1ARKA

Sh3 domain from human nebulin, nmr, 15 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NEBULIN
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1arkA00
1SEMA 4JZ3A 1PNJA 4LN2A 3QWYA 2DLPA 2A08A 4J9IA 2K6DA 3NMZC 2EKHA 2FRWA 2JS2A 4RTXA 1SHGA 2IIMA 3LH5A 1ZUKA 2HCKA 2EGEA 1QWEA 2KXCA 2KXDA 1QKXA 2LJ3A 2V1QA 4AFSC 3EG3A 2JXBA 3REBB 2B86A 4J9BA 2EGAA 2JM8A 2DX1A 1KIKA 1GCQA 2ECZA 1XOVA 4JZ4A 3UF4A 4Z8AA 3VS3A 1K0XA 3I5SA 2JT4A 3I9QA 1MV0B 1X6BA 4RTVA 3U23A 2YUNA 2FRYA 1WXTA 3H0HA 2L2PA 1PRLC 2VVKA 5IHIA 3PVQA 2K9GA 2ESWA 2KT1A 1GCPA 4F14A 3ULRB 1H8KA 2DL4A 2EYXA 2MCNA 1B3QA 2KE9A 4CC2A 2JW4A 1I07A 4JPBW 4AG1C 2RQUA 3C0CA 1YWOA 2SRCA 2G6FX 1AVZC 1K1ZA 1X2KA 1M30A 2DJQA 4HCKA 1AD5A 4JJDA 3SHWA 2CUDA 2EGCA 3VS5A 2D8HA 2JM9A 2PTKA 2L3PA 1JXMA 1TUDA 2L0AA 1QKWA 2D1XA 1WLPB 1Z9ZA 2EQIA 1MV3A 1ZUYA 1QLYA 4ORZA 2ED1A 2EPDA 3EGUA 2ROLA 2YUPA 1AWOA 3VS4A 1J3TA 2J6KA 1S1NA 1CKBA 1BK2A 4AFUC 1SRLA 2J6OA 1OPKA 1UE9A 2LX7A 2CDTA 2K7AA 2P4RA 2DL3A 1JQQA 1NYFA 4RTUA 2M51A 1A0NB 1WX6A 1E6HA 2DBKA 4E6RA 2KR3A 4F17A 1U5SA 2PNIA 2RQRA 3M0QA 1YWPA 1BBZA 2YUOA 1GFCA 5FWCA 2X3WD 3VS0A 1AEYA 3UATA 1H92A 1UJ0A 1FYNA 2ED0A 1UECA 5IXFA 3I35A 1T0JA 1RLPC 4ESRA 2AKLA 2BZ8A 1WXUA 1ZUUA 4J9DA 2SEMA 1MUZA 4Z89A 1Y0MA 4OMLA 5I22A 1AZEA 2K2MA 4AFQC 2KRMA 2F2WA 1V1CA 5IHKA 4X1VA 1Y57A 1AWJA 1X69A 1H3HA 4QT7A 1UHCA 2JMCA 3O5ZA 4CC3A 1UJYA 2O31A 1WXBA 4JJBA 2EYWA 1K76A 1WYXA 1U3OA 4OMMA 3M0SA 4M4ZA 2CH4A 2DMOA 2FPDA 3TSWA 1HJDA 2K79A 4HVVA 4KRTA 4RTTA 2KYMA 4D8DA 3GBQA 1M3CA 2A36A 3A98A 1M3AA 1PWTA 1GFDA 1W70A 2NWMA 1GBRA 4OMPA 2LQNA 2A28A 2RNAA 1PKTA 3H0IA 4AG2C 1WI7A 1PRMC 4F16A 1BU1A 1OEBA 3H41A 1UG1A 2H8HA 2DL5A 2AK5A 4GLMA 2FPEA 2E5KA 5FW9A 1QCFA 2CT3A 2BZXA 3QWXX 1UUEA 2GGRA 1ABOA 2DNUA 2O9VA 4FSSA 3UA6A 2MOXA 2CH4W 2LJ0A 2W10A 2FPFA 4OMNA 2HBWA 2KBTA 3VS1A 5I11A 3PE0A 2AZVA 2DL8A 1I0CA 3EHQA 1CSKA 1ZLMA 2RPNA 2O88A 3NHNA 3TVTA 2HDAA 2GBQA 2L3SA 1AZGB 2VKNA 2X3XD 2EBPA 3EHRA 1W6XA 3M0RA 2ENMA 1ABQA 1KFZA 2DVJA 4RUGA 1K0SA 1GCQC 1FMKA 4AFZC 4LE9A 4Z88A 5HCKA 2RF0A 1T3LA 1M3BA 1RLQC 1VYUA 1VYTA 4LUDA 2YSQA 4R0KA 1UTIA 4K11A 3THKA 1E6GA 1T3SA 3I5RA 2D8JA 2LZ6B 4JJCA 2L3QA 3R6NA 1WIEA 3M0TA 1BB9A 2DA9A 3M0PA 3TSZA 1AOJA 4J9CA 2DRKA 4RTYA 1NYGA 4D8KA 1KJWA 2YDLA 2RN8A 2J05A 1G2BA 1RI9A 2C0TA 3UA7A 4CC7A 4IIMA 1WA7A 4OMQA 1GBQA 2J6FA 2ROTA 4ZNXA 1UHFA 3RBBB 1JXOA 2EW3A 2QDLA 1ZX6A 2DL7A 2F2XA 5L23A 2CUBA 3VS6A 2HEQA 1T0HA 2O9SA 4RTZA 3VS2A 2KRNA 3IQLA 4HVUA 4DEYA 2CSQA 1UFFA 1KSWA 2LCSA 3NGPA 2LNHB 1NLPC 1W1FA 1TUCA 3EG0A 3SEMA 1JEGA 2CT4A 1EFNA 2LMJA 1GL5A 2KT8A 2KYBA 1K9AA 1OV3A 4Y92A 1QWFA 1HSQA 2DM1A 2C0OA 3JV3A 1UGVA 1OPLA 2BTTA 1X6GA 1JU5C 1OOTA 1HD3A 2DYBA 2FO0A 1IO6A 1UDLA 1NLOC 4RTWA 1K4US 2DRMA 1ZSGA 3EG2A 1CKAA 1ZBJA 1AWXA 1PHTA 5ECAA 3CQTA 5FWBA 3FJ5A 1Z9QA 1PKSA 3RNJA 4LNPA 2VWFA 1SPKA 2AZSA 1X2QA 2AKKA 1LCKA 2NUZA 2YUQA 2EYYA 2K3BA 2XMFA 2HSPA 1G83A 2LQWA 2BZYA 4IIOA 1SSHA 2GNCA 2GTJA 2RQVA 4J9EA 2A37A 2KRSA 1YP5A 1YN8A 1NG2A 3ZL7C 1TG0A 1SRMA 1VA7A 3M0UA 2C0IA 2LJ1A 1VYVA 4J9HA 2EYZA 5GJVB 1RUWA 2KGTA 2DBMA 1M27C 1ARKA 2PZ1A 4LUEA 1YNZA 5GJWB 4J9FA 2OJ2A 4A63B 2F2VA 2CREA 2GQIA 1NM7A 3VS7A 2KNBB 2RMOA 4HXJA 1U06A 2W0ZA 2EVRA 4HVWA 2JMAA 1M8MA 5IHNA 2JS0A 3H0FA 4DEXA 5IXBA 2D0NA 1AWWA 3VRZA 2GTOA 2OAWA 3PVLA 1GRIA 1X27A 1N5ZA 2OI3A 4EIKA 2KEAA 1SHFA 1X43A 2J06A 3KFVA 2O2OA 2JTEA 1WFWA 2MIOA 2FEIA 2RQWA 1NEBA 1I1JA 2J7IA 2I0NA 1B07A 2DE0X 2FG0A 4CC4B 1E7OA 3EG1A 2DF6A 1YCSB 4OMOA 1JO8A 1NEGA 5IH2A 3NPFA 4WCIA 2CSIA 2YT6A 3VRYA 4J9GA 2KROA 2LP5A 4GBQA 3REAB 1WDXA 5EC7A 2RQTA 2M0YA 2DILA 2V1RA 2ABLA
chains in the Genus database with same CATH superfamily
3OYAA 4OGCA 3BDUA 3M59A 2K6DA 1WHMA 4MZPA 1S72T 2EKHA 2K5LA 2FZCB 1UGPB 3E9FA 4BACA 1ZSZB 1SHGA 1KD1R 3OSSC 1Q86R 1WHGA 1YHQA 3TU4K 2V1QA 2QYZA 5CR2A 3REBB 2JXBA 3RKXA 2B86A 2K2VA 4J9BA 3PFSA 2ECZA 3EGDA 4JRIA 3SD4A 4Z8AA 1RABB 1VQ7T 2JT4A 3OYMA 1B34B 4PFOA 4RTVA 1MMGA 2ZPHB 1KQSA 2BUDA 2XG8D 3PNWC 2MWOA 4X9CA 4PJNA 3LLRA 3CCEQ 1PRLC 3A8OB 1YJ9Q 4HA8A 2X4WA 3PVQA 4X9DA 4XK8E 1VQLT 2LTOA 2MCNA 1Q7YR 4CC2A 2JW4A 1I07A 3EG9B 3JCMg 2SRCA 2G6FX 4M78F 3J81E 1WQWA 5C0MA 4ZGJB 1X2KA 1M30A 3WXMB 3M9QA 1VIEA 1YI2A 3V8KA 4EMHA 1AD5A 4JJDA 4DOVA 2EGCA 3KXTA 1NBEB 2DTOA 2EAYA 3KBGA 1VQPT 1JXMA 1TUDA 4KH1B 2H3JA 1WLPB 3EAEA 1VQOT 3CXCA 2HKQB 1LNXA 3M54A 1Z9ZA 1M1KU 3CCJA 5DM7R 1QLYA 3VU3C 1AWOA 2J6KA 1S1NA 1CKBA 1BK2A 5FU7B 4R55A 1IZ6A 2LX7A 4PLLA 2CDTA 2P4RA 1NYFA 3FDRA 5DLOA 1E6HA 4NL2A 4E6RA 1JJ2S 2NUPB 4FCYA 4A4HA 4PJOC 3NTHA 3I55A 2DK3A 5FWCA 2AHJB 3CCLT 3FJPA 3H6ZA 3QUIA 1UECA 3MP1A 4ZGEB 3CBOA 4C92E 4HCZA 3JCMQ 2HQHA 3EGXA 1JJ2A 5GANj 2AKLA 1QVFP 2BZ8A 2COZA 3D7SB 1ZUUA 4J9DA 2EQJA 2ZPGB 3BW1A 1UB4A 2AIRB 3MP8A 4EMGA 5GMKe 4QW2A 4E7SA 3UPUA 1ZBXA 4PJOG 1TTHB 1EZZB 1I81A 1WHLA 3HKSA 1V1CA 2EYQA 5IHKA 1QVFA 4X1VA 1H3HA 1AWJA 1UHCA 3A8HB 3EH2A 2RM4A 3UT1A 2O31A 3JCMd 3FC3A 2XDDA 1K76A 4M7DG 1U1SA 4M4ZA 3M0SA 2CH4A 5FRMA 3OYYA 2E12A 2K79A 4HVVA 1G3SA 4Q5WA 4D8DA 1K8AC 4N0AC 5CQXA 4J7FA 1GFDA 5CVIA 5FU6B 1VQ5A 1D09B 2HL5C 1PKTA 1WI7A 3CMET 3CD6Q 1Q95G 3G1JA 3CCUT 1Q82R 1U1TA 1WGSA 2AK5A 2VGNA 3F70A 4XU2A 1RAGB 3QWXX 2RO0A 3QPHA 1ABOA 3HP9A 1VQ4Q 5A0GA 2HZYA 2MOXA 4ELZC 2CZ1B 1OZ2A 4L6V5 2P4TA 3BY7A 1SSFA 4RCBA 2OTLQ 1OU9A 4PJJA 1C1AA 2RJDA 5GANg 3LYIA 5LJ3e 2HL3A 1ZLMA 1MNDA 4M77E 2QEXQ 2EJFA 3QSUA 4B9XA 1Q86U 3CC7A 2RK1A 2L3SA 3EHRA 2HKNA 4E7KA 4ZN3A 4RUGA 1K0SA 5KYWB 2DEUA 4AFZC 3DB3A 1T3LA 1M3BA 1VYTA 1KQSP 1BCMA 5LJ5h 2YSQA 2MPXC 3OYJA 3I5RA 3J80E 2A0FB 4C5HA 4JJCA 4M75E 3G6ET 1M2OA 3A8GB 4OB0B 1NYGA 1OYXA 4LDXA 1KJWA 4M78A 4ZGDB 2KVQG 5CO7A 1WQ7A 2J6FA 2ROTA 4KH0B 3EFOB 4A4KA 1UHFA 2R57A 4Y91A 3CMAT 3MP6A 2RI5A 2DL7A 1YIJQ 2O9SA 1IGQA 2QQAA 1JJ2P 4OB2B 2GQVA 3IQLA 4HVUA 1WZOA 2CSQA 1VQ8T 1UFFA 1KSWA 5I2SA 4M75F 1MMNA 4II1A 4C0DB 2CT4A 1GL5A 2KT8A 5CK9A 2E6ZA 1W2BP 2PUOB 3LGLA 4PJOF 5KYWA 4BY6C 2LCCA 5GANf 1X6GA 5IT9E 1OOTA 4L5GA 2DYBA 1D0ZA 3CPWA 5GMKh 3RR6A 1K9MC 1VQ8Q 1UDLA 1NLOC 1VQ9A 4PLIA 3A8LB 3EG2A 4LDVA 1SF9A 1PHTA 4J6XA 2ZAEA 