1ARKA

Sh3 domain from human nebulin, nmr, 15 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords NEBULIN
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1arkA00
2V1QA 3VRZA 4LNPA 2CH4W 4LE9A 2YSQA 3I35A 3VS6A 3NHNA 2KT1A 1WXUA 3TVTA 1JO8A 2K6DA 5GJWB 3GBQA 1SRLA 1CKAA 2RQUA 3UF4A 1HD3A 2DBKA 1SHGA 1WFWA 4JJCA 5IXBA 1K9AA 4ESRA 2YUNA 3VS0A 2A08A 2DVJA 2O9SA 2A28A 2FPEA 3TSZA 2AZVA 1JXMA 4J9IA 3I9QA 3RBBB 2KR3A 3C0CA 1WI7A 4KRTA 2YUPA 2XMFA 2CT4A 4DEYA 1UHCA 3EG0A 2LJ1A 2PNIA 3M0SA 1ZUUA 4CC2A 2CREA 4AFQC 3I5SA 1RLPC 2DLPA 2DRMA 2DBMA 3ULRB 2DILA 4OMPA 1M3CA 2W10A 1ZX6A 1AOJA 1QWEA 3EG2A 2KNBB 1GFCA 1OOTA 2C0TA 4HVVA 2J6OA 2JS0A 1EFNA 2OJ2A 2PTKA 1G2BA 5GJVB 1K0XA 5HCKA 2L3SA 2J7IA 3FJ5A 2NWMA 2KYMA 2BTTA 4EIKA 2K7AA 3VRYA 3EG3A 3UA7A 2A37A 3H0IA 2EGEA 1VYUA 2VWFA 2RQVA 4IIMA 1E6GA 2LJ0A 2RF0A 1PRLC 4JJDA 4CC7A 4HXJA 1OPKA 4FSSA 1XOVA 2YDLA 2FG0A 4M4ZA 2EYWA 2KXCA 1CSKA 1MV3A 2DL3A 1X43A 1JQQA 1T0JA 1NYGA 5EC7A 5FWBA 3PE0A 1X27A 1K76A 4J9GA 1BU1A 2D0NA 4J9CA 4A63B 1X2QA 1K0SA 4E6RA 4R0KA 1ZBJA 5IXFA 4RUGA 1AWWA 4Z88A 1MUZA 2GTOA 1AD5A 1GL5A 1TUDA 1M8MA 2YT6A 1PWTA 2DL7A 1GFDA 2AZSA 3LH5A 5I22A 2KE9A 1OV3A 5FW9A 2L3QA 1Z9QA 2ENMA 2F2VA 1ABQA 1B3QA 3O5ZA 2LZ6B 2AKKA 2EGAA 2LQWA 2F2XA 2D8JA 4J9HA 3NMZC 2A36A 2ROTA 1BBZA 1H92A 4CC4B 4JPBW 2LMJA 1UDLA 2SRCA 4GLMA 2P4RA 1UFFA 4IIOA 2DJQA 4AFSC 1WYXA 2DL8A 4OMMA 4X1VA 1WXTA 2X3XD 1G83A 3VS5A 4JZ4A 5IH2A 3UATA 4Z89A 2DL4A 2KGTA 1JXOA 1PKTA 2DX1A 1I07A 1AVZC 1WA7A 2DM1A 1T3SA 2EKHA 1UGVA 2EYXA 1WIEA 2YUQA 4CC3A 1U3OA 1NG2A 1YN8A 2EYYA 2LCSA 2JT4A 2M0YA 3A98A 2J06A 1QWFA 2LX7A 1GCQC 2DE0X 3IQLA 1BK2A 2HEQA 1W1FA 1AZEA 3M0RA 1U06A 1TUCA 1N5ZA 1UG1A 1M27C 2RQWA 2J6FA 4D8DA 1VA7A 1PKSA 2LP5A 2VKNA 2K9GA 4JJBA 2BZ8A 1K1ZA 2JMCA 3VS2A 3UA6A 2HDAA 2I0NA 2W0ZA 1W6XA 1VYVA 3REAB 4Y92A 3ZL7C 4HVWA 1UJYA 2FRWA 1AWJA 2ECZA 2O88A 2VVKA 2O31A 2EBPA 1WX6A 2DF6A 1FYNA 1RUWA 4AG2C 2JMAA 1AWOA 2K2MA 2K3BA 1NLPC 1Y0MA 4AFZC 4DEXA 2IIMA 4AG1C 3H0HA 2LQNA 2KRMA 5IHIA 3M0PA 3R6NA 1AWXA 2KBTA 2F2WA 2MOXA 3EG1A 3VS7A 4RTZA 4GBQA 4J9DA 1VYTA 4OMNA 4OMQA 1AZGB 4F16A 1AEYA 3VS4A 4RTTA 2AK5A 3RNJA 2KXDA 4RTUA 4RTWA 1NLOC 2JTEA 3TSWA 5L23A 2C0OA 2KT8A 2KRNA 3PVQA 2ROLA 3SHWA 2J6KA 3M0UA 2EVRA 1T0HA 1GCQA 1E7OA 2DYBA 2CT3A 1QKXA 1KIKA 2L3PA 1SPKA 1H3HA 2FPFA 3EGUA 2KEAA 2DMOA 4Z8AA 1YWOA 2KYBA 1RI9A 2L0AA 2AKLA 3NPFA 2OI3A 1UTIA 2O2OA 2JS2A 1PHTA 2M51A 2K79A 3VS1A 1GBRA 4LN2A 2GNCA 4ORZA 2B86A 2EQIA 3I5RA 1WXBA 1W70A 1UECA 5I11A 1S1NA 2CSIA 2RN8A 5FWCA 4WCIA 2E5KA 2X3WD 1ARKA 1OEBA 5IHKA 4J9EA 4HCKA 2ED0A 2D8HA 1SRMA 4OMOA 2V1RA 1X6GA 2MCNA 2FPDA 1IO6A 2G6FX 4QT7A 1SEMA 1ABOA 3QWYA 2C0IA 1BB9A 1KFZA 1TG0A 3VS3A 2JW4A 4J9FA 1JEGA 1ZUYA 1UJ0A 1GCPA 3JV3A 4D8KA 1H8KA 2FO0A 1YP5A 2GQIA 2JM9A 4HVUA 3M0QA 1QKWA 2PZ1A 1HJDA 4F17A 1SHFA 1U5SA 2ESWA 1GRIA 1ZLMA 1J3TA 4ZNXA 2LNHB 1X69A 1LCKA 3PVLA 2ABLA 1PRMC 2EW3A 1K4US 1I1JA 2HBWA 1FMKA 5ECAA 2CH4A 1NM7A 4LUDA 1KSWA 2L2PA 4JZ3A 4F14A 1X6BA 3REBB 1Z9ZA 2RNAA 1ZUKA 2LJ3A 1MV0B 1YNZA 1JU5C 4RTVA 2DRKA 2DNUA 2RPNA 1NYFA 1I0CA 1T3LA 1V1CA 2BZXA 2YUOA 2DL5A 2FEIA 2H8HA 2HCKA 3EHQA 1RLQC 5IHNA 2RQRA 1QLYA 2GBQA 1CKBA 2JM8A 1M3AA 1YWPA 2GGRA 1PNJA 2RQTA 1B07A 1X2KA 1NEBA 1Y57A 2O9VA 1HSQA 2KROA 1UE9A 1YCSB 2D1XA 3H0FA 2HSPA 2RMOA 1UUEA 2JXBA 1GBQA 3M0TA 3U23A 4RTYA 4AFUC 4OMLA 3SEMA 2CUDA 2EPDA 2NUZA 3NGPA 2DA9A 3QWXX 4K11A 2KRSA 3THKA 4J9BA 1QCFA 1E6HA 2EGCA 2BZYA 2CDTA 1ZSGA 3CQTA 2CUBA 3H41A 1WLPB 2CSQA 1KJWA 1WDXA 2QDLA 2GTJA 3EHRA 2SEMA 1M3BA 2J05A 2OAWA 4LUEA 3KFVA 1SSHA 2FRYA 4RTXA 2ED1A 1NEGA 2EYZA 1OPLA 1A0NB 2MIOA 1M30A 1UHFA
chains in the Genus database with same CATH superfamily
4PJOD 2K5LA 3N5BB 3JCMh 5GAOm 3I35A 5FRNA 4XU3A 4PKCC 2L8DA 2P84A 3CC7Q 3AHUA 3CMET 3A8OB 1HD3A 4KGZB 4JJCA 5IXBA 4JRKA 2O4XB 5KH6A 2PVGB 4ESRA 2CYZB 2A08A 2DVJA 1FMVA 2F5TX 2O9SA 2AIRB 3I9QA 2O01E 2CGHA 3RBBB 2D6FA 5KE3A 4KRTA 2YUPA 2RD1A 2RI3A 2X51A 3EG0A 3M0SA 1VQMQ 4P5NA 2CREA 4CC2A 4AFQC 3I5SA 4XTWA 2RO0A 2JN0A 3D7SB 2W10A 1ZX6A 1AOJA 1QWEA 1XJWB 3EG2A 3V8KA 4PJOG 2KNBB 1ZQ1A 2COWA 1OU9A 4PJMA 3S3OA 4HVVA 4HT9A 3OS1A 3QBYA 1EFNA 2E1HA 4DBHA 1IHVA 2J7IA 3FJ5A 4EPCA 4M75C 5CAIA 4RMOA 1YJ9T 4FYYB 2VWFA 2RQVA 2OTLQ 2LJ0A 3KBGA 1K8AR 1YITQ 1AHJB 4YTLA 2LCCA 2YDLA 2JTMA 2RI5A 2EYWA 2KXCA 4D6WA 5GAN6 4M78F 2QG9B 2EIFA 4C5GA 3G6EA 2YRVA 3BDUA 3LGFA 2FYKA 2XU8A 5CKDA 4TVRA 1K0SA 4E6RA 5GAMj 2QQSA 3P8DA 5J3BA 5L8RE 3CCLT 1XTDA 3A8HB 1Q82C 1AWWA 2Y4XA 1MUZA 1P92A 4M78E 1AD5A 1GL5A 2ZZDA 2DXCA 3C4SA 1LJOA 1PWTA 2DL7A 2O4XA 4M78A 3E1SA 5I22A 4ZN1A 3JCMg 1QCNA 3RESA 1Z9QA 3RMSA 1I4K1 2YRDA 2F2VA 1ABQA 1JRIA 3CPWP 2LZ6B 3HRUA 2F1LA 2D8JA 4J9HA 4ZGJB 3CPFA 2BUDA 2A36A 2ROTA 4NL3A 1Q81U 4CC4B 2LMJA 2SRCA 4OF1A 3TEEA 4GLMA 1UFFA 4IIOA 4M75A 3SWNA 3CXCP 1KD1R 1WXTA 1G83A 2PUKB 3H9NA 1VQKA 4MZMA 1VQOT 4M75E 4C8QD 1PKTA 3OYJA 4IUVA 4N4GA 4CC3A 5FU7B 3ASKA 3NFCA 3CCSA 1VQMA 3S3NA 1YN8A 2EYYA 2JT4A 2DJZA 4DQ2A 2M0YA 2J06A 2LX7A 2VGNA 4C0DC 4BD3A 4M7AB 3HPWA 2DE0X 4XTXA 2NUTA 1AZEA 5GMKe 4E47A 3META 2QQRA 1N5ZA 2QTVA 5GANg 1NZ9A 2RQWA 1I8FA 4D8DA 1VA7A 2BE9B 4PJOE 1Y7XA 4M77F 3VYHB 4BI8B 1MMDA 3RIRA 4E7IA 3OSSC 1RADB 4O5VA 5KYUB 1KC8C 1VQ8Q 2RHZA 4HCCA 3JB9I 2E5QA 1UJYA 2NUPB 4BY6B 2O88A 1PD1A 1WX6A 3GPLA 1FYNA 5GMKj 1AWOA 2E6NA 3G4SQ 4J8OA 3JCMW 4M77A 5DY9A 2EQUA 3CPWA 5GAOp 1TSFA 5LJ3g 2WSEE 5IHIA 1XNIA 2KY9A 4FYXB 2DEUA 2QEXQ 4XTYA 5DLQE 1IREB 3MJXA 1AWXA 3WVEB 3JRZA 2LC4A 3VS7A 3CXCS 4J9DA 4C92E 4OMNA 3OYGA 1AEYA 2DIGA 1BCOA 2AK5A 2FVUA 1YHQT 4RTWA 2GF7A 1NLOC 1F1BB 1BI3A 2PUOB 3JCMX 2ZAEA 4FT4A 4GY5A 2ROLA 3M0UA 1GCQA 3EH1A 3OYFA 4C5IA 1ZSZA 4ZTJA 3EGUA 3HRTA 4OMFB 4Z8AA 1KD1U 2VV5A 4Y91A 4MDXA 1YWOA 1NBEB 1RI9A 2OTLA 4BY6C 1IGQA 3FIFA 5KCHA 2JS2A 1PHTA 3FRNA 1FMWA 3G4ST 2GNCA 4ORZA 2A7YA 2B86A 2HNIA 1WXBA 3KUFA 4QQDA 1UECA 3M54A 2RN8A 3FC3A 1G3TA 1UGPB 1VIFA 3QZ9B 4Y28E 3DB3A 2X3WD 3VUZA 3L1AA 2ED0A 2V1RA 4ZGDB 2HSEB 1HYOA 2MCNA 5I2SA 1YI2Q 2LX9A 1IO6A 4MMLA 1ABOA 2C06A 3CC2Q 4M75G 3SDZA 1NJIU 3OYAA 1KFZA 3VS3A 1JEGA 4XU2A 1BYMA 3CEYA 