1ARKA

Sh3 domain from human nebulin, nmr, 15 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
b'TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEBULIN
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1arkA00
2NUZA 3UA6A 1OEBA 2CH4A 3M0TA 2PZ1A 2EW3A 2VKNA 2EPDA 1AEYA 2DBMA 2DM1A 2FPEA 1K76A 3VS2A 4AG1C 2YUNA 3RNJA 1T0JA 2CUDA 2FRWA 2RF0A 2PTKA 2AK5A 2RQVA 1W1FA 1Y0MA 3GBQA 3M0PA 3EG0A 1TUCA 2VWFA 3R6NA 3ZL7C 2KRSA 3M0SA 2M0YA 3M0QA 1H92A 2H8HA 2JM8A 2D1XA 3KFVA 2ECZA 3PE0A 2JT4A 2KBTA 2OI3A 2DRKA 2CSIA 3VRZA 1E6HA 4RTYA 4Z89A 2BTTA 1SSHA 3EG1A 4AFQC 2E5KA 2CUBA 4OMOA 4LE9A 3EG2A 2FRYA 3H0FA 4OMQA 4OMNA 1W70A 1CKAA 2D8JA 1WA7A 2GQIA 1ZLMA 1RLQC 2ABLA 1QKXA 1NG2A 4J9HA 4D8KA 1ZUYA 4JJDA 3H0HA 5EC7A 2VVKA 1X27A 3NPFA 1KFZA 3VS6A 1TUDA 1I1JA 2A08A 2MCNA 1PKTA 2RQWA 2J6FA 4J9GA 1UTIA 3VS3A 1Z9ZA 3M0UA 1GFCA 4DEXA 1SHGA 2FPDA 2CT4A 1PKSA 2LQWA 2A28A 2CSQA 2J6KA 1NLOC 2V1RA 1U3OA 1KJWA 1ZSGA 2CH4W 4OMMA 1FYNA 1I0CA 2QDLA 1RLPC 1WYXA 2HDAA 1YN8A 2KYBA 1Z9QA 2ESWA 2CDTA 1OPKA 1ZUUA 3PVLA 3PVQA 1SRMA 2AKLA 2O9VA 1YNZA 4E6RA 4JZ4A 3UF4A 2AZVA 5ECAA 2J06A 4RTXA 2KROA 1EFNA 2NWMA 2V1QA 2GBQA 4IIOA 4KRTA 2LX7A 2ED1A 1X2KA 1QLYA 4CC3A 2KYMA 4A63B 1K4US 3SHWA 1JU5C 1T3LA 2O31A 5IHKA 2F2VA 3EHRA 3CQTA 4K11A 2I0NA 1GCQA 4ORZA 2KE9A 2DL8A 3TSZA 2X3WD 1U06A 2KT8A 2KR3A 5I11A 4J9IA 2L3QA 4M4ZA 1M8MA 2LQNA 2YUQA 2JTEA 4CC2A 2JXBA 2LMJA 1RUWA 2DMOA 4RTTA 1ZBJA 3NGPA 4RTZA 3SEMA 1S1NA 2HBWA 2CREA 2YSQA 1T0HA 1N5ZA 1WX6A 1HD3A 3IQLA 4J9CA 2MIOA 2KRMA 1UDLA 1AZGB 1JXOA 4LUEA 2FG0A 1K9AA 2EYZA 1GFDA 2CT3A 4WCIA 1ARKA 2JMAA 2YT6A 3UA7A 1MV3A 1MV0B 3VS4A 1K0SA 3O5ZA 4HVUA 1SPKA 1K1ZA 1UGVA 1ZUKA 2C0OA 4R0KA 4RTWA 4F16A 2W0ZA 1AWOA 2C0IA 2LNHB 2MOXA 4RTVA 1BBZA 2SRCA 1GBRA 2EGEA 2HEQA 2K7AA 1NYFA 4D8DA 5I22A 1GCPA 4OMPA 1PHTA 1UJ0A 2K3BA 5FWCA 1AOJA 4HCKA 2O88A 1G2BA 1GRIA 2L3PA 1OOTA 2K9GA 1QWEA 4X1VA 1H3HA 2G6FX 5IHNA 2YDLA 4IIMA 4J9DA 1PRLC 2GTOA 2RQRA 1PWTA 2J7IA 3QWXX 1MUZA 2D0NA 5IXFA 3H0IA 2AKKA 3JV3A 2GNCA 2ROTA 3QWYA 1X43A 3I35A 4RUGA 4JJCA 4AFSC 2DE0X 2O2OA 1VYVA 2LJ3A 2DLPA 4CC4B 1NEBA 2JS2A 1BU1A 2C0TA 1X2QA 1JQQA 2EYXA 3EHQA 2M51A 1NYGA 1QWFA 2A36A 1XOVA 1U5SA 1SEMA 4LN2A 1ABQA 3THKA 1M3BA 4QT7A 2YUOA 2RQUA 2AZSA 1B07A 1BB9A 1UG1A 2L2PA 2P4RA 2RQTA 2X3XD 2OJ2A 3I5RA 3VRYA 1NEGA 2ENMA 1WDXA 2HCKA 3H41A 2DX1A 1G83A 2KEAA 1QCFA 4GBQA 1AVZC 1UE9A 1WXTA 1WIEA 3NHNA 4AFZC 1NLPC 3EGUA 4EIKA 1X6GA 2RPNA 1CSKA 2LZ6B 2B86A 1K0XA 4F17A 2DF6A 2KGTA 2DYBA 1E6GA 1KSWA 1UECA 2JM9A 1GCQC 3C0CA 2LP5A 4Z88A 1WFWA 2DL7A 2KXDA 2EQIA 2IIMA 2A37A 1PRMC 5GJVB 1E7OA 1GL5A 2ED0A 1OV3A 4J9EA 1ABOA 1V1CA 1B3QA 2DNUA 1SHFA 2F2WA 4JJBA 2BZYA 1TG0A 1CKBA 2JMCA 2RNAA 2L3SA 1UHFA 2O9SA 4RTUA 1I07A 2GTJA 1HJDA 1Y57A 3VS0A 3ULRB 2KNBB 4ESRA 1IO6A 1YWPA 4DEYA 1VYUA 2EKHA 4LNPA 1X6BA 4J9BA 2JS0A 1M30A 5FWBA 2SEMA 1JO8A 1AWWA 2K2MA 2RN8A 3U23A 2J05A 1T3SA 1WXBA 4J9FA 2DA9A 2XMFA 3FJ5A 4HXJA 3VS7A 2FEIA 1HSQA 2FO0A 2DL4A 2DL5A 2EGCA 1VA7A 1UJYA 1AWJA 1M3AA 2DRMA 4LUDA 1WLPB 2J6OA 2LJ1A 4Z8AA 2KXCA 2YUPA 3TSWA 1FMKA 2GGRA 5HCKA 1QKWA 4CC7A 2KT1A 1X69A 4GLMA 3LH5A 1LCKA 2L0AA 4JPBW 2LCSA 2EVRA 3A98A 1ZX6A 2ROLA 1UFFA 1OPLA 1JXMA 2FPFA 1W6XA 1YP5A 4JZ3A 2F2XA 3NMZC 5IHIA 2KRNA 3EG3A 2DBKA 4Y92A 5L23A 4AG2C 1VYTA 1J3TA 4OMLA 1M27C 1M3CA 2K6DA 1AD5A 5FW9A 2PNIA 4AFUC 1GBQA 5GJWB 5IH2A 1AZEA 1H8KA 2K79A 2OAWA 2EYYA 3VS1A 2JW4A 1RI9A 3I9QA 2DJQA 2D8HA 3UATA 4F14A 4HVVA 4FSSA 1NM7A 3REAB 2EYWA 3I5SA 3TVTA 1AWXA 3VS5A 2BZXA 1PNJA 1WXUA 3M0RA 1UHCA 1WI7A 2EBPA 2RMOA 2DL3A 1JEGA 2HSPA 2W10A 2DVJA 2EGAA 1YWOA 4ZNXA 5IXBA 3RBBB 4HVWA 1A0NB 1SRLA 2LJ0A 1BK2A 3REBB 2BZ8A 1KIKA 2DILA 1YCSB 1UUEA
chains in the Genus database with same CATH superfamily
2NUPB 3S3MA 4A4HA 2CH4A 2RJEA 2FPEA 2FRWA 2O4XA 3S6WA 2RD1A 2RQVA 1W1FA 3JRZA 4QQGA 2EJFA 3M0PA 2KRSA 1H92A 4E7JA 2E41A 1K8AU 1ZSZC 3CCSQ 4XTVA 2ECZA 1VQLA 4X9DA 3GPLA 2JT4A 2P0QA 3OS2A 3EG1A 1K73C 1VQPA 2E5KA 4XK8E 5J3BA 2M02A 4QKUA 3QYHB 2QQRA 2GQVA 2KI7A 2GFAA 4UC4A 5LJ5j 1VIEA 3TU4K 4RKUE 4A4KA 1RLQC 4BDYA 2ABLA 5CQXA 4D8KA 2HQEA 5A2QE 1UGQB 4XTYA 3VS6A 1KFZA 2MCNA 4DEXA 3Q1JA 4FYXB 1XJWB 3P8HA 4F04B 3JB9D 2CP5A 2K4YA 1D1CA 4C92D 1PKSA 1LPLA 1Q86C 3CCMQ 2A28A 2CSQA 3PMTA 1PSEA 4C8QD 1U3OA 3RKWA 2XD0A 2CH4W 2QASA 3OYAA 3JB9H 1I0CA 1M5Q1 1WYXA 3OYCA 2RO0A 2HDAA 1QP3A 1VQPT 5LJ5e 4JUVA 2LVMA 1YNZA 4E6RA 5ECAA 2J06A 1ZBXA 2X4WA 2L5QA 1EFNA 1JBMA 3UT1A 3QJYA 3OW2P 2FHDA 1QLYA 4PLLA 1K4US 3LWIA 4MMLA 3SB2A 2M1HA 1VQ6Q 3EHRA 3CQTA 1G3YA 1WHLA 3GNGA 1W2BS 3TSZA 3D7SB 2X3WD 2KR3A 3X26B 4M4ZA 3GLXA 2YUQA 4CC2A 2KQWA 2JXBA 1F1BB 3OS1A 2LMJA 1IB8A 4RTTA 4PFZA 3NGPA 5CKEA 3HFOA 4E7HA 4XU1A 1N5ZA 2I2LA 4DBFA 4J9CA 4C0ZA 3CCUQ 5CR2A 1VQ9T 1AZGB 1JXOA 1M90R 4LUEA 4AMCA 5CK9A 1LNXA 4NL2A 3HKSA 3QDFA 2GF7A 3QDRB 3QZ5B 2YWWA 3JCMb 1QVFA 3G4ST 1MV3A 3CCVT 1K0SA 1UGVA 1ZUKA 4J7IA 3CPWP 4ELZC 4M7AE 5FRMA 2R5MA 2LNHB 1QVGS 4M75G 2SRCA 1GBRA 5DY9A 1Y71A 2GCXA 2K3BA 1LOJA 4R56A 4OB1B 1G2BA 3CC4A 3PIPA 2RJDA 1H3HA 2RJFA 5IHNA 3M59A 3C94A 1ZA2B 2FZKB 2LCCA 1PRLC 1Y96B 1Q82R 2FVUA 2J7IA 2L8DA 4LDYA 5IXFA 2K3XA 2BE7D 3JCMc 2QQBA 2E10A 4P5NA 2ROTA 5GAOl 1X43A 3I35A 2LQKA 4ZGEB 1VQMA 3EGDB 2A7YA 1VQOA 4AFSC 1UGRB 2DE0X 1JJ2S 1K8AC 4L5GA 2LJ3A 4DOVA 4RCCA 1WJSA 2LX9A 3VUBA 4EPCA 4JLIA 5CKFA 3DB4A 1U1SA 3PFSA 1S72Q 3EHQA 2M51A 4PK4A 4M78F 1NYGA 1QWFA 3L2RA 4LN2A 1SEMA 2ZPIB 3CC4T 1NBEB 1M1FA 1YITA 1Y07A 4PJOB 3THKA 1M3BA 4QT7A 4KUIA 2QK0A 1UG1A 2X3XD 2OJ2A 2RH2A 3I5RA 2FZCB 1NEGA 2R58A 2DK3A 3MP8A 2HCKA 4O5VA 3JCMW 4FCYA 1WGSA 2DIQA 4GBQA 4CRIA 2DTOA 5KYWB 2A3LA 1UE9A 1WXTA 1BCOA 5A0DA 1YHQQ 3NHNA 4AFZC 3MKDA 1WPYA 2MPXC 2OTJA 1M8VA 1QVPA 4J8OA 5KYYB 2B86A 1K0XA 4F17A 2DF6A 1UECA 3MEUA 2DKGA 3TREA 4M75D 1YJWA 2LP5A 4Z88A 1VQ7Q 2KXDA 2PUOB 4B9XA 2IIMA 4C92F 1YITT 1TUGB 4FW2A 4C8QF 3DLLA 1G8XA 1MMAA 4BE1A 2QEXA 1Q82U 1SHFA 2F2WA 1TG0A 2RNAA 1UHFA 1KQSP 2E70A 4LDVA 1BI2A 2WSEE 3E9FA 2YRCA 4BE0A 2RI2A 5CKHA 1WHGA 2LC4A 1K73R 2KDSA 4LDXA 3BDLA 3ULRB 4ESRA 3JB9I 1VYUA 4LNPA 1K9MC 4J9BA 2JS0A 3PGGA 3V8LA 1AWWA 