2A3LA 3MEUA 2MYSA 2R5AA 2XIDA 2QAZA 2XICA 3VJPA 4LNPA 4QQDA 3CXCP 1BI1A 1S72Q 2DXTA 1X2QA 2AKKA 4IUUA 3CEYA 2XI9A 2ZPEB 4C5EA 1G83A 2RHXA 2HBPA 2XK0A 2K4YA 1KQ2A 2GTJA 3JCMX 1V76A 1YN8A 3CCET 5DY9A 1VA7A 3A5ZB 1QCNA 1ARKA 2PZ1A 1YNZA 2HQXA 4QQGA 2OJ2A 2H3EB 2RHYA 1C0MA 4A63B 5KYXA 1LPLA 2CP6A 4A4GA 4C92F 4VUBA 3GNGA 3WVDB 3CC7Q 3QXEB 2RMOA 4L59A 2EVRA 3H0FA 2DIGA 2M0OA 4M7AC 2D0NA 3CCLA 3VRZA 1R77A 1G8XA 2GTOA 3GLXA 2OAWA 2VB6A 1X27A 2OX7A 1P92A 3SWNB 2OTJA 2L8DA 1X43A 2X4YA 2J06A 3KFVA 3META 3PMTA 1PD1A 3QZ9B 2B8AA 2I0NA 4JJNK 2DO3A 2FG0A 1MMDA 1VQOQ 4F7UF 1NJIU 3EGXB 1JO8A 3CD6T 4OF1A 2P84A 5GMKi 2ZPBB 2K5FA 2QTXA 5CKHA 3OYFA 3CCSA 3REAB 4BD3A 1WPYA 4PJLA 1N27A 4C92A 4LN2A 3S3NA 4J9IA 3NMZC 3OB9A 1UEBA 2EJ9A 4ZN1A 2JS2A 4XAXB 4IUVA 4RTXA 1YFNA 3JB9G 3QG1A 2IIMA 4TVRA 2HCKA 3OMCA 3JCMc 2KXCA 2DYIA 2LJ3A 4M75B 3CCEA 4E7IA 1YJ9A 3X20B 1YJNT 2IG0A 1GCQA 3UF4A 1XOVA 3C95A 1VQ5T 4ZTJA 3JCMJ 3VS3A 3CMEQ 5LJ3j 2Z0WA 4HCCA 1M8VA 1BCOA 3L1AA 3U23A 2YUNA 2FRYA 4LDYA 4FYYB 2LDMA 3G71A 1G5VA 2ESWA 2PVDB 3ULRB 4JS4A 1H8KA 2FL7A 2NYSA 5D6YA 2DEQA 4MDWA 1QMCA 2M9UA 5GAOn 3RUXA 3C0CA 1XJWB 1YWOA 4NS5A 4O6JA 2OTLT 5GMKl 1RL2A 1I4K1 3T9NA 1K1ZA 3CCQT 3PIPA 3QIIA 4Z02A 4JDSA 2C06A 1KC8U 3Q1JA 2CYZB 4ELYC 3NTKA 3CC2T 2PTKA 4JRKA 2WACA 2L0AA 4C0GA 4MMLA 2D1XA 4OVAA 1TU0B 4KULA 2EQIA 2DXCA 2JTFA 2X51A 3CCRQ 3E19A 3QJ6A 2ED1A 2RHUA 3I55T 1K8AR 4C92B 3CCMT 2V26A 1SRLA 1OPKA 2K7AA 1YITA 2DL3A 3ASKA 1VQMQ 1WX6A 1HXDA 6AT1B 1VOMA 2DBKA 1FMWA 1N9SA 1U5SA 5GAN7 1OU8A 2PNIA 3HL8A 3M0QA 3ME9A 4O5VA 1QP3A 4QQ6A 1N6AA 4E2FB 2O01E 2EFIA 3VS0A 2QQSA 3RKYA 3NFCA 1YJWA 2MAMA 2R5MA 1VQOA 2MI6A 4JRPA 2JUFA 3JB9F 5LJ5f 4M7DB 4ESRA 2YWWA 4M75A 3LWHA 4F7UB 1MUZA 3GIBA 3HPWA 5AYFA 1Y0MA 3CMAA 4NL3A 4OMLA 5HK0A 4PFZA 4BB7A 2F2WA 3OQ5A 1OX8A 3HRSA 4JRQA 1VQ6Q 3MEWA 3LH0A 5GAOl 2RD1A 4CC3A 1G3WA 1KK7A 1U3OA 1K73R 1IB8A 1HJDA 3TSWA 2CZ0B 4FSXA 3QKJA 4KRTA 4D6WA 3GBQA 5LJ5d 1M4ZA 1QP2A 4M78G 4MZMA 2P0KA 3G6EQ 2NWMA 1YCYA 4OMPA 3CCUQ 2KDSA 5GAN4 1M90C 2LRQA 2OTJT 1PRMC 2EJGA 1VUBA 4BE0A 3ZBDA 1VQPQ 2NUTA 2YLBA 1BU1A 3CBMA 3L2QA 1OEBA 1R0CB 5KYUB 3OYKA 2H8HA 4XQ3A 1MNEA 4GLMA 3X24B 3JCMe 2DTIA 1QVPA 5FW9A 3I56Q 1QCFA 2BZXA 5GAN8 1UUEA 2E70A 2DNUA 3ZEHA 2JOYA 1OQKA 1FXXA 1HYOA 3OYLA 1JRIA 1IREB 2HBWA 1YBYA 1VQ4T 5KYXB 4XTUA 2AZVA 1I0CA 1Q86C 1B7TA 1PCXA 1QVGS 3ZFJA 1MGQA 3MHXA 1AZGB 2EBPA 4DBFA 2ENMA 1ABQA 4FYVB 4N0AA 1Q81U 1VIFA 4Z88A 2RF0A 2IPOB 1G3YA 1VYUA 4PNOA 2QTVA 4K11A 2E3HA 3THKA 3JCMP 1T3SA 1KD1C 1U8RA 2L3QA 1WIEA 4M78E 1FX7A 2WSEE 5CKDA 2DA9A 3VUZA 3TSZA 2VYTA 4JLIA 1VQMT 5CIUA 4OB3B 1KC8R 1YJWQ 4N4HA 1Y07A 2LC4A 2MMPA 2C0TA 1D0XA 3L42A 4CC7A 4F7UE 1LVKA 1WJSA 4OMQA 1F1BB 4PFPA 4M7DE 1JXOA 3BFMA 2DD5A 3RMQA 1M90U 1ZX6A 3G4ST 4DBHA 2HEQA 4C8QD 1TSFA 1NE8A 1IXDA 3VS2A 2E64A 4DEYA 5GAOm 3QDFA 3V8LA 2LNHB 1O9SA 3O8VA 1VQ8A 3EG0A 3MO8A 4EMKC 1YJWT 1EFNA 2LMJA 1RAHB 4BUGA 7AT1B 1QWFA 2I2LA 3JV3A 2Y90A 1OPLA 2BTTA 2E1HA 1BYMA 1Q81C 1K73C 3C12A 5GAN3 3QZ5B 2FO0A 2ATCB 2GFUA 1VQ6T 2DTHA 2KMTA 2BE7D 4FW1A 1CKAA 3G6EA 5KCOA 4ME7A 2KQWA 5GAOp 1Y96B 4RKUE 1Z9QA 4IUPA 1PSFA 2EQMA 2GCXA 1SPKA 1R0BG 2L89A 4E7JA 2F5TX 4EDUA 4DQ2A 5KH6A 2XMFA 2LX9A 4IIOA 3VYHB 1N9RA 3QDRB 1YP5A 1Y96A 5KE2A 3G4SA 5FROA 2LJ1A 3EGDB 4J9HA 5GJVB 1RUWA 3OSVA 1AHJB 2DBMA 1M27C 2CP5A 4PJMA 1VQNQ 3OMGA 4LUEA 3JCMb 1IGUA 2CP2A 2F2VA 3V7SA 4C92D 1OI1A 2QGFB 4E7LA 4A54A 1M2VA 1U06A 5HY6A 2FVUA 3JAME 4HVWA 2JMAA 5IHNA 3G71T 2JS0A 2L5QA 4DEXA 2DPPB 3TCJA 3HFNA 5CKEA 1GRIA 5GAN5 5GAN6 3OYEA 1N5ZA 3GPLA 2CZ6B 2KEAA 5KYYB 2O2OA 2JTEA 1WFWA 3CCSQ 3SWNA 3M5AA 2RQWA 1H3ZA 1YJNA 2ZPFB 2EWNA 1X75C 5DLQE 2YRCA 1E7OA 3EG1A 2XU8A 4QVZA 3CCQQ 4OMOA 2DJZA 3NPFA 4M7AF 2JJ9A 3VRYA 3QJYA 1QVGA 4F7UA 4IKFA 4J9GA 2PVGB 3HTRA 1IRXA 2KROA 1BI3A 2LP5A 4GBQA 2E5QA 4HT8A 3FLGA 1WJQA 5GANd 2RQTA 2M0YA 2V1RA 2ABLA 3CCST 1SEMA 4JZ3A 5GAN2 4ZTFA 4OB1B 2FRWA 3JCMf 4EPCA 3LH5A 2E6NA 2L3RA 1ZUKA 2DFUA 1BIBA 2EGEA 1QWEA 2KXDA 5D6WA 2K3XA 4BDZA 2FYKA 3X28B 2AT1B 1UGSB 4J7IA 2EGAA 3TQ7P 2JM8A 2DX1A 3LW5E 3M55A 3CC2Q 2E65A 4QVDA 3M4YA 3I5SA 1VQKQ 4FYXB 1PM3A 5EG2A 5J3BA 2GF7A 2PVOB 3I9QA 1FWZA 1X6BA 1OZ3A 4EMKA 3MJXA 1WXTA 2RJCA 3H0HA 2L2PA 5A0LA 4YTLA 2K9GA 3OYNA 2KT1A 4N4IA 1GCPA 2QA4Q 2DL4A 2EYXA 4M75G 4MMKA 1B3QA 2KE9A 3SFMA 4FM4B 4JPBW 2RQUA 5KYYA 4J8OA 4HCKA 3CCJT 2QDYB 3LGFA 4OMFB 3SHWA 2YLCA 3GP8A 3MEAA 1YITQ 4PJOE 1QKWA 2XDBA 5GAMd 5A2QE 2E4HA 1NJIR 5FRNA 1ZUYA 4ORZA 3EGUA 3P8BB 2YUPA 4RCCA 3FB9A 1LOJA 1J3TA 4PL6A 5I2MA 8ATCB 3TEEA 4M77C 1M1KC 2D0QB 2RHIA 2E3IA 3CPWP 1JQQA 4RTUA 2M51A 3E1SA 4IURA 2K57A 1QVGP 4E47A 1YITT 4F17A 4C8QC 3JSCA 1Y7XA 2QG9B 3CCVA 2F5KA 4J6WA 5IAYA 5GAMg 1YWPA 1BBZA 2YUOA 2D6FA 1RI0A 1YJNQ 2VC8A 2X3WD 1R8OB 3ER0A 5LL6S 1AEYA 1H92A 1FYNA 3MCAB 3S3OA 2ED0A 3C4SA 2PQWA 5IXFA 1QVFS 3CPWS 1PG5B 3OYBA 1VQ6A 1T0JA 4XU0A 1YI2Q 5CQYA 1YHQT 5GAMj 4E7ZA 2SEMA 4Z89A 1EX4A 1D0YA 3I56T 4A53A 3NTIA 2OTLA 2K2MA 2IVWA 2DZCA 3INZA 2KRMA 4BY6B 2VUBA 2QEXA 1Y57A 1X69A 3JB9H 2JMCA 3O5ZA 3LWIA 1UJYA 1VQLQ 2EQUA 4JJBA 2EYWA 4BE1A 3EFSA 1MHNA 5GAOr 1W2BS 3H9NA 2FHDA 2DD4A 2FPDA 2QGGA 1VQKA 4F7UG 5KYNA 1ZHIA 4XU3A 5GMKj 3A98A 1M3AA 3C94A 1W70A 1GBRA 2QA4T 2A28A 3H0IA 4Y28E 2VXEA 1W2BA 9ATCB 3QO3A 1BI0A 3QYGB 2RB6A 1QCOA 3FRNA 2DAQA 2HAXA 3X26B 5GAMf 2FPEA 3HHTB 4V2SA 4B6MA 5LJ3f 1UGRB 2GGRA 1I8FA 2O9VA 4M78B 3CCMQ 3UA6A 5D7UA 3P8HA 2LJ0A 2W10A 2FPFA 4OMNA 1NZ9A 3J7AF 3S6WA 2KBTA 2DXBA 5I11A 2COYA 1DJ7B 5LJ5g 3PE0A 4M7AB 3JB9J 1G3TA 2QASA 1KQSS 3EHQA 5KE3A 5HK3A 3NHNA 3TVTA 2HDAA 2GBQA 4OP0A 2MWPA 2VKNA 2X3XD 1W6XA 1Q7YC 1KFZA 1EIFA 3WVEB 4N4GA 1FMKA 4LE9A 2R58A 1PSEA 5HCKA 1XNIA 4J6YA 2EIFA 1VQNT 1RLQC 3X25B 4LUDA 3L2ZA 1UTIA 2ZGWA 2RHZA 3OBWA 1E6GA 1TH7A 2D8JA 4M7AG 4M77G 2LZ6B 3R6NA 1N8RR 1JBMA 1RACB 4BI3A 4XTYA 2XD0A 1BB9A 3M0PA 1IHWA 1AOJA 2DRKA 4RTYA 3M56A 2YDLA 1IHVA 5D6XA 1RI9A 3UA7A 1WA7A 4XTWA 4ZNXA 3E2UA 4XTZA 4C0FA 1WJRA 5L23A 1VQ4A 3G71Q 1T0HA 3HRUA 3URGA 2KRNA 4M75C 4M77B 2LCSA 2DXUA 4M78C 3NGPA 1NLPC 1W1FA 2XKOC 1ZA2B 5CKBA 4FU6A 1TUCA 3SEMA 1JEGA 4J5YA 