1ARKA

Sh3 domain from human nebulin, nmr, 15 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
TAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEBULIN
publication title SH3 in muscles: solution structure of the SH3 domain from nebulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1997-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1arkA00
4CC7A 2ABLA 2OI3A 4RTWA 3VRZA 5IHKA 1PWTA 3O5ZA 1X2QA 5GJWB 4OMQA 1Y0MA 1GFCA 1W70A 4Z8AA 1CKBA 2QDLA 2EQIA 3M0TA 3RNJA 1RUWA 4KRTA 1RI9A 1GCPA 4OMLA 4JJBA 2L3PA 4R0KA 2YUQA 2KXCA 2LP5A 2EYWA 2O88A 1U3OA 1PKSA 2EKHA 1NEBA 4WCIA 2DL8A 3EG2A 1A0NB 1S1NA 2YDLA 3SHWA 2FPDA 4D8KA 3ZL7C 2GBQA 3REAB 2DL4A 4ZNXA 3I9QA 2DL3A 1UHFA 4ORZA 1OV3A 2J7IA 5IHIA 1OPKA 2RF0A 4FSSA 2A37A 2GTOA 1YCSB 1PNJA 1U5SA 3EHRA 2LQNA 2J6OA 2ECZA 1QLYA 4AFQC 4QT7A 3VRYA 1B07A 2RPNA 2EYYA 5I22A 3R6NA 2CDTA 1QWFA 1HSQA 1X2KA 2E5KA 2JMAA 1UFFA 1BB9A 1WLPB 3NHNA 1GBRA 2YUNA 2VWFA 2GTJA 1VYUA 2YT6A 5FWCA 1QKWA 4A63B 1YP5A 3TVTA 2DA9A 4J9DA 3VS7A 2AKKA 2L3QA 2ED0A 2K9GA 2KNBB 2HEQA 2EGCA 1K0SA 1W6XA 2CREA 1X6GA 2RQRA 3KFVA 1QKXA 4HVUA 3VS6A 3QWYA 4AFZC 2C0OA 1OOTA 1H3HA 2J06A 2X3XD 4DEYA 1UGVA 4J9HA 4J9IA 1GL5A 2SEMA 2K7AA 4LN2A 1X27A 3UATA 2K6DA 1GFDA 1G83A 2YUPA 3EHQA 5IXFA 2LCSA 2BZYA 2FPEA 2DVJA 1H8KA 2YUOA 2CH4A 1OPLA 1XOVA 3QWXX 3ULRB 4M4ZA 3NPFA 1ZX6A 4LE9A 4RTUA 2DRKA 4LNPA 3PVQA 2LJ3A 1AD5A 1W1FA 2KROA 2O9VA 4OMNA 2PTKA 1K9AA 2K3BA 2O31A 3VS2A 1UHCA 1AWXA 2RN8A 2J6KA 1K76A 3C0CA 1WYXA 2RQWA 1K4US 2KBTA 1BK2A 2DNUA 2W0ZA 3U23A 2RQUA 1B3QA 1V1CA 4D8DA 1RLQC 1JO8A 2GNCA 1KSWA 2X3WD 1HJDA 1QWEA 2RNAA 1IO6A 1QCFA 4RTZA 2A28A 1WI7A 1CKAA 1WXUA 2F2VA 2OJ2A 2A36A 2AKLA 3UF4A 2J05A 1AVZC 2W10A 4J9BA 2L2PA 1GCQA 2JS0A 1UTIA 3A98A 3M0PA 2EW3A 2CUBA 4ESRA 2MOXA 1AEYA 1U06A 1M3CA 4J9EA 5ECAA 2O2OA 2BZXA 1SSHA 1T0JA 1NG2A 4JPBW 1EFNA 2VKNA 3TSWA 4JZ3A 5IH2A 2ENMA 1YN8A 4AG2C 2F2XA 4RTYA 3RBBB 3VS0A 2I0NA 4GLMA 2JW4A 2KEAA 4RTTA 1SRMA 2CSQA 2JT4A 2L3SA 2FG0A 3NGPA 2DLPA 2CSIA 1ARKA 5FW9A 4AG1C 1M3BA 1M30A 4RTXA 2D8HA 2NUZA 1UE9A 1WDXA 3UA6A 2KYBA 2DM1A 1JEGA 4J9GA 1AWWA 2RQTA 2ED1A 2CH4W 4HVWA 2CT4A 2HDAA 2KGTA 1WX6A 1X6BA 2A08A 4JJCA 2JTEA 5IHNA 1PKTA 1AWJA 1PRMC 1BBZA 3EG3A 1PRLC 1ZLMA 1YWPA 1G2BA 2KT1A 4AFSC 4Y92A 2IIMA 3VS3A 2HCKA 2LJ0A 1K0XA 3EG1A 2P4RA 1UUEA 2NWMA 4Z88A 1JU5C 1UJ0A 1NLOC 2KRNA 2EYXA 1J3TA 2RMOA 2DRMA 1MV0B 3PVLA 3VS5A 1KFZA 1KJWA 2F2WA 2C0TA 2JM9A 1NYGA 1GBQA 5IXBA 1WA7A 4RUGA 3H0HA 2JXBA 4CC4B 2AZSA 1K1ZA 4AFUC 2VVKA 2PNIA 5HCKA 1SRLA 4F14A 1H92A 3VS1A 1I1JA 1NM7A 1RLPC 2DBKA 1JQQA 1YWOA 5FWBA 2DILA 2EVRA 1Z9ZA 3I5RA 1M27C 4LUDA 2AK5A 1JXMA 4DEXA 1SEMA 1GCQC 1M8MA 4IIMA 3THKA 1N5ZA 2GGRA 2JS2A 1T0HA 4OMMA 2CUDA 4JZ4A 2DL5A 4CC2A 1WFWA 2J6FA 1OEBA 2GQIA 1ZSGA 4F17A 2FPFA 1WXTA 1MV3A 1UG1A 2DBMA 1E6GA 2KRSA 2V1QA 1TUDA 2KYMA 2DMOA 1PHTA 1GRIA 1FMKA 2DX1A 2KR3A 1FYNA 1I0CA 3I35A 1ABQA 1VYVA 2RQVA 2PZ1A 1X69A 4J9FA 2G6FX 2LJ1A 2FRYA 2HSPA 1WXBA 2D8JA 3M0RA 3CQTA 