA 1AY6H 1BQYA 3HKJB 1O5GH 2ZDLA 2BTCE 1L4DA 4JZIA 2C8YB 1Z6JH 1SQRA 3GY3A 3SU2A 3ESTA 1RTFB 1GI4A 3M5OA 2ZP0H 1QL7A 1AGJA 3BEUA 3KQBA 1C1WH 1G2LA 3SI4H 5E0GA 1SQOA 3UQVA 1MQ6A 2BDBA 4K60A 1BT7A 1GI2A 1ANCA 1QB1A 2ZDVH 3A7YA 1G3EA 3FVFB 2ZKSA 4ACAA 5LPFA 1YM0A 4Y8ZA 3BTHE 1D4PB 1SVPA 2QXGA 5HKKD 5JPMH 4UFFH 3RMMH 3E6PH 3EGKH 4B71A 1KSNA 1P57B 1V2UT 1EQ9A 4FUEA 1P8VC 1O2TA 3BTME 3F3BA 4AG1A 1LDTT 1CGHA 3SUGA 1MD7A 2BDYA 1BMAA 1AVWA 3HGNA 1TNKA 1TPAE 2L74A 2A4OA 5F8XA 2GV7A 1TGSZ 1OWIA 3U69H 4ASUD 1K1IA 3GCNA 3BV9B 1BTHH 1P03A 3P95A 5EGMA 1PPGE 5EODA 5EQSA 2VGCC 2AGIX 3PV2A 1GHVH 2BDAA 3BIUH 2I6SA 2W6ID 3TGKE 1FONA 4A92A 1GBBA 1T32A 1CHOF 2PR3A 4DOQA 1H8DH 1VJ9U 1O2GH 1TX8A 2QF0A 3F2HA 2WUCA 4I33A 1ELFA 2FS8A 4F48B 1O2QA 4CRCA 5T6DA 1WQVH 3MU4A 2W7SA 8LPRA 3GY4A 1ZTKA 3SGQE 2P3TB 1S81A 4U2WA 2XBXA 1ELBA 3RXSA 3P8GA 5AFZH 4MPUA 2BX4A 3P6ZB 4F4OC 1UVTH 2QXJA 2NU1E 4X8VH 1FXYA 5GPIB 1GHAG 2J2UA 2PKSC 2R9PA 5DKMA 2ZQ2A 2IPQX 5C5NA 1K1LA 1HAPH 1S82A 1H1BA 1B7XB 2FOMB 3RMNH 3TGJE 2A45B 2IOTA 1TGTA 3H09A 4NSVA 3RU4D 3SU0A 4AB9A 6ESTA 2GGVB 4M9FA 4BXSA 1FIZA 3A8AA 1DOJA 2ZPRA 4TT3D 5K0HA 2GKVE 1RXPA 2Z9IA 2JIZD 1OYQA 2D26C 4A5TS 1AMHA 1QGFA 2ZHQH 1LVMA 1MKWK 2C8WB 2Q6FA 4XBBA 3B23B 3A7WA 2CHAC 2UUJB 3UPEA 1CGJE 2HVXA 1T4UH 2VJ1A 1BMNH 4AFSA 3F68H 1S0QA 4X2WA 1GJ5H 1ZLRA 2EQNA 1A7SA 1ELTA 1Z8JB 1GVZA 1SGIB 1PJPA 4TPIZ 2BQ7B 1KMHB 4D9QA 3GCOA 3BEIB 2R2MB 4VGCC 3GY2A 3MWIU 4OS4A 5AVDA 3TK5A 5LGOA 1JRSA 3W94A 1LVBA 1EPTC 1BBRH 3BG4C 1SLWB 1ID5H 2LELA 1CSOE 4K1EA 1EP5A 2GCHF 2Z9LA 2ASUB 1GMDF 3HATH 1CBWB 4HGCA 1E38B 1KYNA 1SGYE 3MNSA 4OGYA
chains in the Genus database with same CATH topology