2RN8A 2E3IA 3RKYA 4J9FA 2DA9A 1I81A 4M78C 3BW1A 3F70A 2DL5A 5LJ3f 4V2SA 3PT9A 1UJYA 2HMAA 5GAMh 2D9TA 2DRMA 1VQ8Q 2LDMA 1D1AA 1Q86R 1BIBA 1YIJT 5HK3A 4QQDA 5FU6B 2YUPA 2QEXT 4PJOG 2OTLQ 2XKOC 2DD5A 3HPWA 2E64A 3A98A 1MNEA 1KD1U 1UFFA 2HKQB 4N0AC 5AYFA 1H641 1WJRA 5IHIA 2QQ9A 4Y92A 1U8RA 1N9RA 4AG2C 4OMLA 3CCET 4XAXB 5FW9A 3CMEA 4IUVA 5GMKh 3CD6T 2DXUA 3KXTA 2JW4A 1RI9A 3L2ZA 2ZPEB 4PJLA 1I8FA 5LL6S 3M55A 4C92C 1RADB 1AHJB 4FSSA 4C8QC 4C5EA 1R0BG 3OW2S 3CCSA 1RAFB 3CC2A 4QVZA 3NTIA 1WXUA 4II1A 3SWNA 1UHCA 1WI7A 2RHZA 1JEGA 1N8RR 2QTVA 4M7DG 1YI2T 4XTUA 4JRPA 4PFPA 5GAOr 2LJ0A 3OYMA 1VQ4Q 2VUBA 1YCYA 3M58A 1KIKA 2Y4YA 4M77A 3G6EA 1YJ9A 2JUFA 5CAIA 1QVGA 2X4XA 4RMOA 1KHIA 1OEBA 3M0TA 2DVEA 5GAMg 5KYXA 2X35A 1AEYA 3VS2A 3OYDA 2MYSA 1OYXA 3CCMA 3QBYA 1C1AA 3CCJQ 1H3ZA 4HCBA 4ZGDB 4HKEA 3MEVA 2AK5A 5KH6A 3L42A 1Y0MA 2CGHA 2M0YA 3M0QA 3UDCA 3A1PA 1R8OB 2NUTA 3FDRA 2CSIA 4PJOD 2BTTA 3QPHA 5KE2A 1SSHA 4M78A 4PKCC 3CPWS 4KH0B 4OMOA 1PSFA 1JRIA 2FZGB 4M7AB 1IGQA 2QQSA 3OYFA 3OB9A 1CKAA 5GMKl 3MCAB 3JCMh 5DLOA 4OGEA 3VYHB 1BI1A 3H0HA 4JDSA 1YBYA 1Q82C 1UB4A 1X27A 2O4XB 5GAOp 1K8AR 4C0DB 2A08A 2Y90A 1UTIA 2XIDA 2YHTA 1GFCA 2NYSA 4Q5WA 4A4EA 4MDWA 3CCMT 3M57A 2J6KA 1NE8A 1OX9A 4FYYB 3I55Q 2E6ZA 3LYIA 3EH2A 4EMKA 2F5TX 2QDLA 1N8RU 2MK5A 3CMAT 1Z9QA 1RL2A 3OA6A 1OPKA 4IUUA 3V8JA 4M7DD 1ZUUA 3PVQA 2AKLA 4QVDA 5GAMj 1OZ3A 4N4GA 2RHXA 4MZMA 4RTXA 4FW1A 2KROA 1SKUB 2EJ9A 4KRTA 5GAOq 5LJ3d 4A4GA 3RIRA 1IZ6A 2KYMA 3RESA 3SHWA 1VQ6T 1MNDA 5GAOm 2F2VA 2HNIA 4K11A 1GCQA 1D3BA 2KE9A 1KD1C 2KT8A 4LXCA 2VV5A 4J9IA 2L3QA 4MZTA 2EQMA 2LQNA 3TEEA 1C0MA 1N27A 5HK0A 2VGMA 3OQ5A 5CCAA 2DMOA 1HYOA 3VKIA 3QSUA 2XU8A 5GMKj 3FLGA 3CCUT 5D6XA 1WX6A 5GAMe 1HD3A 2HSEB 3IQLA 1KK7A 2E1HA 3LGLA 4E7KA 3JCMg 4PJJA 4D6WA 2R57A 2FG0A 1Q7YC 1K9AA 1I5OB 2EYZA 3QYGB 3L2QA 2ZPFB 4E2FB 4BI4A 4M7AG 4DBQA 3UA7A 3EGXA 1K9MR 1B34B 2KY9A 3O5ZA 4M77E 1SPKA 4XTZA 4BE2A 1IXDA 4F16A 4RTWA 5M9OA 2W0ZA 2C0IA 4FSXA 4RTVA 2RK1A 2F5KA 4F7UA 4Y28E 2K7AA 3I56Q 4M75C 1NYFA 3H9NA 4OMPA 2DEQA 1AOJA 2O88A 3EG9B 3ZBDA 5GMKe 2PVOB 1NJIC 5GAMf 1OOTA 2CZ6B 1D0YA 3L2WA 2ZAEA 2ZPBB 3M4YA 4M75B 4IIMA 3OYGA 2RQRA 1ZA1B 1LJOA 1NPPA 3QWXX 2DEUA 4BI8B 2BE9B 3G71Q 1MMNA 1R0CB 4E47A 3E19A 4PNOA 2GNCA 5LJ3h 1N6AA 4RUGA 5CIUA 3CEYA 4M78E 3CCQQ 2CZ1B 4HCZA 1QCOA 2DLPA 4EDUA 1M2OA 3OW2A 2JS2A 2C0TA 1S72T 1TS9A 3MP6A 3CMAQ 3M54A 2WSFE 1VQ9A 3OMCA 1JQQA 1WZOA 2F69A 2E5QA 3JCMJ 3OYJA 3H8ZA 1MHNA 2A36A 2AIRB 1TH7A 1ABQA 4BUGA 3CPFA 3JCMX 2RHUA 1WHKA 2RQUA 4HA8A 1KQ2A 2P4RA 3G4SA 3CCVA 1AT1B 1HK9A 2VASA 5GAN8 3QO3A 4TVRA 1WDXA 3H41A 4PJOF 2RK2A 4BY6B 2KEAA 2XI9A 2AHJB 1YHQT 2O01E 1XTDA 1FWZA 1NLPC 2LCLA 2RJCA 4C5HA 1K9MU 1BIAA 4M7AD 1X6GA 1N8RC 4C8QE 2HZYA 5KYNA 4A54A 3RKXA 1ZHIA 3JCMe 1VQ7T 3ME9A 4C0GA 3CC7Q 1LVKA 2DL7A 4KGXB 1P92A 2PVDB 4DBRA 2A37A 2QGGA 3CPWA 1RABB 2FB7A 2YRVA 2ED0A 1ZSZA 1ABOA 5I2SA 2OTLA 1V1CA 3MEWA 5LJ3g 3OS0A 3KBGA 1CKBA 5KYUA 3L2VA 2L3SA 4RTUA 1VQKT 5HKCA 3EAEA 2E3HA 4C0FA 2KNBB 4PJNA 3E9GA 3CCRQ 1BYMA 3ZEHA 3JCMf 4OP0A 4N4IA 2DERA 2E65A 1JO8A 3U23A 2Z0WA 1TXQA 2JZ2A 3QJ6A 1IGUA 1HSQA 3CCLQ 2FO0A 2EGCA 3HTRA 1VQ8T 1M3AA 2DJZA 1WLPB 4Z8AA 2LJ1A 4F7UE 1VIFA 2OTLT 2DTHA 2GGRA 5HCKA 2RA2A 4GLMA 4LDWA 4PJOC 1M2VA 1LCKA 3J80E 2EVRA 3A8HB 1KHCA 1IHWA 3OYEA 1OPLA 3CBMA 3ZFJA 9ATCB 2QYZA 5KCHA 4XQ3A 1YP5A 4JZ3A 4X9CA 2XK0A 4XU2A 3LWHA 3LX7A 3EG3A 3HRSA 4ME7A 3O8VA 3LLRA 1J3TA 5GAMd 2K6DA 1VQLQ 1AD5A 4AFUC 1GBQA 2JTMA 5GJWB 1AZEA 2K79A 5LJ3j 1WHHA 4OMFB 5GMKm 1YJNT 3VS1A 1O9SA 3I9QA 4F14A 4HVVA 1NM7A 2WSCE 3REAB 1KD1R 5IT9E 1G3TA 3X28B 3VS5A 2EQJA 1RAAB 8AT1B 2EBPA 2BKDN 2DETA 2HSPA 2DVJA 1YWOA 2D0QB 4ATOA 4M7DC 4HVWA 1OI1A 2G3RA 1VQ4T 2BZ8A 2DZ9A 2R5AA 3JSCA 3JB9F 1Q7YR 3OYYA 3UWNA 1SSFA 1KQSA 4MDXA 1YIJA 4M7DB 5LJ3e 3OY9A 5A0GA 1RAGB 4IKFA 4Y91A 3V7RA 2EW3A 2QAZA 2EPDA 4A53A 3CCJT 1VQKQ 2EKOA 2RF0A 2PTKA 4PL6A 3RMSA 3SWNB 3VJPA 2EJGA 3EG0A 2NLUA 3NTKA 2VWFA 3R6NA 2EQKA 3M0SA 5J39A 2JM8A 1NJIR 2D1XA 3EGDA 2PQWA 3PE0A 3PNWC 2VGNA 3VRZA 3CCEA 1E6HA 4RTYA 4L6V5 4Z89A 3HFNA 1VQNQ 2EFIA 2DTIA 2FL7A 4MZPA 3CD6A 4AFQC 4M77B 5FU6C 2COWA 4LE9A 3OS5A 3H0FA 2ZZDA 4OMNA 5HY6A 1W70A 3SFMA 3BFMA 1ZLMA 4PFOA 1M1KR 3GIBA 3M56A 4BACA 2DAQA 3SD4A 2LT4A 1NG2A 2XG8D 4J9HA 3QG1A 5EC7A 5CKDA 2H3EB 3A8MB 2XICA 2EYQA 1TUDA 1I1JA 4FL6A 1FMVA 4QQ6A 4J9GA 1YI2A 1SHGA 1JB0E 4DA4A 3I55T 1NLOC 2V1RA 5AT1B 1KJWA 5GANf 1FYNA 2HL3A 2QG9B 5GAN5 3E1SA 3EFOA 1YN8A 3JCMd 2ESWA 2CDTA 2CP3A 5IN1A 2MF2A 4JLGA 5KYYA 2O9VA 2JVVA 4JZ4A 3UF4A 1YJNQ 2AZVA 1Q7YU 2JJ9A 5FLXE 2NWMA 2V1QA 3DKMA 4IIOA 1RAEB 4E7LA 3JCMQ 2CP0A 2ED1A 1UGSB 1BI0A 4A63B 1JU5C 2M9UA 3HRUA 3PIOA 5CO7A 2O31A 3X20B 5IHKA 2CZ0B 1W2BP 2I0NA 4KT0E 2BIVA 4ORZA 4EMKB 4OGCA 4J6YA 1PG5B 1VQMQ 1I5LA 2QGFB 1Q95G 1NJIU 1VQOQ 1RUWA 1ZBJA 4XU3A 3SDZA 3SEMA 1S1NA 1OQKA 1T0HA 2RHIA 4RG2A 4YTLA 2JOYA 2MIOA 1Q81R 2C06A 4ZTFA 3P8BB 3MPUB 3T9NA 5GAN2 1GFDA 3CCQA 1M1KU 4ELYC 4M77G 4FYWB 4MMKA 1XQHA 2HAXA 2CT3A 4BD3A 1ARKA 3FRNA 1OULA 4M7AC 1D0ZA 3QHSA 1WHJA 2CP6A 1D3BB 2XDPA 4HVUA 3BE3A 4E7SA 2CP7A 1K1ZA 2C0OA 3BY7A 4R0KA 1AWOA 3CMAA 2MOXA 2HBPA 3I56T 1BBZA 2CZ7B 4VUBA 2HEQA 5I22A 1GCPA 1PHTA 3CBPA 4XTWA 4C0DC 3NTHA 3X25B 3OYIA 1QWEA 2VB6A 4X1VA 4ZTJA 2OTJQ 2G6FX 1PM3A 2YDLA 3C12A 4HT8A 5GAN4 1VQ6A 3FB9A 2GTOA 1PWTA 3G71T 2Y4XA 4M78G 2D0NA 3QKJA 3H0IA 2AKKA 3JV3A 1YJWQ 3QWYA 4N0AA 3CCQT 3WXMB 4JJCA 4M75F 2E12A 1JJ2P 1IREB 3M9QA 2DXBA 2O2OA 2HL5C 1VYVA 4F7UB 4R55A 2RM4A 4JS5A 3CCUA 2KK4A 2A0FB 1NEBA 4KGZB 2X9HA 3A5ZB 2HQHA 1X2QA 1V29B 4C92A 1M1GA 2EYXA 4JRIA 3DLMA 3A8LB 1WJQA 4C8QA 2V8KA 3TCJA 2VXEA 2AZSA 1B07A 1BB9A 2CKKA 2L2PA 2RQTA 4C5IA 3QXEB 1VQ5Q 1SF9A 3VRYA 1Q81U 1MGQA 2MMPA 2DX1A 2KMTA 1G83A 1QCFA 4WTOB 2FYKA 4HCCA 1AVZC 4J7FA 2LQ8A 4M77D 2HKNA 4EIKA 3CXCP 2P4TA 4QVCA 2RPNA 3MO8A 1OU8A 1WQ7A 2XHCA 4DOWA 1SG5A 5GANd 3GOXA 1KSWA 3CC7T 2QI2A 2V8IA 3C0CA 2EQIA 1PRMC 1QCNA 1PD1A 4KULA 1GL5A 1OV3A 1B3QA 2DFUA 2RI3A 3CMEQ 3MEAA 2JMCA 1I4K1 3C95A 2LRQA 3L1AA 4M78D 5FU7C 2MWOA 1S72A 1KQSS 3S3OA 3CCRT 1IO6A 1BCMA 4DEYA 4LD6A 1X6BA 3RR6A 2K2VA 2XDBA 