4J9CA 2O9SA 3EGUA 3M0QA 1NLPC 3H0FA 2LQWA 2ROLA 1T3LA 3LH5A 2JMCA 2D1XA 2FO0A 2M0YA 2LMJA 1CSKA 5L23A 1UDLA 5I11A 2C0IA 2DYBA 1NEGA 3FJ5A 1HD3A 4F16A 5GJVB 1Y57A 1VA7A 2BTTA 1MUZA 2JM8A 3GBQA 1T3SA 2DL7A 1AOJA 3H41A 4K11A 3IQLA 4HCKA 2KE9A 2FRWA 4RTVA 2ESWA 2LX7A 2K2MA 2SRCA 2CT3A 2M51A 3EG0A 4X1VA 1E6HA 2DE0X 1YNZA 4JJDA 1VYTA 3M0SA 2EYZA 1ZUYA 1E7OA 1TUCA 1SHGA 2DJQA 4HVVA 2MIOA 4OMPA 1UJYA 4IIOA 4LUEA 2KXDA 1X43A 4HXJA 2FEIA 2D0NA 1ZBJA 2EBPA 1UECA 2EGEA 2MCNA 2H8HA 3H0IA 4Z89A 1ZUKA 2XMFA 1ZUUA 3M0UA 1AWOA 2L0AA 2YSQA 1Z9QA 1M3AA 2LNHB 3SEMA 1JXOA 2EPDA 4CC3A 1AZEA 3JV3A 1ABOA 2OAWA 2HBWA 1TG0A 3VS4A 1NYFA 3TSZA 2B86A 4OMOA 4E6RA 5EC7A 2ROTA 4GBQA 1WIEA 1SHFA 1BU1A 1AZGB 1I07A 2DF6A 3NMZC 1LCKA 2AZVA 2LZ6B 1KIKA 3I5SA 2EGAA 2K79A 2KT8A 4EIKA 1SPKA 3PE0A 2V1RA 2KRMA 3REBB 2BZ8A 3UA7A
chains in the Genus database with same CATH superfamily
2HQEA 5IHKA 3A8MB 1X2QA 4QQDA 1B7TA 3HHTB 1W70A 2HNIA 2YRDA 4M7DE 3V8KA 4FYYB 2QDLA 2EQJA 2WSFE 2EQIA 3OSSC 4KRTA 4DBFA 1M2OA 2VUBA 4C8QG 2H3EB 1GCPA 2P4TA 2RHXA 2O88A 1U3OA 2EKHA 3EGDA 3J80E 2MWOA 2M16A 4XTYA 4D8KA 3ZL7C 2CZ7B 5GAN4 3REAB 3I9QA 1BI0A 1UHFA 1OPKA 2KVQG 2OTJT 4EMKC 3CD6A 1Y96A 3EHRA 4M77C 2LQNA 2ECZA 1QVGA 1WZOA 3VRYA 2E64A 4X9CA 2RJCA 3GF5A 3H9NA 2EYYA 4N4GA 3UDCA 1QWFA 1HSQA 1UFFA 1XTDA 1VQPQ 2YUNA 2KSSA 4PFOA 5KYUB 2O4XB 3TU4K 4BUGA 4J9DA 3GOXA 1BIBA 5KYYB 1YHQA 4MZTA 2HEQA 2EGCA 1K0SA 2JVVA 1VQKQ 4Y91A 4JJNK 1M9SA 3I55Q 1QKXA 4OMFB 3VS6A 3DLMA 1OU8A 2FVUA 1ZQ1A 2IVWA 4PJOE 3CMAA 3MP1A 3L42A 3LGLA 3CD6T 3RIRA 4E7HA 1NBEB 4J9IA 1GL5A 1K8AR 2K7AA 4LN2A 1X27A 3HFNA 2QI2A 1G83A 1IB8A 1NJIU 1BI2A 1Q86C 1UGQB 2BKDN 4PJOG 1JJ2A 1H8KA 3OA6A 3QWXX 2A0FB 2ZPGB 4M78E 4LNPA 5GAN6 2LJ3A 2QDYB 4HT8A 1OU9A 3BDUA 5I2MA 3OS5A 4RG2A 4OMNA 1YHQT 2OTLQ 1FMVA 3GLXA 1UHCA 1WYXA 1QVFP 4NS5A 2KDSA 5GANd 2F5TX 4OGCA 1SSFA 4O5VA 5IAYA 2QQBA 1Q82U 2MWPA 3CC4Q 2RQUA 1WGSA 2CKKA 1RLQC 1JO8A 2GNCA 1IGQA 4C5IA 1KSWA 5DM7R 5GAMj 1QWEA 1QCFA 4KH1B 4PJNA 3ASKA 4M7AE 1N8RU 3SWNA 2RI3A 2XI9A 3HL8A 2A36A 2AKLA 2CP5A 4FT4A 2QA4A 4NL2A 3PNWC 4RMOA 1GCQA 3CCMA 1YJWQ 3VUZA 4XU3A 1UTIA 3MEUA 3CBPA 3M53A 2MOXA 5KCHA 4XTWA 1AEYA 1U06A 1SF9A 5GMKj 3DLLA 4F7UE 3CCQA 1NG2A 4JPBW 1YCYA 3QG1A 5GAN7 3NFCA 1B34A 5KE3A 5IH2A 4PFPA 3QDFA 1RAEB 4AG2C 4RTYA 1KD1R 2RJFA 5LJ3d 3PFSA 4RTTA 4C0GA 2XHCA 4QQGA 1SRMA 1YITA 1KC8R 4PK4A 2CSIA 3CCVQ 4C8QC 3JCMQ 5FW9A 4AG1C 1M3BA 1M30A 1WNLA 2NUZA 1TTHB 4FT2A 2KYBA 2CP6A 4M7DD 4DOVA 1RI0A 2CH4W 4LDWA 3CCLQ 3GNGA 4AT1B 2QA4T 1K73C 2COZA 2JTMA 1X6BA 2A08A 1AWJA 1BBZA 3EG3A 4AFSC 3MHXA 4LDYA 3OY9A 1ZBXA 2JN0A 2HCKA 4KULA 3PIPA 1UUEA 1O75A 1R77A 3WVEB 1JU5C 3CCQT 1NLOC 2EYXA 3A8LB 2RMOA 5CQYA 5L8RE 1PG5B 2WACA 1W2BP 5IXBA 1WA7A 4RUGA 1WHJA 1I81A 5HK0A 1YITT 2R5MA 4AFUC 2DZCA 4C92B 1QCNA 3OYKA 4F14A 1I1JA 2DBKA 1JQQA 1YWOA 3OYNA 4OP0A 2EQUA 1Q7YR 2EQMA 4DBRA 3P8DA 4IURA 1Z9ZA 4J83A 4Z02A 1M27C 2DERA 2PUOB 4DEXA 1SEMA 3ZBDA 1C1AA 1OULA 3THKA 1HK9A 4M75E 1N5ZA 