2FOAA 2ZGXH 3RC6A 3T5FH 3ZVBA 3PMAB 2VIDA 1QQUA 1RFNA 1HJ8A 2R3YA 1O2NA 5DP7A 3ZZAA 4DJZB 4E05H 1P9UA 1RRKA 1D6WA 1TABE 2BY9X 3SJKA 1SHHB 1KLIH 3M36A 1C1QA 1MTSA 4Q2KA 4Y71A 4X6OA 1VCPA 3FP8E 2WPHS 4HFPB 7GCHG 2F9NA 1EJAA 4JCNA 3LONA 1AZZA 2H5CA 3A89A 5J4SA 3LH1A 1EOJA 1KXAA 1XUFA 2F83A 2ZDAH 1AKSA 1T8NA 1HAZB 1HIAB 2RG3A 1NFXA 4CR5A 4VGCB 3L6PA 3RXRA 1UCYE 3BTQE 4WMFA 2RA3A 1GI0A 1TGBA 2PKAB 1GBIA 1OWJA 3Q3XA 1C1TA 2KAIB 1YCPK 1A5IA 3TK6A 3E91A 1G3CA 2WYJA 3Q3YA 4ABEA 1NU9A 2A2QH 1QR3E 3Q3KA 2W7UA 1PQAA 1C4Y2 5L30H 1EPTA 4Y7AA 1IQNA 2SGFE 5C1YA 2BY6X 3M3SA 1C1RA 1C5TA 2ZHFH 3SV6A 1BRBE 3ATIA 3PLKA 1C1MA 5EG4A 3NCLA 1EUFA 1S6FA 3EE0B 2FS9A 1TMBH 2XTTB 3U9AH 1NZQH 4LK4A 3ZYEA 4FUIA 3JZ2B 4OS1A 2F9UA 2P8OC 3A8BA 2G4UA 4H42U 1Y5AT 3AW1A 1W13U 2PGQB 4AFQA 2B7DH 1GCTB 4XSKU 1TNHA 4UFDH 3T62A 4ISLA 4I8JA 4KGAA 2WINI 1UJ1A 1O2SA 3RXOA 1HCGA 2HNTF 3QLPH 5DK1A 1FY8E 4ESTE 2OBQA 5FPTA 3SO3A 2GMTC 2P93A 1UTKA 2PKSB 2PV9B 4INHA 4Q7YA 1BITA 2ZZUH 3QTVH 1X7AC 2XRCA 2RDLA 5GJ4B 5LPEA 1O3LA 4NSYA 4ABIA 1YCPH 1FY3A 3A80A 3RXAA 2BM2A 1P01A 4AN7A 4XE4A 1TA2A 2H6MA 1QNJA 1U6QA 3KIDU 1J16A 2O8UA 3SJ9A 1RIWC 2HPPH 4JYTA 1A5GH 4GSOA 1XUKA 2GDDA 2H5DA 1KIGH 5FX6A 4WF8A 1LCYA 2VVCA 2FOHA 2ZPSA 3DT0H 2FOGA 2HGTH 1Y3XA 2PTCE 3KEEA 1ZJKA 4UDWH 1YLDA 2B8OH 2BZ6H 3KF2A 1GBTA 3E3TA 4TY6A 1RTLA 2BXTH 3PWCA 3SN8A 1UTOA 4ABAA 4DVAU 4FUCA 4ASHA 1C5RA 2OP9A 1WQSA 1C5YB 1WYKA 4RN6A 4IW4E 3RU4E 1QJ7B 3SZNA 2SGPE 5L2YH 1EZQA 4YO9A 1TGNA 3MU8A 2PHBA 1FAXA 1K1PA 4ZROA 3LGVA 1OYTH 1V2VT 4KELA 3ATMA 1GJAB 1MBMA 1A0HB 1WTHD 1HAOH 2UUYA 3MU5A 2Y5GA 1DT2A 4NIWA 2FI4E 2GCHG 3RP2A 1GMDG 3VFEA 1TOMH 2WV5A 2A7HA 4RKJB 3ATKA 1UTJA 3S7KB 1D3DB 1GJCB 4JZ1A 3OU0A 4B1TA 8KME2 2FODA 3KNXA 1KTTB 1UTQA 1ETTH 3SU1A 8ESTE 1S84A 4O3TA 2GDEH 3ZZ8A 1YPEH 3RXMA 1P2IA 3UOUA 1EP6A 2GCTB 1G32B 5GXPA 1SGFG 2WV4A 1QA0A 1A61H 2Y82A 1C2KA 1AD8H 4BTIB 3HK3B 1G30B 2ALPA 3FANA 4DCDA 4ZHLU 4X1NU 4GHTA 4MPVA 1ANBA 4DW2U 1GL1A 3A88A 5SGAE 3A85A 2UWOA 5FXLA 1FMGA 4DT7B 1ZSKA 2KAIA 5T3HA 5T6FA 1LKBA 2Y7ZA 3TITA 1ZHMA 1TBRH 1YC0A 1GCTC 2OXSA 5E0HA 4J1YA 1FY1A 3V12A 2G81E 1MKWH 2VWNA 3VXEH 