1M9SA 3ER0A 4FU6A 5FU7B 3CC2Q 2K2MA 2J05A 1T3SA 1DJ7B 2IVWA 2DXTA 1G3SA 3CCLT 1VUBA 1NPRA 4F7UG 3VS7A 2DL4A 1ZSZB 1M1KC 1VA7A 5CVIA 3OYNA 1AWJA 1YHQA 3V7CA 2RI5A 1YJ9Q 4BI3A 3G6EQ 4ZGJB 5KYUB 1TWBA 4FYVB 2CP2A 3TSWA 2LT1A 4KBMB 2VC8A 1QKWA 2KT1A 1X69A 2MI6A 3LH5A 4NL3A 2L0AA 2LCSA 1VQ7A 1W6XA 1ACMB 4J6WA 3AT1B 3X24B 2PUKB 4J5YA 5GANh 4BY6C 4FM4B 2RHYA 1VQLT 4N4HA 5L23A 1HXDA 2COZA 1H8KA 1EX4A 2OAWA 2EYYA 4E7ZA 1VQKA 2NUPA 3OSVA 3JCMV 2DJQA 3UATA 4O6JA 3I5SA 2QA4Q 4C92E 3QUIA 1M2VB 4KUDK 3TVTA 1AWXA 2P0KA 2RMOA 3QIIA 4DQ2A 2PU9B 1VQNA 4FIBA 5IXBA 1B34A 1U1TA 2E6NA 3RBBB 4EMGA 1FMWA 1A0NB 2V8JA 1SRLA 2P84A 3P8DA 3PTAA 1BK2A 1KQ1A 1VQ8A 2DILA 1UUEA 4XU0A 2CYZB 5LJ5f 2V26A 3EG9A 4RCBA 2NUZA 3UA6A 4GLKA 1KC8R 5FRNA 1Q81C 2PZ1A 1RI0A 2VKNA 2DBMA 2DM1A 1K76A 1X6OA 4AG1C 2YUNA 4M75A 2D6FA 4KGVB 3RNJA 1T0JA 2CUDA 4M7DF 2VXFA 4J83A 1FXXA 2H3JA 1M4ZA 3GBQA 2KAFA 1TSFA 3TQ7P 1TUCA 3ZL7C 4BB7A 4FT4A 2H8HA 8ATCB 3KFVA 3JAME 2KBTA 2OI3A 1VQNT 2QDYB 1X01A 2DRKA 1Y7XA 3INZA 5GAN3 3V8KA 2CUBA 1QVFP 3MP1A 5C6SA 1YJNA 2HD0A 3EG2A 5GANg 2FRYA 3MJXA 4OB2B 3VU3C 4OMQA 3OMGA 3AHUA 4WF2A 4JRQA 2D8JA 3META 1WA7A 2GQIA 1D0XA 2DZCA 3HRTA 4M77F 1QKXA 1ZUYA 4JJDA 1MMGA 2JNGA 2VVKA 3NPFA 3J81E 1PKTA 2ZPHB 2RQWA 5A0LA 3JCMP 2J6FA 3VS3A 1Z9ZA 3M0UA 2FPDA 2CT4A 1VQ4A 2LQWA 4PLIA 5I2MA 4PJMA 3H6ZA 2EIFA 1GXIE 1ZSGA 1PCXA 3V7SA 4OMMA 2K5FA 4CI0C 1D1BA 2M16A 1RLPC 3WVEB 2ZPGB 2KYBA 3DB3A 5KCOA 3S3NA 1TOVA 3PVLA 1SRMA 1N9SA 1VQPQ 2YRDA 3CCJA 5EG2A 7AT1B 3EH1A 1ZQ1A 2GBQA 4IUTA 3EFRA 5DM7R 2LX7A 1WHMA 1IHVA 1X2KA 2DD4A 4CC3A 1KC8U 4JS4A 1T3LA 4L59A 1D09B 3OYHA 1M90U 3PMIA 1TU0B 2DL8A 1U06A 1VQMT 5I11A 3GP8A 4ZN1A 5GANj 1M8MA 1YFNA 1VQOT 5DLQE 2JTEA 3EFOB 1PD0A 1XNIA 4BDZA 3VYGA 3CXCS 4RTZA 2HBWA 2CREA 2YSQA 2OX7A 3SWNC 2XDDA 2X4YA 1G3WA 3ASKA 4ANJA 2KRMA 1UDLA 3VUZA 1VQ9Q 1Y96A 2K5IA 5C0MA 4JRKA 1O75A 3I55A 4M77C 1MMDA 4WCIA 2JMAA 2YT6A 1MV0B 3WVDB 3VS4A 3OBYA 3G4SQ 2DXCA 3CCVQ 2BUDA 5D6WA 3G7ZA 2HQXA 1R77A 5GANe 3R6OA 4RG8A 2EGEA 3C4SA 4D8DA 3UPUA 2VYTA 1UJ0A 5FWCA 2EWNA 4HCKA 5D7UA 4Z02A 1GRIA 2L3PA 2EQUA 4M75E 2OTJT 2K9GA 3BDUA 1VQ5A 6AT1B 5KYXB 3A8OB 4M7AF 4PJOA 4J9DA 5LJ5d 2GFUA 1WQWA 2KVQG 4OB3B 3GF5A 3URGA 1MUZA 2JTFA 1YJWT 2YXYA 2KSSA 2IG0A 1IRXA 4OF1A 5I21A 2NUTB 1X75C 5D6YA 4OVAA 2QQAA 5KYWA 4M78B 4CC4B 1UGPB 5GAOn 1BU1A 3MHXA 3KUFA 5GAN7 3FEOA 2DIGA 3OBWA 4F7UF 3OSSC 4JJNK 1XOVA 1U5SA 2L89A 3HP9A 4AT1B 1W2BA 3CC4Q 2YUOA 4QW2A 1VQ5T 4OB0B 2QTXA 1RACB 4KH1B 5FROA 1QW1A 4EMKC 2YLCA 2CS7A 3HL8A 3OYLA 3FJPA 3NFCA 2WACA 2ENMA 3LGFA 4M7DA 4B6MA 3RERA 1RAHB 2RB6A 1KG1A 3I56A 1WIEA 2K57A 2ZGWA 2YLBA 4C5GA 3EGUA 4J6XA 1NZ9A 1BI3A 1CSKA 2LZ6B 3LW5E 4C92B 3JB9J 1RAIB 2KGTA 2DYBA 5CQYA 3RMQA 1E6GA 1G5VA 2LNVA 3G71A 2JM9A 4C8QB 5CKBA 1K73U 1GCQC 1QMCA 3OYKA 4LD9K 2COYA 1WFWA 3HSBA 2K5LA 4X34A 4LDUA 2EAYA 5GJVB 1E7OA 4IURA 1FX7A 3M53A 5LJ5h 1YITQ 2F1LA 2OAUA 4J9EA 1KC8C 1EIFA 3M5AA 3FIFA 3CMET 3J7AF 2LTOA 2DNUA 3M4GA 4JJBA 2BZYA 3CBOA 1M90C 5GAN6 1QVGP 2O9SA 1I07A 2GTJA 1OU9A 4IUQA 1HJDA 1Y57A 3VS0A 3L2UA 2ATCB 1Q86U 1YWPA 2X51A 2EKHA 4NS5A 4FT2A 3CCST 4DBHA 1M30A 2QXFA 3CC2T 1UEBA 5FWBA 2SEMA 1EZZB 4XTXA 3G1JA 2X4JA 1PC0A 1WXBA 2XMFA 3FJ5A 1JJ2A 1OZ2A 4HXJA 2DPPB 2FEIA 1QVFS 3EGXB 1YJ9T 3G6ET 2QA4A 4LUDA 2J6OA 3QZ9B 3VV0A 2KXCA 1V76A 2MAMA 1YIJQ 2MWPA 1WNLA 1FMKA 4CC7A 1C6VX 2PVGB 2QEXQ 4E7IA 4JPBW 1QP2A 4NOYA 5IAYA 4ZN3A 3CC7A 3HHTB 1ZX6A 4IUPA 2K3YA 5L8RE 2ROLA 4PJOE 1JXMA 2FPFA 5GMKi 2P0PA 5J26A 2F2XA 3NMZC 2KRNA 4HT9A 2DBKA 3EFSA 1B7TA 1VYTA 1BKBA 1M27C 1M3CA 2PNIA 5IH2A 1VOMA 1QQJA 3N5BB 3OYBA 3E2UA 3CCEQ 2B8AA 4B9WA 3GNFB 3CD6Q 3JB9G 5LJ5g 3CXCA 4C92G 2M0OA 2D8HA 3RDVA 5KE3A 3CCRA 4C8QG 3RUXA 3A8GB 2QA4T 2EYWA 2L3RA 4GY5A 2JN0A 2BZXA 1PNJA 3M0RA 3FC3A 2DYIA 2DL3A 1OX8A 2W10A 2EGAA 4ZNXA 1TTHB 3CCLA 1YI2Q 2DO3A 4EMHA 3REBB 1W4SA 4M7DE 1YCSB 2IPOB 4M7AA 2AT1B 2ZCFB 2E4HA 4A4FA 3LH0A
chains in the Genus database with same CATH topology
2NUZA 3UA6A 1OEBA 2CH4A 3M0TA 2PZ1A 2EW3A 2VKNA 2EPDA 1AEYA 2DBMA 2DM1A 2FPEA 1K76A 3VS2A 4AG1C 2YUNA 3RNJA 1T0JA 2CUDA 2FRWA 2RF0A 2PTKA 2AK5A 2RQVA 1W1FA 1Y0MA 3GBQA 3M0PA 3EG0A 1TUCA 2VWFA 3R6NA 3ZL7C 2KRSA 3M0SA 2M0YA 3M0QA 1H92A 2H8HA 2JM8A 2D1XA 3KFVA 2ECZA 3PE0A 2JT4A 2KBTA 2OI3A 2DRKA 2CSIA 3VRZA 1E6HA 4RTYA 4Z89A 2BTTA 1SSHA 3EG1A 4AFQC 2E5KA 2CUBA 4OMOA 4LE9A 3EG2A 2FRYA 3H0FA 4OMQA 4OMNA 1W70A 1CKAA 2D8JA 1WA7A 2GQIA 1ZLMA 1RLQC 2ABLA 1QKXA 1NG2A 4J9HA 4D8KA 1ZUYA 4JJDA 3H0HA 5EC7A 2VVKA 1X27A 3NPFA 1KFZA 3VS6A 1TUDA 1I1JA 2A08A 2MCNA 1PKTA 2RQWA 2J6FA 4J9GA 1UTIA 3VS3A 1Z9ZA 3M0UA 1GFCA 4DEXA 1SHGA 2FPDA 2CT4A 1PKSA 2LQWA 2A28A 2CSQA 2J6KA 1NLOC 2V1RA 1U3OA 1KJWA 1ZSGA 2CH4W 4OMMA 1FYNA 1I0CA 2QDLA 1RLPC 1WYXA 2HDAA 1YN8A 2KYBA 1Z9QA 2ESWA 2CDTA 1OPKA 1ZUUA 3PVLA 3PVQA 1SRMA 2AKLA 2O9VA 1YNZA 4E6RA 4JZ4A 3UF4A 2AZVA 5ECAA 2J06A 4RTXA 2KROA 1EFNA 2NWMA 2V1QA 2GBQA 4IIOA 4KRTA 2LX7A 2ED1A 1X2KA 1QLYA 4CC3A 2KYMA 4A63B 1K4US 3SHWA 1JU5C 1T3LA 2O31A 5IHKA 2F2VA 3EHRA 3CQTA 4K11A 2I0NA 1GCQA 4ORZA 2KE9A 2DL8A 3TSZA 2X3WD 1U06A 2KT8A 2KR3A 5I11A 4J9IA 2L3QA 4M4ZA 1M8MA 2LQNA 2YUQA 2JTEA 4CC2A 2JXBA 2LMJA 1RUWA 2DMOA 4RTTA 1ZBJA 3NGPA 4RTZA 3SEMA 1S1NA 2HBWA 2CREA 2YSQA 1T0HA 1N5ZA 1WX6A 1HD3A 3IQLA 4J9CA 2MIOA 2KRMA 1UDLA 1AZGB 1JXOA 4LUEA 2FG0A 1K9AA 2EYZA 1GFDA 2CT3A 4WCIA 1ARKA 2JMAA 2YT6A 3UA7A 1MV3A 1MV0B 3VS4A 1K0SA 3O5ZA 4HVUA 1SPKA 1K1ZA 1UGVA 1ZUKA 2C0OA 4R0KA 4RTWA 4F16A 2W0ZA 1AWOA 2C0IA 2LNHB 2MOXA 4RTVA 1BBZA 2SRCA 1GBRA 2EGEA 2HEQA 2K7AA 1NYFA 4D8DA 5I22A 1GCPA 4OMPA 1PHTA 1UJ0A 2K3BA 5FWCA 1AOJA 4HCKA 2O88A 1G2BA 1GRIA 2L3PA 1OOTA 2K9GA 1QWEA 4X1VA 1H3HA 2G6FX 5IHNA 2YDLA 4IIMA 4J9DA 1PRLC 2GTOA 2RQRA 1PWTA 2J7IA 3QWXX 1MUZA 2D0NA 5IXFA 3H0IA 2AKKA 3JV3A 2GNCA 2ROTA 3QWYA 1X43A 3I35A 4RUGA 4JJCA 4AFSC 2DE0X 2O2OA 1VYVA 2LJ3A 2DLPA 4CC4B 1NEBA 2JS2A 1BU1A 2C0TA 1X2QA 1JQQA 2EYXA 3EHQA 2M51A 1NYGA 1QWFA 2A36A 1XOVA 1U5SA 1SEMA 4LN2A 1ABQA 3THKA 1M3BA 4QT7A 2YUOA 2RQUA 2AZSA 1B07A 1BB9A 1UG1A 2L2PA 2P4RA 2RQTA 2X3XD 2OJ2A 3I5RA 3VRYA 1NEGA 2ENMA 1WDXA 2HCKA 