4E47A 1SKUB 2GGRA 4XK8E 2CZ0B 3VKIA 1WQWA 1WFWA 3JCMX 4F17A 1UG1A 4LXCA 2DBMA 2KRSA 2ZZDA 4PJOD 4IUPA 1VQ8A 5GAN8 1ABQA 3OYJA 2LDMA 1KQSP 1QP2A 2HSPA 2D8JA 2NUTB 2RJDA 5AYFA 3QJ6A 5LJ5h 2O9SA 1PM3A 1OZ2A 1NLPC 4BI3A 4J5YA 3ER0A 3JCMV 4J8OA 2JMCA 3M54A 2XIDA 2M0YA 4OB3B 3V8LA 2DXBA 2EFIA 5L23A 1UDLA 5I11A 1MNDA 2E10A 5KH6A 1HD3A 4M78D 3EFRA 1NE8A 1D3BB 5GAMe 3JCMh 5GAOl 1QVGS 2X4JA 3X24B 5KYNA 3GBQA 4QQ6A 1WJSA 2NLUA 2DL7A 4A4EA 1C6VX 1VQNA 1KQ2A 4RTVA 4BI4A 5GAMh 2ESWA 2K2MA 3JRZA 3CPWP 2LX9A 2M51A 2GQVA 3EG0A 5HK3A 5FRMA 1VIEA 1MMDA 4P5NA 2VGMA 5GMKe 2DEUA 4M7AD 2HD0A 2P84A 3OB9A 4C0ZA 4EMKB 4CRIA 1ZUYA 2K3XA 2IG0A 1TUCA 4M77B 1Q86U 2DKGA 4LUEA 3G6EQ 3EG9B 2EBPA 5GMKh 4HA8A 2EGEA 1VQLA 2K5FA 2NUPA 3X26B 1AWOA 4M7DF 4M7DA 1Z9QA 3G1JA 1VQNT 2EWNA 2JUFA 2MYSA 3OW2P 3EH2A 4E7SA 1JJ2S 2EJFA 1XQHA 3LWHA 4MZPA 5DLQE 2HBWA 3P8HA 1TG0A 3RMSA 1VQ4T 3TSZA 4OB2B 4Y28E 1QP3A 3CC2Q 5CVIA 3OYDA 2ROTA 2E6NA 1BU1A 3I56Q 1VQ5A 1LCKA 2RI5A 2RJEA 1JB0E 4DA4A 1FXXA 4XU2A 1X6OA 1VQOQ 2FZCB 2K79A 4BY6C 1TXQA 4FW1A 2E4HA 2KRMA 3REBB 2BZ8A 2ABLA 2OI3A 3VRZA 4EMHA 1PWTA 3O5ZA 4OB0B 3CCRA 3DB3A 1M90R 4J6XA 3FB9A 3RNJA 5IN1A 2QEXQ 4MDXA 4JJBA 4R0KA 1RABB 1R8OB 2EYWA 5CKHA 3CXCA 1VQ5T 5EG2A 1TS9A 1K73U 3EG2A 1K8AU 2YDLA 3SHWA 4M75D 2FPDA 4NOYA 1H641 1N8RC 3RDVA 1U8RA 2XU8A 4KH0B 5IHIA 2A37A 3M57A 2GTOA 2LT1A 2X35A 3JCMb 3M58A 4VUBA 1PSFA 2VV5A 3A8GB 4ZGEB 1H3ZA 1B07A 2X4XA 1RAAB 3C4SA 2MMPA 3CCRT 4PNOA 2CDTA 2E5KA 4M78F 4M78A 4L59A 1S72Q 1BB9A 3OS2A 2GTJA 1VYUA 2K2VA 1HXDA 2CP3A 2E65A 1QKWA 2Y4XA 4A63B 5CK9A 3QZ5B 2AKKA 2L3QA 2ED0A 4C8QB 2COYA 1VQPA 2KNBB 1N9RA 1W6XA 5GANf 1G5VA 1X6GA 4WF2A 4A4KA 3KXTA 2RQRA 8AT1B 4HVUA 2C06A 4JLIA 4M7AF 4M7AA 1UGRB 3QXEB 1VQKA 4E7JA 2CZ1B 1QQJA 1UGVA 3I55A 4J9HA 5KYYA 1ZA2B 3L2RA 3SDZA 1UGSB 4IKFA 2XDDA 3UATA 2K6DA 2YLBA 2YUPA 4HCBA 1V76A 3RKXA 2RHIA 2LCSA 5D6WA 3SFMA 2FPEA 2M0OA 2AHJB 1KD1U 1IRXA 3ULRB 4M4ZA 3SWNC 4F7UF 4F7UA 3NPFA 3V7SA 1ZX6A 4LE9A 2DRKA 4A4HA 1G3WA 2YXYA 1AD5A 1P92A 1W1FA 2KROA 1VQPT 1WHGA 2PTKA 4MDWA 1K9AA 4XTVA 1AWXA 5LJ3f 2J6KA 2RQWA 3EH1A 2DZ9A 2L5QA 5KYWB 1QW1A 2OTLA 1WHHA 4FSXA 9ATCB 1VQKT 3I55T 2X4WA 3OYAA 2X3WD 4KT0E 4RTZA 4E7ZA 1QCOA 1IZ6A 3CC4A 1ZSZA 1MGQA 2YHTA 5LJ5g 3RKWA 3UF4A 2W10A 2JS0A 4M7DG 3OYFA 3R6OA 3CBOA 1M3CA 2FHDA 4QW2A 3RKYA 5ECAA 4XU1A 1SSHA 1T0JA 1YJWA 5CIUA 3JCMg 1EFNA 4JZ3A 1WJQA 1QVFS 1Y7XA 4ELZC 2D6FA 3FLGA 2HBPA 2OTLT 4ATOA 4GY5A 1IHWA 4C0FA 2RM4A 5GAOn 3NGPA 2DLPA 4ELYC 5GAMg 2HL3A 1OQKA 4XAXB 1JRIA 1WDXA 2DM1A 2LQKA 4J9GA 3VV0A 3CC4T 2RQTA 4M75F 4M75A 4HVWA 2CT4A 3CCVA 4HKEA 3QSUA 4JJCA 5IHNA 1PKTA 1PRLC 1G2BA 2KT1A 1LVKA 7AT1B 4Y92A 2DTHA 3VS3A 3CCLA 1Q95G 2QQAA 4PJMA 2NWMA 4EDUA 1YJWT 1J3TA 1MV0B 1KJWA 4E7LA 2C0TA 2JM9A 1VQ6Q 3G7ZA 2LRQA 1M1KC 2AIRB 3DB4A 5A0DA 5LJ5j 2ZPFB 5HCKA 3WXMB 1H92A 2E5QA 4PFZA 3L2QA 1D0ZA 5CKFA 4LD9K 3S3NA 1KK7A 1NPRA 4LUDA 1G3TA 2XDBA 1Q81R 2AK5A 3CCSQ 3NTKA 2E70A 2CP2A 5A2QE 4IUUA 3MJXA 5LJ3j 2JS2A 3CCLT 1T0HA 