4C0DC 3DLLA 2KYBA 5LJ3h 3M53A 1HSQA 4KT0E 2YXYA 2BKDN 2CP3A 4DBQA 2HNIA 1HD3A 3L2RA 5GAOq 2DKGA 2RI3A 2JNGA 2DRMA 1ZSGA 1D1BA 1ZBJA 3JCMh 1Q82U 5LJ3g 5AT1B 3G4SQ 1K9MR 5GANe 4LD9K 4M7DD 2DVEA 2VWFA 3RKWA 2NUZA 2QQBA 2YUQA 4GY5A 1HK9A 1K8AU 5FLXE 3BE3A 2BZYA 3OYDA 2QEXT 1SSHA 2RQVA 2MK5A 1WHKA 2A37A 1XQHA 1GXIE 3CCMA 1TG0A 1D1AA 4MDXA 2EYZA 1YI2T 1RAFB 3OYGA 2VASA 4J83A 2KGTA 4MZTA 4PKCC 4WTOB 2HD0A 1V29B 8AT1B 2Y4XA 2CREA 3OYIA 4A4FA 2DIQA 1NM7A 2HSEB 3MEVA 3PT9A 4HXJA 4KUIA 5A0DA 1M8MA 2ZZDA 3CD6A 3MPUB 2KAFA 4RMOA 1X6OA 2OI3A 3CCQA 2YHTA 4FIBA 4C5IA 1SHFA 1SKUB 1M2VB 2FEIA 2DERA 3CC7T 1NJIC 3A8MB 4FT4A 2J7IA 1B07A 1M5Q1 4M7DF 4FL6A 4CC4B 2DF6A 2LT1A 4M77D 2FB7A 4HCBA 3HSBA 5IH2A 1M1KR 1Q82C 4WCIA 3LX7A 3E9GA 4CRIA 4XTXA 2VXFA 1ZQ1A 3OBYA 4KUDK 3QHSA 1KHCA 5EC7A 3CC2A 2DILA 4CI0C 2KY9A 1Q7YU 3CC4Q 1QW1A 1PNJA 2P0PA 3QWYA 2DLPA 3OS5A 1Q81R 2A08A 2XHCA 5GAMh 2KK4A 1ACMB 3M57A 2O4XA 3V8JA 3CC4T 2DETA 4E7HA 4M7AD 3HRTA 3DB4A 4WF2A 3CCVT 1QKXA 4AFSC 1VQ7Q 2RI2A 3EG3A 4HT9A 5KCHA 2QA4A 1KIKA 4EMKB 4JZ4A 3CCLQ 1K0XA 1I5LA 3G7ZA 4X34A 3P8DA 2A7YA 3OYCA 1MV0B 4GLKA 1RAAB 4M77A 4JLGA 3OY9A 1VQKT 3JRZA 1YHQQ 2LQKA 3H8ZA 4AT1B 2YRDA 2VVKA 5IHIA 4BI8B 2CKKA 2K5IA 4F14A 5IN1A 2GFAA 2X35A 1YJ9T 1M9SA 5C6SA 4AG1C 5GMKm 4IUQA 1AVZC 1JB0E 4NOYA 1QQJA 2DJQA 4KBMB 3OS1A 1KHIA 2CUDA 2E41A 4LXCA 2CP7A 3VS5A 3L2VA 4KGVB 3TREA 2D8HA 3DKMA 2JM9A 4BDYA 2L3PA 5CAIA 1KC8C 1WHHA 1VQ9Q 1KQ1A 1KD1U 3OW2S 2V8KA 3QYHB 2QQRA 1MV3A 2RK2A 2EPDA 2ROLA 3M4GA 1X01A 3VS4A 4M77F 4AFUC 3JCMV 2J6OA 1UE9A 3CMEA 4FT2A 5L8RE 4DA4A 1MMAA 2COWA 3HFOA 3GOXA 1A0NB 2MF2A 2KR3A 2RA2A 3AT1B 4IUTA 3DLMA 3OW2A 4ATOA 2CGHA 2RQRA 3BDLA 4PJOB 1BKBA 4DOWA 2EQKA 2BIVA 1GFCA 1YIJT 3V7RA 1KG1A 2M02A 3UATA 1UJ0A 4JUVA 4PK4A 3QBYA 4C92G 3I35A 1VQ9T 2FZGB 2CS7A 1RLPC 1WXUA 4M7DC 1TWBA 5M9OA 1RAIB 3CC4A 1K73U 4C8QF 3JB9I 2K3YA 5I22A 3JCMW 1PD0A 2JVVA 4OGEA 2NUPA 1AZEA 4KGZB 4AFQC 3PGGA 3R6OA 2CZ7B 4QT7A 5I21A 1NPPA 4XU1A 2QI2A 1WXBA 2QXFA 1WYXA 2LQ8A 3PMIA 4OMMA 2DMOA 1TUGB 1UGQB 4RTTA 2KYMA 1WNLA 1VQNA 1M3CA 2A36A 4P5NA 1PWTA 2V8IA 2PU9B 3OS0A 2D9TA 1XTDA 2LQNA 2RNAA 1WHJA 4AG2C 2HMAA 2FZKB 4M7AE 5J26A 2XDPA 4F16A 2M1HA 2P0QA 5GANh 2WSFE 3H41A 3CBPA 1UG1A 3PTAA 4FYWB 1C6VX 2DL5A 3CPFA 1M90R 1O75A 2E5KA 3EG9A 5LJ5j 1PC0A 3UWNA 2CT3A 4F04B 2X9HA 1LJOA 2O4XB 1VQ5Q 3SB2A 4FSSA 2CH4W 2ZCFB 3VS1A 2JZ2A 1D3BA 2DL8A 3VYGA 3RMSA 1CSKA 2RPNA 3V7CA 2Y4YA 2O88A 3PIOA 5LJ5e 3SWNC 3OS2A 4RG8A 5J39A 2NUTB 4HKEA 4XTVA 3RESA 3M0RA 2CP0A 1I5OB 2DVJA 1GCQC 2RJEA 4C8QE 4ANJA 3OYHA 2OAUA 4R0KA 1Y71A 3KUFA 3CCUA 2JN0A 4QVCA 3M0TA 1RADB 4DBRA 4A4EA 4J9CA 1NPRA 1VQPA 1OX9A 3RDVA 4D8KA 2RN8A 2J05A 1G2BA 2JTMA 1ZA1B 4IIMA 1GBQA 2RH2A 2F1LA 2V8JA 4C0ZA 3I56A 3RBBB 2QDLA 2EW3A 4LDWA 3CCRA 2F2XA 2CUBA 3VS6A 2VV5A 2LNVA 1OULA 4M78D 4RTZA 3EFRA 4M75D 1N8RU 5FU7C 1M1FA 3L2WA 2WSCE 1VQMA 2NLUA 4R56A 1W4SA 4LDUA 1K9AA 1OV3A 4Y92A 3EFOA 2DM1A 4JS5A 2C0OA 1YIJA 2LT4A 1UGVA 3VUBA 2PUKB 5CKFA 1JU5C 1IO6A 5LJ3d 4RTWA 1K4US 1K9MU 3CXCS 1AWXA 5ECAA 1D1CA 3CQTA 3FEOA 5FWBA 2QK0A 1FMVA 2VGMA 3FJ5A 4C5GA 1SG5A 1PKSA 3RNJA 3CMAQ 3EH1A 2AZSA 4BE2A 2BE9B 1LCKA 3S3MA 1TOVA 2YRVA 2EYYA 2K3BA 2HSPA 4LD6A 4QKUA 2LQWA 1RAEB 3CCVQ 2GNCA 3RIRA 4J9EA 2KRSA 4BI4A 1NG2A 3ZL7C 2KI7A 2QQ9A 2M16A 3CCRT 1SRMA 3M0UA 2C0IA 3N5BB 1VYVA 1H641 1ZSZC 1S72A 3M58A 5HKCA 4B9WA 4C8QA 1AT1B 3JB9D 3A1PA 5GJWB 4J9FA 4C92C 4PJOA 2GQIA 4AMCA 2ZPIB 3OA6A 4UC4A 2HQEA 3VS7A 3MKDA 2KNBB 4KGXB 3FIFA 5GAMe 3CCJQ 2W0ZA 1N8RC 4C8QB 5IXBA 1AWWA 3GF5A 4PJOD 1ZSZA 3PVLA 2RJFA 2LVMA 3OW2P 4EIKA 3RERA 2KSSA 4FW2A 1D3BB 2X4JA 3UDCA 2MIOA 1M1GA 2G3RA 1NEBA 1VQLA 1I1JA 3I55Q 2DE0X 4RG2A 3GNFB 4C8QG 1TXQA 1YCSB 5KYUA 2E10A 3SDZA 3VV0A 4M7DA 2OTJQ 1NEGA 1BIAA 2CSIA 2YT6A 1TS9A 5FU6C 5CCAA 3L2UA 3VKIA 1B34A 2EKOA 3AHUA 2LCLA 1VQ7A 2DZ9A 2F69A 4M7AA 1WDXA 1BI2A 2X4XA
chains in the Genus database with same CATH topology
1SEMA 4JZ3A 1PNJA 4LN2A 3QWYA 2DLPA 2A08A 4J9IA 2K6DA 3NMZC 2EKHA 2FRWA 2JS2A 4RTXA 1SHGA 2IIMA 3LH5A 1ZUKA 2HCKA 2EGEA 1QWEA 2KXCA 2KXDA 1QKXA 2LJ3A 2V1QA 4AFSC 3EG3A 2JXBA 3REBB 2B86A 4J9BA 2EGAA 2JM8A 2DX1A 1KIKA 1GCQA 2ECZA 1XOVA 4JZ4A 3UF4A 4Z8AA 3VS3A 1K0XA 3I5SA 2JT4A 3I9QA 1MV0B 1X6BA 4RTVA 3U23A 2YUNA 2FRYA 1WXTA 3H0HA 2L2PA 1PRLC 2VVKA 5IHIA 3PVQA 2K9GA 2ESWA 2KT1A 1GCPA 4F14A 3ULRB 1H8KA 2DL4A 2EYXA 2MCNA 1B3QA 2KE9A 4CC2A 2JW4A 1I07A 4JPBW 4AG1C 2RQUA 3C0CA 1YWOA 2SRCA 2G6FX 1AVZC 1K1ZA 1X2KA 1M30A 2DJQA 4HCKA 1AD5A 4JJDA 3SHWA 2CUDA 2EGCA 3VS5A 2D8HA 2JM9A 2PTKA 2L3PA 1JXMA 1TUDA 2L0AA 1QKWA 2D1XA 1WLPB 1Z9ZA 2EQIA 1MV3A 1ZUYA 1QLYA 4ORZA 2ED1A 2EPDA 3EGUA 2ROLA 2YUPA 1AWOA 3VS4A 1J3TA 2J6KA 1S1NA 1CKBA 1BK2A 4AFUC 1SRLA 2J6OA 1OPKA 1UE9A 2LX7A 2CDTA 2K7AA 2P4RA 2DL3A 1JQQA 1NYFA 4RTUA 2M51A 1A0NB 1WX6A 1E6HA 2DBKA 4E6RA 2KR3A 4F17A 1U5SA 2PNIA 2RQRA 3M0QA 1YWPA 1BBZA 2YUOA 1GFCA 5FWCA 2X3WD 3VS0A 1AEYA 3UATA 1H92A 1UJ0A 1FYNA 2ED0A 1UECA 5IXFA 3I35A 1T0JA 1RLPC 4ESRA 2AKLA 2BZ8A 1WXUA 1ZUUA 4J9DA 2SEMA 1MUZA 4Z89A 1Y0MA 4OMLA 5I22A 1AZEA 2K2MA 4AFQC 2KRMA 2F2WA 1V1CA 5IHKA 4X1VA 1Y57A 1AWJA 1X69A 1H3HA 4QT7A 1UHCA 2JMCA 3O5ZA 4CC3A 1UJYA 2O31A 1WXBA 4JJBA 2EYWA 1K76A 1WYXA 1U3OA 4OMMA 3M0SA 4M4ZA 2CH4A 2DMOA 2FPDA 3TSWA 1HJDA 2K79A 4HVVA 4KRTA 4RTTA 2KYMA 4D8DA 3GBQA 1M3CA 2A36A 3A98A 1M3AA 1PWTA 1GFDA 1W70A 2NWMA 1GBRA 4OMPA 2LQNA 2A28A 2RNAA 1PKTA 3H0IA 4AG2C 1WI7A 1PRMC 4F16A 1BU1A 1OEBA 3H41A 1UG1A 2H8HA 2DL5A 2AK5A 4GLMA 2FPEA 2E5KA 5FW9A 1QCFA 2CT3A 2BZXA 3QWXX 1UUEA 2GGRA 1ABOA 2DNUA 2O9VA 4FSSA 3UA6A 2MOXA 2CH4W 2LJ0A 2W10A 2FPFA 4OMNA 2HBWA 2KBTA 3VS1A 5I11A 3PE0A 2AZVA 2DL8A 1I0CA 3EHQA 1CSKA 1ZLMA 2RPNA 2O88A 3NHNA 3TVTA 2HDAA 2GBQA 2L3SA 1AZGB 2VKNA 2X3XD 2EBPA 3EHRA 1W6XA 3M0RA 2ENMA 1ABQA 1KFZA 2DVJA 4RUGA 1K0SA 1GCQC 1FMKA 4AFZC 4LE9A 4Z88A 5HCKA 2RF0A 1T3LA 1M3BA 1RLQC 1VYUA 1VYTA 4LUDA 2YSQA 4R0KA 1UTIA 4K11A 3THKA 1E6GA 1T3SA 3I5RA 2D8JA 2LZ6B 4JJCA 2L3QA 3R6NA 1WIEA 3M0TA 1BB9A 2DA9A 3M0PA 3TSZA 1AOJA 4J9CA 2DRKA 4RTYA 1NYGA 4D8KA 1KJWA 2YDLA 2RN8A 2J05A 1G2BA 1RI9A 2C0TA 3UA7A 