2MI6A 1QP2A 2QQ9A 3BY7A 3JCMd 2ESWA 1IXDA 1GRIA 5CKBA 5FU7C 1J3TA 3QXEB 1M1KC 1LCKA 3RKYA 2KAFA 3MKDA 2QK0A 4J6WA 5GAMe 1K4US 5C6SA 5LL6S 1D1BA 1SG5A 3BE3A 5LJ5g 4F7UE 4IUPA 1NM7A 1OQKA 2JOYA 3JCMQ 3JAME 1RAHB 1MMAA 4XTUA 2VGMA 3REBB 1Z9ZA 1ZUKA 1R0CB 3LLRA 1PC0A 2LQ8A 3RDVA 5GAN7 1OZ2A 1K9MU 1D3BB 2GBQA 1CKBA 1YWPA 2GGRA 2LT1A 3CMEA 1PSEA 5KYWA 1M1GA 1Y57A 3OYIA 2O9VA 2ZGWA 1HSQA 3VYGA 3A8LB 1KHCA 1MHNA 3FLGA 2Z0WA 1YJWA 4JRIA 1GBQA 1RAEB 1K8AU 1G3YA 4R56A 3EG9B 4OMLA 2CUDA 3JCMe 3QYHB 3THKA 2DA9A 4K11A 2KRSA 4RCCA 4M7AD 1VQ5A 5KCOA 2BZYA 1MNDA 1ZSGA 4DBRA 1U1TA 2QA4A 3LYIA 2QDLA 1M90C 3SB2A 2JUFA 4E7KA 2GTJA 2HMAA 3EHRA 2J05A 4L5GA 1SSHA 2IPOB 3OYHA 4NL2A 1NEGA 2EYZA 1OPLA 1RAAB 4LNPA 3FEOA 2XHCA 2HKQB 2DPPB 3CBMA 3NHNA 2KT1A 5M9OA 3RERA 1SRLA 2K3YA 3PMTA 2OTLT 2DBKA 1WFWA 1QW1A 2KDSA 1BCMA 2YUNA 1VQLQ 2A28A 1X75C 2AZVA 3MP8A 2E65A 4CI0C 4RCBA 2MWPA 3CCRQ 2XMFA 4B9XA 3I55Q 5FROA 1ZUUA 3OYCA 3L2QA 2CP2A 2QDYB 2DRMA 2DBMA 2KSSA 2BIVA 2M16A 3CCUA 1M3CA 4M7DB 1C1AA 5KYWB 3F70A 1GFCA 2DIQA 4XQ3A 2C0TA 2DKGA 1M2VB 2PTKA 4J83A 5GJVB 5HCKA 1QP3A 2NWMA 5DM7R 2KYMA 2BTTA 3VRYA 2A37A 1WJSA 2EGEA 1VYUA 5D7UA 4IIMA 1E6GA 2HQXA 2OTJA 1PRLC 4CC7A 2YLBA 1BIAA 1OPKA 4FSSA 4J7FA 4M4ZA 5GAN5 3FDRA 5LJ3d 4PJOB 1FX7A 1MV3A 2M1HA 2DL3A 3QSUA 1YHQA 4F7UF 4BACA 1K76A 1BU1A 3RR6A 2DD5A 1WHJA 2BKDN 5LJ5e 2ZPFB 2VYTA 2HBPA 3EFRA 1GXIE 1ZBJA 3UPUA 5GAMd 3DB4A 4Z88A 3RUXA 2M9UA 5FU6B 1UB4A 1M5Q1 2CP6A 2K5IA 3OYYA 1GFDA 3HRSA 2PQWA 2K2VA 4J6YA 4M77D 5FW9A 4F7UA 2RK2A 2R57A 3JB9F 2EGAA 2LQWA 3QHSA 3CCMT 1QVFP 1UGSB 3OYNA 1BBZA 1H92A 4M75D 4C8QE 2GCXA 4JPBW 5HK0A 1G8XA 1TU0B 3QYGB 2P4RA 2K3XA 4X9CA 1S72A 4AFSC 1WYXA 2DL8A 3NTIA 4M7AC 4X1VA 4AT1B 1KQ1A 5LJ5h 2X3XD 3BW1A 3CCLQ 4JZ4A 3LX7A 3UATA 4Z89A 3URGA 1R8OB 3TU4K 2DX1A 1WA7A 1IZ6A 4M7DD 3VUBA 1ACMB 3DLMA 1YI2T 1U3OA 4A54A 2LCSA 4ZGEB 1QWFA 1GCQC 1K9MC 1BK2A 2HEQA 1C0MA 1G5VA 1W1FA 1KHIA 8ATCB 1VQ7T 1ZSZC 5KYXB 2JVVA 4EMGA 4DOVA 2E12A 2J6FA 2HQEA 3OYBA 1PKSA 3A5ZB 5GAN4 2VKNA 2FHDA 1VQPT 2K9GA 4FM4B 3CCMQ 1V29B 1WQ7A 1JJ2P 4E2FB 3I56A 1K1ZA 3VS2A 3UA6A 2HDAA 2I0NA 2W0ZA 4EMKC 2QA4T 4M7AF 4FU6A 1VYVA 3REAB 1KQ2A 1ZSZB 4NS5A 3CCVA 1AWJA 1MGQA 5GAMg 4C8QC 2ZPHB 2E64A 4JS4A 3JCMf 2DXTA 2ZPEB 1D0ZA 1RUWA 2X4XA 1LNXA 2EAYA 2K3BA 1NLPC 3SFMA 1M1KR 4DEXA 3QKJA 1VQOA 4AG1C 4F7UG 1C6VX 2I2LA 1VQ4A 3CD6A 2VB6A 3ER0A 4Z02A 4O6JA 1QVFA 3I55T 4M7AA 1I5LA 3R6NA 3VJPA 2MOXA 3EG1A 1ZHIA 3CBPA 3OW2P 4RTZA 2MYSA 2FZCB 2QGFB 3A1PA 3VS4A 4QVDA 4RTTA 2KXDA 4RTUA 3TSWA 3BFMA 2CP7A 3EG9A 2RJCA 1RACB 1VQKQ 3HHTB 3MPUB 3SHWA 2X9HA 1D0YA 1Q7YU 2FZKB 1E7OA 1ZA1B 2CT3A 2QI2A 3CPWS 2CP0A 3V8JA 4M75B 4CRIA 1VQNT 1SPKA 2FPFA 2DMOA 2OTJT 5FRMA 2LVMA 4C92C 5GANf 2O2OA 1NE8A 4KH1B 3CCRA 2JNGA 3PIPA 4LN2A 2EQIA 2XIDA 3I5RA 4MZPA 2WSCE 3BDLA 1S1NA 1X01A 3X25B 1UEBA 2VC8A 2DETA 2E5KA 1MNEA 3TCJA 1JJ2A 4VUBA 5CCAA 2OAUA 2EWNA 4QQ6A 1M90R 1SRMA 3CMEQ 3MEUA 3CC7A 1X6GA 1FXXA 2FPDA 1BKBA 2G6FX 5CKFA 4QT7A 2DFUA 1SEMA 2L5QA 3QWYA 5GANe 3L2RA 4BE2A 4C8QB 1TG0A 4EMHA 1OYXA 4J9FA 1BI2A 1K8AC 1H641 4PFPA 1UJ0A 1GCPA 3JV3A 4D8KA 2JM9A 2GQIA 1SSFA 4HVUA 3UWNA 1QKWA 1VQNQ 3JCMV 1WQWA 2ZCFB 1WHLA 4AMCA 1SHFA 2RJDA 4PJJA 3LWHA 1ZLMA 4ANJA 3CC4T 1R0BG 4HA8A 1M8VA 1X69A 3V7RA 2QAZA 1VQMT 1YJNT 1PRMC 6AT1B 1D0XA 1I1JA 4OB2B 2KVQG 4X9DA 5ECAA 4QVCA 1Q82R 3OW2A 1VQLT 4E7JA 2L2PA 5LJ3j 3M9QA 4JZ3A 3CCVT 1X6BA 2GFAA 2DEQA 4L59A 5A0LA 2HD0A 1DJ7B 2DNUA 1WHKA 1NYFA 1I0CA 1T3LA 2VXFA 5AYFA 1Q7YR 2DD4A 2QTXA 2H8HA 2R5MA 1YITT 3CC2A 3CCJQ 3HSBA 2QEXT 4JLGA 2HAXA 1QLYA 2YWWA 2HL3A 1M1KU 1PM3A 1U1SA 3T9NA 4ZTFA 4XTZA 3HTRA 2RQTA 4C92B 2X35A 2Y90A 5A2QE 1K9MR 2V8KA 2D1XA 3QDFA 4JDSA 5GAOq 2HSPA 2RMOA 4A4EA 2E70A 4LD9K 5GAN8 2DAQA 2NUZA 2EPDA 1NJIC 3OYMA 3MP6A 5D6XA 2FZGB 3QWXX 4J9BA 1QCFA 1E6HA 2EGCA 4C92G 3E2UA 5C0MA 4ME7A 3CQTA 1W2BA 4KGVB 3OBYA 1WPYA 5GANh 1RAGB 1QVGP 2PU9B 5A0DA 2K4YA 4HCZA 3CCEQ 2FRYA 3NTKA 2COZA 1WJQA 5LJ3e 2YXYA 1VQ6A 1U8RA 4N4IA 3VRZA 2CH4W 4LE9A 2MPXC 4LD6A 3GNGA 1M2VA 3VS6A 2QXFA 1LOJA 3TVTA 3CC4Q 1JO8A 2K6DA 1KD1C 5GJWB 1BI0A 3GBQA 1KC8R 3EFOA 1SF9A 4OVAA 3G4SA 3C95A 5CKHA 2FPEA 3TSZA 3SWNC 2KR3A 3C0CA 5KE2A 2RI2A 2CT4A 2OX7A 4DEYA 4XU0A 4C8QG 4A4GA 1VQ5T 2DLPA 1I5OB 3ULRB 4OMPA 1V76A 3I56Q 4BB7A 2YRCA 3OW2S 2Y4YA 3QO3A 4XAXB 3LWIA 2KQWA 1OOTA 2QQBA 4PJOA 3CCRT 2CZ1B 2OJ2A 4LDUA 1G2BA 1K0XA 2DTIA 2E3IA 1VQ6T 1ZBXA 1RL2A 2QEXA 3L42A 5AT1B 3EGDA 3CCSQ 1N6AA 2RF0A 2LTOA 4JJDA 4HXJA 1ZA2B 1KC8U 1XOVA 2FG0A 1VQ9Q 3C94A 3PIOA 4OB3B 1WHGA 3S6WA 1CSKA 1WJRA 2QASA 1VQPQ 1JQQA 4KUDK 1T0JA 1NYGA 3OBWA 5FWBA 1X27A 4J9GA 5D6WA 4J9CA 2V8IA 4J5YA 4RG8A 1BI1A 4R0KA 5IXFA 4FIBA 2RHXA 4RUGA 1YJNA 1WGSA 3RMQA 2F5KA 1M8MA 5GMKi 3J80E 4IURA 3VV0A 4FL6A 2AZSA 3LH5A 2NUPA 2CP3A 2QQAA 3PMIA 1OV3A 4DBFA 3G71Q 4M7AG 4JUVA 4PLIA 2FB7A 3O5ZA 2AKKA 5GANd 3SD4A 3X24B 2F2XA 3KXTA 2CKKA 5CQXA 1YJ9A 3M56A 1VQ9T 3CC7T 3NMZC 4IUQA 3CCQA 1UDLA 4M7DE 2K57A 1M9SA 1QVFS 2DJQA 3H6ZA 2LQKA 3VS5A 5IH2A 2KGTA 1JXOA 5D6YA 1I07A 2EKHA 2EYXA 5LJ3f 2EJFA 2OTJQ 2JTFA 5DLOA 1NG2A 4EMKB 3OYEA 1Y96A 3I55A 4J6XA 3A98A 1VQ8T 1HXDA 3E19A 1OU8A 2CS7A 3M0RA 1U06A 1TUCA 3V8LA 3Q1JA 3SWNB 4MZTA 1K73C 1VIEA 1UGQB 3M55A 3OS0A 1YFNA 1NPRA 2EJGA 3MO8A 4C92A 3VKIA 4A53A 3M5AA 3CC4A 4JJBA 1N27A 2FL7A 3V7SA 2BZ8A 2MK5A 3PGGA 1VQNA 1YCYA 1W6XA 4KGXB 3AT1B 2NLUA 5GAOl 4C5HA 4HVWA 3L2WA 2FRWA 4JS5A 2VVKA 4BDZA 2DZCA 1TH7A 2LRQA 3EGXB 2B8AA 4AG2C 2JMAA 3JSCA 2K2MA 4ELZC 3CD6Q 2MMPA 2XI9A 1Y0MA 3EH2A 3M4YA 2VUBA 1YIJQ 3V7CA 4X34A 5CR2A 2P0QA 1N8RR 4HCBA 3M0PA 1RABB 5FU6C 2F2WA 3J81E 1OZ3A 1Y96B 1VYTA 1Y71A 3MCAB 3CXCA 4OMQA 4C0FA 3X26B 4EDUA 5L23A 2GFUA 3GF5A 3OYDA 2C0OA 4V2SA 2KRNA 4ELYC 2F69A 2YLCA 2M0OA 2DYBA 2BE7D 4XU1A 4N0AA 1QCOA 2KEAA 3PT9A 4II1A 3QUIA 3E9GA 4KUIA 3ME9A 2D0QB 4F7UB 2KYBA 5KYYB 3FJPA 2AKLA 5EG2A 3QG1A 3NPFA 2OI3A 1UTIA 4J7IA 4FT2A 4MMKA 2K79A 1W2BS 3VS1A 4A4KA 5I21A 3H8ZA 3M53A 5I11A 3UT1A 5FWCA 1ARKA 1OEBA 1R77A 1N9SA 1YIJA 5LJ3h 2H3JA 4OGCA 5IHKA 4J9EA 4HCKA 1Q81C 2JZ2A 2LCLA 1FWZA 3RKXA 4E7HA 3J7AF 1K73R 4M7AE 2LNVA 2X4WA 