1VCWA 4ZKOU 1IHTH 2QXIA 1LVYA 7KMEH 2VIVA 4B2CA 3TVJB 1HIAA 3SU6A 1AKSB 2ZFTA 4BAHB 5JB8S 5HMAA 1QRWA 1MTNC 1HFDA 1QURH 1ZTJA 4BANB 1QIXB 2F91A 1HLTH 1GGDB 2NU2E 3PMJA 1GBKA 3MO3A 1QQ4A 1TIOA 1JXPA 2ZECA 3S69A 3UUZA 3DA9B 4I8KA 4J2YB 3DUXH 3KQCA 4WMDA 1O30A 4U30A 3U8RH 1Q2WA 1DVAH 2P8OB 1AU8A 4H6TA 1GJ4H 4IBLH 1MAYA 1MAXA 1QY6A 1JRTA 2AFQB 3JZ1B 2G5VA 1JWTA 3ZZBA 4CBNA 4O3UA 1W0YH 1T8OA 1IQFA 4YESB 3PYHA 2BQ6B 1ESAA 2Y6TA 2ANWA 1S6HA 3GY7A 4XBCA 2Z9GA 3RC4A 3LH3A 1FY4A 4NIYA 1XKBC 4I8GA 3DD2H 1UVUH 3BN9A 3BIVH 4GAWA 4Y76A 2ZNKH 4Y6DA 3BF6H 4AOQA 3NUMA 4X0WU 2VIWA 2ZIQH 1C9PA 2GX4A 1K9OE 1SLXB 2R3UA 1HAYB 5DP3A 3MHWU 3S9AA 1UTMA 1GDQA 1BTYA 3SNCA 4IGDA 1DUAA 2ZU3A 2CF8H 3RXJA 1FY5A 2CGAA 5I46H 2AMQA 2EEKA 1DX5M 3BTFE 3M35A 3BTTE 1LHFH 2GV6A 3T28A 1GI5A 4CBOA 1ZMLA 1DY9A 1SGEE 1LHGH 2GT8A 1K1OA 2PTNA 2A7JA 4U32A 3GYMA 4Y79A 3BEFB 4Y8YA 4CHAC 5ESTE 4NGAH 1VITG 1ZMJA 3URCA 5DJ7A 1BIOA 1HBTH 1AQ7A 1V2ST 3MTYA 4DIHH 5CE1A 1LVOA 2ZGJA 1HNEE 3Q77A 2RA0A 1ZZZA 4NA9H 4DURA 1GHBF 1T7CA 1E34B 1AUTC 4BTTB 4D8NA 2ZFRH 1BJUA 2BY5X 4YOJA 5JBAS 2A4QA 2P94A 4JK5A 1YKTA 2G4TA 1ELEE 2ZG0H 3QDZB 2FYRA 2HNTC 3ELAH 4ISNA 3SV9A 2VH6A 3LC5A 1B0EA 1O2WA 1V2OT 3PMBB 4E06H 1EPTB 5AF9H 1HDTH 4I8HA 2PSYA 2C90B 1W7GH 1P11E 1TFXA 1UCYK 5LH8A 1TQ0B 2FTLE 3FZDA 1E36B 1O33A 3NKKA 4YZUA 1DXPA 2ZCHP 1YPLH 1MKXK 2J94A 1BUIA 1LPGB 5EPYA 4HZHA 1W2KH 4KTSA 4DY7B 4AYYB 1FQ3A 1J8AA 1P02A 1TX6A 3RXCA 3P8NA 3I77A 1Y59T 3MH5A 1C1VH 2JH5D 3AAVA 5E8EH 2B9LA 2A5AA 3M3TA 3A7TA 1LMWB 1P9SA 1C2LA 4JZEH 1FV9A 2XBVA 2Z7FE 3O8DA 1DE7H 3KQDA 1RIWB 2QCYA 4OS6A 1S83A 4BAOB 1C5XB 2YNBA 1GJDB 1E35B 1ELGA 3SJIA 1HAVA 2OBOA 5HXFA 2QY0B 3BTDE 3LGUA 5EW1H 1ZPZA 1V3XA 2ZTXA 1QA7A 1A4WH 1YPHC 1SOZA 2G51A 1NTPA 5C1UA 1PFXC 3UR6A 3A7VA 1UTLM 1E0FD 1TRMA 2SFAA 1O35A 3HKIB 3K9XB 1ESTA 1TE0A 3K6ZA 1E37B 1IQKA 1OKXA 1O3GA 1ESBA 1YPMH 2FMJA 1KXCA 3ATLA 3ITIA 1BTWA 