4CC7A 4IIMA 1WA7A 4OMQA 1GBQA 2J6FA 2ROTA 4ZNXA 1UHFA 3RBBB 1JXOA 2EW3A 2QDLA 1ZX6A 2DL7A 2F2XA 5L23A 2CUBA 3VS6A 2HEQA 1T0HA 2O9SA 4RTZA 3VS2A 2KRNA 3IQLA 4HVUA 4DEYA 2CSQA 1UFFA 1KSWA 2LCSA 3NGPA 2LNHB 1NLPC 1W1FA 1TUCA 3EG0A 3SEMA 1JEGA 2CT4A 1EFNA 2LMJA 1GL5A 2KT8A 2KYBA 1K9AA 1OV3A 4Y92A 1QWFA 1HSQA 2DM1A 2C0OA 3JV3A 1UGVA 1OPLA 2BTTA 1X6GA 1JU5C 1OOTA 1HD3A 2DYBA 2FO0A 1IO6A 1UDLA 1NLOC 4RTWA 1K4US 2DRMA 1ZSGA 3EG2A 1CKAA 1ZBJA 1AWXA 1PHTA 5ECAA 3CQTA 5FWBA 3FJ5A 1Z9QA 1PKSA 3RNJA 4LNPA 2VWFA 1SPKA 2AZSA 1X2QA 2AKKA 1LCKA 2NUZA 2YUQA 2EYYA 2K3BA 2XMFA 2HSPA 1G83A 2LQWA 2BZYA 4IIOA 1SSHA 2GNCA 2GTJA 2RQVA 4J9EA 2A37A 2KRSA 1YP5A 1YN8A 1NG2A 3ZL7C 1TG0A 1SRMA 1VA7A 3M0UA 2C0IA 2LJ1A 1VYVA 4J9HA 2EYZA 5GJVB 1RUWA 2KGTA 2DBMA 1M27C 1ARKA 2PZ1A 4LUEA 1YNZA 5GJWB 4J9FA 2OJ2A 4A63B 2F2VA 2CREA 2GQIA 1NM7A 3VS7A 2KNBB 2RMOA 4HXJA 1U06A 2W0ZA 2EVRA 4HVWA 2JMAA 1M8MA 5IHNA 2JS0A 3H0FA 4DEXA 5IXBA 2D0NA 1AWWA 3VRZA 2GTOA 2OAWA 3PVLA 1GRIA 1X27A 1N5ZA 2OI3A 4EIKA 2KEAA 1SHFA 1X43A 2J06A 3KFVA 2O2OA 2JTEA 1WFWA 2MIOA 2FEIA 2RQWA 1NEBA 1I1JA 2J7IA 2I0NA 1B07A 2DE0X 2FG0A 4CC4B 1E7OA 3EG1A 2DF6A 1YCSB 4OMOA 1JO8A 1NEGA 5IH2A 3NPFA 4WCIA 2CSIA 2YT6A 3VRYA 4J9GA 2KROA 2LP5A 4GBQA 3REAB 1WDXA 5EC7A 2RQTA 2M0YA 2DILA 2V1RA 2ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEM A;  4JZ3 A;  1PNJ A;  4LN2 A;  3QWY A;  2DLP A;  2A08 A;  4J9I A;  2K6D A;  3NMZ C;  2EKH A;  2FRW A;  2JS2 A;  4RTX A;  1SHG A;  2IIM A;  3LH5 A;  1ZUK A;  2HCK A;  2EGE A;  1QWE A;  2KXC A;  2KXD A;  1QKX A;  2LJ3 A;  2V1Q A;  4AFS C;  3EG3 A;  2JXB A;  3REB B;  2B86 A;  4J9B A;  2EGA A;  2JM8 A;  2DX1 A;  1KIK A;  1GCQ A;  2ECZ A;  1XOV A;  4JZ4 A;  3UF4 A;  4Z8A A;  3VS3 A;  1K0X A;  3I5S A;  2JT4 A;  3I9Q A;  1MV0 B;  1X6B A;  4RTV A;  3U23 A;  2YUN A;  2FRY A;  1WXT A;  3H0H A;  2L2P A;  1PRL C;  2VVK A;  5IHI A;  3PVQ A;  2K9G A;  2ESW A;  2KT1 A;  1GCP A;  4F14 A;  3ULR B;  1H8K A;  2DL4 A;  2EYX A;  2MCN A;  1B3Q A;  2KE9 A;  4CC2 A;  2JW4 A;  1I07 A;  4JPB W;  4AG1 C;  2RQU A;  3C0C A;  1YWO A;  2SRC A;  2G6F X;  1AVZ C;  1K1Z A;  1X2K A;  1M30 A;  2DJQ A;  4HCK A;  1AD5 A;  4JJD A;  3SHW A;  2CUD A;  2EGC A;  3VS5 A;  2D8H A;  2JM9 A;  2PTK A;  2L3P A;  1JXM A;  1TUD A;  2L0A A;  1QKW A;  2D1X A;  1WLP B;  1Z9Z A;  2EQI A;  1MV3 A;  1ZUY A;  1QLY A;  4ORZ A;  2ED1 A;  2EPD A;  3EGU A;  2ROL A;  2YUP A;  1AWO A;  3VS4 A;  1J3T A;  2J6K A;  1S1N A;  1CKB A;  1BK2 A;  4AFU C;  1SRL A;  2J6O A;  1OPK A;  1UE9 A;  2LX7 A;  2CDT A;  2K7A A;  2P4R A;  2DL3 A;  1JQQ A;  1NYF A;  4RTU A;  2M51 A;  1A0N B;  1WX6 A;  1E6H A;  2DBK A;  4E6R A;  2KR3 A;  4F17 A;  1U5S A;  2PNI A;  2RQR A;  3M0Q A;  1YWP A;  1BBZ A;  2YUO A;  1GFC A;  5FWC A;  2X3W D;  3VS0 A;  1AEY A;  3UAT A;  1H92 A;  1UJ0 A;  1FYN A;  2ED0 A;  1UEC A;  5IXF A;  3I35 A;  1T0J A;  1RLP C;  4ESR A;  2AKL A;  2BZ8 A;  1WXU A;  1ZUU A;  4J9D A;  2SEM A;  1MUZ A;  4Z89 A;  1Y0M A;  4OML A;  5I22 A;  1AZE A;  2K2M A;  4AFQ C;  2KRM A;  2F2W A;  1V1C A;  5IHK A;  4X1V A;  1Y57 A;  1AWJ A;  1X69 A;  1H3H A;  4QT7 A;  1UHC A;  2JMC A;  3O5Z A;  4CC3 A;  1UJY A;  2O31 A;  1WXB A;  4JJB A;  2EYW A;  1K76 A;  1WYX A;  1U3O A;  4OMM A;  3M0S A;  4M4Z A;  2CH4 A;  2DMO A;  2FPD A;  3TSW A;  1HJD A;  2K79 A;  4HVV A;  4KRT A;  4RTT A;  2KYM A;  4D8D A;  3GBQ A;  1M3C A;  2A36 A;  3A98 A;  1M3A A;  1PWT A;  1GFD A;  1W70 A;  2NWM A;  1GBR A;  4OMP A;  2LQN A;  2A28 A;  2RNA A;  1PKT A;  3H0I A;  4AG2 C;  1WI7 A;  1PRM C;  4F16 A;  1BU1 A;  1OEB A;  3H41 A;  1UG1 A;  2H8H A;  2DL5 A;  2AK5 A;  4GLM A;  2FPE A;  2E5K A;  5FW9 A;  1QCF A;  2CT3 A;  2BZX A;  3QWX X;  1UUE A;  2GGR A;  1ABO A;  2DNU A;  2O9V A;  4FSS A;  3UA6 A;  2MOX A;  2CH4 W;  2LJ0 A;  2W10 A;  2FPF A;  4OMN A;  2HBW A;  2KBT A;  3VS1 A;  5I11 A;  3PE0 A;  2AZV A;  2DL8 A;  1I0C A;  3EHQ A;  1CSK A;  1ZLM A;  2RPN A;  2O88 A;  3NHN A;  3TVT A;  2HDA A;  2GBQ A;  2L3S A;  1AZG B;  2VKN A;  2X3X D;  2EBP A;  3EHR A;  1W6X A;  3M0R A;  2ENM A;  1ABQ A;  1KFZ A;  2DVJ A;  4RUG A;  1K0S A;  1GCQ C;  1FMK A;  4AFZ C;  4LE9 A;  4Z88 A;  5HCK A;  2RF0 A;  1T3L A;  1M3B A;  1RLQ C;  1VYU A;  1VYT A;  4LUD A;  2YSQ A;  4R0K A;  1UTI A;  4K11 A;  3THK A;  1E6G A;  1T3S A;  3I5R A;  2D8J A;  2LZ6 B;  4JJC A;  2L3Q A;  3R6N A;  1WIE A;  3M0T A;  1BB9 A;  2DA9 A;  3M0P A;  3TSZ A;  1AOJ A;  4J9C A;  2DRK A;  4RTY A;  1NYG A;  4D8K A;  1KJW A;  2YDL A;  2RN8 A;  2J05 A;  1G2B A;  1RI9 A;  2C0T A;  3UA7 A;  4CC7 A;  4IIM A;  1WA7 A;  4OMQ A;  1GBQ A;  2J6F A;  2ROT A;  4ZNX A;  1UHF A;  3RBB B;  1JXO A;  2EW3 A;  2QDL A;  1ZX6 A;  2DL7 A;  2F2X A;  5L23 A;  2CUB A;  3VS6 A;  2HEQ A;  1T0H A;  2O9S A;  4RTZ A;  3VS2 A;  2KRN A;  3IQL A;  4HVU A;  4DEY A;  2CSQ A;  1UFF A;  1KSW A;  2LCS A;  3NGP A;  2LNH B;  1NLP C;  1W1F A;  1TUC A;  3EG0 A;  3SEM A;  1JEG A;  2CT4 A;  1EFN A;  2LMJ A;  1GL5 A;  2KT8 A;  2KYB A;  1K9A A;  1OV3 A;  4Y92 A;  1QWF A;  1HSQ A;  2DM1 A;  2C0O A;  3JV3 A;  1UGV A;  1OPL A;  2BTT A;  1X6G A;  1JU5 C;  1OOT A;  1HD3 A;  2DYB A;  2FO0 A;  1IO6 A;  1UDL A;  1NLO C;  4RTW A;  1K4U S;  2DRM A;  1ZSG A;  3EG2 A;  1CKA A;  1ZBJ A;  1AWX A;  1PHT A;  5ECA A;  3CQT A;  5FWB A;  3FJ5 A;  1Z9Q A;  1PKS A;  3RNJ A;  4LNP A;  2VWF A;  1SPK A;  2AZS A;  1X2Q A;  2AKK A;  1LCK A;  2NUZ A;  2YUQ A;  2EYY A;  2K3B A;  2XMF A;  2HSP A;  1G83 A;  2LQW A;  2BZY A;  4IIO A;  1SSH A;  2GNC A;  2GTJ A;  2RQV A;  4J9E A;  2A37 A;  2KRS A;  1YP5 A;  1YN8 A;  1NG2 A;  3ZL7 C;  1TG0 A;  1SRM A;  1VA7 A;  3M0U A;  2C0I A;  2LJ1 A;  1VYV A;  4J9H A;  2EYZ A;  5GJV B;  1RUW A;  2KGT A;  2DBM A;  1M27 C;  1ARK A;  2PZ1 A;  4LUE A;  1YNZ A;  5GJW B;  4J9F A;  2OJ2 A;  4A63 B;  2F2V A;  2CRE A;  2GQI A;  1NM7 A;  3VS7 A;  2KNB B;  2RMO A;  4HXJ A;  1U06 A;  2W0Z A;  2EVR A;  4HVW A;  2JMA A;  1M8M A;  5IHN A;  2JS0 A;  3H0F A;  4DEX A;  5IXB A;  2D0N A;  1AWW A;  3VRZ A;  2GTO A;  2OAW A;  3PVL A;  1GRI A;  1X27 A;  1N5Z A;  2OI3 A;  4EIK A;  2KEA A;  1SHF A;  1X43 A;  2J06 A;  3KFV A;  2O2O A;  2JTE A;  1WFW A;  2MIO A;  2FEI A;  2RQW A;  1NEB A;  1I1J A;  2J7I A;  2I0N A;  1B07 A;  2DE0 X;  2FG0 A;  4CC4 B;  1E7O A;  3EG1 A;  2DF6 A;  1YCS B;  4OMO A;  1JO8 A;  1NEG A;  5IH2 A;  3NPF A;  4WCI A;  2CSI A;  2YT6 A;  3VRY A;  4J9G A;  2KRO A;  2LP5 A;  4GBQ A;  3REA B;  1WDX A;  5EC7 A;  2RQT A;  2M0Y A;  2DIL A;  2V1R A;  2ABL A; 