2C0IA 1BB9A 3HFNA 4PK4A 1TUGB 3X20B 1ZUYA 4ZN3A 1H8KA 2FO0A 3JB9G 4N4HA 3M0QA 4UC4A 2RM4A 1IGUA 3OS5A 1HJDA 4WF2A 5LJ5d 4F17A 1U5SA 1MMGA 2A3LA 5KYNA 3OS2A 4ZNXA 3FB9A 2ABLA 3MEVA 1W4SA 2WSFE 2HBWA 3OMCA 2DTHA 2JJ9A 4JJNK 1Q81R 5FLXE 3O8VA 2RNAA 2LJ3A 1MV0B 3GNFB 5GAN3 4OGEA 1N8RC 2DRKA 2RPNA 4N0AC 2DTOA 1WHMA 1Q95G 4M7DA 3EGXA 2DL5A 1KQSA 7AT1B 2HCKA 1RLQC 5IHNA 2XDPA 2A0FB 3JB9J 3CCMA 1AT1B 1YI2A 1MMNA 1M3AA 2JM8A 2EFIA 1M2OA 2R5AA 5HY6A 3GIBA 1WZOA 2EQMA 3JCMb 4PFOA 5IN1A 4JRQA 2QGGA 5KYXA 1N9RA 2EYQA 3EFSA 3S3MA 3JCMP 3LW5E 4ATOA 4E7LA 2JXBA 3M0TA 3U23A 1JJ2S 1VQKT 4RTYA 3NGPA 4MDWA 3JCMJ 1G3WA 2VASA 2M02A 1QMCA 1VQ4T 2CDTA 3JB9D 4LDYA 3H41A 2CSQA 5LJ5f 1KJWA 1WDXA 3DLLA 4DOWA 4PJOF 1Q86U 4BI3A 3PTAA 3M57A 2SEMA 4A4HA 2LT4A 2OAWA 4LUEA 3KFVA 1NPPA 4PJNA 4RTXA 1A0NB 3OY9A 3G71T 1M30A 1UHFA 3MP1A 2V1QA 2ATCB 2HKNA 2YSQA 3JB9H 2WACA 3CD6T 1VOMA 3CBOA 2XD0A 1WXUA 1G3SA 3OMGA 5GAMh 1I81A 1CKAA 2RQUA 3DKMA 3UF4A 4BUGA 1SHGA 4PL6A 1VUBA 4BE0A 1UGRB 1K9AA 4M7DC 2RHIA 3VS0A 3GP8A 2DYIA 1K73U 1JXMA 4J9IA 4BDYA 1EIFA 1QQJA 2HZYA 1WI7A 2HQHA 1KQSP 1UHCA 2LJ1A 2PNIA 3QJ6A 1D3BA 4M7DG 3GLXA 1RLPC 1IHWA 9ATCB 2DILA 1H3ZA 3NTHA 1OULA 2ZPGB 1VQ8A 2CZ6B 3HKSA 3CCEA 2J6OA 2JS0A 3HL8A 1S72Q 4C8QF 4BE1A 2P4TA 2L3SA 3G1JA 1VQ5Q 2X4JA 4EIKA 2K7AA 3EG3A 3M59A 3UA7A 3I56T 3H0IA 1X6OA 4RG2A 2X4YA 3PFSA 3WVDB 4JRPA 3QZ5B 2DO3A 1PD0A 2RK1A 4PLLA 1D09B 5GMKm 1VQLA 1EZZB 2RB6A 2DZ9A 3M58A 2V8JA 1RAIB 4C8QA 1X43A 2XICA 2CP5A 5EC7A 5CKEA 3PE0A 4QQGA 3TREA 1YIJT 2G3RA 2D0NA 3LGLA 4A63B 1X2QA 2DK3A 1M90U 5GAN2 1B34B 3EAEA 3CCUT 5LJ5j 5IAYA 2GTOA 4IUTA 3OB9A 1BIBA 4FW1A 1TUDA 3OSVA 2AT1B 3G6EQ 1YHQQ 2XKOC 2YT6A 3TQ7P 5CO7A 4C92F 2COYA 5I2MA 2XDBA 1OI1A 2KE9A 2R58A 2L3QA 4XK8E 4M78D 2ENMA 4M78G 3UDCA 1B3QA 1SKUB 4B9WA 2K5FA 5CK9A 2E4HA 1PCXA 5GAMf 3CMAT 3EGDB 2V26A 1PSFA 4OMMA 3A8MB 2RH2A 2L3RA 1B7TA 5CIUA 2NUTB 1WHHA 5HK3A 5J39A 2DL4A 4FSXA 3CCJA 3LH0A 2XG8D 2PVDB 1AVZC 2DM1A 1T3SA 3P8HA 3CCUQ 1UGVA 1WIEA 2YUQA 1XQHA 3CCQQ 1YITA 3CC2T 2E6ZA 2E10A 3E9FA 2RJEA 3ZEHA 1YJ9Q 1O75A 5J26A 3IQLA 1D1AA 2DVEA 2XDDA 2ZPIB 4LDWA 3ZBDA 1JBMA 1TS9A 1UG1A 4IKFA 1M27C 1YJWT 4A4FA 1HK9A 2LP5A 4QW2A 1EX4A 5KYUA 2JMCA 4OB0B 2P0KA 3QPHA 3CCVQ 3EFOB 1YJNQ 2LDMA 4Y92A 4C0GA 4KBMB 3ZL7C 2RA2A 1Q7YC 2EQKA 2ECZA 4KH0B 2O31A 3C12A 2EBPA 2DF6A 2HL5C 4M75F 3L2VA 5KYYA 2GQVA 5HKCA 3CCJT 4AFZC 4PNOA 2IIMA 3QIIA 3H0HA 2QA4Q 2IVWA 2LQNA 1TWBA 2KRMA 4B6MA 1KQSS 2MWOA 2CZ0B 2RJFA 4PJLA 2KBTA 1Q82U 4GBQA 3PNWC 1NJIR 1YJWQ 4HT8A 1VQ7A 4F04B 4M78C 3RKWA 1AZGB 4M77E 4F16A 3OA6A 3RNJA 1TXQA 2JTEA 2ZPBB 3QDRB 1Q86R 1OX9A 2KT8A 3PVQA 2J6KA 2EVRA 1T0HA 1KK7A 4C92D 4L6V5 1QKXA 1KIKA 5GMKl 2L3PA 1D1CA 4LDXA 1H3HA 3R6OA 3L2UA 1RAFB 3CCET 2L0AA 4M78B 4C5EA 1WNLA 3VU3C 2M51A 5GAOn 1GBRA 2YHTA 4M7DF 4OB1B 1W70A 3G71A 5CQYA 2QYZA 2CSIA 3OYKA 4WCIA 4QVZA 1VQ4Q 4R55A 2EJ9A 2E3HA 1OX8A 3X28B 4WTOB 1VQOQ 4KT0E 3GOXA 2D8HA 4OMOA 3CCLA 2VXEA 3OYLA 1Q86C 4NOYA 1W2BP 4GLKA 4JLIA 1KG1A 2D9TA 3CMAA 3MHXA 4C0DB 1M1FA 1QVGA 2JW4A 2EQJA 4FCYA 1VQ7Q 4DA4A 2RHUA 1LPLA 1YP5A 4Q5WA 2L89A 3G6ET 2PZ1A 1PG5B 3QJYA 3G7ZA 1QVPA 4RKUE 1VQPA 2LNHB 3L2ZA 8AT1B 2P0PA 4EMKA 3JCMc 3MEAA 3PVLA 5IT9E 2EW3A 1VQ9A 4QKUA 5GMKh 4M77G 1TOVA 3A8GB 2KMTA 1FMKA 2CH4A 1JB0E 4LUDA 1KSWA 2DXBA 2DERA 4F14A 2AHJB 3OQ5A 1IRXA 2CZ7B 1S72T 2XK0A 3MEWA 4FYWB 2NYSA 3P8BB 1YNZA 4KULA 4E7SA 1JU5C 4RTVA 4M77C 4PJOC 4M77B 3HFOA 1N8RU 2DXUA 1VQ6Q 2EKOA 4OP0A 4BI4A 1V1CA 1RI0A 2BZXA 2MF2A 2YUOA 2FEIA 4IUUA 4LDVA 3EHQA 3CMAQ 2RQRA 4HKEA 3ZFJA 3CCST 1PNJA 2KI7A 4PFZA 3CCQT 4LXCA 1B07A 4C0ZA 1X2KA 5GAOr 3HP9A 1NEBA 1B34A 1TTHB 2KROA 2H3EB 4FYVB 1UE9A 1YCSB 3H0FA 1UUEA 2PVOB 4AFUC 3SEMA 5GANj 4XTVA 5A0GA 3INZA 4E7ZA 1M4ZA 2CUBA 1WLPB 3WXMB 4DBQA 2E41A 2KK4A 4FW2A 1IB8A 1M3BA 2MAMA 2IG0A 1QVGS 3M4GA 5CVIA 1YBYA 1O9SA 1LVKA 2ED1A 2RHYA 2MIOA 1Y07A
chains in the Genus database with same CATH topology
2V1QA 3VRZA 4LNPA 2CH4W 4LE9A 2YSQA 3I35A 3VS6A 3NHNA 2KT1A 1WXUA 3TVTA 1JO8A 2K6DA 5GJWB 3GBQA 1SRLA 1CKAA 2RQUA 3UF4A 1HD3A 2DBKA 1SHGA 1WFWA 4JJCA 5IXBA 1K9AA 4ESRA 2YUNA 3VS0A 2A08A 2DVJA 2O9SA 2A28A 2FPEA 3TSZA 2AZVA 1JXMA 4J9IA 3I9QA 3RBBB 2KR3A 3C0CA 1WI7A 4KRTA 2YUPA 2XMFA 2CT4A 4DEYA 1UHCA 3EG0A 2LJ1A 2PNIA 3M0SA 1ZUUA 4CC2A 2CREA 4AFQC 3I5SA 1RLPC 2DLPA 2DRMA 2DBMA 3ULRB 2DILA 4OMPA 1M3CA 2W10A 1ZX6A 1AOJA 1QWEA 3EG2A 2KNBB 1GFCA 1OOTA 2C0TA 4HVVA 2J6OA 2JS0A 1EFNA 2OJ2A 2PTKA 1G2BA 5GJVB 1K0XA 5HCKA 2L3SA 2J7IA 3FJ5A 2NWMA 2KYMA 2BTTA 4EIKA 2K7AA 3VRYA 3EG3A 3UA7A 2A37A 3H0IA 2EGEA 1VYUA 2VWFA 2RQVA 4IIMA 1E6GA 2LJ0A 2RF0A 1PRLC 4JJDA 4CC7A 4HXJA 1OPKA 4FSSA 1XOVA 2YDLA 2FG0A 4M4ZA 2EYWA 2KXCA 1CSKA 1MV3A 2DL3A 1X43A 1JQQA 1T0JA 1NYGA 5EC7A 5FWBA 3PE0A 1X27A 1K76A 4J9GA 1BU1A 2D0NA 4J9CA 4A63B 1X2QA 1K0SA 4E6RA 4R0KA 1ZBJA 5IXFA 4RUGA 1AWWA 4Z88A 1MUZA 2GTOA 1AD5A 1GL5A 1TUDA 1M8MA 2YT6A 1PWTA 2DL7A 1GFDA 2AZSA 3LH5A 5I22A 2KE9A 1OV3A 5FW9A 2L3QA 1Z9QA 2ENMA 2F2VA 1ABQA 1B3QA 3O5ZA 2LZ6B 2AKKA 2EGAA 2LQWA 2F2XA 2D8JA 4J9HA 3NMZC 2A36A 2ROTA 1BBZA 1H92A 4CC4B 4JPBW 2LMJA 1UDLA 2SRCA 4GLMA 2P4RA 1UFFA 4IIOA 2DJQA 4AFSC 1WYXA 2DL8A 4OMMA 4X1VA 1WXTA 2X3XD 1G83A 3VS5A 4JZ4A 5IH2A 3UATA 4Z89A 2DL4A 2KGTA 1JXOA 1PKTA 2DX1A 1I07A 1AVZC 1WA7A 2DM1A 1T3SA 2EKHA 1UGVA 2EYXA 1WIEA 2YUQA 4CC3A 1U3OA 1NG2A 1YN8A 2EYYA 2LCSA 2JT4A 2M0YA 3A98A 2J06A 1QWFA 2LX7A 1GCQC 2DE0X 3IQLA 1BK2A 2HEQA 1W1FA 1AZEA 3M0RA 1U06A 1TUCA 1N5ZA 1UG1A 1M27C 2RQWA 2J6FA 4D8DA 1VA7A 1PKSA 2LP5A 2VKNA 2K9GA 4JJBA 2BZ8A 1K1ZA 2JMCA 3VS2A 3UA6A 2HDAA 2I0NA 2W0ZA 1W6XA 1VYVA 3REAB 4Y92A 3ZL7C 4HVWA 1UJYA 2FRWA 1AWJA 2ECZA 2O88A 2VVKA 2O31A 2EBPA 1WX6A 2DF6A 1FYNA 1RUWA 4AG2C 2JMAA 1AWOA 2K2MA 2K3BA 1NLPC 1Y0MA 4AFZC 4DEXA 2IIMA 4AG1C 3H0HA 2LQNA 2KRMA 5IHIA 3M0PA 3R6NA 1AWXA 2KBTA 2F2WA 2MOXA 3EG1A 3VS7A 4RTZA 4GBQA 4J9DA 1VYTA 4OMNA 4OMQA 1AZGB 4F16A 1AEYA 3VS4A 4RTTA 2AK5A 3RNJA 2KXDA 4RTUA 4RTWA 1NLOC 2JTEA 3TSWA 5L23A 2C0OA 2KT8A 2KRNA 3PVQA 2ROLA 3SHWA 2J6KA 3M0UA 2EVRA 1T0HA 1GCQA 1E7OA 2DYBA 2CT3A 1QKXA 1KIKA 2L3PA 1SPKA 1H3HA 