4FW2A 3E2UA 3HTRA 2DL5A 1RADB 3CMAT 4CC2A 4M78G 1OEBA 2GQIA 1EZZB 1ZSGA 3G71Q 1WXTA 3VU3C 5GAOm 4FIBA 2V1QA 2OAUA 1UB4A 2DMOA 1PHTA 1GRIA 4A4FA 1FYNA 1D1CA 1I0CA 3OS0A 3I35A 4J9FA 2LJ1A 2PVDB 1WXBA 3JAME 4BY6B 1YBYA 4BI8B 3M0RA 4PLLA 1XNIA 3CXCS 2LQWA 2KY9A 2ROLA 1BI3A 1VOMA 3LH5A 4C5EA 4M7AG 5D7UA 2FO0A 1MNEA 1Y07A 2XG8D 2EJ9A 5M9OA 4E7KA 3LWIA 5GJVB 2ZPBB 3T9NA 4KGVB 1JBMA 4E7IA 3CD6Q 1PC0A 4IUQA 1MUZA 1UEBA 2L3RA 4C0DC 1BIAA 1AOJA 3H41A 4K11A 2QQRA 4F7UG 2VXEA 4E2FB 3QIIA 1VQ9A 2LX7A 5D6YA 2YWWA 2VASA 4X34A 4ZGDB 4M7DC 3OYGA 2PVOB 2KK4A 4ZN1A 3M4YA 1K8AC 4BE0A 3CCMT 1IREB 2DYIA 2KQWA 3CEYA 1FWZA 1KQ1A 1SHGA 2DJQA 3M55A 4XU0A 1ACMB 4HVVA 2VXFA 5GAMd 3CCJQ 2MIOA 2XD0A 1WQ7A 2LNVA 3C94A 4OMPA 4QKUA 2KXDA 3CC7Q 1UECA 2MCNA 3S3MA 1M90U 1YI2Q 4BDZA 2V8KA 2GF7A 3G6EA 1FMWA 4XQ3A 2K4YA 1VQ7Q 4M77F 4M77A 2CP0A 1M3AA 1RL2A 2P0PA 3EG9A 1VQ9T 2YLCA 3C12A 5LL6S 3JV3A 5FROA 4R55A 3UPUA 3HFOA 2ATCB 2DD4A 2EJGA 3TEEA 4OMOA 2P0KA 1WPYA 3Q1JA 2EAYA 1MHNA 1WIEA 1SHFA 4GBQA 3JB9D 4KUDK 3EGXA 1YJ9Q 2LZ6B 3LYIA 3CC2A 3I5SA 3HPWA 5LJ5e 2I2LA 3HP9A 1PSEA 4BDYA 2QQ9A 4JRIA 3I56A 2JOYA 4PJOC 4M75G 1M2VB 4XTXA 4IUVA 2MF2A 3SWNB 4JRKA 3G6ET 4FYXB 4J6YA 1N6AA 3UA7A 1VQOA 4RTWA 1KD1C 1MMNA 1TSFA 2MPXC 8ATCB 3JCMe 1KC8C 1GFCA 4Z8AA 2MI6A 5LJ3e 1CKBA 2M02A 3N5BB 2HZYA 4L6V5 1YIJQ 2YRCA 1RI9A 1OZ3A 2QAZA 1B34B 2L3PA 1R0BG 3QUIA 4M78C 3G4SQ 4J7IA 4WCIA 4N0AC 2DL8A 2RD1A 5LJ3h 3LGFA 4C92E 3X28B 2ZPEB 5J3BA 2QEXA 3CC2T 2COWA 3MEVA 1QVPA 4ZNXA 1K9MR 4RCBA 2RHYA 4ORZA 1OV3A 4OGEA 2J7IA 3I56T 1NJIR 2QK0A 2RF0A 1VQ8T 3M9QA 1QVFA 1U5SA 4N4IA 2X9HA 3HRSA 2L89A 4AFQC 1QLYA 3TREA 4QT7A 2HKNA 3BW1A 2L8DA 2RPNA 4ZTJA 2RH2A 5CCAA 5I22A 1ZHIA 4JRQA 1M1KU 3ZFJA 1X2KA 3LW5E 2FL7A 1HYOA 4N4HA 3TCJA 1GBRA 3QZ9B 2VWFA 1Q7YC 4KGXB 2HKQB 2YT6A 5FWCA 5GMKi 1YP5A 3TVTA 2DA9A 1D09B 2Y90A 1NZ9A 3OYIA 3VS7A 1Q82R 1S72A 2K9GA 2DJZA 4CI0C 2V8JA 2QEXT 1YJNQ 3CPFA 2HQHA 4ZTFA 3META 2JZ2A 3M5AA 3CCEQ 3EAEA 2C0OA 1OOTA 4HCZA 1OX9A 5CKBA 2J06A 3J7AF 4DEYA 1ZA1B 3BE3A 3OYYA 3ME9A 3F70A 2QTXA 3BY7A 3MPUB 3FRNA 2D0QB 3OMCA 2DPPB 3H6ZA 2K57A 3L2ZA 1M1GA 2F69A 3E19A 4RCCA 2LT4A 2YUOA 2CH4A 1OPLA 1RAHB 1M1FA 3RESA 3GP8A 1ZSZC 2MK5A 4RTUA 3FIFA 4BE2A 5KYXA 3PVQA 3UT1A 1S72T 2O9VA 1VQLT 2WSCE 2K3BA 2O31A 3QDRB 3UWNA 3MCAB 2RN8A 4JUVA 1WJRA 2R58A 3TQ7P 1C0MA 1K4US 1BK2A 1QVGP 2DNUA 4KBMB 1V1CA 4M77E 1BCMA 3QKJA 1HJDA 1IO6A 1W2BA 3JB9F 1CKAA 3LLRA 4QVDA 5GAN3 3CMEQ 3CCUQ 1Y71A 4JDSA 1AVZC 4J7FA 3S6WA 2L2PA 2P0QA 5IT9E 4JLGA 4M77G 3A98A 2CUBA 5C6SA 4M75C 1TUGB 3URGA 2O2OA 1BKBA 2R5AA 4L5GA 2VKNA 1I5OB 3TSWA 4B9WA 1LPLA 4DQ2A 1UGPB 2F2XA 2E1HA 2Y4YA 1QMCA 2I0NA 4GLMA 3NTIA 2KEAA 5CO7A 2CSQA 2JT4A 3GNFB 2QASA 1VQ4Q 2D8HA 1JJ2P 2DVEA 2ZPIB 2HAXA 3VUBA 5FU6C 1OI1A 1KQSA 2E41A 4C0DB 1ZLMA 1YWPA 5GAOp 2IIMA 2V26A 1K0XA 3EG1A 4M7DB 4MMKA 4Z88A 2FZGB 3L2WA 3QHSA 5KYUA 1UJ0A 2O4XA 4C92D 2KRNA 2DRMA 3VS5A 3OQ5A 1KFZA 2F2WA 1NYGA 2CP7A 2JTFA 4UC4A 1GBQA 5CKDA 3H0HA 4CC4B 2AZSA 3PT9A 