1BA8B 1TYNA 1XUJA 1C9TA 1YGCH 4MDSA 3UY9A 2BLQA 3A7ZA 1VCQA 5BPEA 3KHVA 1AVXA 2BLWA 2OINA 2SGQE 3M7UA 4X1QU 2D1JA 4GPGA 2P3FH 5FCRA 1MZDA 1SGCA 1CA0B 5CMXH 3TU7H 2AH4X 4I7YH 1O3NA 2WYGA 1DXWA 4UFEH 3UTUH 2BVXH 3TK9A 2F3CE 1GHXH 1SBWA 4ZHAA 1DDJA 3GCTF 1JIRA 1QRXA 1O39A 3BTKE 4ABHA 4A6LA 4ISHH 1LHDH 3SBKA 4FXGH 1MMJN 4B73A 1UK3A 1IQEA 1O2OA 4ABFA 1DITH 1ZPBA 4AYVB 1P2JA 4K69A 3LT3A 3NK8A 9LPRA 1AZ8A 3SNEA 1BDAA 5JYIA 4GHQA 1F0UA 4SGAE 1D3PB 1ZRKA 2OQ5A 1CT0E 3ZVCA 2XXLA 1GHYH 1SGFA 2NU3E 4X8UH 3M3VA 1THPB 2Y5FA 4FU9A 1BTZA 1FUJA 1OWHA 1EAIA 2VIOA 1GPZA 4D7FA 2Z3DA 2ZO3H 3TH4H 1BOQA 1F92A 1IQHA 2XC4A 1XVMA 1P2QA 1QHRB 4INKA 4AG2A 5AFYH 3RXLA 3UR9A 3P17H 4FUHA 4CRAA 2FX6A 1V2QT 5A8ZA 5JDUB 1XKAC 4ABBA 4IC6A 2BY8X 4IS5A 2UWLA 1W0ZU 1DY8A 3AW0A 2BDHA 4R8TB 5F8ZA 1AFQB 1EATA 2BZAA 1W8BH 2ZFFH 3GCHC 4NFFA 4BAQB 1SGQE 1K1JA 1C2JA 3GY5A 2J38A 2VH0A 1ZGVA 2DE8A 1S85A 3ENSB 1FJSA 8GCHG 3EA9A 1ZPCA 1ELCA 3LC3A 2O8WA 1NRNH 1TNGA 2LPRA 1C5QA 1OWKA 4NZQA 2R0LA 1C1SA 3MU0A 5G4BA 1INCA 2NU0E 3GY6A 2GZ9A 1EB2A 3LOXA 2BXUH 2BX3A 1L2EA 2R2WU 2CJIA 4D76A 1DM4B 1TOCB 6CHAC 2EI7A 1NRQH 1IQLA 2BD8A 1GMCG 3K2UA 2AERH 1UVSH 2ZHWH 1QCPA 1CT2E 1WUNH 3M61U 1UVOA 2TGAA 4I31A 1C5OH 3RXDA 1OWEA 4XOJA 1N8OB 1KDQB 1O34A 1ACBE 1T4VH 4AX9H 1GBEA 1T8MA 4UE7H 3VB5A 5DP5A 3R3GB 2FYQA 3E8LA 5AHGH 1AE8H 3F9EA 1P04A 1L4ZA 1Z1JA 1SMFE 3KQEA 3E0PB 1C5VA 2BQWB 3IG6B 1O2PA 1TALA 1O5DH 2V3HH 3HK6B 6CHAB 1A0JA 2R0KA 1PPFE 3MH4A 4O97A 3UWIA 1F2SE 4JZDH 4KTUA 1BBRE 1QB6A 1MD8A 3SW2B 3M5LA 1SR5C 5EXMA 2GVFA 3TLOA 9ESTA 2BD9A 2B5TB 3ZYDA 1MUEB 2BD4A 3DFJA 1PQ8A 3RXEA 4HTCH 1YCPM 2P16A 1C2DA 3RDZA 1PYTC 5GWZA 2EA3A 1SC8U 3FZZA 1KLJH 2D8WA 2ZGHA 1DWEH 2HRVA 3WY8A 1G3DA 3DHKH 2H9EH 1MZAA 1SPJA 1W14U 2OCVB 1J14A 1W12U 1DFPA 2OC8A 4FUFA 4MG3A 3O8RA 3STIA 3OY5U 1IAUA 1XUHA 3U8OH 2ZTZA 5JBCS 4X8SH 1A1RA 5A2MH 4ISOA 1OWDA 2J4IA 1LQDB 3S9CA 1AO5A 1N6XA 1GHAF 