2FPFA 3EGUA 2KEAA 2DMOA 4Z8AA 1YWOA 2KYBA 1RI9A 2L0AA 2AKLA 3NPFA 2OI3A 1UTIA 2O2OA 2JS2A 1PHTA 2M51A 2K79A 3VS1A 1GBRA 4LN2A 2GNCA 4ORZA 2B86A 2EQIA 3I5RA 1WXBA 1W70A 1UECA 5I11A 1S1NA 2CSIA 2RN8A 5FWCA 4WCIA 2E5KA 2X3WD 1ARKA 1OEBA 5IHKA 4J9EA 4HCKA 2ED0A 2D8HA 1SRMA 4OMOA 2V1RA 1X6GA 2MCNA 2FPDA 1IO6A 2G6FX 4QT7A 1SEMA 1ABOA 3QWYA 2C0IA 1BB9A 1KFZA 1TG0A 3VS3A 2JW4A 4J9FA 1JEGA 1ZUYA 1UJ0A 1GCPA 3JV3A 4D8KA 1H8KA 2FO0A 1YP5A 2GQIA 2JM9A 4HVUA 3M0QA 1QKWA 2PZ1A 1HJDA 4F17A 1SHFA 1U5SA 2ESWA 1GRIA 1ZLMA 1J3TA 4ZNXA 2LNHB 1X69A 1LCKA 3PVLA 2ABLA 1PRMC 2EW3A 1K4US 1I1JA 2HBWA 1FMKA 5ECAA 2CH4A 1NM7A 4LUDA 1KSWA 2L2PA 4JZ3A 4F14A 1X6BA 3REBB 1Z9ZA 2RNAA 1ZUKA 2LJ3A 1MV0B 1YNZA 1JU5C 4RTVA 2DRKA 2DNUA 2RPNA 1NYFA 1I0CA 1T3LA 1V1CA 2BZXA 2YUOA 2DL5A 2FEIA 2H8HA 2HCKA 3EHQA 1RLQC 5IHNA 2RQRA 1QLYA 2GBQA 1CKBA 2JM8A 1M3AA 1YWPA 2GGRA 1PNJA 2RQTA 1B07A 1X2KA 1NEBA 1Y57A 2O9VA 1HSQA 2KROA 1UE9A 1YCSB 2D1XA 3H0FA 2HSPA 2RMOA 1UUEA 2JXBA 1GBQA 3M0TA 3U23A 4RTYA 4AFUC 4OMLA 3SEMA 2CUDA 2EPDA 2NUZA 3NGPA 2DA9A 3QWXX 4K11A 2KRSA 3THKA 4J9BA 1QCFA 1E6HA 2EGCA 2BZYA 2CDTA 1ZSGA 3CQTA 2CUBA 3H41A 1WLPB 2CSQA 1KJWA 1WDXA 2QDLA 2GTJA 3EHRA 2SEMA 1M3BA 2J05A 2OAWA 4LUEA 3KFVA 1SSHA 2FRYA 4RTXA 2ED1A 1NEGA 2EYZA 1OPLA 1A0NB 2MIOA 1M30A 1UHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1Q A;  3VRZ A;  4LNP A;  2CH4 W;  4LE9 A;  2YSQ A;  3I35 A;  3VS6 A;  3NHN A;  2KT1 A;  1WXU A;  3TVT A;  1JO8 A;  2K6D A;  5GJW B;  3GBQ A;  1SRL A;  1CKA A;  2RQU A;  3UF4 A;  1HD3 A;  2DBK A;  1SHG A;  1WFW A;  4JJC A;  5IXB A;  1K9A A;  4ESR A;  2YUN A;  3VS0 A;  2A08 A;  2DVJ A;  2O9S A;  2A28 A;  2FPE A;  3TSZ A;  2AZV A;  1JXM A;  4J9I A;  3I9Q A;  3RBB B;  2KR3 A;  3C0C A;  1WI7 A;  4KRT A;  2YUP A;  2XMF A;  2CT4 A;  4DEY A;  1UHC A;  3EG0 A;  2LJ1 A;  2PNI A;  3M0S A;  1ZUU A;  4CC2 A;  2CRE A;  4AFQ C;  3I5S A;  1RLP C;  2DLP A;  2DRM A;  2DBM A;  3ULR B;  2DIL A;  4OMP A;  1M3C A;  2W10 A;  1ZX6 A;  1AOJ A;  1QWE A;  3EG2 A;  2KNB B;  1GFC A;  1OOT A;  2C0T A;  4HVV A;  2J6O A;  2JS0 A;  1EFN A;  2OJ2 A;  2PTK A;  1G2B A;  5GJV B;  1K0X A;  5HCK A;  2L3S A;  2J7I A;  3FJ5 A;  2NWM A;  2KYM A;  2BTT A;  4EIK A;  2K7A A;  3VRY A;  3EG3 A;  3UA7 A;  2A37 A;  3H0I A;  2EGE A;  1VYU A;  2VWF A;  2RQV A;  4IIM A;  1E6G A;  2LJ0 A;  2RF0 A;  1PRL C;  4JJD A;  4CC7 A;  4HXJ A;  1OPK A;  4FSS A;  1XOV A;  2YDL A;  2FG0 A;  4M4Z A;  2EYW A;  2KXC A;  1CSK A;  1MV3 A;  2DL3 A;  1X43 A;  1JQQ A;  1T0J A;  1NYG A;  5EC7 A;  5FWB A;  3PE0 A;  1X27 A;  1K76 A;  4J9G A;  1BU1 A;  2D0N A;  4J9C A;  4A63 B;  1X2Q A;  1K0S A;  4E6R A;  4R0K A;  1ZBJ A;  5IXF A;  4RUG A;  1AWW A;  4Z88 A;  1MUZ A;  2GTO A;  1AD5 A;  1GL5 A;  1TUD A;  1M8M A;  2YT6 A;  1PWT A;  2DL7 A;  1GFD A;  2AZS A;  3LH5 A;  5I22 A;  2KE9 A;  1OV3 A;  5FW9 A;  2L3Q A;  1Z9Q A;  2ENM A;  2F2V A;  1ABQ A;  1B3Q A;  3O5Z A;  2LZ6 B;  2AKK A;  2EGA A;  2LQW A;  2F2X A;  2D8J A;  4J9H A;  3NMZ C;  2A36 A;  2ROT A;  1BBZ A;  1H92 A;  4CC4 B;  4JPB W;  2LMJ A;  1UDL A;  2SRC A;  4GLM A;  2P4R A;  1UFF A;  4IIO A;  2DJQ A;  4AFS C;  1WYX A;  2DL8 A;  4OMM A;  4X1V A;  1WXT A;  2X3X D;  1G83 A;  3VS5 A;  4JZ4 A;  5IH2 A;  3UAT A;  4Z89 A;  2DL4 A;  2KGT A;  1JXO A;  1PKT A;  2DX1 A;  1I07 A;  1AVZ C;  1WA7 A;  2DM1 A;  1T3S A;  2EKH A;  1UGV A;  2EYX A;  1WIE A;  2YUQ A;  4CC3 A;  1U3O A;  1NG2 A;  1YN8 A;  2EYY A;  2LCS A;  2JT4 A;  2M0Y A;  3A98 A;  2J06 A;  1QWF A;  2LX7 A;  1GCQ C;  2DE0 X;  3IQL A;  1BK2 A;  2HEQ A;  1W1F A;  1AZE A;  3M0R A;  1U06 A;  1TUC A;  1N5Z A;  1UG1 A;  1M27 C;  2RQW A;  2J6F A;  4D8D A;  1VA7 A;  1PKS A;  2LP5 A;  2VKN A;  2K9G A;  4JJB A;  2BZ8 A;  1K1Z A;  2JMC A;  3VS2 A;  3UA6 A;  2HDA A;  2I0N A;  2W0Z A;  1W6X A;  1VYV A;  3REA B;  4Y92 A;  3ZL7 C;  4HVW A;  1UJY A;  2FRW A;  1AWJ A;  2ECZ A;  2O88 A;  2VVK A;  2O31 A;  2EBP A;  1WX6 A;  2DF6 A;  1FYN A;  1RUW A;  4AG2 C;  2JMA A;  1AWO A;  2K2M A;  2K3B A;  1NLP C;  1Y0M A;  4AFZ C;  4DEX A;  2IIM A;  4AG1 C;  3H0H A;  2LQN A;  2KRM A;  5IHI A;  3M0P A;  3R6N A;  1AWX A;  2KBT A;  2F2W A;  2MOX A;  3EG1 A;  3VS7 A;  4RTZ A;  4GBQ A;  4J9D A;  1VYT A;  4OMN A;  4OMQ A;  1AZG B;  4F16 A;  1AEY A;  3VS4 A;  4RTT A;  2AK5 A;  3RNJ A;  2KXD A;  4RTU A;  4RTW A;  1NLO C;  2JTE A;  3TSW A;  5L23 A;  2C0O A;  2KT8 A;  2KRN A;  3PVQ A;  2ROL A;  3SHW A;  2J6K A;  3M0U A;  2EVR A;  1T0H A;  1GCQ A;  1E7O A;  2DYB A;  2CT3 A;  1QKX A;  1KIK A;  2L3P A;  1SPK A;  1H3H A;  2FPF A;  3EGU A;  2KEA A;  2DMO A;  4Z8A A;  1YWO A;  2KYB A;  1RI9 A;  2L0A A;  2AKL A;  3NPF A;  2OI3 A;  1UTI A;  2O2O A;  2JS2 A;  1PHT A;  2M51 A;  2K79 A;  3VS1 A;  1GBR A;  4LN2 A;  2GNC A;  4ORZ A;  2B86 A;  2EQI A;  3I5R A;  1WXB A;  1W70 A;  1UEC A;  5I11 A;  1S1N A;  2CSI A;  2RN8 A;  5FWC A;  4WCI A;  2E5K A;  2X3W D;  1ARK A;  1OEB A;  5IHK A;  4J9E A;  4HCK A;  2ED0 A;  2D8H A;  1SRM A;  4OMO A;  2V1R A;  1X6G A;  2MCN A;  2FPD A;  1IO6 A;  2G6F X;  4QT7 A;  1SEM A;  1ABO A;  3QWY A;  2C0I A;  1BB9 A;  1KFZ A;  1TG0 A;  3VS3 A;  2JW4 A;  4J9F A;  1JEG A;  1ZUY A;  1UJ0 A;  1GCP A;  3JV3 A;  4D8K A;  1H8K A;  2FO0 A;  1YP5 A;  2GQI A;  2JM9 A;  4HVU A;  3M0Q A;  1QKW A;  2PZ1 A;  1HJD A;  4F17 A;  1SHF A;  1U5S A;  2ESW A;  1GRI A;  1ZLM A;  1J3T A;  4ZNX A;  2LNH B;  1X69 A;  1LCK A;  3PVL A;  2ABL A;  1PRM C;  2EW3 A;  1K4U S;  1I1J A;  2HBW A;  1FMK A;  5ECA A;  2CH4 A;  1NM7 A;  4LUD A;  1KSW A;  2L2P A;  4JZ3 A;  4F14 A;  1X6B A;  3REB B;  1Z9Z A;  2RNA A;  1ZUK A;  2LJ3 A;  1MV0 B;  1YNZ A;  1JU5 C;  4RTV A;  2DRK A;  2DNU A;  2RPN A;  1NYF A;  1I0C A;  1T3L A;  1V1C A;  2BZX A;  2YUO A;  2DL5 A;  2FEI A;  2H8H A;  2HCK A;  3EHQ A;  1RLQ C;  5IHN A;  2RQR A;  1QLY A;  2GBQ A;  1CKB A;  2JM8 A;  1M3A A;  1YWP A;  2GGR A;  1PNJ A;  2RQT A;  1B07 A;  1X2K A;  1NEB A;  1Y57 A;  2O9V A;  1HSQ A;  2KRO A;  1UE9 A;  1YCS B;  2D1X A;  3H0F A;  2HSP A;  2RMO A;  1UUE A;  2JXB A;  1GBQ A;  3M0T A;  3U23 A;  4RTY A;  4AFU C;  4OML A;  3SEM A;  2CUD A;  2EPD A;  2NUZ A;  3NGP A;  2DA9 A;  3QWX X;  4K11 A;  2KRS A;  3THK A;  4J9B A;  1QCF A;  1E6H A;  2EGC A;  2BZY A;  2CDT A;  1ZSG A;  3CQT A;  2CUB A;  3H41 A;  1WLP B;  2CSQ A;  1KJW A;  1WDX A;  2QDL A;  2GTJ A;  3EHR A;  2SEM A;  1M3B A;  2J05 A;  2OAW A;  4LUE A;  3KFV A;  1SSH A;  2FRY A;  4RTX A;  2ED1 A;  1NEG A;  2EYZ A;  1OPL A;  1A0N B;  2MIO A;  1M30 A;  1UHF A; 