3H41A 2DX1A 1G83A 2KEAA 1QCFA 4GBQA 1AVZC 1UE9A 1WXTA 1WIEA 3NHNA 4AFZC 1NLPC 3EGUA 4EIKA 1X6GA 2RPNA 1CSKA 2LZ6B 2B86A 1K0XA 4F17A 2DF6A 2KGTA 2DYBA 1E6GA 1KSWA 1UECA 2JM9A 1GCQC 3C0CA 2LP5A 4Z88A 1WFWA 2DL7A 2KXDA 2EQIA 2IIMA 2A37A 1PRMC 5GJVB 1E7OA 1GL5A 2ED0A 1OV3A 4J9EA 1ABOA 1V1CA 1B3QA 2DNUA 1SHFA 2F2WA 4JJBA 2BZYA 1TG0A 1CKBA 2JMCA 2RNAA 2L3SA 1UHFA 2O9SA 4RTUA 1I07A 2GTJA 1HJDA 1Y57A 3VS0A 3ULRB 2KNBB 4ESRA 1IO6A 1YWPA 4DEYA 1VYUA 2EKHA 4LNPA 1X6BA 4J9BA 2JS0A 1M30A 5FWBA 2SEMA 1JO8A 1AWWA 2K2MA 2RN8A 3U23A 2J05A 1T3SA 1WXBA 4J9FA 2DA9A 2XMFA 3FJ5A 4HXJA 3VS7A 2FEIA 1HSQA 2FO0A 2DL4A 2DL5A 2EGCA 1VA7A 1UJYA 1AWJA 1M3AA 2DRMA 4LUDA 1WLPB 2J6OA 2LJ1A 4Z8AA 2KXCA 2YUPA 3TSWA 1FMKA 2GGRA 5HCKA 1QKWA 4CC7A 2KT1A 1X69A 4GLMA 3LH5A 1LCKA 2L0AA 4JPBW 2LCSA 2EVRA 3A98A 1ZX6A 2ROLA 1UFFA 1OPLA 1JXMA 2FPFA 1W6XA 1YP5A 4JZ3A 2F2XA 3NMZC 5IHIA 2KRNA 3EG3A 2DBKA 4Y92A 5L23A 4AG2C 1VYTA 1J3TA 4OMLA 1M27C 1M3CA 2K6DA 1AD5A 5FW9A 2PNIA 4AFUC 1GBQA 5GJWB 5IH2A 1AZEA 1H8KA 2K79A 2OAWA 2EYYA 3VS1A 2JW4A 1RI9A 3I9QA 2DJQA 2D8HA 3UATA 4F14A 4HVVA 4FSSA 1NM7A 3REAB 2EYWA 3I5SA 3TVTA 1AWXA 3VS5A 2BZXA 1PNJA 1WXUA 3M0RA 1UHCA 1WI7A 2EBPA 2RMOA 2DL3A 1JEGA 2HSPA 2W10A 2DVJA 2EGAA 1YWOA 4ZNXA 5IXBA 3RBBB 4HVWA 1A0NB 1SRLA 2LJ0A 1BK2A 3REBB 2BZ8A 1KIKA 2DILA 1YCSB 1UUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUZ A;  3UA6 A;  1OEB A;  2CH4 A;  3M0T A;  2PZ1 A;  2EW3 A;  2VKN A;  2EPD A;  1AEY A;  2DBM A;  2DM1 A;  2FPE A;  1K76 A;  3VS2 A;  4AG1 C;  2YUN A;  3RNJ A;  1T0J A;  2CUD A;  2FRW A;  2RF0 A;  2PTK A;  2AK5 A;  2RQV A;  1W1F A;  1Y0M A;  3GBQ A;  3M0P A;  3EG0 A;  1TUC A;  2VWF A;  3R6N A;  3ZL7 C;  2KRS A;  3M0S A;  2M0Y A;  3M0Q A;  1H92 A;  2H8H A;  2JM8 A;  2D1X A;  3KFV A;  2ECZ A;  3PE0 A;  2JT4 A;  2KBT A;  2OI3 A;  2DRK A;  2CSI A;  3VRZ A;  1E6H A;  4RTY A;  4Z89 A;  2BTT A;  1SSH A;  3EG1 A;  4AFQ C;  2E5K A;  2CUB A;  4OMO A;  4LE9 A;  3EG2 A;  2FRY A;  3H0F A;  4OMQ A;  4OMN A;  1W70 A;  1CKA A;  2D8J A;  1WA7 A;  2GQI A;  1ZLM A;  1RLQ C;  2ABL A;  1QKX A;  1NG2 A;  4J9H A;  4D8K A;  1ZUY A;  4JJD A;  3H0H A;  5EC7 A;  2VVK A;  1X27 A;  3NPF A;  1KFZ A;  3VS6 A;  1TUD A;  1I1J A;  2A08 A;  2MCN A;  1PKT A;  2RQW A;  2J6F A;  4J9G A;  1UTI A;  3VS3 A;  1Z9Z A;  3M0U A;  1GFC A;  4DEX A;  1SHG A;  2FPD A;  2CT4 A;  1PKS A;  2LQW A;  2A28 A;  2CSQ A;  2J6K A;  1NLO C;  2V1R A;  1U3O A;  1KJW A;  1ZSG A;  2CH4 W;  4OMM A;  1FYN A;  1I0C A;  2QDL A;  1RLP C;  1WYX A;  2HDA A;  1YN8 A;  2KYB A;  1Z9Q A;  2ESW A;  2CDT A;  1OPK A;  1ZUU A;  3PVL A;  3PVQ A;  1SRM A;  2AKL A;  2O9V A;  1YNZ A;  4E6R A;  4JZ4 A;  3UF4 A;  2AZV A;  5ECA A;  2J06 A;  4RTX A;  2KRO A;  1EFN A;  2NWM A;  2V1Q A;  2GBQ A;  4IIO A;  4KRT A;  2LX7 A;  2ED1 A;  1X2K A;  1QLY A;  4CC3 A;  2KYM A;  4A63 B;  1K4U S;  3SHW A;  1JU5 C;  1T3L A;  2O31 A;  5IHK A;  2F2V A;  3EHR A;  3CQT A;  4K11 A;  2I0N A;  1GCQ A;  4ORZ A;  2KE9 A;  2DL8 A;  3TSZ A;  2X3W D;  1U06 A;  2KT8 A;  2KR3 A;  5I11 A;  4J9I A;  2L3Q A;  4M4Z A;  1M8M A;  2LQN A;  2YUQ A;  2JTE A;  4CC2 A;  2JXB A;  2LMJ A;  1RUW A;  2DMO A;  4RTT A;  1ZBJ A;  3NGP A;  4RTZ A;  3SEM A;  1S1N A;  2HBW A;  2CRE A;  2YSQ A;  1T0H A;  1N5Z A;  1WX6 A;  1HD3 A;  3IQL A;  4J9C A;  2MIO A;  2KRM A;  1UDL A;  1AZG B;  1JXO A;  4LUE A;  2FG0 A;  1K9A A;  2EYZ A;  1GFD A;  2CT3 A;  4WCI A;  1ARK A;  2JMA A;  2YT6 A;  3UA7 A;  1MV3 A;  1MV0 B;  3VS4 A;  1K0S A;  3O5Z A;  4HVU A;  1SPK A;  1K1Z A;  1UGV A;  1ZUK A;  2C0O A;  4R0K A;  4RTW A;  4F16 A;  2W0Z A;  1AWO A;  2C0I A;  2LNH B;  2MOX A;  4RTV A;  1BBZ A;  2SRC A;  1GBR A;  2EGE A;  2HEQ A;  2K7A A;  1NYF A;  4D8D A;  5I22 A;  1GCP A;  4OMP A;  1PHT A;  1UJ0 A;  2K3B A;  5FWC A;  1AOJ A;  4HCK A;  2O88 A;  1G2B A;  1GRI A;  2L3P A;  1OOT A;  2K9G A;  1QWE A;  4X1V A;  1H3H A;  2G6F X;  5IHN A;  2YDL A;  4IIM A;  4J9D A;  1PRL C;  2GTO A;  2RQR A;  1PWT A;  2J7I A;  3QWX X;  1MUZ A;  2D0N A;  5IXF A;  3H0I A;  2AKK A;  3JV3 A;  2GNC A;  2ROT A;  3QWY A;  1X43 A;  3I35 A;  4RUG A;  4JJC A;  4AFS C;  2DE0 X;  2O2O A;  1VYV A;  2LJ3 A;  2DLP A;  4CC4 B;  1NEB A;  2JS2 A;  1BU1 A;  2C0T A;  1X2Q A;  1JQQ A;  2EYX A;  3EHQ A;  2M51 A;  1NYG A;  1QWF A;  2A36 A;  1XOV A;  1U5S A;  1SEM A;  4LN2 A;  1ABQ A;  3THK A;  1M3B A;  4QT7 A;  2YUO A;  2RQU A;  2AZS A;  1B07 A;  1BB9 A;  1UG1 A;  2L2P A;  2P4R A;  2RQT A;  2X3X D;  2OJ2 A;  3I5R A;  3VRY A;  1NEG A;  2ENM A;  1WDX A;  2HCK A;  3H41 A;  2DX1 A;  1G83 A;  2KEA A;  1QCF A;  4GBQ A;  1AVZ C;  1UE9 A;  1WXT A;  1WIE A;  3NHN A;  4AFZ C;  1NLP C;  3EGU A;  4EIK A;  1X6G A;  2RPN A;  1CSK A;  2LZ6 B;  2B86 A;  1K0X A;  4F17 A;  2DF6 A;  2KGT A;  2DYB A;  1E6G A;  1KSW A;  1UEC A;  2JM9 A;  1GCQ C;  3C0C A;  2LP5 A;  4Z88 A;  1WFW A;  2DL7 A;  2KXD A;  2EQI A;  2IIM A;  2A37 A;  1PRM C;  5GJV B;  1E7O A;  1GL5 A;  2ED0 A;  1OV3 A;  4J9E A;  1ABO A;  1V1C A;  1B3Q A;  2DNU A;  1SHF A;  2F2W A;  4JJB A;  2BZY A;  1TG0 A;  1CKB A;  2JMC A;  2RNA A;  2L3S A;  1UHF A;  2O9S A;  4RTU A;  1I07 A;  2GTJ A;  1HJD A;  1Y57 A;  3VS0 A;  3ULR B;  2KNB B;  4ESR A;  1IO6 A;  1YWP A;  4DEY A;  1VYU A;  2EKH A;  4LNP A;  1X6B A;  4J9B A;  2JS0 A;  1M30 A;  5FWB A;  2SEM A;  1JO8 A;  1AWW A;  2K2M A;  2RN8 A;  3U23 A;  2J05 A;  1T3S A;  1WXB A;  4J9F A;  2DA9 A;  2XMF A;  3FJ5 A;  4HXJ A;  3VS7 A;  2FEI A;  1HSQ A;  2FO0 A;  2DL4 A;  2DL5 A;  2EGC A;  1VA7 A;  1UJY A;  1AWJ A;  1M3A A;  2DRM A;  4LUD A;  1WLP B;  2J6O A;  2LJ1 A;  4Z8A A;  2KXC A;  2YUP A;  3TSW A;  1FMK A;  2GGR A;  5HCK A;  1QKW A;  4CC7 A;  2KT1 A;  1X69 A;  4GLM A;  3LH5 A;  1LCK A;  2L0A A;  4JPB W;  2LCS A;  2EVR A;  3A98 A;  1ZX6 A;  2ROL A;  1UFF A;  1OPL A;  1JXM A;  2FPF A;  1W6X A;  1YP5 A;  4JZ3 A;  2F2X A;  3NMZ C;  5IHI A;  2KRN A;  3EG3 A;  2DBK A;  4Y92 A;  5L23 A;  4AG2 C;  1VYT A;  1J3T A;  4OML A;  1M27 C;  1M3C A;  2K6D A;  1AD5 A;  5FW9 A;  2PNI A;  4AFU C;  1GBQ A;  5GJW B;  5IH2 A;  1AZE A;  1H8K A;  2K79 A;  2OAW A;  2EYY A;  3VS1 A;  2JW4 A;  1RI9 A;  3I9Q A;  2DJQ A;  2D8H A;  3UAT A;  4F14 A;  4HVV A;  4FSS A;  1NM7 A;  3REA B;  2EYW A;  3I5S A;  3TVT A;  1AWX A;  3VS5 A;  2BZX A;  1PNJ A;  1WXU A;  3M0R A;  1UHC A;  1WI7 A;  2EBP A;  2RMO A;  2DL3 A;  1JEG A;  2HSP A;  2W10 A;  2DVJ A;  2EGA A;  1YWO A;  4ZNX A;  5IXB A;  3RBB B;  4HVW A;  1A0N B;  1SRL A;  2LJ0 A;  1BK2 A;  3REB B;  2BZ8 A;  1KIK A;  2DIL A;  1YCS B;  1UUE A; 