2ZQ1A 3IWMA 3URDA 1ELAA 2ZU5A 1GHWH 3PM3A 2FESH 1G3BA 3OYPA 1GG6B 3ZZ9A 2ODQA 1J9CH 1QRZA 2QGRA 2ZHDA 1C2MA 1O2RA 1V6DA 1O2LA 4K1TA 6GCHF 1GDNA 2SNWA 4CH8B 2CV3A 3SV2H 5TCAA 2TGPZ 1UCYH 2FXRA 2BD2A 5C67A 3D65E 1GI8B 1LPZB 4MNXA 1TBZH 4BOHA 1TB6H 4MPWA 1C5PA 1G2MA 4JYUH 3RU4T 5EPNA 4ZXXH 1ZSLA 1K21H 3A84A 4UFGH 1NT1A 3SNAA 2W3IA 4X1SU 1AUJA 3GDUA 4ISIH 4MVNA 4MNYA 1GJ8B 3RMOH 1CQQA 2C3SA 1NM6A 1TLDA 5ESBA 4D9RA 1VZQH 3T26A 4CHAB 2H9TH 1P0SH 4ZKRU 3CS7A 2WPJS 2O9QA 3TJVA 4TYDA 1NROH 4INLA 1HAHH 1TMTH 1SFIA 1GL0E 2EI6A 4A1XA 5IYTA 1YLCA 1Z6EA 1ZHPA 1P2MA 4BTUB 1TWXB 1WTGH 1MCTA 2Z3CA 1W3CA 1EJMA 2BDCA 4BAMB 4PROA 4Q80A 1PPCE 1GVKB 2SGAA 1Z8RA 2CHAB 3P8OA 2IPHA 2A1DB 3TH3H 3SI3H 2O8LA 1HAXB 3VEQB 1D9IA 1CGIE 2HWLB 1IQMA 5C1XA 4Y0YE 4Y11E 1ELDE 4KTCA 2Y81A 2FLRH 5DP6A 7GCHF 2ILNA 1BTPA 3RXUA 1XMNB 3E0NB 5C20A 1MBQA 4TPYA 1BBRK 1GJ6A 4WH8A 4JYVH 1XX9A 1J15A 3UOPA 1SLVB 1P06A 2ANKH 2J34A 2ZEBA 4B75A 3RXKA 2BLOA 4Q7ZA 1EAUA 3PROA 1O3DA 2BVRH 4YLUA 2VWLA 1O2HA 1QJ1B 2BLVA 2FIRH 1YPKH 4AB8A 1W10U 3ZZCA 4DGJA 1GMCF 3S0NA 1VITH 1Y3WA 3LKWA 5HM2A 2GTBA 1EX3A 2W5EA 1O3HA 3W95A 1TRYA 4B2BA 1GDUA 1V2PT 4MQAA 3PLPA 3UQOA 2O8TA 4H6SB 3M37A 5E2OA 4R0IA 3ZZ4A 5DP8A 1TONA 5ETXA 1MTWA 3HPTB 3F1SB 2AIQA 1QBVH 1ZGIA 4DIIH 4NIVA 4NA8A 1C2GA 4FUGA 4UONA 2JH6D 3EDXB 5BRRE 1CT4E 3MI4A 4TWYA 3OY6U 2VWOA 3UNSA 5CHAB 1F7ZA 2QC2A 3SNDA 4Q7XA 2ZPQA 3LDXH 1BHXF 3T25A 1NRSH 4I32A 3ZVAA 1YYY1 1LHCH 1O5AB 1P3CA 4O03A 1N8OC 2ZU4A 2QAAA 3QX5H 5FCKA 4A1TA 2JKHA 1HJAC 1BMMH 2BDGA 2ZF0H 1NN6A 1SGRE 1AN1E 5LPRA 4RKOB 3SUEA 1VJAU 3GISB 2A7CA 2FLBH 5GCHF 1FPCH 1CU1A 1ZRBA 3VB4A 4CRGA 3GOVB 3SOSA 3FAOA 2BHGA 2FZZA 3U98H 1HXEH 1SGDE 3PMHB 3D62A 3ZV8A 1O36A 3BG8A 3RXPA 2NU4E 5DP4A 2BVSH 4Y8XA 1F0RA 1Y5UT 4TY7A 1H4WA 3A87A 1G36A 4GCHG 4X1RU 4FU8A 4X6NA 3NXPA 1A2CH 5C2ZA 3MO9A 1PQ5A 2OC1A 1CBWC 4YOGA 3PTBA 1QBNA 1V2NT 1S5SA 5L6NH 3SORA 3CENA