#chains in the Genus database with same CATH topology
 4PJO D;  2K5L A;  3N5B B;  3JCM h;  5GAO m;  3I35 A;  5FRN A;  4XU3 A;  4PKC C;  2L8D A;  2P84 A;  3CC7 Q;  3AHU A;  3CME T;  3A8O B;  1HD3 A;  4KGZ B;  4JJC A;  5IXB A;  4JRK A;  2O4X B;  5KH6 A;  2PVG B;  4ESR A;  2CYZ B;  2A08 A;  2DVJ A;  1FMV A;  2F5T X;  2O9S A;  2AIR B;  3I9Q A;  2O01 E;  2CGH A;  3RBB B;  2D6F A;  5KE3 A;  4KRT A;  2YUP A;  2RD1 A;  2RI3 A;  2X51 A;  3EG0 A;  3M0S A;  1VQM Q;  4P5N A;  2CRE A;  4CC2 A;  4AFQ C;  3I5S A;  4XTW A;  2RO0 A;  2JN0 A;  3D7S B;  2W10 A;  1ZX6 A;  1AOJ A;  1QWE A;  1XJW B;  3EG2 A;  3V8K A;  4PJO G;  2KNB B;  1ZQ1 A;  2COW A;  1OU9 A;  4PJM A;  3S3O A;  4HVV A;  4HT9 A;  3OS1 A;  3QBY A;  1EFN A;  2E1H A;  4DBH A;  1IHV A;  2J7I A;  3FJ5 A;  4EPC A;  4M75 C;  5CAI A;  4RMO A;  1YJ9 T;  4FYY B;  2VWF A;  2RQV A;  2OTL Q;  2LJ0 A;  3KBG A;  1K8A R;  1YIT Q;  1AHJ B;  4YTL A;  2LCC A;  2YDL A;  2JTM A;  2RI5 A;  2EYW A;  2KXC A;  4D6W A;  5GAN 6;  4M78 F;  2QG9 B;  2EIF A;  4C5G A;  3G6E A;  2YRV A;  3BDU A;  3LGF A;  2FYK A;  2XU8 A;  5CKD A;  4TVR A;  1K0S A;  4E6R A;  5GAM j;  2QQS A;  3P8D A;  5J3B A;  5L8R E;  3CCL T;  1XTD A;  3A8H B;  1Q82 C;  1AWW A;  2Y4X A;  1MUZ A;  1P92 A;  4M78 E;  1AD5 A;  1GL5 A;  2ZZD A;  2DXC A;  3C4S A;  1LJO A;  1PWT A;  2DL7 A;  2O4X A;  4M78 A;  3E1S A;  5I22 A;  4ZN1 A;  3JCM g;  1QCN A;  3RES A;  1Z9Q A;  3RMS A;  1I4K 1;  2YRD A;  2F2V A;  1ABQ A;  1JRI A;  3CPW P;  2LZ6 B;  3HRU A;  2F1L A;  2D8J A;  4J9H A;  4ZGJ B;  3CPF A;  2BUD A;  2A36 A;  2ROT A;  4NL3 A;  1Q81 U;  4CC4 B;  2LMJ A;  2SRC A;  4OF1 A;  3TEE A;  4GLM A;  1UFF A;  4IIO A;  4M75 A;  3SWN A;  3CXC P;  1KD1 R;  1WXT A;  1G83 A;  2PUK B;  3H9N A;  1VQK A;  4MZM A;  1VQO T;  4M75 E;  4C8Q D;  1PKT A;  3OYJ A;  4IUV A;  4N4G A;  4CC3 A;  5FU7 B;  3ASK A;  3NFC A;  3CCS A;  1VQM A;  3S3N A;  1YN8 A;  2EYY A;  2JT4 A;  2DJZ A;  4DQ2 A;  2M0Y A;  2J06 A;  2LX7 A;  2VGN A;  4C0D C;  4BD3 A;  4M7A B;  3HPW A;  2DE0 X;  4XTX A;  2NUT A;  1AZE A;  5GMK e;  4E47 A;  3MET A;  2QQR A;  1N5Z A;  2QTV A;  5GAN g;  1NZ9 A;  2RQW A;  1I8F A;  4D8D A;  1VA7 A;  2BE9 B;  4PJO E;  1Y7X A;  4M77 F;  3VYH B;  4BI8 B;  1MMD A;  3RIR A;  4E7I A;  3OSS C;  1RAD B;  4O5V A;  5KYU B;  1KC8 C;  1VQ8 Q;  2RHZ A;  4HCC A;  3JB9 I;  2E5Q A;  1UJY A;  2NUP B;  4BY6 B;  2O88 A;  1PD1 A;  1WX6 A;  3GPL A;  1FYN A;  5GMK j;  1AWO A;  2E6N A;  3G4S Q;  4J8O A;  3JCM W;  4M77 A;  5DY9 A;  2EQU A;  3CPW A;  5GAO p;  1TSF A;  5LJ3 g;  2WSE E;  5IHI A;  1XNI A;  2KY9 A;  4FYX B;  2DEU A;  2QEX Q;  4XTY A;  5DLQ E;  1IRE B;  3MJX A;  1AWX A;  3WVE B;  3JRZ A;  2LC4 A;  3VS7 A;  3CXC S;  4J9D A;  4C92 E;  4OMN A;  3OYG A;  1AEY A;  2DIG A;  1BCO A;  2AK5 A;  2FVU A;  1YHQ T;  4RTW A;  2GF7 A;  1NLO C;  1F1B B;  1BI3 A;  2PUO B;  3JCM X;  2ZAE A;  4FT4 A;  4GY5 A;  2ROL A;  3M0U A;  1GCQ A;  3EH1 A;  3OYF A;  4C5I A;  1ZSZ A;  4ZTJ A;  3EGU A;  3HRT A;  4OMF B;  4Z8A A;  1KD1 U;  2VV5 A;  4Y91 A;  4MDX A;  1YWO A;  1NBE B;  1RI9 A;  2OTL A;  4BY6 C;  1IGQ A;  3FIF A;  5KCH A;  2JS2 A;  1PHT A;  3FRN A;  1FMW A;  3G4S T;  2GNC A;  4ORZ A;  2A7Y A;  2B86 A;  2HNI A;  1WXB A;  3KUF A;  4QQD A;  1UEC A;  3M54 A;  2RN8 A;  3FC3 A;  1G3T A;  1UGP B;  1VIF A;  3QZ9 B;  4Y28 E;  3DB3 A;  2X3W D;  3VUZ A;  3L1A A;  2ED0 A;  2V1R A;  4ZGD B;  2HSE B;  1HYO A;  2MCN A;  5I2S A;  1YI2 Q;  2LX9 A;  1IO6 A;  4MML A;  1ABO A;  2C06 A;  3CC2 Q;  4M75 G;  3SDZ A;  1NJI U;  3OYA A;  1KFZ A;  3VS3 A;  1JEG A;  4XU2 A;  1BYM A;  3CEY A;  2MI6 A;  1QP2 A;  2QQ9 A;  3BY7 A;  3JCM d;  2ESW A;  1IXD A;  1GRI A;  5CKB A;  5FU7 C;  1J3T A;  3QXE B;  1M1K C;  1LCK A;  3RKY A;  2KAF A;  3MKD A;  2QK0 A;  4J6W A;  5GAM e;  1K4U S;  5C6S A;  5LL6 S;  1D1B A;  1SG5 A;  3BE3 A;  5LJ5 g;  4F7U E;  4IUP A;  1NM7 A;  1OQK A;  2JOY A;  3JCM Q;  3JAM E;  1RAH B;  1MMA A;  4XTU A;  2VGM A;  3REB B;  1Z9Z A;  1ZUK A;  1R0C B;  3LLR A;  1PC0 A;  2LQ8 A;  3RDV A;  5GAN 7;  1OZ2 A;  1K9M U;  1D3B B;  2GBQ A;  1CKB A;  1YWP A;  2GGR A;  2LT1 A;  3CME A;  1PSE A;  5KYW A;  1M1G A;  1Y57 A;  3OYI A;  2O9V A;  2ZGW A;  1HSQ A;  3VYG A;  3A8L B;  1KHC A;  1MHN A;  3FLG A;  2Z0W A;  1YJW A;  4JRI A;  1GBQ A;  1RAE B;  1K8A U;  1G3Y A;  4R56 A;  3EG9 B;  4OML A;  2CUD A;  3JCM e;  3QYH B;  3THK A;  2DA9 A;  4K11 A;  2KRS A;  4RCC A;  4M7A D;  1VQ5 A;  5KCO A;  2BZY A;  1MND A;  1ZSG A;  4DBR A;  1U1T A;  2QA4 A;  3LYI A;  2QDL A;  1M90 C;  3SB2 A;  2JUF A;  4E7K A;  2GTJ A;  2HMA A;  3EHR A;  2J05 A;  4L5G A;  1SSH A;  2IPO B;  3OYH A;  4NL2 A;  1NEG A;  2EYZ A;  1OPL A;  1RAA B;  4LNP A;  3FEO A;  2XHC A;  2HKQ B;  2DPP B;  3CBM A;  3NHN A;  2KT1 A;  5M9O A;  3RER A;  1SRL A;  2K3Y A;  3PMT A;  2OTL T;  2DBK A;  1WFW A;  1QW1 A;  2KDS A;  1BCM A;  2YUN A;  1VQL Q;  2A28 A;  1X75 C;  2AZV A;  3MP8 A;  2E65 A;  4CI0 C;  4RCB A;  2MWP A;  3CCR Q;  2XMF A;  4B9X A;  3I55 Q;  5FRO A;  1ZUU A;  3OYC A;  3L2Q A;  2CP2 A;  2QDY B;  2DRM A;  2DBM A;  2KSS A;  2BIV A;  2M16 A;  3CCU A;  1M3C A;  4M7D B;  1C1A A;  5KYW B;  3F70 A;  1GFC A;  2DIQ A;  4XQ3 A;  2C0T A;  2DKG A;  1M2V B;  2PTK A;  4J83 A;  5GJV B;  5HCK A;  1QP3 A;  2NWM A;  5DM7 R;  2KYM A;  2BTT A;  3VRY A;  2A37 A;  1WJS A;  2EGE A;  1VYU A;  5D7U A;  4IIM A;  1E6G A;  2HQX A;  2OTJ A;  1PRL C;  4CC7 A;  2YLB A;  1BIA A;  1OPK A;  4FSS A;  4J7F A;  4M4Z A;  5GAN 5;  3FDR A;  5LJ3 d;  4PJO B;  1FX7 A;  1MV3 A;  2M1H A;  2DL3 A;  3QSU A;  1YHQ A;  4F7U F;  4BAC