#chains in the Genus database with same CATH topology
 3OYA A;  4OGC A;  3BDU A;  3M59 A;  2K6D A;  1WHM A;  4MZP A;  1S72 T;  2EKH A;  2K5L A;  2FZC B;  1UGP B;  3E9F A;  4BAC A;  1ZSZ B;  1SHG A;  1KD1 R;  3OSS C;  1Q86 R;  1WHG A;  1YHQ A;  3TU4 K;  2V1Q A;  2QYZ A;  5CR2 A;  3REB B;  2JXB A;  3RKX A;  2B86 A;  2K2V A;  4J9B A;  3PFS A;  2ECZ A;  3EGD A;  4JRI A;  3SD4 A;  4Z8A A;  1RAB B;  1VQ7 T;  2JT4 A;  3OYM A;  1B34 B;  4PFO A;  4RTV A;  1MMG A;  2ZPH B;  1KQS A;  2BUD A;  2XG8 D;  3PNW C;  2MWO A;  4X9C A;  4PJN A;  3LLR A;  3CCE Q;  1PRL C;  3A8O B;  1YJ9 Q;  4HA8 A;  2X4W A;  3PVQ A;  4X9D A;  4XK8 E;  1VQL T;  2LTO A;  2MCN A;  1Q7Y R;  4CC2 A;  2JW4 A;  1I07 A;  3EG9 B;  3JCM g;  2SRC A;  2G6F X;  4M78 F;  3J81 E;  1WQW A;  5C0M A;  4ZGJ B;  1X2K A;  1M30 A;  3WXM B;  3M9Q A;  1VIE A;  1YI2 A;  3V8K A;  4EMH A;  1AD5 A;  4JJD A;  4DOV A;  2EGC A;  3KXT A;  1NBE B;  2DTO A;  2EAY A;  3KBG A;  1VQP T;  1JXM A;  1TUD A;  4KH1 B;  2H3J A;  1WLP B;  3EAE A;  1VQO T;  3CXC A;  2HKQ B;  1LNX A;  3M54 A;  1Z9Z A;  1M1K U;  3CCJ A;  5DM7 R;  1QLY A;  3VU3 C;  1AWO A;  2J6K A;  1S1N A;  1CKB A;  1BK2 A;  5FU7 B;  4R55 A;  1IZ6 A;  2LX7 A;  4PLL A;  2CDT A;  2P4R A;  1NYF A;  3FDR A;  5DLO A;  1E6H A;  4NL2 A;  4E6R A;  1JJ2 S;  2NUP B;  4FCY A;  4A4H A;  4PJO C;  3NTH A;  3I55 A;  2DK3 A;  5FWC A;  2AHJ B;  3CCL T;  3FJP A;  3H6Z A;  3QUI A;  1UEC A;  3MP1 A;  4ZGE B;  3CBO A;  4C92 E;  4HCZ A;  3JCM Q;  2HQH A;  3EGX A;  1JJ2 A;  5GAN j;  2AKL A;  1QVF P;  2BZ8 A;  2COZ A;  3D7S B;  1ZUU A;  4J9D A;  2EQJ A;  2ZPG B;  3BW1 A;  1UB4 A;  2AIR B;  3MP8 A;  4EMG A;  5GMK e;  4QW2 A;  4E7S A;  3UPU A;  1ZBX A;  4PJO G;  1TTH B;  1EZZ B;  1I81 A;  1WHL A;  3HKS A;  1V1C A;  2EYQ A;  5IHK A;  1QVF A;  4X1V A;  1H3H A;  1AWJ A;  1UHC A;  3A8H B;  3EH2 A;  2RM4 A;  3UT1 A;  2O31 A;  3JCM d;  3FC3 A;  2XDD A;  1K76 A;  4M7D G;  1U1S A;  4M4Z A;  3M0S A;  2CH4 A;  5FRM A;  3OYY A;  2E12 A;  2K79 A;  4HVV A;  1G3S A;  4Q5W A;  4D8D A;  1K8A C;  4N0A C;  5CQX A;  4J7F A;  1GFD A;  5CVI A;  5FU6 B;  1VQ5 A;  1D09 B;  2HL5 C;  1PKT A;  1WI7 A;  3CME T;  3CD6 Q;  1Q95 G;  3G1J A;  3CCU T;  1Q82 R;  1U1T A;  1WGS A;  2AK5 A;  2VGN A;  3F70 A;  4XU2 A;  1RAG B;  3QWX X;  2RO0 A;  3QPH A;  1ABO A;  3HP9 A;  1VQ4 Q;  5A0G A;  2HZY A;  2MOX A;  4ELZ C;  2CZ1 B;  1OZ2 A;  4L6V 5;  2P4T A;  3BY7 A;  1SSF A;  4RCB A;  2OTL Q;  1OU9 A;  4PJJ A;  1C1A A;  2RJD A;  5GAN g;  3LYI A;  5LJ3 e;  2HL3 A;  1ZLM A;  1MND A;  4M77 E;  2QEX Q;  2EJF A;  3QSU A;  4B9X A;  1Q86 U;  3CC7 A;  2RK1 A;  2L3S A;  3EHR A;  2HKN A;  4E7K A;  4ZN3 A;  4RUG A;  1K0S A;  5KYW B;  2DEU A;  4AFZ C;  3DB3 A;  1T3L A;  1M3B A;  1VYT A;  1KQS P;  1BCM A;  5LJ5 h;  2YSQ A;  2MPX C;  3OYJ A;  3I5R A;  3J80 E;  2A0F B;  4C5H A;  4JJC A;  4M75 E;  3G6E T;  1M2O A;  3A8G B;  4OB0 B;  1NYG A;  1OYX A;  4LDX A;  1KJW A;  4M78 A;  4ZGD B;  2KVQ G;  5CO7 A;  1WQ7 A;  2J6F A;  2ROT A;  4KH0 B;  3EFO B;  4A4K A;  1UHF A;  2R57 A;  4Y91 A;  3CMA T;  3MP6 A;  2RI5 A;  2DL7 A;  1YIJ Q;  2O9S A;  1IGQ A;  2QQA A;  1JJ2 P;  4OB2 B;  2GQV A;  3IQL A;  4HVU A;  1WZO A;  2CSQ A;  1VQ8 T;  1UFF A;  1KSW A;  5I2S A;  4M75 F;  1MMN A;  4II1 A;  4C0D B;  2CT4 A;  1GL5 A;  2KT8 A;  5CK9 A;  2E6Z A;  1W2B P;  2PUO B;  3LGL A;  4PJO F;  5KYW A;  4BY6 C;  2LCC A;  5GAN f;  1X6G A;  5IT9 E;  1OOT A;  4L5G A;  2DYB A;  1D0Z A;  3CPW A;  5GMK h;  3RR6 A;  1K9M C;  1VQ8 Q;  1UDL A;  1NLO C;  1VQ9 A;  4PLI A;  3A8L B;  3EG2 A;  4LDV A;  1SF9 A;  1PHT A;  4J6X A;  2ZAE A;  2A3L A;  3MEU A;  2MYS A;  2R5A A;  2XID A;  2QAZ A;  2XIC A;  3VJP A;  4LNP A;  4QQD A;  3CXC P;  1BI1 A;  1S72 Q;  2DXT A;  1X2Q A;  2AKK A;  4IUU A;  3CEY A;  2XI9 A;  2ZPE B;  4C5E A;  1G83 A;  2RHX A;  2HBP A;  2XK0 A;  2K4Y A;  1KQ2 A;  2GTJ A;  3JCM X;  1V76 A;  1YN8 A;  3CCE T;  5DY9 A;  1VA7 A;  3A5Z B;  1QCN A;  1ARK A;  2PZ1 A;  1YNZ A;  2HQX A;  4QQG A;  2OJ2 A;  2H3E B;  2RHY A;  1C0M A;  4A63 B;  5KYX A;  1LPL A;  2CP6 A;  4A4G A;  4C92 F;  4VUB A;  3GNG A;  3WVD B;  3CC7 Q;  3QXE B;  2RMO A;  4L59 A;  2EVR A;  3H0F A;  2DIG A;  2M0O A;  4M7A C;  2D0N A;  3CCL A;  3VRZ A;  1R77 A;  1G8X A;  2GTO A;  3GLX A;  2OAW A;  2VB6 A;  1X27 A;  2OX7 A;  1P92 A;  3SWN B;  2OTJ A;  2L8D A;  1X43 A;  2X4Y A;  2J06 A;  3KFV A;  3MET A;  3PMT A;  1PD1 A;  3QZ9 B;  2B8A A;  2I0N A;  4JJN K;  2DO3 A;  2FG0 A;  1MMD A;  1VQO Q;  4F7U F;  1NJI U;  3EGX B;  1JO8 A;  3CD6 T;  4OF1 A;  2P84 A;  5GMK i;  2ZPB B;  2K5F A;  2QTX A;  5CKH A;  3OYF A;  3CCS A;  3REA B;  4BD3 A;  1WPY A;  4PJL A;  1N27 A;  4C92 A;  4LN2 A;  3S3N A;  4J9I A;  3NMZ C;  3OB9 A;  1UEB A;  2EJ9 A;  4ZN1 A;  2JS2 A;  4XAX B;  4IUV A;  4RTX A;  1YFN A;  3JB9 G;  3QG1 A;  2IIM A;  4TVR A;  2HCK A;  3OMC A;  3JCM c;  2KXC A;  2DYI A;  2LJ3 A;  4M75 B;  3CCE A;  4E7I A;  1YJ9 A;  3X20 B;  1YJN T;  2IG0 A;  1GCQ A;  3UF4 A;  1XOV A;  3C95 A;  1VQ5 T;  4ZTJ A;  3JCM J;  3VS3 A;  3CME Q;  5LJ3 j;  2Z0W A;  4HCC A;  1M8V A;  1BCO A;  3L1A A;  3U23 A;  2YUN A;  2FRY A;  4LDY A;  4FYY B;  2LDM A;  3G71 A;  1G5V A;  2ESW A;  2PVD B;  3ULR B;  4JS4 A;  1H8K A;  2FL7 A;  2NYS A;  5D6Y A;  2DEQ A;  4MDW A;  1QMC A;  2M9U A;  5GAO n;  3RUX A;  3C0C A;  1XJW B;  1YWO A;  4NS5 A;  4O6J A;  2OTL T;  5GMK l;  1RL2 A;  1I4K 1;  3T9N A;  1K1Z A;  3CCQ T;  3PIP A;  3QII A;  4Z02 A;  4JDS A;  2C06 A;  1KC8 U;  3Q1J A;  2CYZ B;  4ELY C;  3NTK A;  3CC2 T;  2PTK A;  4JRK A;  2WAC A;  2L0A A;  4C0G A;  4MML