1K1ZA 2PNIA 3H8ZA 2FB7A 1SRLA 3VS1A 1BCOA 1NM7A 1RLPC 1KG1A 2CGHA 5FWBA 1VQ6A 3X20B 3CPWA 1XJWB 1M90C 1WHKA 1KC8U 2RI2A 2QXFA 1GCQC 1PD1A 2CZ6B 4LDUA 3DKMA 4QVZA 4IIMA 3HRUA 3RMQA 4PKCC 5FU7C 5CKEA 4OMMA 2A7YA 3CCSA 3GIBA 4JZ4A 3BFMA 5FRNA 3PGGA 4OB1B 2FPFA 3MP6A 1MV3A 2XDPA 1G3SA 3VYHB 2DX1A 1FMKA 2WSEE 2QQSA 2RQVA 1W4SA 2PZ1A 4ZN3A 3G71A 1X69A 4C8QE 1Q86R 2G6FX 1YFNA 5KE2A 3OW2A 4J9CA 1VQ6T 1D0XA 3HSBA 4PJOB 2QTVA 3H0FA 4LDXA 2ZGWA 1T3LA 2ZCFB 2NYSA 5GAMf 5CR2A 3QYHB 3KUFA 3GPLA 1CSKA 3L2UA 3FJ5A 4F16A 3E9GA 4FYWB 4LDVA 4LD6A 1Q7YU 5LJ3g 1VA7A 4WTOB 2RHZA 3QBYA 3CCST 1X75C 2BTTA 3QPHA 2VB6A 4PLIA 5A0GA 3MKDA 1BYMA 3EFOB 1T3SA 3MEWA 4M78B 2MAMA 3M56A 2KE9A 2PU9B 4M77D 2CT3A 3E9FA 3G71T 1IHVA 4X1VA 3OYCA 1YNZA 3A8HB 2DTOA 3NTHA 5GANj 4KGZB 4Q5WA 1VQMQ 4HCCA 1MMGA 2GFAA 1BI1A 4XTZA 2RO0A 4M7AB 2DFUA 2QG9B 4PJJA 2FEIA 1WHLA 2D0NA 3JB9G 2RK1A 2XKOC 1O9SA 2DO3A 2H8HA 3H0IA 2GCXA 1U1TA 4Z89A 3OBWA 4ZGJB 1ZUKA 3CCJA 1AHJB 1ZUUA 3CC7A 3SEMA 1YI2A 3A8OB 2EPDA 3JCMc 4CC3A 5J39A 1U1SA 4F7UB 5GMKl 3PTAA 3MO8A 1VQ7A 2OAWA 1K73R 2JNGA 3CCVT 2JJ9A 3VS4A 1NYFA 5CQXA 5DLOA 1K9MU 2B86A 3EFSA 4NL3A 3WVDB 4C92F 4C92A 5EC7A 2LCCA 3QJYA 1VIFA 3NMZC 2OTJQ 4JS4A 2AZVA 2EGAA 4EIKA 4A54A 4DBHA 4AMCA 3PE0A 3CCJT 1YJ9A 1W2BS 1ZSZB 4CC7A 3CC7T 3OMGA 2DXCA 5GJWB 3EGDB 1YI2T 3PMIA 1M5Q1 4OMQA 2G3RA 1Y0MA 4KUIA 3JCMJ 3FEOA 6AT1B 1VQ7T 4FYVB 3M0TA 1M2VA 2LQ8A 2O01E 1EX4A 1RUWA 1EIFA 2HSEB 2IPOB 4OMLA 1Y96B 4B6MA 2YUQA 2KXCA 2LP5A 3CBMA 2NUTA 2AT1B 1PKSA 5LJ5d 1NEBA 2RA2A 1YIJA 2PUKB 1A0NB 3OYBA 1S1NA 1TWBA 3E1SA 2GBQA 3RR6A 2DL4A 3G4SA 2DL3A 3L2VA 2DAQA 4FSSA 3OYLA 4BB7A 1YJ9T 4GLKA 2XK0A 3VYGA 1YCSB 4BD3A 1D3BA 1PNJA 4DOWA 3JCMd 3OYEA 4M75B 5HY6A 1KQSS 2J6OA 1TH7A 2M9UA 3R6NA 2HL5C 4C8QD 2X51A 3S3OA 2JMAA 2LCLA 4RG8A 1YHQQ 1WLPB 3NHNA 3SD4A 2LC4A 1GXIE 1Q81C 3M59A 4OF1A 3CMAQ 1YIJT 4EMKA 4BACA 2CREA 3QYGB 5FU6B 3KFVA 3ZEHA 5GAN2 3QWYA 4AFZC 3G4ST 2QGGA 2Z0WA 1H3HA 5GANe 1LNXA 3PMTA 2X3XD 1YJNA 3CPWS 3RUXA 2SEMA 3CCEA 2DD5A 1GFDA 3EHQA 5IXFA 2E3IA 2BZYA 2D9TA 2DVJA 5GANh 3CXCP 2BE9B 1TU0B 3PIOA 1XOVA 1I8FA 2VGNA 4HT9A 4IUTA 2RK2A 2BUDA 3HKSA 2E3HA 5A0LA 1PCXA 3LH0A 2VC8A 3OBYA 2E12A 3VS2A 4F04B 3BDLA 1K76A 1RAIB 3C0CA 4TVRA 2KBTA 4EMGA 2W0ZA 2RB6A 3U23A 4V2SA 1B3QA 2HQXA 3OW2S 4D8DA 2DEQA 2PQWA 2V8IA 3KBGA 1YJNT 2QA4Q 5FU7B 2RNAA 4PJLA 3CCMQ 2A28A 3CCET 1KHCA 1WI7A 1WXUA 2F2VA 2OJ2A 3OS1A 4J6WA 2J05A 4J9BA 4XTUA 3CCQQ 3L1AA 1D1AA 3M0PA 2EW3A 4ESRA 1FX7A 3J81E 3CMEA 1IXDA 4J9EA 3CCUA 1TOVA 4PL6A 2BZXA 3OSVA 1YITQ 4MMLA 2ENMA 3AHUA 3FJPA 1VQOT 3RERA 1YN8A 4A4GA 2DXUA 3FC3A 3SB2A 3RBBB 3VJPA 3VS0A 4C92G 2JW4A 3P8BB 1VQ9Q 4M7AC 2L3SA 2FG0A 1ARKA 1WHMA 3LX7A 3AT1B 4RTXA 1UE9A 3UA6A 2X4YA 1JEGA 1AWWA 2FYKA 1V29B 2ED1A 4II1A 2DXTA 2HDAA 2KGTA 4EPCA 1WX6A 3A5ZB 1MMAA 1VQ4A 2JTEA 3HRTA 1PRMC 3OYHA 1I5LA 2LJ0A 3CMET 3CCUT 1N8RR 2P4RA 4R56A 4RKUE 3V7CA 2DTIA 1I4K1 3PVLA 4C8QF 4C8QA 4OVAA 3FDRA 2QYZA 5GAN5 5I21A 2JXBA 2KAFA 1RACB 2VVKA 