A;  1K76 A;  1BU1 A;  3RR6 A;  2DD5 A;  1WHJ A;  2BKD N;  5LJ5 e;  2ZPF B;  2VYT A;  2HBP A;  3EFR A;  1GXI E;  1ZBJ A;  3UPU A;  5GAM d;  3DB4 A;  4Z88 A;  3RUX A;  2M9U A;  5FU6 B;  1UB4 A;  1M5Q 1;  2CP6 A;  2K5I A;  3OYY A;  1GFD A;  3HRS A;  2PQW A;  2K2V A;  4J6Y A;  4M77 D;  5FW9 A;  4F7U A;  2RK2 A;  2R57 A;  3JB9 F;  2EGA A;  2LQW A;  3QHS A;  3CCM T;  1QVF P;  1UGS B;  3OYN A;  1BBZ A;  1H92 A;  4M75 D;  4C8Q E;  2GCX A;  4JPB W;  5HK0 A;  1G8X A;  1TU0 B;  3QYG B;  2P4R A;  2K3X A;  4X9C A;  1S72 A;  4AFS C;  1WYX A;  2DL8 A;  3NTI A;  4M7A C;  4X1V A;  4AT1 B;  1KQ1 A;  5LJ5 h;  2X3X D;  3BW1 A;  3CCL Q;  4JZ4 A;  3LX7 A;  3UAT A;  4Z89 A;  3URG A;  1R8O B;  3TU4 K;  2DX1 A;  1WA7 A;  1IZ6 A;  4M7D D;  3VUB A;  1ACM B;  3DLM A;  1YI2 T;  1U3O A;  4A54 A;  2LCS A;  4ZGE B;  1QWF A;  1GCQ C;  1K9M C;  1BK2 A;  2HEQ A;  1C0M A;  1G5V A;  1W1F A;  1KHI A;  8ATC B;  1VQ7 T;  1ZSZ C;  5KYX B;  2JVV A;  4EMG A;  4DOV A;  2E12 A;  2J6F A;  2HQE A;  3OYB A;  1PKS A;  3A5Z B;  5GAN 4;  2VKN A;  2FHD A;  1VQP T;  2K9G A;  4FM4 B;  3CCM Q;  1V29 B;  1WQ7 A;  1JJ2 P;  4E2F B;  3I56 A;  1K1Z A;  3VS2 A;  3UA6 A;  2HDA A;  2I0N A;  2W0Z A;  4EMK C;  2QA4 T;  4M7A F;  4FU6 A;  1VYV A;  3REA B;  1KQ2 A;  1ZSZ B;  4NS5 A;  3CCV A;  1AWJ A;  1MGQ A;  5GAM g;  4C8Q C;  2ZPH B;  2E64 A;  4JS4 A;  3JCM f;  2DXT A;  2ZPE B;  1D0Z A;  1RUW A;  2X4X A;  1LNX A;  2EAY A;  2K3B A;  1NLP C;  3SFM A;  1M1K R;  4DEX A;  3QKJ A;  1VQO A;  4AG1 C;  4F7U G;  1C6V X;  2I2L A;  1VQ4 A;  3CD6 A;  2VB6 A;  3ER0 A;  4Z02 A;  4O6J A;  1QVF A;  3I55 T;  4M7A A;  1I5L A;  3R6N A;  3VJP A;  2MOX A;  3EG1 A;  1ZHI A;  3CBP A;  3OW2 P;  4RTZ A;  2MYS A;  2FZC B;  2QGF B;  3A1P A;  3VS4 A;  4QVD A;  4RTT A;  2KXD A;  4RTU A;  3TSW A;  3BFM A;  2CP7 A;  3EG9 A;  2RJC A;  1RAC B;  1VQK Q;  3HHT B;  3MPU B;  3SHW A;  2X9H A;  1D0Y A;  1Q7Y U;  2FZK B;  1E7O A;  1ZA1 B;  2CT3 A;  2QI2 A;  3CPW S;  2CP0 A;  3V8J A;  4M75 B;  4CRI A;  1VQN T;  1SPK A;  2FPF A;  2DMO A;  2OTJ T;  5FRM A;  2LVM A;  4C92 C;  5GAN f;  2O2O A;  1NE8 A;  4KH1 B;  3CCR A;  2JNG A;  3PIP A;  4LN2 A;  2EQI A;  2XID A;  3I5R A;  4MZP A;  2WSC E;  3BDL A;  1S1N A;  1X01 A;  3X25 B;  1UEB A;  2VC8 A;  2DET A;  2E5K A;  1MNE A;  3TCJ A;  1JJ2 A;  4VUB A;  5CCA A;  2OAU A;  2EWN A;  4QQ6 A;  1M90 R;  1SRM A;  3CME Q;  3MEU A;  3CC7 A;  1X6G A;  1FXX A;  2FPD A;  1BKB A;  2G6F X;  5CKF A;  4QT7 A;  2DFU A;  1SEM A;  2L5Q A;  3QWY A;  5GAN e;  3L2R A;  4BE2 A;  4C8Q B;  1TG0 A;  4EMH A;  1OYX A;  4J9F A;  1BI2 A;  1K8A C;  1H64 1;  4PFP A;  1UJ0 A;  1GCP A;  3JV3 A;  4D8K A;  2JM9 A;  2GQI A;  1SSF A;  4HVU A;  3UWN A;  1QKW A;  1VQN Q;  3JCM V;  1WQW A;  2ZCF B;  1WHL A;  4AMC A;  1SHF A;  2RJD A;  4PJJ A;  3LWH A;  1ZLM A;  4ANJ A;  3CC4 T;  1R0B G;  4HA8 A;  1M8V A;  1X69 A;  3V7R A;  2QAZ A;  1VQM T;  1YJN T;  1PRM C;  6AT1 B;  1D0X A;  1I1J A;  4OB2 B;  2KVQ G;  4X9D A;  5ECA A;  4QVC A;  1Q82 R;  3OW2 A;  1VQL T;  4E7J A;  2L2P A;  5LJ3 j;  3M9Q A;  4JZ3 A;  3CCV T;  1X6B A;  2GFA A;  2DEQ A;  4L59 A;  5A0L A;  2HD0 A;  1DJ7 B;  2DNU A;  1WHK A;  1NYF A;  1I0C A;  1T3L A;  2VXF A;  5AYF A;  1Q7Y R;  2DD4 A;  2QTX A;  2H8H A;  2R5M A;  1YIT T;  3CC2 A;  3CCJ Q;  3HSB A;  2QEX T;  4JLG A;  2HAX A;  1QLY A;  2YWW A;  2HL3 A;  1M1K U;  1PM3 A;  1U1S A;  3T9N A;  4ZTF A;  4XTZ A;  3HTR A;  2RQT A;  4C92 B;  2X35 A;  2Y90 A;  5A2Q E;  1K9M R;  2V8K A;  2D1X A;  3QDF A;  4JDS A;  5GAO q;  2HSP A;  2RMO A;  4A4E A;  2E70 A;  4LD9 K;  5GAN 8;  2DAQ A;  2NUZ A;  2EPD A;  1NJI C;  3OYM A;  3MP6 A;  5D6X A;  2FZG B;  3QWX X;  4J9B A;  1QCF A;  1E6H A;  2EGC A;  4C92 G;  3E2U A;  5C0M A;  4ME7 A;  3CQT A;  1W2B A;  4KGV B;  3OBY A;  1WPY A;  5GAN h;  1RAG B;  1QVG P;  2PU9 B;  5A0D A;  2K4Y A;  4HCZ A;  3CCE Q;  2FRY A;  3NTK A;  2COZ A;  1WJQ A;  5LJ3 e;  2YXY A;  1VQ6 A;  1U8R A;  4N4I A;  3VRZ A;  2CH4 W;  4LE9 A;  2MPX C;  4LD6 A;  3GNG A;  1M2V A;  3VS6 A;  2QXF A;  1LOJ A;  3TVT A;  3CC4 Q;  1JO8 A;  2K6D A;  1KD1 C;  5GJW B;  1BI0 A;  3GBQ A;  1KC8 R;  3EFO A;  1SF9 A;  4OVA A;  3G4S A;  3C95 A;  5CKH A;  2FPE A;  3TSZ A;  3SWN C;  2KR3 A;  3C0C A;  5KE2 A;  2RI2 A;  2CT4 A;  2OX7 A;  4DEY A;  4XU0 A;  4C8Q G;  4A4G A;  1VQ5 T;  2DLP A;  1I5O B;  3ULR B;  4OMP A;  1V76 A;  3I56 Q;  4BB7 A;  2YRC A;  3OW2 S;  2Y4Y A;  3QO3 A;  4XAX B;  3LWI A;  2KQW A;  1OOT A;  2QQB A;  4PJO A;  3CCR T;  2CZ1 B;  2OJ2 A;  4LDU A;  1G2B A;  1K0X A;  2DTI A;  2E3I A;  1VQ6 T;  1ZBX A;  1RL2 A;  2QEX A;  3L42 A;  5AT1 B;  3EGD A;  3CCS Q;  1N6A A;  2RF0 A;  2LTO A;  4JJD A;  4HXJ A;  1ZA2 B;  1KC8 U;  1XOV A;  2FG0 A;  1VQ9 Q;  3C94 A;  3PIO A;  4OB3 B;  1WHG A;  3S6W A;  1CSK A;  1WJR A;  2QAS A;  1VQP Q;  1JQQ A;  4KUD K;  1T0J A;  1NYG A;  3OBW A;  5FWB A;  1X27 A;  4J9G A;  5D6W A;  4J9C A;  2V8I A;  4J5Y A;  4RG8 A;  1BI1 A;  4R0K A;  5IXF A;  4FIB A;  2RHX A;  4RUG A;  1YJN A;  1WGS A;  3RMQ A;  2F5K A;  1M8M A;  5GMK i;  3J80 E;  4IUR A;  3VV0 A;  4FL6 A;  2AZS A;  3LH5 A;  2NUP A;  2CP3 A;  2QQA A;  3PMI A;  1OV3 A;  4DBF A;  3G71 Q;  4M7A G;  4JUV A;  4PLI A;  2FB7 A;  3O5Z A;  2AKK A;  5GAN d;  3SD4 A;  3X24 B;  2F2X A;  3KXT A;  2CKK A;  5CQX A;  1YJ9 A;  3M56 A;  1VQ9 T;  3CC7 T;  3NMZ C;  4IUQ A;  3CCQ A;  1UDL A;  4M7D E;  2K57 A;  1M9S A;  1QVF S;  2DJQ A;  3H6Z A;  2LQK A;  3VS5 A;  5IH2 A;  2KGT A;  1JXO A;  5D6Y A;  1I07 A;  2EKH A;  2EYX A;  5LJ3 f;  2EJF A;  2OTJ Q;  2JTF A;  5DLO A;  1NG2 A;  4EMK B;  3OYE A;  1Y96 A;  3I55 A;  4J6X A;  3A98 A;  1VQ8 T;  1HXD A;  3E19 A;  1OU8 A;  2CS7 A;  3M0R A;  1U06 A;  1TUC A;  3V8L A;  3Q1J A;  3SWN B;  4MZT A;  1K73 C;  1VIE A;  1UGQ B;  3M55 A;  3OS0 A;  1YFN A;  1NPR A;  2EJG A;  3MO8 A;  4C92 A;  3VKI A;  4A53 A;  3M5A A;  3CC4 A;  4JJB A;  1N27 A;  2FL7 A;  3V7S A;  2BZ8 A;  2MK5 A;  3PGG A;  1VQN A;  1YCY A;  1W6X A;  4KGX B;  3AT1 B;  2NLU A;  5GAO l;  4C5H A;  4HVW A;  3L2W A;  2FRW A;  