A;  2D1X A;  4OVA A;  1TU0 B;  4KUL A;  2EQI A;  2DXC A;  2JTF A;  2X51 A;  3CCR Q;  3E19 A;  3QJ6 A;  2ED1 A;  2RHU A;  3I55 T;  1K8A R;  4C92 B;  3CCM T;  2V26 A;  1SRL A;  1OPK A;  2K7A A;  1YIT A;  2DL3 A;  3ASK A;  1VQM Q;  1WX6 A;  1HXD A;  6AT1 B;  1VOM A;  2DBK A;  1FMW A;  1N9S A;  1U5S A;  5GAN 7;  1OU8 A;  2PNI A;  3HL8 A;  3M0Q A;  3ME9 A;  4O5V A;  1QP3 A;  4QQ6 A;  1N6A A;  4E2F B;  2O01 E;  2EFI A;  3VS0 A;  2QQS A;  3RKY A;  3NFC A;  1YJW A;  2MAM A;  2R5M A;  1VQO A;  2MI6 A;  4JRP A;  2JUF A;  3JB9 F;  5LJ5 f;  4M7D B;  4ESR A;  2YWW A;  4M75 A;  3LWH A;  4F7U B;  1MUZ A;  3GIB A;  3HPW A;  5AYF A;  1Y0M A;  3CMA A;  4NL3 A;  4OML A;  5HK0 A;  4PFZ A;  4BB7 A;  2F2W A;  3OQ5 A;  1OX8 A;  3HRS A;  4JRQ A;  1VQ6 Q;  3MEW A;  3LH0 A;  5GAO l;  2RD1 A;  4CC3 A;  1G3W A;  1KK7 A;  1U3O A;  1K73 R;  1IB8 A;  1HJD A;  3TSW A;  2CZ0 B;  4FSX A;  3QKJ A;  4KRT A;  4D6W A;  3GBQ A;  5LJ5 d;  1M4Z A;  1QP2 A;  4M78 G;  4MZM A;  2P0K A;  3G6E Q;  2NWM A;  1YCY A;  4OMP A;  3CCU Q;  2KDS A;  5GAN 4;  1M90 C;  2LRQ A;  2OTJ T;  1PRM C;  2EJG A;  1VUB A;  4BE0 A;  3ZBD A;  1VQP Q;  2NUT A;  2YLB A;  1BU1 A;  3CBM A;  3L2Q A;  1OEB A;  1R0C B;  5KYU B;  3OYK A;  2H8H A;  4XQ3 A;  1MNE A;  4GLM A;  3X24 B;  3JCM e;  2DTI A;  1QVP A;  5FW9 A;  3I56 Q;  1QCF A;  2BZX A;  5GAN 8;  1UUE A;  2E70 A;  2DNU A;  3ZEH A;  2JOY A;  1OQK A;  1FXX A;  1HYO A;  3OYL A;  1JRI A;  1IRE B;  2HBW A;  1YBY A;  1VQ4 T;  5KYX B;  4XTU A;  2AZV A;  1I0C A;  1Q86 C;  1B7T A;  1PCX A;  1QVG S;  3ZFJ A;  1MGQ A;  3MHX A;  1AZG B;  2EBP A;  4DBF A;  2ENM A;  1ABQ A;  4FYV B;  4N0A A;  1Q81 U;  1VIF A;  4Z88 A;  2RF0 A;  2IPO B;  1G3Y A;  1VYU A;  4PNO A;  2QTV A;  4K11 A;  2E3H A;  3THK A;  3JCM P;  1T3S A;  1KD1 C;  1U8R A;  2L3Q A;  1WIE A;  4M78 E;  1FX7 A;  2WSE E;  5CKD A;  2DA9 A;  3VUZ A;  3TSZ A;  2VYT A;  4JLI A;  1VQM T;  5CIU A;  4OB3 B;  1KC8 R;  1YJW Q;  4N4H A;  1Y07 A;  2LC4 A;  2MMP A;  2C0T A;  1D0X A;  3L42 A;  4CC7 A;  4F7U E;  1LVK A;  1WJS A;  4OMQ A;  1F1B B;  4PFP A;  4M7D E;  1JXO A;  3BFM A;  2DD5 A;  3RMQ A;  1M90 U;  1ZX6 A;  3G4S T;  4DBH A;  2HEQ A;  4C8Q D;  1TSF A;  1NE8 A;  1IXD A;  3VS2 A;  2E64 A;  4DEY A;  5GAO m;  3QDF A;  3V8L A;  2LNH B;  1O9S A;  3O8V A;  1VQ8 A;  3EG0 A;  3MO8 A;  4EMK C;  1YJW T;  1EFN A;  2LMJ A;  1RAH B;  4BUG A;  7AT1 B;  1QWF A;  2I2L A;  3JV3 A;  2Y90 A;  1OPL A;  2BTT A;  2E1H A;  1BYM A;  1Q81 C;  1K73 C;  3C12 A;  5GAN 3;  3QZ5 B;  2FO0 A;  2ATC B;  2GFU A;  1VQ6 T;  2DTH A;  2KMT A;  2BE7 D;  4FW1 A;  1CKA A;  3G6E A;  5KCO A;  4ME7 A;  2KQW A;  5GAO p;  1Y96 B;  4RKU E;  1Z9Q A;  4IUP A;  1PSF A;  2EQM A;  2GCX A;  1SPK A;  1R0B G;  2L89 A;  4E7J A;  2F5T X;  4EDU A;  4DQ2 A;  5KH6 A;  2XMF A;  2LX9 A;  4IIO A;  3VYH B;  1N9R A;  3QDR B;  1YP5 A;  1Y96 A;  5KE2 A;  3G4S A;  5FRO A;  2LJ1 A;  3EGD B;  4J9H A;  5GJV B;  1RUW A;  3OSV A;  1AHJ B;  2DBM A;  1M27 C;  2CP5 A;  4PJM A;  1VQN Q;  3OMG A;  4LUE A;  3JCM b;  1IGU A;  2CP2 A;  2F2V A;  3V7S A;  4C92 D;  1OI1 A;  2QGF B;  4E7L A;  4A54 A;  1M2V A;  1U06 A;  5HY6 A;  2FVU A;  3JAM E;  4HVW A;  2JMA A;  5IHN A;  3G71 T;  2JS0 A;  2L5Q A;  4DEX A;  2DPP B;  3TCJ A;  3HFN A;  5CKE A;  1GRI A;  5GAN 5;  5GAN 6;  3OYE A;  1N5Z A;  3GPL A;  2CZ6 B;  2KEA A;  5KYY B;  2O2O A;  2JTE A;  1WFW A;  3CCS Q;  3SWN A;  3M5A A;  2RQW A;  1H3Z A;  1YJN A;  2ZPF B;  2EWN A;  1X75 C;  5DLQ E;  2YRC A;  1E7O A;  3EG1 A;  2XU8 A;  4QVZ A;  3CCQ Q;  4OMO A;  2DJZ A;  3NPF A;  4M7A F;  2JJ9 A;  3VRY A;  3QJY A;  1QVG A;  4F7U A;  4IKF A;  4J9G A;  2PVG B;  3HTR A;  1IRX A;  2KRO A;  1BI3 A;  2LP5 A;  4GBQ A;  2E5Q A;  4HT8 A;  3FLG A;  1WJQ A;  5GAN d;  2RQT A;  2M0Y A;  2V1R A;  2ABL A;  3CCS T;  1SEM A;  4JZ3 A;  5GAN 2;  4ZTF A;  4OB1 B;  2FRW A;  3JCM f;  4EPC A;  3LH5 A;  2E6N A;  2L3R A;  1ZUK A;  2DFU A;  1BIB A;  2EGE A;  1QWE A;  2KXD A;  5D6W A;  2K3X A;  4BDZ A;  2FYK A;  3X28 B;  2AT1 B;  1UGS B;  4J7I A;  2EGA A;  3TQ7 P;  2JM8 A;  2DX1 A;  3LW5 E;  3M55 A;  3CC2 Q;  2E65 A;  4QVD A;  3M4Y A;  3I5S A;  1VQK Q;  4FYX B;  1PM3 A;  5EG2 A;  5J3B A;  2GF7 A;  2PVO B;  3I9Q A;  1FWZ A;  1X6B A;  1OZ3 A;  4EMK A;  3MJX A;  1WXT A;  2RJC A;  3H0H A;  2L2P A;  5A0L A;  4YTL A;  2K9G A;  3OYN A;  2KT1 A;  4N4I A;  1GCP A;  2QA4 Q;  2DL4 A;  2EYX A;  4M75 G;  4MMK A;  1B3Q A;  2KE9 A;  3SFM A;  4FM4 B;  4JPB W;  2RQU A;  5KYY A;  4J8O A;  4HCK A;  3CCJ T;  2QDY B;  3LGF A;  4OMF B;  3SHW A;  2YLC A;  3GP8 A;  3MEA A;  1YIT Q;  4PJO E;  1QKW A;  2XDB A;  5GAM d;  5A2Q E;  2E4H A;  1NJI R;  5FRN A;  1ZUY A;  4ORZ A;  3EGU A;  3P8B B;  2YUP A;  4RCC A;  3FB9 A;  1LOJ A;  1J3T A;  4PL6 A;  5I2M A;  8ATC B;  3TEE A;  4M77 C;  1M1K C;  2D0Q B;  2RHI A;  2E3I A;  3CPW P;  1JQQ A;  4RTU A;  2M51 A;  3E1S A;  4IUR A;  2K57 A;  1QVG P;  4E47 A;  1YIT T;  4F17 A;  4C8Q C;  3JSC A;  1Y7X A;  2QG9 B;  3CCV A;  2F5K A;  4J6W A;  5IAY A;  5GAM g;  1YWP A;  1BBZ A;  2YUO A;  2D6F A;  1RI0 A;  1YJN Q;  2VC8 A;  2X3W D;  1R8O B;  3ER0 A;  5LL6 S;  1AEY A;  1H92 A;  1FYN A;  3MCA B;  3S3O A;  2ED0 A;  3C4S A;  2PQW A;  5IXF A;  1QVF S;  3CPW S;  1PG5 B;  3OYB A;  1VQ6 A;  1T0J A;  4XU0 A;  1YI2 Q;  5CQY A;  1YHQ T;  5GAM j;  4E7Z A;  2SEM A;  4Z89 A;  1EX4 A;  1D0Y A;  3I56 T;  4A53 A;  3NTI A;  2OTL A;  2K2M A;  2IVW A;  2DZC A;  3INZ A;  2KRM A;  4BY6 B;  2VUB A;  2QEX A;  1Y57 A;  1X69 A;  3JB9 H;  2JMC A;  3O5Z A;  3LWI A;  1UJY A;  1VQL Q;  2EQU A;  4JJB A;  2EYW A;  4BE1 A;  3EFS A;  1MHN A;  5GAO r;  1W2B S;  3H9N A;  2FHD A;  2DD4 A;  2FPD A;  2QGG A;  1VQK A;  4F7U G;  5KYN A;  1ZHI A;  4XU3 A;  5GMK j;  3A98 A;  1M3A A;  3C94 A;  1W70 A;  1GBR A;  2QA4 T;  2A28 A;  3H0I A;  4Y28 E;  2VXE A;  1W2B A;  9ATC B;  3QO3 A;  1BI0 A;  3QYG B;  2RB6 A;  1QCO A;  3FRN A;  2DAQ A;  2HAX A;  3X26 B;  5GAM f;  2FPE A;  3HHT B;  4V2S A;  4B6M A;  5LJ3 f;  1UGR B;  2GGR A;  1I8F A;  2O9V A;  4M78 B;  3CCM Q;  