#chains in the Genus database with same CATH topology
 2NUP B;  3S3M A;  4A4H A;  2CH4 A;  2RJE A;  2FPE A;  2FRW A;  2O4X A;  3S6W A;  2RD1 A;  2RQV A;  1W1F A;  3JRZ A;  4QQG A;  2EJF A;  3M0P A;  2KRS A;  1H92 A;  4E7J A;  2E41 A;  1K8A U;  1ZSZ C;  3CCS Q;  4XTV A;  2ECZ A;  1VQL A;  4X9D A;  3GPL A;  2JT4 A;  2P0Q A;  3OS2 A;  3EG1 A;  1K73 C;  1VQP A;  2E5K A;  4XK8 E;  5J3B A;  2M02 A;  4QKU A;  3QYH B;  2QQR A;  2GQV A;  2KI7 A;  2GFA A;  4UC4 A;  5LJ5 j;  1VIE A;  3TU4 K;  4RKU E;  4A4K A;  1RLQ C;  4BDY A;  2ABL A;  5CQX A;  4D8K A;  2HQE A;  5A2Q E;  1UGQ B;  4XTY A;  3VS6 A;  1KFZ A;  2MCN A;  4DEX A;  3Q1J A;  4FYX B;  1XJW B;  3P8H A;  4F04 B;  3JB9 D;  2CP5 A;  2K4Y A;  1D1C A;  4C92 D;  1PKS A;  1LPL A;  1Q86 C;  3CCM Q;  2A28 A;  2CSQ A;  3PMT A;  1PSE A;  4C8Q D;  1U3O A;  3RKW A;  2XD0 A;  2CH4 W;  2QAS A;  3OYA A;  3JB9 H;  1I0C A;  1M5Q 1;  1WYX A;  3OYC A;  2RO0 A;  2HDA A;  1QP3 A;  1VQP T;  5LJ5 e;  4JUV A;  2LVM A;  1YNZ A;  4E6R A;  5ECA A;  2J06 A;  1ZBX A;  2X4W A;  2L5Q A;  1EFN A;  1JBM A;  3UT1 A;  3QJY A;  3OW2 P;  2FHD A;  1QLY A;  4PLL A;  1K4U S;  3LWI A;  4MML A;  3SB2 A;  2M1H A;  1VQ6 Q;  3EHR A;  3CQT A;  1G3Y A;  1WHL A;  3GNG A;  1W2B S;  3TSZ A;  3D7S B;  2X3W D;  2KR3 A;  3X26 B;  4M4Z A;  3GLX A;  2YUQ A;  4CC2 A;  2KQW A;  2JXB A;  1F1B B;  3OS1 A;  2LMJ A;  1IB8 A;  4RTT A;  4PFZ A;  3NGP A;  5CKE A;  3HFO A;  4E7H A;  4XU1 A;  1N5Z A;  2I2L A;  4DBF A;  4J9C A;  4C0Z A;  3CCU Q;  5CR2 A;  1VQ9 T;  1AZG B;  1JXO A;  1M90 R;  4LUE A;  4AMC A;  5CK9 A;  1LNX A;  4NL2 A;  3HKS A;  3QDF A;  2GF7 A;  3QDR B;  3QZ5 B;  2YWW A;  3JCM b;  1QVF A;  3G4S T;  1MV3 A;  3CCV T;  1K0S A;  1UGV A;  1ZUK A;  4J7I A;  3CPW P;  4ELZ C;  4M7A E;  5FRM A;  2R5M A;  2LNH B;  1QVG S;  4M75 G;  2SRC A;  1GBR A;  5DY9 A;  1Y71 A;  2GCX A;  2K3B A;  1LOJ A;  4R56 A;  4OB1 B;  1G2B A;  3CC4 A;  3PIP A;  2RJD A;  1H3H A;  2RJF A;  5IHN A;  3M59 A;  3C94 A;  1ZA2 B;  2FZK B;  2LCC A;  1PRL C;  1Y96 B;  1Q82 R;  2FVU A;  2J7I A;  2L8D A;  4LDY A;  5IXF A;  2K3X A;  2BE7 D;  3JCM c;  2QQB A;  2E10 A;  4P5N A;  2ROT A;  5GAO l;  1X43 A;  3I35 A;  2LQK A;  4ZGE B;  1VQM A;  3EGD B;  2A7Y A;  1VQO A;  4AFS C;  1UGR B;  2DE0 X;  1JJ2 S;  1K8A C;  4L5G A;  2LJ3 A;  4DOV A;  4RCC A;  1WJS A;  2LX9 A;  3VUB A;  4EPC A;  4JLI A;  5CKF A;  3DB4 A;  1U1S A;  3PFS A;  1S72 Q;  3EHQ A;  2M51 A;  4PK4 A;  4M78 F;  1NYG A;  1QWF A;  3L2R A;  4LN2 A;  1SEM A;  2ZPI B;  3CC4 T;  1NBE B;  1M1F A;  1YIT A;  1Y07 A;  4PJO B;  3THK A;  1M3B A;  4QT7 A;  4KUI A;  2QK0 A;  1UG1 A;  2X3X D;  2OJ2 A;  2RH2 A;  3I5R A;  2FZC B;  1NEG A;  2R58 A;  2DK3 A;  3MP8 A;  2HCK A;  4O5V A;  3JCM W;  4FCY A;  1WGS A;  2DIQ A;  4GBQ A;  4CRI A;  2DTO A;  5KYW B;  2A3L A;  1UE9 A;  1WXT A;  1BCO A;  5A0D A;  1YHQ Q;  3NHN A;  4AFZ C;  3MKD A;  1WPY A;  2MPX C;  2OTJ A;  1M8V A;  1QVP A;  4J8O A;  5KYY B;  2B86 A;  1K0X A;  4F17 A;  2DF6 A;  1UEC A;  3MEU A;  2DKG A;  3TRE A;  4M75 D;  1YJW A;  2LP5 A;  4Z88 A;  1VQ7 Q;  2KXD A;  2PUO B;  4B9X A;  2IIM A;  4C92 F;  1YIT T;  1TUG B;  4FW2 A;  4C8Q F;  3DLL A;  1G8X A;  1MMA A;  4BE1 A;  2QEX A;  1Q82 U;  1SHF A;  2F2W A;  1TG0 A;  2RNA A;  1UHF A;  1KQS P;  2E70 A;  4LDV A;  1BI2 A;  2WSE E;  3E9F A;  2YRC A;  4BE0 A;  2RI2 A;  5CKH A;  1WHG A;  2LC4 A;  1K73 R;  2KDS A;  4LDX A;  3BDL A;  3ULR B;  4ESR A;  3JB9 I;  1VYU A;  4LNP A;  1K9M C;  4J9B A;  2JS0 A;  3PGG A;  3V8L A;  1AWW A;  2RN8 A;  2E3I A;  3RKY A;  4J9F A;  2DA9 A;  1I81 A;  4M78 C;  3BW1 A;  3F70 A;  2DL5 A;  5LJ3 f;  4V2S A;  3PT9 A;  1UJY A;  2HMA A;  5GAM h;  2D9T A;  2DRM A;  1VQ8 Q;  2LDM A;  1D1A A;  1Q86 R;  1BIB A;  1YIJ T;  5HK3 A;  4QQD A;  5FU6 B;  2YUP A;  2QEX T;  4PJO G;  2OTL Q;  2XKO C;  2DD5 A;  3HPW A;  2E64 A;  3A98 A;  1MNE A;  1KD1 U;  1UFF A;  2HKQ B;  4N0A C;  5AYF A;  1H64 1;  1WJR A;  5IHI A;  2QQ9 A;  4Y92 A;  1U8R A;  1N9R A;  4AG2 C;  4OML A;  3CCE T;  4XAX B;  5FW9 A;  3CME A;  4IUV A;  5GMK h;  3CD6 T;  2DXU A;  3KXT A;  2JW4 A;  1RI9 A;  3L2Z A;  2ZPE B;  4PJL A;  1I8F A;  5LL6 S;  3M55 A;  4C92 C;  1RAD B;  1AHJ B;  4FSS A;  4C8Q C;  4C5E A;  1R0B G;  3OW2 S;  3CCS A;  1RAF B;  3CC2 A;  4QVZ A;  3NTI A;  1WXU A;  4II1 A;  3SWN A;  1UHC A;  1WI7 A;  2RHZ A;  1JEG A;  1N8R R;  2QTV A;  4M7D G;  1YI2 T;  4XTU A;  4JRP A;  4PFP A;  5GAO r;  2LJ0 A;  3OYM A;  1VQ4 Q;  2VUB A;  1YCY A;  3M58 A;  1KIK A;  2Y4Y A;  4M77 A;  3G6E A;  1YJ9 A;  2JUF A;  5CAI A;  1QVG A;  2X4X A;  4RMO A;  1KHI A;  1OEB A;  3M0T A;  2DVE A;  5GAM g;  5KYX A;  2X35 A;  1AEY A;  3VS2 A;  3OYD A;  2MYS A;  1OYX A;  3CCM A;  3QBY A;  1C1A A;  3CCJ Q;  1H3Z A;  4HCB A;  4ZGD B;  4HKE A;  3MEV A;  2AK5 A;  5KH6 A;  3L42 A;  1Y0M A;  2CGH A;  2M0Y A;  3M0Q A;  3UDC A;  3A1P A;  1R8O B;  2NUT A;  3FDR A;  2CSI A;  4PJO D;  2BTT A;  3QPH A;  5KE2 A;  1SSH A;  4M78 A;  4PKC C;  3CPW S;  4KH0 B;  4OMO A;  1PSF A;  1JRI A;  2FZG B;  4M7A B;  1IGQ A;  2QQS A;  3OYF A;  3OB9 A;  1CKA A;  5GMK l;  3MCA B;  3JCM h;  5DLO A;  4OGE A;  3VYH B;  1BI1 A;  3H0H A;  4JDS A;  1YBY A;  1Q82 C;  1UB4 A;  1X27 A;  2O4X B;  5GAO p;  1K8A R;  4C0D B;  2A08 A;  2Y90 A;  1UTI A;  2XID A;  2YHT A;  1GFC A;  2NYS A;  4Q5W A;  4A4E A;  4MDW A;  3CCM T;  3M57 A;  2J6K A;  1NE8 A;  1OX9 A;  4FYY B;  3I55 Q;  2E6Z A;  3LYI A;  3EH2 A;  4EMK A;  2F5T X;  2QDL A;  1N8R U;  2MK5 A;  3CMA T;  1Z9Q A;  1RL2 A;  3OA6 A;  1OPK A;  4IUU A;  3V8J A;  4M7D D;  1ZUU