4JS5 A;  2VVK A;  4BDZ A;  2DZC A;  1TH7 A;  2LRQ A;  3EGX B;  2B8A A;  4AG2 C;  2JMA A;  3JSC A;  2K2M A;  4ELZ C;  3CD6 Q;  2MMP A;  2XI9 A;  1Y0M A;  3EH2 A;  3M4Y A;  2VUB A;  1YIJ Q;  3V7C A;  4X34 A;  5CR2 A;  2P0Q A;  1N8R R;  4HCB A;  3M0P A;  1RAB B;  5FU6 C;  2F2W A;  3J81 E;  1OZ3 A;  1Y96 B;  1VYT A;  1Y71 A;  3MCA B;  3CXC A;  4OMQ A;  4C0F A;  3X26 B;  4EDU A;  5L23 A;  2GFU A;  3GF5 A;  3OYD A;  2C0O A;  4V2S A;  2KRN A;  4ELY C;  2F69 A;  2YLC A;  2M0O A;  2DYB A;  2BE7 D;  4XU1 A;  4N0A A;  1QCO A;  2KEA A;  3PT9 A;  4II1 A;  3QUI A;  3E9G A;  4KUI A;  3ME9 A;  2D0Q B;  4F7U B;  2KYB A;  5KYY B;  3FJP A;  2AKL A;  5EG2 A;  3QG1 A;  3NPF A;  2OI3 A;  1UTI A;  4J7I A;  4FT2 A;  4MMK A;  2K79 A;  1W2B S;  3VS1 A;  4A4K A;  5I21 A;  3H8Z A;  3M53 A;  5I11 A;  3UT1 A;  5FWC A;  1ARK A;  1OEB A;  1R77 A;  1N9S A;  1YIJ A;  5LJ3 h;  2H3J A;  4OGC A;  5IHK A;  4J9E A;  4HCK A;  1Q81 C;  2JZ2 A;  2LCL A;  1FWZ A;  3RKX A;  4E7H A;  3J7A F;  1K73 R;  4M7A E;  2LNV A;  2X4W A;  2C0I A;  1BB9 A;  3HFN A;  4PK4 A;  1TUG B;  3X20 B;  1ZUY A;  4ZN3 A;  1H8K A;  2FO0 A;  3JB9 G;  4N4H A;  3M0Q A;  4UC4 A;  2RM4 A;  1IGU A;  3OS5 A;  1HJD A;  4WF2 A;  5LJ5 d;  4F17 A;  1U5S A;  1MMG A;  2A3L A;  5KYN A;  3OS2 A;  4ZNX A;  3FB9 A;  2ABL A;  3MEV A;  1W4S A;  2WSF E;  2HBW A;  3OMC A;  2DTH A;  2JJ9 A;  4JJN K;  1Q81 R;  5FLX E;  3O8V A;  2RNA A;  2LJ3 A;  1MV0 B;  3GNF B;  5GAN 3;  4OGE A;  1N8R C;  2DRK A;  2RPN A;  4N0A C;  2DTO A;  1WHM A;  1Q95 G;  4M7D A;  3EGX A;  2DL5 A;  1KQS A;  7AT1 B;  2HCK A;  1RLQ C;  5IHN A;  2XDP A;  2A0F B;  3JB9 J;  3CCM A;  1AT1 B;  1YI2 A;  1MMN A;  1M3A A;  2JM8 A;  2EFI A;  1M2O A;  2R5A A;  5HY6 A;  3GIB A;  1WZO A;  2EQM A;  3JCM b;  4PFO A;  5IN1 A;  4JRQ A;  2QGG A;  5KYX A;  1N9R A;  2EYQ A;  3EFS A;  3S3M A;  3JCM P;  3LW5 E;  4ATO A;  4E7L A;  2JXB A;  3M0T A;  3U23 A;  1JJ2 S;  1VQK T;  4RTY A;  3NGP A;  4MDW A;  3JCM J;  1G3W A;  2VAS A;  2M02 A;  1QMC A;  1VQ4 T;  2CDT A;  3JB9 D;  4LDY A;  3H41 A;  2CSQ A;  5LJ5 f;  1KJW A;  1WDX A;  3DLL A;  4DOW A;  4PJO F;  1Q86 U;  4BI3 A;  3PTA A;  3M57 A;  2SEM A;  4A4H A;  2LT4 A;  2OAW A;  4LUE A;  3KFV A;  1NPP A;  4PJN A;  4RTX A;  1A0N B;  3OY9 A;  3G71 T;  1M30 A;  1UHF A;  3MP1 A;  2V1Q A;  2ATC B;  2HKN A;  2YSQ A;  3JB9 H;  2WAC A;  3CD6 T;  1VOM A;  3CBO A;  2XD0 A;  1WXU A;  1G3S A;  3OMG A;  5GAM h;  1I81 A;  1CKA A;  2RQU A;  3DKM A;  3UF4 A;  4BUG A;  1SHG A;  4PL6 A;  1VUB A;  4BE0 A;  1UGR B;  1K9A A;  4M7D C;  2RHI A;  3VS0 A;  3GP8 A;  2DYI A;  1K73 U;  1JXM A;  4J9I A;  4BDY A;  1EIF A;  1QQJ A;  2HZY A;  1WI7 A;  2HQH A;  1KQS P;  1UHC A;  2LJ1 A;  2PNI A;  3QJ6 A;  1D3B A;  4M7D G;  3GLX A;  1RLP C;  1IHW A;  9ATC B;  2DIL A;  1H3Z A;  3NTH A;  1OUL A;  2ZPG B;  1VQ8 A;  2CZ6 B;  3HKS A;  3CCE A;  2J6O A;  2JS0 A;  3HL8 A;  1S72 Q;  4C8Q F;  4BE1 A;  2P4T A;  2L3S A;  3G1J A;  1VQ5 Q;  2X4J A;  4EIK A;  2K7A A;  3EG3 A;  3M59 A;  3UA7 A;  3I56 T;  3H0I A;  1X6O A;  4RG2 A;  2X4Y A;  3PFS A;  3WVD B;  4JRP A;  3QZ5 B;  2DO3 A;  1PD0 A;  2RK1 A;  4PLL A;  1D09 B;  5GMK m;  1VQL A;  1EZZ B;  2RB6 A;  2DZ9 A;  3M58 A;  2V8J A;  1RAI B;  4C8Q A;  1X43 A;  2XIC A;  2CP5 A;  5EC7 A;  5CKE A;  3PE0 A;  4QQG A;  3TRE A;  1YIJ T;  2G3R A;  2D0N A;  3LGL A;  4A63 B;  1X2Q A;  2DK3 A;  1M90 U;  5GAN 2;  1B34 B;  3EAE A;  3CCU T;  5LJ5 j;  5IAY A;  2GTO A;  4IUT A;  3OB9 A;  1BIB A;  4FW1 A;  1TUD A;  3OSV A;  2AT1 B;  3G6E Q;  1YHQ Q;  2XKO C;  2YT6 A;  3TQ7 P;  5CO7 A;  4C92 F;  2COY A;  5I2M A;  2XDB A;  1OI1 A;  2KE9 A;  2R58 A;  2L3Q A;  4XK8 E;  4M78 D;  2ENM A;  4M78 G;  3UDC A;  1B3Q A;  1SKU B;  4B9W A;  2K5F A;  5CK9 A;  2E4H A;  1PCX A;  5GAM f;  3CMA T;  3EGD B;  2V26 A;  1PSF A;  4OMM A;  3A8M B;  2RH2 A;  2L3R A;  1B7T A;  5CIU A;  2NUT B;  1WHH A;  5HK3 A;  5J39 A;  2DL4 A;  4FSX A;  3CCJ A;  3LH0 A;  2XG8 D;  2PVD B;  1AVZ C;  2DM1 A;  1T3S A;  3P8H A;  3CCU Q;  1UGV A;  1WIE A;  2YUQ A;  1XQH A;  3CCQ Q;  1YIT A;  3CC2 T;  2E6Z A;  2E10 A;  3E9F A;  2RJE A;  3ZEH A;  1YJ9 Q;  1O75 A;  5J26 A;  3IQL A;  1D1A A;  2DVE A;  2XDD A;  2ZPI B;  4LDW A;  3ZBD A;  1JBM A;  1TS9 A;  1UG1 A;  4IKF A;  1M27 C;  1YJW T;  4A4F A;  1HK9 A;  2LP5 A;  4QW2 A;  1EX4 A;  5KYU A;  2JMC A;  4OB0 B;  2P0K A;  3QPH A;  3CCV Q;  3EFO B;  1YJN Q;  2LDM A;  4Y92 A;  4C0G A;  4KBM B;  3ZL7 C;  2RA2 A;  1Q7Y C;  2EQK A;  2ECZ A;  4KH0 B;  2O31 A;  3C12 A;  2EBP A;  2DF6 A;  2HL5 C;  4M75 F;  3L2V A;  5KYY A;  2GQV A;  5HKC A;  3CCJ T;  4AFZ C;  4PNO A;  2IIM A;  3QII A;  3H0H A;  2QA4 Q;  2IVW A;  2LQN A;  1TWB A;  2KRM A;  4B6M A;  1KQS S;  2MWO A;  2CZ0 B;  2RJF A;  4PJL A;  2KBT A;  1Q82 U;  4GBQ A;  3PNW C;  1NJI R;  1YJW Q;  4HT8 A;  1VQ7 A;  4F04 B;  4M78 C;  3RKW A;  1AZG B;  4M77 E;  4F16 A;  3OA6 A;  3RNJ A;  1TXQ A;  2JTE A;  2ZPB B;  3QDR B;  1Q86 R;  1OX9 A;  2KT8 A;  3PVQ A;  2J6K A;  2EVR A;  1T0H A;  1KK7 A;  4C92 D;  4L6V 5;  1QKX A;  1KIK A;  5GMK l;  2L3P A;  1D1C A;  4LDX A;  1H3H A;  3R6O A;  3L2U A;  1RAF B;  3CCE T;  2L0A A;  4M78 B;  4C5E A;  1WNL A;  3VU3 C;  2M51 A;  5GAO n;  1GBR A;  2YHT A;  4M7D F;  4OB1 B;  1W70 A;  3G71 A;  5CQY A;  2QYZ A;  2CSI A;  3OYK A;  4WCI A;  4QVZ A;  1VQ4 Q;  4R55 A;  2EJ9 A;  2E3H A;  1OX8 A;  3X28 B;  4WTO B;  1VQO Q;  4KT0 E;  3GOX A;  2D8H A;  4OMO A;  3CCL A;  2VXE A;  3OYL A;  1Q86 C;  4NOY A;  1W2B P;  4GLK A;  4JLI A;  1KG1 A;  2D9T A;  3CMA A;  3MHX A;  4C0D B;  1M1F A;  1QVG A;  2JW4 A;  2EQJ A;  4FCY A;  1VQ7 Q;  4DA4 A;  2RHU A;  1LPL A;  1YP5 A;  4Q5W A;  2L89 A;  3G6E T;  2PZ1 A;  1PG5 B;  3QJY A;  3G7Z A;  1QVP A;  4RKU E;  1VQP A;  2LNH B;  3L2Z A;  8AT1 B;  2P0P A;  4EMK A;  3JCM c;  3MEA A;  3PVL A;  5IT9 E;  2EW3 A;  1VQ9 A;  4QKU A;  5GMK h;  4M77 G;  1TOV A;  3A8G B;  2KMT A;  1FMK A;  2CH4 A;  1JB0 E;  4LUD A;  1KSW A;  2DXB A;  2DER A;  4F14 A;  2AHJ B;  3OQ5 A;  1IRX A;  2CZ7 B;  1S72 T;  2XK0 A;  3MEW A;  4FYW B;  2NYS A;  3P8B B;  1YNZ A;  4KUL A;  4E7S A;  1JU5 C;  4RTV A;  4M77 C;  4PJO C;  4M77 B;  3HFO A;  1N8R U;  2DXU A;  1VQ6 Q;  2EKO A;  4OP0 A;  4BI4 A;  1V1C A;  1RI0 A;  2BZX A;  2MF2 A;  2YUO A;  2FEI A;  4IUU A;  4LDV A;  3EHQ A;  3CMA Q;  2RQR A;  4HKE A;  3ZFJ A;  3CCS T;  1PNJ A;  2KI7 A;  4PFZ A;  3CCQ T;  4LXC A;  1B07 A;  4C0Z A;  1X2K A;  5GAO r;  3HP9 A;  1NEB A;  1B34 A;  1TTH B;  2KRO A;  2H3E B;  4FYV B;  1UE9 A;  1YCS B;  3H0F A;  1UUE A;  2PVO B;  4AFU C;  3SEM A;  5GAN j;  4XTV A;  5A0G A;  3INZ A;  4E7Z A;  1M4Z A;  2CUB A;  1WLP B;  3WXM B;  4DBQ A;  2E41 A;  2KK4 A;  4FW2 A;  1IB8 A;  1M3B A;  2MAM A;  2IG0 A;  1QVG S;  3M4G A;  5CVI A;  1YBY A;  1O9S A;  1LVK A;  2ED1 A;  2RHY A;  2MIO A;  1Y07 A; 