3UA6 A;  5D7U A;  3P8H A;  2LJ0 A;  2W10 A;  2FPF A;  4OMN A;  1NZ9 A;  3J7A F;  3S6W A;  2KBT A;  2DXB A;  5I11 A;  2COY A;  1DJ7 B;  5LJ5 g;  3PE0 A;  4M7A B;  3JB9 J;  1G3T A;  2QAS A;  1KQS S;  3EHQ A;  5KE3 A;  5HK3 A;  3NHN A;  3TVT A;  2HDA A;  2GBQ A;  4OP0 A;  2MWP A;  2VKN A;  2X3X D;  1W6X A;  1Q7Y C;  1KFZ A;  1EIF A;  3WVE B;  4N4G A;  1FMK A;  4LE9 A;  2R58 A;  1PSE A;  5HCK A;  1XNI A;  4J6Y A;  2EIF A;  1VQN T;  1RLQ C;  3X25 B;  4LUD A;  3L2Z A;  1UTI A;  2ZGW A;  2RHZ A;  3OBW A;  1E6G A;  1TH7 A;  2D8J A;  4M7A G;  4M77 G;  2LZ6 B;  3R6N A;  1N8R R;  1JBM A;  1RAC B;  4BI3 A;  4XTY A;  2XD0 A;  1BB9 A;  3M0P A;  1IHW A;  1AOJ A;  2DRK A;  4RTY A;  3M56 A;  2YDL A;  1IHV A;  5D6X A;  1RI9 A;  3UA7 A;  1WA7 A;  4XTW A;  4ZNX A;  3E2U A;  4XTZ A;  4C0F A;  1WJR A;  5L23 A;  1VQ4 A;  3G71 Q;  1T0H A;  3HRU A;  3URG A;  2KRN A;  4M75 C;  4M77 B;  2LCS A;  2DXU A;  4M78 C;  3NGP A;  1NLP C;  1W1F A;  2XKO C;  1ZA2 B;  5CKB A;  4FU6 A;  1TUC A;  3SEM A;  1JEG A;  4J5Y A;  4C0D C;  3DLL A;  2KYB A;  5LJ3 h;  3M53 A;  1HSQ A;  4KT0 E;  2YXY A;  2BKD N;  2CP3 A;  4DBQ A;  2HNI A;  1HD3 A;  3L2R A;  5GAO q;  2DKG A;  2RI3 A;  2JNG A;  2DRM A;  1ZSG A;  1D1B A;  1ZBJ A;  3JCM h;  1Q82 U;  5LJ3 g;  5AT1 B;  3G4S Q;  1K9M R;  5GAN e;  4LD9 K;  4M7D D;  2DVE A;  2VWF A;  3RKW A;  2NUZ A;  2QQB A;  2YUQ A;  4GY5 A;  1HK9 A;  1K8A U;  5FLX E;  3BE3 A;  2BZY A;  3OYD A;  2QEX T;  1SSH A;  2RQV A;  2MK5 A;  1WHK A;  2A37 A;  1XQH A;  1GXI E;  3CCM A;  1TG0 A;  1D1A A;  4MDX A;  2EYZ A;  1YI2 T;  1RAF B;  3OYG A;  2VAS A;  4J83 A;  2KGT A;  4MZT A;  4PKC C;  4WTO B;  2HD0 A;  1V29 B;  8AT1 B;  2Y4X A;  2CRE A;  3OYI A;  4A4F A;  2DIQ A;  1NM7 A;  2HSE B;  3MEV A;  3PT9 A;  4HXJ A;  4KUI A;  5A0D A;  1M8M A;  2ZZD A;  3CD6 A;  3MPU B;  2KAF A;  4RMO A;  1X6O A;  2OI3 A;  3CCQ A;  2YHT A;  4FIB A;  4C5I A;  1SHF A;  1SKU B;  1M2V B;  2FEI A;  2DER A;  3CC7 T;  1NJI C;  3A8M B;  4FT4 A;  2J7I A;  1B07 A;  1M5Q 1;  4M7D F;  4FL6 A;  4CC4 B;  2DF6 A;  2LT1 A;  4M77 D;  2FB7 A;  4HCB A;  3HSB A;  5IH2 A;  1M1K R;  1Q82 C;  4WCI A;  3LX7 A;  3E9G A;  4CRI A;  4XTX A;  2VXF A;  1ZQ1 A;  3OBY A;  4KUD K;  3QHS A;  1KHC A;  5EC7 A;  3CC2 A;  2DIL A;  4CI0 C;  2KY9 A;  1Q7Y U;  3CC4 Q;  1QW1 A;  1PNJ A;  2P0P A;  3QWY A;  2DLP A;  3OS5 A;  1Q81 R;  2A08 A;  2XHC A;  5GAM h;  2KK4 A;  1ACM B;  3M57 A;  2O4X A;  3V8J A;  3CC4 T;  2DET A;  4E7H A;  4M7A D;  3HRT A;  3DB4 A;  4WF2 A;  3CCV T;  1QKX A;  4AFS C;  1VQ7 Q;  2RI2 A;  3EG3 A;  4HT9 A;  5KCH A;  2QA4 A;  1KIK A;  4EMK B;  4JZ4 A;  3CCL Q;  1K0X A;  1I5L A;  3G7Z A;  4X34 A;  3P8D A;  2A7Y A;  3OYC A;  1MV0 B;  4GLK A;  1RAA B;  4M77 A;  4JLG A;  3OY9 A;  1VQK T;  3JRZ A;  1YHQ Q;  2LQK A;  3H8Z A;  4AT1 B;  2YRD A;  2VVK A;  5IHI A;  4BI8 B;  2CKK A;  2K5I A;  4F14 A;  5IN1 A;  2GFA A;  2X35 A;  1YJ9 T;  1M9S A;  5C6S A;  4AG1 C;  5GMK m;  4IUQ A;  1AVZ C;  1JB0 E;  4NOY A;  1QQJ A;  2DJQ A;  4KBM B;  3OS1 A;  1KHI A;  2CUD A;  2E41 A;  4LXC A;  2CP7 A;  3VS5 A;  3L2V A;  4KGV B;  3TRE A;  2D8H A;  3DKM A;  2JM9 A;  4BDY A;  2L3P A;  5CAI A;  1KC8 C;  1WHH A;  1VQ9 Q;  1KQ1 A;  1KD1 U;  3OW2 S;  2V8K A;  3QYH B;  2QQR A;  1MV3 A;  2RK2 A;  2EPD A;  2ROL A;  3M4G A;  1X01 A;  3VS4 A;  4M77 F;  4AFU C;  3JCM V;  2J6O A;  1UE9 A;  3CME A;  4FT2 A;  5L8R E;  4DA4 A;  1MMA A;  2COW A;  3HFO A;  3GOX A;  1A0N B;  2MF2 A;  2KR3 A;  2RA2 A;  3AT1 B;  4IUT A;  3DLM A;  3OW2 A;  4ATO A;  2CGH A;  2RQR A;  3BDL A;  4PJO B;  1BKB A;  4DOW A;  2EQK A;  2BIV A;  1GFC A;  1YIJ T;  3V7R A;  1KG1 A;  2M02 A;  3UAT A;  1UJ0 A;  4JUV A;  4PK4 A;  3QBY A;  4C92 G;  3I35 A;  1VQ9 T;  2FZG B;  2CS7 A;  1RLP C;  1WXU A;  4M7D C;  1TWB A;  5M9O A;  1RAI B;  3CC4 A;  1K73 U;  4C8Q F;  3JB9 I;  2K3Y A;  5I22 A;  3JCM W;  1PD0 A;  2JVV A;  4OGE A;  2NUP A;  1AZE A;  4KGZ B;  4AFQ C;  3PGG A;  3R6O A;  2CZ7 B;  4QT7 A;  5I21 A;  1NPP A;  4XU1 A;  2QI2 A;  1WXB A;  2QXF A;  1WYX A;  2LQ8 A;  3PMI A;  4OMM A;  2DMO A;  1TUG B;  1UGQ B;  4RTT A;  2KYM A;  1WNL A;  1VQN A;  1M3C A;  2A36 A;  4P5N A;  1PWT A;  2V8I A;  2PU9 B;  3OS0 A;  2D9T A;  1XTD A;  2LQN A;  2RNA A;  1WHJ A;  4AG2 C;  2HMA A;  2FZK B;  4M7A E;  5J26 A;  2XDP A;  4F16 A;  2M1H A;  2P0Q A;  5GAN h;  2WSF E;  3H41 A;  3CBP A;  1UG1 A;  3PTA A;  4FYW B;  1C6V X;  2DL5 A;  3CPF A;  1M90 R;  1O75 A;  2E5K A;  3EG9 A;  5LJ5 j;  1PC0 A;  3UWN A;  2CT3 A;  4F04 B;  2X9H A;  1LJO A;  2O4X B;  1VQ5 Q;  3SB2 A;  4FSS A;  2CH4 W;  2ZCF B;  3VS1 A;  2JZ2 A;  1D3B A;  2DL8 A;  3VYG A;  3RMS A;  1CSK A;  2RPN A;  3V7C A;  2Y4Y A;  2O88 A;  3PIO A;  5LJ5 e;  3SWN C;  3OS2 A;  4RG8 A;  5J39 A;  2NUT B;  4HKE A;  4XTV A;  3RES A;  3M0R A;  2CP0 A;  1I5O B;  2DVJ A;  1GCQ C;  2RJE A;  4C8Q E;  4ANJ A;  3OYH A;  2OAU A;  4R0K A;  1Y71 A;  3KUF A;  3CCU A;  2JN0 A;  4QVC A;  3M0T A;  1RAD B;  4DBR A;  4A4E A;  4J9C A;  1NPR A;  1VQP A;  1OX9 A;  3RDV A;  4D8K A;  2RN8 A;  2J05 A;  1G2B A;  2JTM A;  1ZA1 B;  4IIM A;  1GBQ A;  2RH2 A;  2F1L A;  2V8J A;  4C0Z A;  3I56 A;  3RBB B;  2QDL A;  2EW3 A;  4LDW A;  3CCR A;  2F2X A;  2CUB A;  3VS6 A;  2VV5 A;  2LNV A;  1OUL A;  4M78 D;  4RTZ A;  3EFR A;  4M75 D;  1N8R U;  5FU7 C;  1M1F A;  3L2W A;  2WSC E;  1VQM A;  2NLU A;  4R56 A;  1W4S A;  4LDU A;  1K9A A;  1OV3 A;  4Y92 A;  3EFO A;  2DM1 A;  4JS5 A;  2C0O A;  1YIJ A;  2LT4 A;  1UGV A;  3VUB A;  2PUK B;  5CKF A;  1JU5 C;  1IO6 A;  5LJ3 d;  4RTW A;  1K4U S;  1K9M U;  3CXC S;  1AWX A;  5ECA A;  1D1C A;  3CQT A;  3FEO A;  5FWB A;  2QK0 A;  1FMV A;  2VGM A;  3FJ5 A;  4C5G A;  1SG5 A;  1PKS A;  3RNJ A;  3CMA Q;  3EH1 A;  2AZS A;  4BE2 A;  2BE9 B;  1LCK A;  3S3M A;  1TOV A;  2YRV A;  2EYY A;  2K3B A;  2HSP A;  4LD6 A;  4QKU A;  2LQW A;  1RAE B;  3CCV Q;  2GNC A;  3RIR A;  4J9E A;  2KRS A;  4BI4 A;  1NG2 A;  3ZL7 C;  2KI7 A;  2QQ9 A;  2M16 A;  3CCR T;  1SRM A;  3M0U A;  2C0I A;  3N5B B;  1VYV A;  1H64 1;  1ZSZ C;  1S72 A;  3M58 A;  5HKC A;  4B9W A;  4C8Q A;  1AT1 B;  3JB9 D;  3A1P A;  5GJW B;  4J9F A;  4C92 C;  4PJO A;  2GQI A;  4AMC A;  2ZPI B;  3OA6 A;  4UC4 A;  2HQE A;  3VS7 A;  3MKD A;  2KNB B;  4KGX B;  3FIF A;  5GAM e;  3CCJ Q;  2W0Z A;  1N8R C;  4C8Q B;  5IXB A;  1AWW A;  3GF5 A;  4PJO D;  1ZSZ A;  3PVL A;  2RJF A;  2LVM A;  3OW2 P;  4EIK A;  3RER A;  2KSS A;  4FW2 A;  1D3B B;  2X4J A;  3UDC A;  2MIO A;  1M1G A;  2G3R A;  1NEB A;  1VQL A;  1I1J A;  3I55 Q;  2DE0 X;  4RG2 A;  3GNF B;  4C8Q G;  1TXQ A;  1YCS B;  5KYU A;  2E10 A;  3SDZ A;  3VV0 A;  4M7D A;  2OTJ Q;  1NEG A;  1BIA A;  2CSI A;  2YT6 A;  1TS9 A;  5FU6 C;  5CCA A;  3L2U A;  3VKI A;  1B34 A;  2EKO A;  3AHU A;  2LCL A;  1VQ7 A;  2DZ9 A;  2F69 A;  4M7A A;  1WDX A;  1BI2 A;  2X4X A; 