A;  3PVQ A;  2AKL A;  4QVD A;  5GAM j;  1OZ3 A;  4N4G A;  2RHX A;  4MZM A;  4RTX A;  4FW1 A;  2KRO A;  1SKU B;  2EJ9 A;  4KRT A;  5GAO q;  5LJ3 d;  4A4G A;  3RIR A;  1IZ6 A;  2KYM A;  3RES A;  3SHW A;  1VQ6 T;  1MND A;  5GAO m;  2F2V A;  2HNI A;  4K11 A;  1GCQ A;  1D3B A;  2KE9 A;  1KD1 C;  2KT8 A;  4LXC A;  2VV5 A;  4J9I A;  2L3Q A;  4MZT A;  2EQM A;  2LQN A;  3TEE A;  1C0M A;  1N27 A;  5HK0 A;  2VGM A;  3OQ5 A;  5CCA A;  2DMO A;  1HYO A;  3VKI A;  3QSU A;  2XU8 A;  5GMK j;  3FLG A;  3CCU T;  5D6X A;  1WX6 A;  5GAM e;  1HD3 A;  2HSE B;  3IQL A;  1KK7 A;  2E1H A;  3LGL A;  4E7K A;  3JCM g;  4PJJ A;  4D6W A;  2R57 A;  2FG0 A;  1Q7Y C;  1K9A A;  1I5O B;  2EYZ A;  3QYG B;  3L2Q A;  2ZPF B;  4E2F B;  4BI4 A;  4M7A G;  4DBQ A;  3UA7 A;  3EGX A;  1K9M R;  1B34 B;  2KY9 A;  3O5Z A;  4M77 E;  1SPK A;  4XTZ A;  4BE2 A;  1IXD A;  4F16 A;  4RTW A;  5M9O A;  2W0Z A;  2C0I A;  4FSX A;  4RTV A;  2RK1 A;  2F5K A;  4F7U A;  4Y28 E;  2K7A A;  3I56 Q;  4M75 C;  1NYF A;  3H9N A;  4OMP A;  2DEQ A;  1AOJ A;  2O88 A;  3EG9 B;  3ZBD A;  5GMK e;  2PVO B;  1NJI C;  5GAM f;  1OOT A;  2CZ6 B;  1D0Y A;  3L2W A;  2ZAE A;  2ZPB B;  3M4Y A;  4M75 B;  4IIM A;  3OYG A;  2RQR A;  1ZA1 B;  1LJO A;  1NPP A;  3QWX X;  2DEU A;  4BI8 B;  2BE9 B;  3G71 Q;  1MMN A;  1R0C B;  4E47 A;  3E19 A;  4PNO A;  2GNC A;  5LJ3 h;  1N6A A;  4RUG A;  5CIU A;  3CEY A;  4M78 E;  3CCQ Q;  2CZ1 B;  4HCZ A;  1QCO A;  2DLP A;  4EDU A;  1M2O A;  3OW2 A;  2JS2 A;  2C0T A;  1S72 T;  1TS9 A;  3MP6 A;  3CMA Q;  3M54 A;  2WSF E;  1VQ9 A;  3OMC A;  1JQQ A;  1WZO A;  2F69 A;  2E5Q A;  3JCM J;  3OYJ A;  3H8Z A;  1MHN A;  2A36 A;  2AIR B;  1TH7 A;  1ABQ A;  4BUG A;  3CPF A;  3JCM X;  2RHU A;  1WHK A;  2RQU A;  4HA8 A;  1KQ2 A;  2P4R A;  3G4S A;  3CCV A;  1AT1 B;  1HK9 A;  2VAS A;  5GAN 8;  3QO3 A;  4TVR A;  1WDX A;  3H41 A;  4PJO F;  2RK2 A;  4BY6 B;  2KEA A;  2XI9 A;  2AHJ B;  1YHQ T;  2O01 E;  1XTD A;  1FWZ A;  1NLP C;  2LCL A;  2RJC A;  4C5H A;  1K9M U;  1BIA A;  4M7A D;  1X6G A;  1N8R C;  4C8Q E;  2HZY A;  5KYN A;  4A54 A;  3RKX A;  1ZHI A;  3JCM e;  1VQ7 T;  3ME9 A;  4C0G A;  3CC7 Q;  1LVK A;  2DL7 A;  4KGX B;  1P92 A;  2PVD B;  4DBR A;  2A37 A;  2QGG A;  3CPW A;  1RAB B;  2FB7 A;  2YRV A;  2ED0 A;  1ZSZ A;  1ABO A;  5I2S A;  2OTL A;  1V1C A;  3MEW A;  5LJ3 g;  3OS0 A;  3KBG A;  1CKB A;  5KYU A;  3L2V A;  2L3S A;  4RTU A;  1VQK T;  5HKC A;  3EAE A;  2E3H A;  4C0F A;  2KNB B;  4PJN A;  3E9G A;  3CCR Q;  1BYM A;  3ZEH A;  3JCM f;  4OP0 A;  4N4I A;  2DER A;  2E65 A;  1JO8 A;  3U23 A;  2Z0W A;  1TXQ A;  2JZ2 A;  3QJ6 A;  1IGU A;  1HSQ A;  3CCL Q;  2FO0 A;  2EGC A;  3HTR A;  1VQ8 T;  1M3A A;  2DJZ A;  1WLP B;  4Z8A A;  2LJ1 A;  4F7U E;  1VIF A;  2OTL T;  2DTH A;  2GGR A;  5HCK A;  2RA2 A;  4GLM A;  4LDW A;  4PJO C;  1M2V A;  1LCK A;  3J80 E;  2EVR A;  3A8H B;  1KHC A;  1IHW A;  3OYE A;  1OPL A;  3CBM A;  3ZFJ A;  9ATC B;  2QYZ A;  5KCH A;  4XQ3 A;  1YP5 A;  4JZ3 A;  4X9C A;  2XK0 A;  4XU2 A;  3LWH A;  3LX7 A;  3EG3 A;  3HRS A;  4ME7 A;  3O8V A;  3LLR A;  1J3T A;  5GAM d;  2K6D A;  1VQL Q;  1AD5 A;  4AFU C;  1GBQ A;  2JTM A;  5GJW B;  1AZE A;  2K79 A;  5LJ3 j;  1WHH A;  4OMF B;  5GMK m;  1YJN T;  3VS1 A;  1O9S A;  3I9Q A;  4F14 A;  4HVV A;  1NM7 A;  2WSC E;  3REA B;  1KD1 R;  5IT9 E;  1G3T A;  3X28 B;  3VS5 A;  2EQJ A;  1RAA B;  8AT1 B;  2EBP A;  2BKD N;  2DET A;  2HSP A;  2DVJ A;  1YWO A;  2D0Q B;  4ATO A;  4M7D C;  4HVW A;  1OI1 A;  2G3R A;  1VQ4 T;  2BZ8 A;  2DZ9 A;  2R5A A;  3JSC A;  3JB9 F;  1Q7Y R;  3OYY A;  3UWN A;  1SSF A;  1KQS A;  4MDX A;  1YIJ A;  4M7D B;  5LJ3 e;  3OY9 A;  5A0G A;  1RAG B;  4IKF A;  4Y91 A;  3V7R A;  2EW3 A;  2QAZ A;  2EPD A;  4A53 A;  3CCJ T;  1VQK Q;  2EKO A;  2RF0 A;  2PTK A;  4PL6 A;  3RMS A;  3SWN B;  3VJP A;  2EJG A;  3EG0 A;  2NLU A;  3NTK A;  2VWF A;  3R6N A;  2EQK A;  3M0S A;  5J39 A;  2JM8 A;  1NJI R;  2D1X A;  3EGD A;  2PQW A;  3PE0 A;  3PNW C;  2VGN A;  3VRZ A;  3CCE A;  1E6H A;  4RTY A;  4L6V 5;  4Z89 A;  3HFN A;  1VQN Q;  2EFI A;  2DTI A;  2FL7 A;  4MZP A;  3CD6 A;  4AFQ C;  4M77 B;  5FU6 C;  2COW A;  4LE9 A;  3OS5 A;  3H0F A;  2ZZD A;  4OMN A;  5HY6 A;  1W70 A;  3SFM A;  3BFM A;  1ZLM A;  4PFO A;  1M1K R;  3GIB A;  3M56 A;  4BAC A;  2DAQ A;  3SD4 A;  2LT4 A;  1NG2 A;  2XG8 D;  4J9H A;  3QG1 A;  5EC7 A;  5CKD A;  2H3E B;  3A8M B;  2XIC A;  2EYQ A;  1TUD A;  1I1J A;  4FL6 A;  1FMV A;  4QQ6 A;  4J9G A;  1YI2 A;  1SHG A;  1JB0 E;  4DA4 A;  3I55 T;  1NLO C;  2V1R A;  5AT1 B;  1KJW A;  5GAN f;  1FYN A;  2HL3 A;  2QG9 B;  5GAN 5;  3E1S A;  3EFO A;  1YN8 A;  3JCM d;  2ESW A;  2CDT A;  2CP3 A;  5IN1 A;  2MF2 A;  4JLG A;  5KYY A;  2O9V A;  2JVV A;  4JZ4 A;  3UF4 A;  1YJN Q;  2AZV A;  1Q7Y U;  2JJ9 A;  5FLX E;  2NWM A;  2V1Q A;  3DKM A;  4IIO A;  1RAE B;  4E7L A;  3JCM Q;  2CP0 A;  2ED1 A;  1UGS B;  1BI0 A;  4A63 B;  1JU5 C;  2M9U A;  3HRU A;  3PIO A;  5CO7 A;  2O31 A;  3X20 B;  5IHK A;  2CZ0 B;  1W2B P;  2I0N A;  4KT0 E;  2BIV A;  4ORZ A;  4EMK B;  4OGC A;  4J6Y A;  1PG5 B;  1VQM Q;  1I5L A;  2QGF B;  1Q95 G;  1NJI U;  1VQO Q;  1RUW A;  1ZBJ A;  4XU3 A;  3SDZ A;  3SEM A;  1S1N A;  1OQK A;  1T0H A;  2RHI A;  4RG2 A;  4YTL A;  2JOY A;  2MIO A;  1Q81 R;  2C06 A;  4ZTF A;  3P8B B;  3MPU B;  3T9N A;  5GAN 2;  1GFD A;  3CCQ A;  1M1K U;  4ELY C;  4M77 G;  4FYW B;  4MMK A;  1XQH A;  2HAX A;  2CT3 A;  4BD3 A;  1ARK A;  3FRN A;  1OUL A;  4M7A C;  1D0Z A;  3QHS A;  1WHJ A;  2CP6 A;  1D3B B;  2XDP A;  4HVU A;  3BE3 A;  4E7S A;  2CP7 A;  1K1Z A;  2C0O A;  3BY7 A;  4R0K A;  1AWO A;  3CMA A;  2MOX A;  2HBP A;  3I56 T;  1BBZ A;  2CZ7 B;  4VUB A;  2HEQ A;  5I22 A;  1GCP A;  1PHT A;  3CBP A;  4XTW A;  4C0D C;  3NTH A;  3X25 B;  3OYI A;  1QWE A;  2VB6 A;  4X1V A;  4ZTJ A;  2OTJ Q;  2G6F X;  1PM3 A;  2YDL A;  3C12 A;  4HT8 A;  5GAN 4;  1VQ6 A;  3FB9 A;  2GTO A;  1PWT A;  3G71 T;  2Y4X A;  4M78 G;  2D0N A;  3QKJ A;  3H0I A;  2AKK A;  3JV3 A;  1YJW Q;  3QWY A;  4N0A A;  3CCQ T;  3WXM B;  4JJC A;  4M75 F;  2E12 A;  1JJ2 P;  1IRE