3JSCA 3V7RA 5C0MA 2OX7A 2K3YA 3EGXB 2F5KA 5KCOA 1LJOA 3QO3A 2DIQA 2DILA 2EVRA 1M8VA 3I5RA 2K5IA 2KI7A 1JXMA 1RAFB 1OYXA 1M8MA 4JS5A 4FL6A 1VUBA 3JB9H 1NPPA 4ANJA 2CUDA 1SG5A 1RAGB 1KHIA 1VQ8Q 2J6FA 3MP8A 4FM4B 2EKOA 1DJ7B 2BIVA 1E6GA 1OX8A 1K9MC 1TUDA 2KYMA 2KR3A 3V8JA 1NJIC 1N27A 2H3JA 2CYZB 1VYVA 4FCYA 4DBQA 2FRYA 5J26A 3JCMP 5KYWA 1G3YA 3CQTA 3EGUA 2E6ZA 3M0QA 4A53A 3JCMW 1AT1B 5DY9A 4YTLA 3O8VA 2D1XA 2DIGA 1LOJA 4B9XA 1R0CB 2LMJA 4ME7A 2C0IA 2DYBA 1NEGA 5HKCA 1Y57A 4BE1A 2DK3A 1Q82C 1D0YA 1VQNQ 1D1BA 5I2SA 1Q81U 3MEAA 1M4ZA 5D6XA 4PJOF 4PJOA 3X25B 2JM8A 4QVCA 2A3LA 3IQLA 2HMAA 4HCKA 2FRWA 5AT1B 5CAIA 2BE7D 2SRCA 4C5GA 2LTOA 5FLXE 4JRPA 2QGFB 1E6HA 2DE0X 1F1BB 1X01A 4JJDA 2ZAEA 4X9DA 1VYTA 3M0SA 3INZA 2EYQA 5GMKm 3EFOA 2EYZA 2RHUA 1E7OA 4O6JA 2NUPB 2ZPHB 2VYTA 1VQLQ 2PVGB 4N0AA 1IGUA 2YRVA 1UJYA 4IIOA 1X43A 4HXJA 2EIFA 1ZBJA 4C92C 1VQMA 1N9SA 2K5LA 2M1HA 2XMFA 3JB9J 3M0UA 4FU6A 2L0AA 2YSQA 2EQKA 2LNHB 1JXOA 5GAOq 3C95A 4C5HA 1AZEA 2FZKB 5KYXB 1ABOA 1PD0A 2LVMA 1VQ5Q 3A1PA 3M4GA 2GFUA 5GANg 2KMTA 4E6RA 5LJ5f 1AZGB 1G8XA 3D7SB 1I07A 2CS7A 2B8AA 2XICA 2DF6A 3JB9I 4MZMA 5GAOr 1KIKA 1VQMT 2DETA 2R57A 2KT8A 4D6WA 1SPKA 3OYMA 2OTJA 3JCMf 1M1KR 2V1RA 3CCRQ 2F1LA
chains in the Genus database with same CATH topology
4CC7A 2ABLA 2OI3A 4RTWA 3VRZA 5IHKA 1PWTA 3O5ZA 1X2QA 5GJWB 4OMQA 1Y0MA 1GFCA 1W70A 4Z8AA 1CKBA 2QDLA 2EQIA 3M0TA 3RNJA 1RUWA 4KRTA 1RI9A 1GCPA 4OMLA 4JJBA 2L3PA 4R0KA 2YUQA 2KXCA 2LP5A 2EYWA 2O88A 1U3OA 1PKSA 2EKHA 1NEBA 4WCIA 2DL8A 3EG2A 1A0NB 1S1NA 2YDLA 3SHWA 2FPDA 4D8KA 3ZL7C 2GBQA 3REAB 2DL4A 4ZNXA 3I9QA 2DL3A 1UHFA 4ORZA 1OV3A 2J7IA 5IHIA 1OPKA 2RF0A 4FSSA 2A37A 2GTOA 1YCSB 1PNJA 1U5SA 3EHRA 2LQNA 2J6OA 2ECZA 1QLYA 4AFQC 4QT7A 3VRYA 1B07A 2RPNA 2EYYA 5I22A 3R6NA 2CDTA 1QWFA 1HSQA 1X2KA 2E5KA 2JMAA 1UFFA 1BB9A 1WLPB 3NHNA 1GBRA 2YUNA 2VWFA 2GTJA 1VYUA 2YT6A 5FWCA 1QKWA 4A63B 1YP5A 3TVTA 2DA9A 4J9DA 3VS7A 2AKKA 2L3QA 2ED0A 2K9GA 2KNBB 2HEQA 2EGCA 1K0SA 1W6XA 2CREA 1X6GA 2RQRA 3KFVA 1QKXA 4HVUA 3VS6A 3QWYA 4AFZC 2C0OA 1OOTA 1H3HA 2J06A 2X3XD 4DEYA 1UGVA 4J9HA 4J9IA 1GL5A 2SEMA 2K7AA 4LN2A 1X27A 3UATA 2K6DA 1GFDA 1G83A 2YUPA 3EHQA 5IXFA 2LCSA 2BZYA 2FPEA 2DVJA 1H8KA 2YUOA 2CH4A 1OPLA 1XOVA 3QWXX 3ULRB 4M4ZA 3NPFA 1ZX6A 4LE9A 4RTUA 2DRKA 4LNPA 3PVQA 2LJ3A 1AD5A 1W1FA 2KROA 2O9VA 4OMNA 2PTKA 1K9AA 2K3BA 2O31A 3VS2A 1UHCA 1AWXA 2RN8A 2J6KA 1K76A 3C0CA 1WYXA 2RQWA 1K4US 2KBTA 1BK2A 2DNUA 2W0ZA 3U23A 2RQUA 1B3QA 1V1CA 4D8DA 1RLQC 1JO8A 2GNCA 1KSWA 2X3WD 1HJDA 1QWEA 2RNAA 1IO6A 1QCFA 4RTZA 2A28A 1WI7A 1CKAA 1WXUA 2F2VA 2OJ2A 2A36A 2AKLA 3UF4A 2J05A 1AVZC 2W10A 4J9BA 2L2PA 1GCQA 2JS0A 1UTIA 3A98A 3M0PA 2EW3A 2CUBA 4ESRA 2MOXA 1AEYA 1U06A 1M3CA 4J9EA 5ECAA 2O2OA 2BZXA 1SSHA 1T0JA 1NG2A 4JPBW 1EFNA 2VKNA 3TSWA 4JZ3A 5IH2A 2ENMA 1YN8A 4AG2C 2F2XA 4RTYA 3RBBB 3VS0A 2I0NA 4GLMA 2JW4A 2KEAA 4RTTA 1SRMA 2CSQA 2JT4A 2L3SA 2FG0A 3NGPA 2DLPA 2CSIA 1ARKA 5FW9A 4AG1C 1M3BA 1M30A 4RTXA 2D8HA 2NUZA 1UE9A 1WDXA 