#chains in the Genus database with same CATH homology
 1SEM A;  4JZ3 A;  1PNJ A;  4LN2 A;  3QWY A;  2DLP A;  2A08 A;  4J9I A;  2K6D A;  3NMZ C;  2EKH A;  2FRW A;  2JS2 A;  4RTX A;  1SHG A;  2IIM A;  3LH5 A;  1ZUK A;  2HCK A;  2EGE A;  1QWE A;  2KXC A;  2KXD A;  1QKX A;  2LJ3 A;  2V1Q A;  4AFS C;  3EG3 A;  2JXB A;  3REB B;  2B86 A;  4J9B A;  2EGA A;  2JM8 A;  2DX1 A;  1KIK A;  1GCQ A;  2ECZ A;  1XOV A;  4JZ4 A;  3UF4 A;  4Z8A A;  3VS3 A;  1K0X A;  3I5S A;  2JT4 A;  3I9Q A;  1MV0 B;  1X6B A;  4RTV A;  3U23 A;  2YUN A;  2FRY A;  1WXT A;  3H0H A;  2L2P A;  1PRL C;  2VVK A;  5IHI A;  3PVQ A;  2K9G A;  2ESW A;  2KT1 A;  1GCP A;  4F14 A;  3ULR B;  1H8K A;  2DL4 A;  2EYX A;  2MCN A;  1B3Q A;  2KE9 A;  4CC2 A;  2JW4 A;  1I07 A;  4JPB W;  4AG1 C;  2RQU A;  3C0C A;  1YWO A;  2SRC A;  2G6F X;  1AVZ C;  1K1Z A;  1X2K A;  1M30 A;  2DJQ A;  4HCK A;  1AD5 A;  4JJD A;  3SHW A;  2CUD A;  2EGC A;  3VS5 A;  2D8H A;  2JM9 A;  2PTK A;  2L3P A;  1JXM A;  1TUD A;  2L0A A;  1QKW A;  2D1X A;  1WLP B;  1Z9Z A;  2EQI A;  1MV3 A;  1ZUY A;  1QLY A;  4ORZ A;  2ED1 A;  2EPD A;  3EGU A;  2ROL A;  2YUP A;  1AWO A;  3VS4 A;  1J3T A;  2J6K A;  1S1N A;  1CKB A;  1BK2 A;  4AFU C;  1SRL A;  2J6O A;  1OPK A;  1UE9 A;  2LX7 A;  2CDT A;  2K7A A;  2P4R A;  2DL3 A;  1JQQ A;  1NYF A;  4RTU A;  2M51 A;  1A0N B;  1WX6 A;  1E6H A;  2DBK A;  4E6R A;  2KR3 A;  4F17 A;  1U5S A;  2PNI A;  2RQR A;  3M0Q A;  1YWP A;  1BBZ A;  2YUO A;  1GFC A;  5FWC A;  2X3W D;  3VS0 A;  1AEY A;  3UAT A;  1H92 A;  1UJ0 A;  1FYN A;  2ED0 A;  1UEC A;  5IXF A;  3I35 A;  1T0J A;  1RLP C;  4ESR A;  2AKL A;  2BZ8 A;  1WXU A;  1ZUU A;  4J9D A;  2SEM A;  1MUZ A;  4Z89 A;  1Y0M A;  4OML A;  5I22 A;  1AZE A;  2K2M A;  4AFQ C;  2KRM A;  2F2W A;  1V1C A;  5IHK A;  4X1V A;  1Y57 A;  1AWJ A;  1X69 A;  1H3H A;  4QT7 A;  1UHC A;  2JMC A;  3O5Z A;  4CC3 A;  1UJY A;  2O31 A;  1WXB A;  4JJB A;  2EYW A;  1K76 A;  1WYX A;  1U3O A;  4OMM A;  3M0S A;  4M4Z A;  2CH4 A;  2DMO A;  2FPD A;  3TSW A;  1HJD A;  2K79 A;  4HVV A;  4KRT A;  4RTT A;  2KYM A;  4D8D A;  3GBQ A;  1M3C A;  2A36 A;  3A98 A;  1M3A A;  1PWT A;  1GFD A;  1W70 A;  2NWM A;  1GBR A;  4OMP A;  2LQN A;  2A28 A;  2RNA A;  1PKT A;  3H0I A;  4AG2 C;  1WI7 A;  1PRM C;  4F16 A;  1BU1 A;  1OEB A;  3H41 A;  1UG1 A;  2H8H A;  2DL5 A;  2AK5 A;  4GLM A;  2FPE A;  2E5K A;  5FW9 A;  1QCF A;  2CT3 A;  2BZX A;  3QWX X;  1UUE A;  2GGR A;  1ABO A;  2DNU A;  2O9V A;  4FSS A;  3UA6 A;  2MOX A;  2CH4 W;  2LJ0 A;  2W10 A;  2FPF A;  4OMN A;  2HBW A;  2KBT A;  3VS1 A;  5I11 A;  3PE0 A;  2AZV A;  2DL8 A;  1I0C A;  3EHQ A;  1CSK A;  1ZLM A;  2RPN A;  2O88 A;  3NHN A;  3TVT A;  2HDA A;  2GBQ A;  2L3S A;  1AZG B;  2VKN A;  2X3X D;  2EBP A;  3EHR A;  1W6X A;  3M0R A;  2ENM A;  1ABQ A;  1KFZ A;  2DVJ A;  4RUG A;  1K0S A;  1GCQ C;  1FMK A;  4AFZ C;  4LE9 A;  4Z88 A;  5HCK A;  2RF0 A;  1T3L A;  1M3B A;  1RLQ C;  1VYU A;  1VYT A;  4LUD A;  2YSQ A;  4R0K A;  1UTI A;  4K11 A;  3THK A;  1E6G A;  1T3S A;  3I5R A;  2D8J A;  2LZ6 B;  4JJC A;  2L3Q A;  3R6N A;  1WIE A;  3M0T A;  1BB9 A;  2DA9 A;  3M0P A;  3TSZ A;  1AOJ A;  4J9C A;  2DRK A;  4RTY A;  1NYG A;  4D8K A;  1KJW A;  2YDL A;  2RN8 A;  2J05 A;  1G2B A;  1RI9 A;  2C0T A;  3UA7 A;  4CC7 A;  4IIM A;  1WA7 A;  4OMQ A;  1GBQ A;  2J6F A;  2ROT A;  4ZNX A;  1UHF A;  3RBB B;  1JXO A;  2EW3 A;  2QDL A;  1ZX6 A;  2DL7 A;  2F2X A;  5L23 A;  2CUB A;  3VS6 A;  2HEQ A;  1T0H A;  2O9S A;  4RTZ A;  3VS2 A;  2KRN A;  3IQL A;  4HVU A;  4DEY A;  2CSQ A;  1UFF A;  1KSW A;  2LCS A;  3NGP A;  2LNH B;  1NLP C;  1W1F A;  1TUC A;  3EG0 A;  3SEM A;  1JEG A;  2CT4 A;  1EFN A;  2LMJ A;  1GL5 A;  2KT8 A;  2KYB A;  1K9A A;  1OV3 A;  4Y92 A;  1QWF A;  1HSQ A;  2DM1 A;  2C0O A;  3JV3 A;  1UGV A;  1OPL A;  2BTT A;  1X6G A;  1JU5 C;  1OOT A;  1HD3 A;  2DYB A;  2FO0 A;  1IO6 A;  1UDL A;  1NLO C;  4RTW A;  1K4U S;  2DRM A;  1ZSG A;  3EG2 A;  1CKA A;  1ZBJ A;  1AWX A;  1PHT A;  5ECA A;  3CQT A;  5FWB A;  3FJ5 A;  1Z9Q A;  1PKS A;  3RNJ A;  4LNP A;  2VWF A;  1SPK A;  2AZS A;  1X2Q A;  2AKK A;  1LCK A;  2NUZ A;  2YUQ A;  2EYY A;  2K3B A;  2XMF A;  2HSP A;  1G83 A;  2LQW A;  2BZY A;  4IIO A;  1SSH A;  2GNC A;  2GTJ A;  2RQV A;  4J9E A;  2A37 A;  2KRS A;  1YP5 A;  1YN8 A;  1NG2 A;  3ZL7 C;  1TG0 A;  1SRM A;  1VA7 A;  3M0U A;  2C0I A;  2LJ1 A;  1VYV A;  4J9H A;  2EYZ A;  5GJV B;  1RUW A;  2KGT A;  2DBM A;  1M27 C;  1ARK A;  2PZ1 A;  4LUE A;  1YNZ A;  5GJW B;  4J9F A;  2OJ2 A;  4A63 B;  2F2V A;  2CRE A;  2GQI A;  1NM7 A;  3VS7 A;  2KNB B;  2RMO A;  4HXJ A;  1U06 A;  2W0Z A;  2EVR A;  4HVW A;  2JMA A;  1M8M A;  5IHN A;  2JS0 A;  3H0F A;  4DEX A;  5IXB A;  2D0N A;  1AWW A;  3VRZ A;  2GTO A;  2OAW A;  3PVL A;  1GRI A;  1X27 A;  1N5Z A;  2OI3 A;  4EIK A;  2KEA A;  1SHF A;  1X43 A;  2J06 A;  3KFV A;  2O2O A;  2JTE A;  1WFW A;  2MIO A;  2FEI A;  2RQW A;  1NEB A;  1I1J A;  2J7I A;  2I0N A;  1B07 A;  2DE0 X;  2FG0 A;  4CC4 B;  1E7O A;  3EG1 A;  2DF6 A;  1YCS B;  4OMO A;  1JO8 A;  1NEG A;  5IH2 A;  3NPF A;  4WCI A;  2CSI A;  2YT6 A;  3VRY A;  4J9G A;  2KRO A;  2LP5 A;  4GBQ A;  3REA B;  1WDX A;  5EC7 A;  2RQT A;  2M0Y A;  2DIL A;  2V1R A;  2ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...