B;  3M9Q A;  2DXB A;  2O2O A;  2HL5 C;  1VYV A;  4F7U B;  4R55 A;  2RM4 A;  4JS5 A;  3CCU A;  2KK4 A;  2A0F B;  1NEB A;  4KGZ B;  2X9H A;  3A5Z B;  2HQH A;  1X2Q A;  1V29 B;  4C92 A;  1M1G A;  2EYX A;  4JRI A;  3DLM A;  3A8L B;  1WJQ A;  4C8Q A;  2V8K A;  3TCJ A;  2VXE A;  2AZS A;  1B07 A;  1BB9 A;  2CKK A;  2L2P A;  2RQT A;  4C5I A;  3QXE B;  1VQ5 Q;  1SF9 A;  3VRY A;  1Q81 U;  1MGQ A;  2MMP A;  2DX1 A;  2KMT A;  1G83 A;  1QCF A;  4WTO B;  2FYK A;  4HCC A;  1AVZ C;  4J7F A;  2LQ8 A;  4M77 D;  2HKN A;  4EIK A;  3CXC P;  2P4T A;  4QVC A;  2RPN A;  3MO8 A;  1OU8 A;  1WQ7 A;  2XHC A;  4DOW A;  1SG5 A;  5GAN d;  3GOX A;  1KSW A;  3CC7 T;  2QI2 A;  2V8I A;  3C0C A;  2EQI A;  1PRM C;  1QCN A;  1PD1 A;  4KUL A;  1GL5 A;  1OV3 A;  1B3Q A;  2DFU A;  2RI3 A;  3CME Q;  3MEA A;  2JMC A;  1I4K 1;  3C95 A;  2LRQ A;  3L1A A;  4M78 D;  5FU7 C;  2MWO A;  1S72 A;  1KQS S;  3S3O A;  3CCR T;  1IO6 A;  1BCM A;  4DEY A;  4LD6 A;  1X6B A;  3RR6 A;  2K2V A;  2XDB A;  1M9S A;  3ER0 A;  4FU6 A;  5FU7 B;  3CC2 Q;  2K2M A;  2J05 A;  1T3S A;  1DJ7 B;  2IVW A;  2DXT A;  1G3S A;  3CCL T;  1VUB A;  1NPR A;  4F7U G;  3VS7 A;  2DL4 A;  1ZSZ B;  1M1K C;  1VA7 A;  5CVI A;  3OYN A;  1AWJ A;  1YHQ A;  3V7C A;  2RI5 A;  1YJ9 Q;  4BI3 A;  3G6E Q;  4ZGJ B;  5KYU B;  1TWB A;  4FYV B;  2CP2 A;  3TSW A;  2LT1 A;  4KBM B;  2VC8 A;  1QKW A;  2KT1 A;  1X69 A;  2MI6 A;  3LH5 A;  4NL3 A;  2L0A A;  2LCS A;  1VQ7 A;  1W6X A;  1ACM B;  4J6W A;  3AT1 B;  3X24 B;  2PUK B;  4J5Y A;  5GAN h;  4BY6 C;  4FM4 B;  2RHY A;  1VQL T;  4N4H A;  5L23 A;  1HXD A;  2COZ A;  1H8K A;  1EX4 A;  2OAW A;  2EYY A;  4E7Z A;  1VQK A;  2NUP A;  3OSV A;  3JCM V;  2DJQ A;  3UAT A;  4O6J A;  3I5S A;  2QA4 Q;  4C92 E;  3QUI A;  1M2V B;  4KUD K;  3TVT A;  1AWX A;  2P0K A;  2RMO A;  3QII A;  4DQ2 A;  2PU9 B;  1VQN A;  4FIB A;  5IXB A;  1B34 A;  1U1T A;  2E6N A;  3RBB B;  4EMG A;  1FMW A;  1A0N B;  2V8J A;  1SRL A;  2P84 A;  3P8D A;  3PTA A;  1BK2 A;  1KQ1 A;  1VQ8 A;  2DIL A;  1UUE A;  4XU0 A;  2CYZ B;  5LJ5 f;  2V26 A;  3EG9 A;  4RCB A;  2NUZ A;  3UA6 A;  4GLK A;  1KC8 R;  5FRN A;  1Q81 C;  2PZ1 A;  1RI0 A;  2VKN A;  2DBM A;  2DM1 A;  1K76 A;  1X6O A;  4AG1 C;  2YUN A;  4M75 A;  2D6F A;  4KGV B;  3RNJ A;  1T0J A;  2CUD A;  4M7D F;  2VXF A;  4J83 A;  1FXX A;  2H3J A;  1M4Z A;  3GBQ A;  2KAF A;  1TSF A;  3TQ7 P;  1TUC A;  3ZL7 C;  4BB7 A;  4FT4 A;  2H8H A;  8ATC B;  3KFV A;  3JAM E;  2KBT A;  2OI3 A;  1VQN T;  2QDY B;  1X01 A;  2DRK A;  1Y7X A;  3INZ A;  5GAN 3;  3V8K A;  2CUB A;  1QVF P;  3MP1 A;  5C6S A;  1YJN A;  2HD0 A;  3EG2 A;  5GAN g;  2FRY A;  3MJX A;  4OB2 B;  3VU3 C;  4OMQ A;  3OMG A;  3AHU A;  4WF2 A;  4JRQ A;  2D8J A;  3MET A;  1WA7 A;  2GQI A;  1D0X A;  2DZC A;  3HRT A;  4M77 F;  1QKX A;  1ZUY A;  4JJD A;  1MMG A;  2JNG A;  2VVK A;  3NPF A;  3J81 E;  1PKT A;  2ZPH B;  2RQW A;  5A0L A;  3JCM P;  2J6F A;  3VS3 A;  1Z9Z A;  3M0U A;  2FPD A;  2CT4 A;  1VQ4 A;  2LQW A;  4PLI A;  5I2M A;  4PJM A;  3H6Z A;  2EIF A;  1GXI E;  1ZSG A;  1PCX A;  3V7S A;  4OMM A;  2K5F A;  4CI0 C;  1D1B A;  2M16 A;  1RLP C;  3WVE B;  2ZPG B;  2KYB A;  3DB3 A;  5KCO A;  3S3N A;  1TOV A;  3PVL A;  1SRM A;  1N9S A;  1VQP Q;  2YRD A;  3CCJ A;  5EG2 A;  7AT1 B;  3EH1 A;  1ZQ1 A;  2GBQ A;  4IUT A;  3EFR A;  5DM7 R;  2LX7 A;  1WHM A;  1IHV A;  1X2K A;  2DD4 A;  4CC3 A;  1KC8 U;  4JS4 A;  1T3L A;  4L59 A;  1D09 B;  3OYH A;  1M90 U;  3PMI A;  1TU0 B;  2DL8 A;  1U06 A;  1VQM T;  5I11 A;  3GP8 A;  4ZN1 A;  5GAN j;  1M8M A;  1YFN A;  1VQO T;  5DLQ E;  2JTE A;  3EFO B;  1PD0 A;  1XNI A;  4BDZ A;  3VYG A;  3CXC S;  4RTZ A;  2HBW A;  2CRE A;  2YSQ A;  2OX7 A;  3SWN C;  2XDD A;  2X4Y A;  1G3W A;  3ASK A;  4ANJ A;  2KRM A;  1UDL A;  3VUZ A;  1VQ9 Q;  1Y96 A;  2K5I A;  5C0M A;  4JRK A;  1O75 A;  3I55 A;  4M77 C;  1MMD A;  4WCI A;  2JMA A;  2YT6 A;  1MV0 B;  3WVD B;  3VS4 A;  3OBY A;  3G4S Q;  2DXC A;  3CCV Q;  2BUD A;  5D6W A;  3G7Z A;  2HQX A;  1R77 A;  5GAN e;  3R6O A;  4RG8 A;  2EGE A;  3C4S A;  4D8D A;  3UPU A;  2VYT A;  1UJ0 A;  5FWC A;  2EWN A;  4HCK A;  5D7U A;  4Z02 A;  1GRI A;  2L3P A;  2EQU A;  4M75 E;  2OTJ T;  2K9G A;  3BDU A;  1VQ5 A;  6AT1 B;  5KYX B;  3A8O B;  4M7A F;  4PJO A;  4J9D A;  5LJ5 d;  2GFU A;  1WQW A;  2KVQ G;  4OB3 B;  3GF5 A;  3URG A;  1MUZ A;  2JTF A;  1YJW T;  2YXY A;  2KSS A;  2IG0 A;  1IRX A;  4OF1 A;  5I21 A;  2NUT B;  1X75 C;  5D6Y A;  4OVA A;  2QQA A;  5KYW A;  4M78 B;  4CC4 B;  1UGP B;  5GAO n;  1BU1 A;  3MHX A;  3KUF A;  5GAN 7;  3FEO A;  2DIG A;  3OBW A;  4F7U F;  3OSS C;  4JJN K;  1XOV A;  1U5S A;  2L89 A;  3HP9 A;  4AT1 B;  1W2B A;  3CC4 Q;  2YUO A;  4QW2 A;  1VQ5 T;  4OB0 B;  2QTX A;  1RAC B;  4KH1 B;  5FRO A;  1QW1 A;  4EMK C;  2YLC A;  2CS7 A;  3HL8 A;  3OYL A;  3FJP A;  3NFC A;  2WAC A;  2ENM A;  3LGF A;  4M7D A;  4B6M A;  3RER A;  1RAH B;  2RB6 A;  1KG1 A;  3I56 A;  1WIE A;  2K57 A;  2ZGW A;  2YLB A;  4C5G A;  3EGU A;  4J6X A;  1NZ9 A;  1BI3 A;  1CSK A;  2LZ6 B;  3LW5 E;  4C92 B;  3JB9 J;  1RAI B;  2KGT A;  2DYB A;  5CQY A;  3RMQ A;  1E6G A;  1G5V A;  2LNV A;  3G71 A;  2JM9 A;  4C8Q B;  5CKB A;  1K73 U;  1GCQ C;  1QMC A;  3OYK A;  4LD9 K;  2COY A;  1WFW A;  3HSB A;  2K5L A;  4X34 A;  4LDU A;  2EAY A;  5GJV B;  1E7O A;  4IUR A;  1FX7 A;  3M53 A;  5LJ5 h;  1YIT Q;  2F1L A;  2OAU A;  4J9E A;  1KC8 C;  1EIF A;  3M5A A;  3FIF A;  3CME T;  3J7A F;  2LTO A;  2DNU A;  3M4G A;  4JJB A;  2BZY A;  3CBO A;  1M90 C;  5GAN 6;  1QVG P;  2O9S A;  1I07 A;  2GTJ A;  1OU9 A;  4IUQ A;  1HJD A;  1Y57 A;  3VS0 A;  3L2U A;  2ATC B;  1Q86 U;  1YWP A;  2X51 A;  2EKH A;  4NS5 A;  4FT2 A;  3CCS T;  4DBH A;  1M30 A;  2QXF A;  3CC2 T;  1UEB A;  5FWB A;  2SEM A;  1EZZ B;  4XTX A;  3G1J A;  2X4J A;  1PC0 A;  1WXB A;  2XMF A;  3FJ5 A;  1JJ2 A;  1OZ2 A;  4HXJ A;  2DPP B;  2FEI A;  1QVF S;  3EGX B;  1YJ9 T;  3G6E T;  2QA4 A;  4LUD A;  2J6O A;  3QZ9 B;  3VV0 A;  2KXC A;  1V76 A;  2MAM A;  1YIJ Q;  2MWP A;  1WNL A;  1FMK A;  4CC7 A;  1C6V X;  2PVG B;  2QEX Q;  4E7I A;  4JPB W;  1QP2 A;  4NOY A;  5IAY A;  4ZN3 A;  3CC7 A;  3HHT B;  1ZX6 A;  4IUP A;  2K3Y A;  5L8R E;  2ROL A;  4PJO E;  1JXM A;  2FPF A;  5GMK i;  2P0P A;  5J26 A;  2F2X A;  3NMZ C;  2KRN A;  4HT9 A;  2DBK A;  3EFS A;  1B7T A;  1VYT A;  1BKB A;  1M27 C;  1M3C A;  2PNI A;  5IH2 A;  1VOM A;  1QQJ A;  3N5B B;  3OYB A;  3E2U A;  3CCE Q;  2B8A A;  4B9W A;  3GNF B;  3CD6 Q;  3JB9 G;  5LJ5 g;  3CXC A;  4C92 G;  2M0O A;  2D8H A;  3RDV A;  5KE3 A;  3CCR A;  4C8Q G;  3RUX A;  3A8G B;  2QA4 T;  2EYW A;  2L3R A;  4GY5 A;  2JN0 A;  2BZX A;  1PNJ A;  3M0R A;  3FC3 A;  2DYI A;  2DL3 A;  1OX8 A;  2W10 A;  2EGA A;  4ZNX A;  1TTH B;  3CCL A;  1YI2 Q;  2DO3 A;  4EMH A;  3REB B;  1W4S A;  4M7D E;  1YCS B;  2IPO B;  4M7A A;  2AT1 B;  2ZCF B;  2E4H A;  4A4F A;  3LH0 A; 