#chains in the Genus database with same CATH homology
 2V1Q A;  3VRZ A;  4LNP A;  2CH4 W;  4LE9 A;  2YSQ A;  3I35 A;  3VS6 A;  3NHN A;  2KT1 A;  1WXU A;  3TVT A;  1JO8 A;  2K6D A;  5GJW B;  3GBQ A;  1SRL A;  1CKA A;  2RQU A;  3UF4 A;  1HD3 A;  2DBK A;  1SHG A;  1WFW A;  4JJC A;  5IXB A;  1K9A A;  4ESR A;  2YUN A;  3VS0 A;  2A08 A;  2DVJ A;  2O9S A;  2A28 A;  2FPE A;  3TSZ A;  2AZV A;  1JXM A;  4J9I A;  3I9Q A;  3RBB B;  2KR3 A;  3C0C A;  1WI7 A;  4KRT A;  2YUP A;  2XMF A;  2CT4 A;  4DEY A;  1UHC A;  3EG0 A;  2LJ1 A;  2PNI A;  3M0S A;  1ZUU A;  4CC2 A;  2CRE A;  4AFQ C;  3I5S A;  1RLP C;  2DLP A;  2DRM A;  2DBM A;  3ULR B;  2DIL A;  4OMP A;  1M3C A;  2W10 A;  1ZX6 A;  1AOJ A;  1QWE A;  3EG2 A;  2KNB B;  1GFC A;  1OOT A;  2C0T A;  4HVV A;  2J6O A;  2JS0 A;  1EFN A;  2OJ2 A;  2PTK A;  1G2B A;  5GJV B;  1K0X A;  5HCK A;  2L3S A;  2J7I A;  3FJ5 A;  2NWM A;  2KYM A;  2BTT A;  4EIK A;  2K7A A;  3VRY A;  3EG3 A;  3UA7 A;  2A37 A;  3H0I A;  2EGE A;  1VYU A;  2VWF A;  2RQV A;  4IIM A;  1E6G A;  2LJ0 A;  2RF0 A;  1PRL C;  4JJD A;  4CC7 A;  4HXJ A;  1OPK A;  4FSS A;  1XOV A;  2YDL A;  2FG0 A;  4M4Z A;  2EYW A;  2KXC A;  1CSK A;  1MV3 A;  2DL3 A;  1X43 A;  1JQQ A;  1T0J A;  1NYG A;  5EC7 A;  5FWB A;  3PE0 A;  1X27 A;  1K76 A;  4J9G A;  1BU1 A;  2D0N A;  4J9C A;  4A63 B;  1X2Q A;  1K0S A;  4E6R A;  4R0K A;  1ZBJ A;  5IXF A;  4RUG A;  1AWW A;  4Z88 A;  1MUZ A;  2GTO A;  1AD5 A;  1GL5 A;  1TUD A;  1M8M A;  2YT6 A;  1PWT A;  2DL7 A;  1GFD A;  2AZS A;  3LH5 A;  5I22 A;  2KE9 A;  1OV3 A;  5FW9 A;  2L3Q A;  1Z9Q A;  2ENM A;  2F2V A;  1ABQ A;  1B3Q A;  3O5Z A;  2LZ6 B;  2AKK A;  2EGA A;  2LQW A;  2F2X A;  2D8J A;  4J9H A;  3NMZ C;  2A36 A;  2ROT A;  1BBZ A;  1H92 A;  4CC4 B;  4JPB W;  2LMJ A;  1UDL A;  2SRC A;  4GLM A;  2P4R A;  1UFF A;  4IIO A;  2DJQ A;  4AFS C;  1WYX A;  2DL8 A;  4OMM A;  4X1V A;  1WXT A;  2X3X D;  1G83 A;  3VS5 A;  4JZ4 A;  5IH2 A;  3UAT A;  4Z89 A;  2DL4 A;  2KGT A;  1JXO A;  1PKT A;  2DX1 A;  1I07 A;  1AVZ C;  1WA7 A;  2DM1 A;  1T3S A;  2EKH A;  1UGV A;  2EYX A;  1WIE A;  2YUQ A;  4CC3 A;  1U3O A;  1NG2 A;  1YN8 A;  2EYY A;  2LCS A;  2JT4 A;  2M0Y A;  3A98 A;  2J06 A;  1QWF A;  2LX7 A;  1GCQ C;  2DE0 X;  3IQL A;  1BK2 A;  2HEQ A;  1W1F A;  1AZE A;  3M0R A;  1U06 A;  1TUC A;  1N5Z A;  1UG1 A;  1M27 C;  2RQW A;  2J6F A;  4D8D A;  1VA7 A;  1PKS A;  2LP5 A;  2VKN A;  2K9G A;  4JJB A;  2BZ8 A;  1K1Z A;  2JMC A;  3VS2 A;  3UA6 A;  2HDA A;  2I0N A;  2W0Z A;  1W6X A;  1VYV A;  3REA B;  4Y92 A;  3ZL7 C;  4HVW A;  1UJY A;  2FRW A;  1AWJ A;  2ECZ A;  2O88 A;  2VVK A;  2O31 A;  2EBP A;  1WX6 A;  2DF6 A;  1FYN A;  1RUW A;  4AG2 C;  2JMA A;  1AWO A;  2K2M A;  2K3B A;  1NLP C;  1Y0M A;  4AFZ C;  4DEX A;  2IIM A;  4AG1 C;  3H0H A;  2LQN A;  2KRM A;  5IHI A;  3M0P A;  3R6N A;  1AWX A;  2KBT A;  2F2W A;  2MOX A;  3EG1 A;  3VS7 A;  4RTZ A;  4GBQ A;  4J9D A;  1VYT A;  4OMN A;  4OMQ A;  1AZG B;  4F16 A;  1AEY A;  3VS4 A;  4RTT A;  2AK5 A;  3RNJ A;  2KXD A;  4RTU A;  4RTW A;  1NLO C;  2JTE A;  3TSW A;  5L23 A;  2C0O A;  2KT8 A;  2KRN A;  3PVQ A;  2ROL A;  3SHW A;  2J6K A;  3M0U A;  2EVR A;  1T0H A;  1GCQ A;  1E7O A;  2DYB A;  2CT3 A;  1QKX A;  1KIK A;  2L3P A;  1SPK A;  1H3H A;  2FPF A;  3EGU A;  2KEA A;  2DMO A;  4Z8A A;  1YWO A;  2KYB A;  1RI9 A;  2L0A A;  2AKL A;  3NPF A;  2OI3 A;  1UTI A;  2O2O A;  2JS2 A;  1PHT A;  2M51 A;  2K79 A;  3VS1 A;  1GBR A;  4LN2 A;  2GNC A;  4ORZ A;  2B86 A;  2EQI A;  3I5R A;  1WXB A;  1W70 A;  1UEC A;  5I11 A;  1S1N A;  2CSI A;  2RN8 A;  5FWC A;  4WCI A;  2E5K A;  2X3W D;  1ARK A;  1OEB A;  5IHK A;  4J9E A;  4HCK A;  2ED0 A;  2D8H A;  1SRM A;  4OMO A;  2V1R A;  1X6G A;  2MCN A;  2FPD A;  1IO6 A;  2G6F X;  4QT7 A;  1SEM A;  1ABO A;  3QWY A;  2C0I A;  1BB9 A;  1KFZ A;  1TG0 A;  3VS3 A;  2JW4 A;  4J9F A;  1JEG A;  1ZUY A;  1UJ0 A;  1GCP A;  3JV3 A;  4D8K A;  1H8K A;  2FO0 A;  1YP5 A;  2GQI A;  2JM9 A;  4HVU A;  3M0Q A;  1QKW A;  2PZ1 A;  1HJD A;  4F17 A;  1SHF A;  1U5S A;  2ESW A;  1GRI A;  1ZLM A;  1J3T A;  4ZNX A;  2LNH B;  1X69 A;  1LCK A;  3PVL A;  2ABL A;  1PRM C;  2EW3 A;  1K4U S;  1I1J A;  2HBW A;  1FMK A;  5ECA A;  2CH4 A;  1NM7 A;  4LUD A;  1KSW A;  2L2P A;  4JZ3 A;  4F14 A;  1X6B A;  3REB B;  1Z9Z A;  2RNA A;  1ZUK A;  2LJ3 A;  1MV0 B;  1YNZ A;  1JU5 C;  4RTV A;  2DRK A;  2DNU A;  2RPN A;  1NYF A;  1I0C A;  1T3L A;  1V1C A;  2BZX A;  2YUO A;  2DL5 A;  2FEI A;  2H8H A;  2HCK A;  3EHQ A;  1RLQ C;  5IHN A;  2RQR A;  1QLY A;  2GBQ A;  1CKB A;  2JM8 A;  1M3A A;  1YWP A;  2GGR A;  1PNJ A;  2RQT A;  1B07 A;  1X2K A;  1NEB A;  1Y57 A;  2O9V A;  1HSQ A;  2KRO A;  1UE9 A;  1YCS B;  2D1X A;  3H0F A;  2HSP A;  2RMO A;  1UUE A;  2JXB A;  1GBQ A;  3M0T A;  3U23 A;  4RTY A;  4AFU C;  4OML A;  3SEM A;  2CUD A;  2EPD A;  2NUZ A;  3NGP A;  2DA9 A;  3QWX X;  4K11 A;  2KRS A;  3THK A;  4J9B A;  1QCF A;  1E6H A;  2EGC A;  2BZY A;  2CDT A;  1ZSG A;  3CQT A;  2CUB A;  3H41 A;  1WLP B;  2CSQ A;  1KJW A;  1WDX A;  2QDL A;  2GTJ A;  3EHR A;  2SEM A;  1M3B A;  2J05 A;  2OAW A;  4LUE A;  3KFV A;  1SSH A;  2FRY A;  4RTX A;  2ED1 A;  1NEG A;  2EYZ A;  1OPL A;  1A0N B;  2MIO A;  1M30 A;  1UHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...