3UA6A 2KYBA 2DM1A 1JEGA 4J9GA 1AWWA 2RQTA 2ED1A 2CH4W 4HVWA 2CT4A 2HDAA 2KGTA 1WX6A 1X6BA 2A08A 4JJCA 2JTEA 5IHNA 1PKTA 1AWJA 1PRMC 1BBZA 3EG3A 1PRLC 1ZLMA 1YWPA 1G2BA 2KT1A 4AFSC 4Y92A 2IIMA 3VS3A 2HCKA 2LJ0A 1K0XA 3EG1A 2P4RA 1UUEA 2NWMA 4Z88A 1JU5C 1UJ0A 1NLOC 2KRNA 2EYXA 1J3TA 2RMOA 2DRMA 1MV0B 3PVLA 3VS5A 1KFZA 1KJWA 2F2WA 2C0TA 2JM9A 1NYGA 1GBQA 5IXBA 1WA7A 4RUGA 3H0HA 2JXBA 4CC4B 2AZSA 1K1ZA 4AFUC 2VVKA 2PNIA 5HCKA 1SRLA 4F14A 1H92A 3VS1A 1I1JA 1NM7A 1RLPC 2DBKA 1JQQA 1YWOA 5FWBA 2DILA 2EVRA 1Z9ZA 3I5RA 1M27C 4LUDA 2AK5A 1JXMA 4DEXA 1SEMA 1GCQC 1M8MA 4IIMA 3THKA 1N5ZA 2GGRA 2JS2A 1T0HA 4OMMA 2CUDA 4JZ4A 2DL5A 4CC2A 1WFWA 2J6FA 1OEBA 2GQIA 1ZSGA 4F17A 2FPFA 1WXTA 1MV3A 1UG1A 2DBMA 1E6GA 2KRSA 2V1QA 1TUDA 2KYMA 2DMOA 1PHTA 1GRIA 1FMKA 2DX1A 2KR3A 1FYNA 1I0CA 3I35A 1ABQA 1VYVA 2RQVA 2PZ1A 1X69A 4J9FA 2G6FX 2LJ1A 2FRYA 2HSPA 1WXBA 2D8JA 3M0RA 3CQTA 4J9CA 2O9SA 3EGUA 3M0QA 1NLPC 3H0FA 2LQWA 2ROLA 1T3LA 3LH5A 2JMCA 2D1XA 2FO0A 2M0YA 2LMJA 1CSKA 5L23A 1UDLA 5I11A 2C0IA 2DYBA 1NEGA 3FJ5A 1HD3A 4F16A 5GJVB 1Y57A 1VA7A 2BTTA 1MUZA 2JM8A 3GBQA 1T3SA 2DL7A 1AOJA 3H41A 4K11A 3IQLA 4HCKA 2KE9A 2FRWA 4RTVA 2ESWA 2LX7A 2K2MA 2SRCA 2CT3A 2M51A 3EG0A 4X1VA 1E6HA 2DE0X 1YNZA 4JJDA 1VYTA 3M0SA 2EYZA 1ZUYA 1E7OA 1TUCA 1SHGA 2DJQA 4HVVA 2MIOA 4OMPA 1UJYA 4IIOA 4LUEA 2KXDA 1X43A 4HXJA 2FEIA 2D0NA 1ZBJA 2EBPA 1UECA 2EGEA 2MCNA 2H8HA 3H0IA 4Z89A 1ZUKA 2XMFA 1ZUUA 3M0UA 1AWOA 2L0AA 2YSQA 1Z9QA 1M3AA 2LNHB 3SEMA 1JXOA 2EPDA 4CC3A 1AZEA 3JV3A 1ABOA 2OAWA 2HBWA 1TG0A 3VS4A 1NYFA 3TSZA 2B86A 4OMOA 4E6RA 5EC7A 2ROTA 4GBQA 1WIEA 1SHFA 1BU1A 1AZGB 1I07A 2DF6A 3NMZC 1LCKA 2AZVA 2LZ6B 1KIKA 3I5SA 2EGAA 2K79A 2KT8A 4EIKA 1SPKA 3PE0A 2V1RA 2KRMA 3REBB 2BZ8A 3UA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC7 A;  2ABL A;  2OI3 A;  4RTW A;  3VRZ A;  5IHK A;  1PWT A;  3O5Z A;  1X2Q A;  5GJW B;  4OMQ A;  1Y0M A;  1GFC A;  1W70 A;  4Z8A A;  1CKB A;  2QDL A;  2EQI A;  3M0T A;  3RNJ A;  1RUW A;  4KRT A;  1RI9 A;  1GCP A;  4OML A;  4JJB A;  2L3P A;  4R0K A;  2YUQ A;  2KXC A;  2LP5 A;  2EYW A;  2O88 A;  1U3O A;  1PKS A;  2EKH A;  1NEB A;  4WCI A;  2DL8 A;  3EG2 A;  1A0N B;  1S1N A;  2YDL A;  3SHW A;  2FPD A;  4D8K A;  3ZL7 C;  2GBQ A;  3REA B;  2DL4 A;  4ZNX A;  3I9Q A;  2DL3 A;  1UHF A;  4ORZ A;  1OV3 A;  2J7I A;  5IHI A;  1OPK A;  2RF0 A;  4FSS A;  2A37 A;  2GTO A;  1YCS B;  1PNJ A;  1U5S A;  3EHR A;  2LQN A;  2J6O A;  2ECZ A;  1QLY A;  4AFQ C;  4QT7 A;  3VRY A;  1B07 A;  2RPN A;  2EYY A;  5I22 A;  3R6N A;  2CDT A;  1QWF A;  1HSQ A;  1X2K A;  2E5K A;  2JMA A;  1UFF A;  1BB9 A;  1WLP B;  3NHN A;  1GBR A;  2YUN A;  2VWF A;  2GTJ A;  1VYU A;  2YT6 A;  5FWC A;  1QKW A;  4A63 B;  1YP5 A;  3TVT A;  2DA9 A;  4J9D A;  3VS7 A;  2AKK A;  2L3Q A;  2ED0 A;  2K9G A;  2KNB B;  2HEQ A;  2EGC A;  1K0S A;  1W6X A;  2CRE A;  1X6G A;  2RQR A;  3KFV A;  1QKX A;  4HVU A;  3VS6 A;  3QWY A;  4AFZ C;  2C0O A;  1OOT A;  1H3H A;  2J06 A;  2X3X D;  4DEY