#chains in the Genus database with same CATH homology
 2NUZ A;  3UA6 A;  1OEB A;  2CH4 A;  3M0T A;  2PZ1 A;  2EW3 A;  2VKN A;  2EPD A;  1AEY A;  2DBM A;  2DM1 A;  2FPE A;  1K76 A;  3VS2 A;  4AG1 C;  2YUN A;  3RNJ A;  1T0J A;  2CUD A;  2FRW A;  2RF0 A;  2PTK A;  2AK5 A;  2RQV A;  1W1F A;  1Y0M A;  3GBQ A;  3M0P A;  3EG0 A;  1TUC A;  2VWF A;  3R6N A;  3ZL7 C;  2KRS A;  3M0S A;  2M0Y A;  3M0Q A;  1H92 A;  2H8H A;  2JM8 A;  2D1X A;  3KFV A;  2ECZ A;  3PE0 A;  2JT4 A;  2KBT A;  2OI3 A;  2DRK A;  2CSI A;  3VRZ A;  1E6H A;  4RTY A;  4Z89 A;  2BTT A;  1SSH A;  3EG1 A;  4AFQ C;  2E5K A;  2CUB A;  4OMO A;  4LE9 A;  3EG2 A;  2FRY A;  3H0F A;  4OMQ A;  4OMN A;  1W70 A;  1CKA A;  2D8J A;  1WA7 A;  2GQI A;  1ZLM A;  1RLQ C;  2ABL A;  1QKX A;  1NG2 A;  4J9H A;  4D8K A;  1ZUY A;  4JJD A;  3H0H A;  5EC7 A;  2VVK A;  1X27 A;  3NPF A;  1KFZ A;  3VS6 A;  1TUD A;  1I1J A;  2A08 A;  2MCN A;  1PKT A;  2RQW A;  2J6F A;  4J9G A;  1UTI A;  3VS3 A;  1Z9Z A;  3M0U A;  1GFC A;  4DEX A;  1SHG A;  2FPD A;  2CT4 A;  1PKS A;  2LQW A;  2A28 A;  2CSQ A;  2J6K A;  1NLO C;  2V1R A;  1U3O A;  1KJW A;  1ZSG A;  2CH4 W;  4OMM A;  1FYN A;  1I0C A;  2QDL A;  1RLP C;  1WYX A;  2HDA A;  1YN8 A;  2KYB A;  1Z9Q A;  2ESW A;  2CDT A;  1OPK A;  1ZUU A;  3PVL A;  3PVQ A;  1SRM A;  2AKL A;  2O9V A;  1YNZ A;  4E6R A;  4JZ4 A;  3UF4 A;  2AZV A;  5ECA A;  2J06 A;  4RTX A;  2KRO A;  1EFN A;  2NWM A;  2V1Q A;  2GBQ A;  4IIO A;  4KRT A;  2LX7 A;  2ED1 A;  1X2K A;  1QLY A;  4CC3 A;  2KYM A;  4A63 B;  1K4U S;  3SHW A;  1JU5 C;  1T3L A;  2O31 A;  5IHK A;  2F2V A;  3EHR A;  3CQT A;  4K11 A;  2I0N A;  1GCQ A;  4ORZ A;  2KE9 A;  2DL8 A;  3TSZ A;  2X3W D;  1U06 A;  2KT8 A;  2KR3 A;  5I11 A;  4J9I A;  2L3Q A;  4M4Z A;  1M8M A;  2LQN A;  2YUQ A;  2JTE A;  4CC2 A;  2JXB A;  2LMJ A;  1RUW A;  2DMO A;  4RTT A;  1ZBJ A;  3NGP A;  4RTZ A;  3SEM A;  1S1N A;  2HBW A;  2CRE A;  2YSQ A;  1T0H A;  1N5Z A;  1WX6 A;  1HD3 A;  3IQL A;  4J9C A;  2MIO A;  2KRM A;  1UDL A;  1AZG B;  1JXO A;  4LUE A;  2FG0 A;  1K9A A;  2EYZ A;  1GFD A;  2CT3 A;  4WCI A;  1ARK A;  2JMA A;  2YT6 A;  3UA7 A;  1MV3 A;  1MV0 B;  3VS4 A;  1K0S A;  3O5Z A;  4HVU A;  1SPK A;  1K1Z A;  1UGV A;  1ZUK A;  2C0O A;  4R0K A;  4RTW A;  4F16 A;  2W0Z A;  1AWO A;  2C0I A;  2LNH B;  2MOX A;  4RTV A;  1BBZ A;  2SRC A;  1GBR A;  2EGE A;  2HEQ A;  2K7A A;  1NYF A;  4D8D A;  5I22 A;  1GCP A;  4OMP A;  1PHT A;  1UJ0 A;  2K3B A;  5FWC A;  1AOJ A;  4HCK A;  2O88 A;  1G2B A;  1GRI A;  2L3P A;  1OOT A;  2K9G A;  1QWE A;  4X1V A;  1H3H A;  2G6F X;  5IHN A;  2YDL A;  4IIM A;  4J9D A;  1PRL C;  2GTO A;  2RQR A;  1PWT A;  2J7I A;  3QWX X;  1MUZ A;  2D0N A;  5IXF A;  3H0I A;  2AKK A;  3JV3 A;  2GNC A;  2ROT A;  3QWY A;  1X43 A;  3I35 A;  4RUG A;  4JJC A;  4AFS C;  2DE0 X;  2O2O A;  1VYV A;  2LJ3 A;  2DLP A;  4CC4 B;  1NEB A;  2JS2 A;  1BU1 A;  2C0T A;  1X2Q A;  1JQQ A;  2EYX A;  3EHQ A;  2M51 A;  1NYG A;  1QWF A;  2A36 A;  1XOV A;  1U5S A;  1SEM A;  4LN2 A;  1ABQ A;  3THK A;  1M3B A;  4QT7 A;  2YUO A;  2RQU A;  2AZS A;  1B07 A;  1BB9 A;  1UG1 A;  2L2P A;  2P4R A;  2RQT A;  2X3X D;  2OJ2 A;  3I5R A;  3VRY A;  1NEG A;  2ENM A;  1WDX A;  2HCK A;  3H41 A;  2DX1 A;  1G83 A;  2KEA A;  1QCF A;  4GBQ A;  1AVZ C;  1UE9 A;  1WXT A;  1WIE A;  3NHN A;  4AFZ C;  1NLP C;  3EGU A;  4EIK A;  1X6G A;  2RPN A;  1CSK A;  2LZ6 B;  2B86 A;  1K0X A;  4F17 A;  2DF6 A;  2KGT A;  2DYB A;  1E6G A;  1KSW A;  1UEC A;  2JM9 A;  1GCQ C;  3C0C A;  2LP5 A;  4Z88 A;  1WFW A;  2DL7 A;  2KXD A;  2EQI A;  2IIM A;  2A37 A;  1PRM C;  5GJV B;  1E7O A;  1GL5 A;  2ED0 A;  1OV3 A;  4J9E A;  1ABO A;  1V1C A;  1B3Q A;  2DNU A;  1SHF A;  2F2W A;  4JJB A;  2BZY A;  1TG0 A;  1CKB A;  2JMC A;  2RNA A;  2L3S A;  1UHF A;  2O9S A;  4RTU A;  1I07 A;  2GTJ A;  1HJD A;  1Y57 A;  3VS0 A;  3ULR B;  2KNB B;  4ESR A;  1IO6 A;  1YWP A;  4DEY A;  1VYU A;  2EKH A;  4LNP A;  1X6B A;  4J9B A;  2JS0 A;  1M30 A;  5FWB A;  2SEM A;  1JO8 A;  1AWW A;  2K2M A;  2RN8 A;  3U23 A;  2J05 A;  1T3S A;  1WXB A;  4J9F A;  2DA9 A;  2XMF A;  3FJ5 A;  4HXJ A;  3VS7 A;  2FEI A;  1HSQ A;  2FO0 A;  2DL4 A;  2DL5 A;  2EGC A;  1VA7 A;  1UJY A;  1AWJ A;  1M3A A;  2DRM A;  4LUD A;  1WLP B;  2J6O A;  2LJ1 A;  4Z8A A;  2KXC A;  2YUP A;  3TSW A;  1FMK A;  2GGR A;  5HCK A;  1QKW A;  4CC7 A;  2KT1 A;  1X69 A;  4GLM A;  3LH5 A;  1LCK A;  2L0A A;  4JPB W;  2LCS A;  2EVR A;  3A98 A;  1ZX6 A;  2ROL A;  1UFF A;  1OPL A;  1JXM A;  2FPF A;  1W6X A;  1YP5 A;  4JZ3 A;  2F2X A;  3NMZ C;  5IHI A;  2KRN A;  3EG3 A;  2DBK A;  4Y92 A;  5L23 A;  4AG2 C;  1VYT A;  1J3T A;  4OML A;  1M27 C;  1M3C A;  2K6D A;  1AD5 A;  5FW9 A;  2PNI A;  4AFU C;  1GBQ A;  5GJW B;  5IH2 A;  1AZE A;  1H8K A;  2K79 A;  2OAW A;  2EYY A;  3VS1 A;  2JW4 A;  1RI9 A;  3I9Q A;  2DJQ A;  2D8H A;  3UAT A;  4F14 A;  4HVV A;  4FSS A;  1NM7 A;  3REA B;  2EYW A;  3I5S A;  3TVT A;  1AWX A;  3VS5 A;  2BZX A;  1PNJ A;  1WXU A;  3M0R A;  1UHC A;  1WI7 A;  2EBP A;  2RMO A;  2DL3 A;  1JEG A;  2HSP A;  2W10 A;  2DVJ A;  2EGA A;  1YWO A;  4ZNX A;  5IXB A;  3RBB B;  4HVW A;  1A0N B;  1SRL A;  2LJ0 A;  1BK2 A;  3REB B;  2BZ8 A;  1KIK A;  2DIL A;  1YCS B;  1UUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...