A;  1UGV A;  4J9H A;  4J9I A;  1GL5 A;  2SEM A;  2K7A A;  4LN2 A;  1X27 A;  3UAT A;  2K6D A;  1GFD A;  1G83 A;  2YUP A;  3EHQ A;  5IXF A;  2LCS A;  2BZY A;  2FPE A;  2DVJ A;  1H8K A;  2YUO A;  2CH4 A;  1OPL A;  1XOV A;  3QWX X;  3ULR B;  4M4Z A;  3NPF A;  1ZX6 A;  4LE9 A;  4RTU A;  2DRK A;  4LNP A;  3PVQ A;  2LJ3 A;  1AD5 A;  1W1F A;  2KRO A;  2O9V A;  4OMN A;  2PTK A;  1K9A A;  2K3B A;  2O31 A;  3VS2 A;  1UHC A;  1AWX A;  2RN8 A;  2J6K A;  1K76 A;  3C0C A;  1WYX A;  2RQW A;  1K4U S;  2KBT A;  1BK2 A;  2DNU A;  2W0Z A;  3U23 A;  2RQU A;  1B3Q A;  1V1C A;  4D8D A;  1RLQ C;  1JO8 A;  2GNC A;  1KSW A;  2X3W D;  1HJD A;  1QWE A;  2RNA A;  1IO6 A;  1QCF A;  4RTZ A;  2A28 A;  1WI7 A;  1CKA A;  1WXU A;  2F2V A;  2OJ2 A;  2A36 A;  2AKL A;  3UF4 A;  2J05 A;  1AVZ C;  2W10 A;  4J9B A;  2L2P A;  1GCQ A;  2JS0 A;  1UTI A;  3A98 A;  3M0P A;  2EW3 A;  2CUB A;  4ESR A;  2MOX A;  1AEY A;  1U06 A;  1M3C A;  4J9E A;  5ECA A;  2O2O A;  2BZX A;  1SSH A;  1T0J A;  1NG2 A;  4JPB W;  1EFN A;  2VKN A;  3TSW A;  4JZ3 A;  5IH2 A;  2ENM A;  1YN8 A;  4AG2 C;  2F2X A;  4RTY A;  3RBB B;  3VS0 A;  2I0N A;  4GLM A;  2JW4 A;  2KEA A;  4RTT A;  1SRM A;  2CSQ A;  2JT4 A;  2L3S A;  2FG0 A;  3NGP A;  2DLP A;  2CSI A;  1ARK A;  5FW9 A;  4AG1 C;  1M3B A;  1M30 A;  4RTX A;  2D8H A;  2NUZ A;  1UE9 A;  1WDX A;  3UA6 A;  2KYB A;  2DM1 A;  1JEG A;  4J9G A;  1AWW A;  2RQT A;  2ED1 A;  2CH4 W;  4HVW A;  2CT4 A;  2HDA A;  2KGT A;  1WX6 A;  1X6B A;  2A08 A;  4JJC A;  2JTE A;  5IHN A;  1PKT A;  1AWJ A;  1PRM C;  1BBZ A;  3EG3 A;  1PRL C;  1ZLM A;  1YWP A;  1G2B A;  2KT1 A;  4AFS C;  4Y92 A;  2IIM A;  3VS3 A;  2HCK A;  2LJ0 A;  1K0X A;  3EG1 A;  2P4R A;  1UUE A;  2NWM A;  4Z88 A;  1JU5 C;  1UJ0 A;  1NLO C;  2KRN A;  2EYX A;  1J3T A;  2RMO A;  2DRM A;  1MV0 B;  3PVL A;  3VS5 A;  1KFZ A;  1KJW A;  2F2W A;  2C0T A;  2JM9 A;  1NYG A;  1GBQ A;  5IXB A;  1WA7 A;  4RUG A;  3H0H A;  2JXB A;  4CC4 B;  2AZS A;  1K1Z A;  4AFU C;  2VVK A;  2PNI A;  5HCK A;  1SRL A;  4F14 A;  1H92 A;  3VS1 A;  1I1J A;  1NM7 A;  1RLP C;  2DBK A;  1JQQ A;  1YWO A;  5FWB A;  2DIL A;  2EVR A;  1Z9Z A;  3I5R A;  1M27 C;  4LUD A;  2AK5 A;  1JXM A;  4DEX A;  1SEM A;  1GCQ C;  1M8M A;  4IIM A;  3THK A;  1N5Z A;  2GGR A;  2JS2 A;  1T0H A;  4OMM A;  2CUD A;  4JZ4 A;  2DL5 A;  4CC2 A;  1WFW A;  2J6F A;  1OEB A;  2GQI A;  1ZSG A;  4F17 A;  2FPF A;  1WXT A;  1MV3 A;  1UG1 A;  2DBM A;  1E6G A;  2KRS A;  2V1Q A;  1TUD A;  2KYM A;  2DMO A;  1PHT A;  1GRI A;  1FMK A;  2DX1 A;  2KR3 A;  1FYN A;  1I0C A;  3I35 A;  1ABQ A;  1VYV A;  2RQV A;  2PZ1 A;  1X69 A;  4J9F A;  2G6F X;  2LJ1 A;  2FRY A;  2HSP A;  1WXB A;  2D8J A;  3M0R A;  3CQT A;  4J9C A;  2O9S A;  3EGU A;  3M0Q A;  1NLP C;  3H0F A;  2LQW A;  2ROL A;  1T3L A;  3LH5 A;  2JMC A;  2D1X A;  2FO0 A;  2M0Y A;  2LMJ A;  1CSK A;  5L23 A;  1UDL A;  5I11 A;  2C0I A;  2DYB A;  1NEG A;  3FJ5 A;  1HD3 A;  4F16 A;  5GJV B;  1Y57 A;  1VA7 A;  2BTT A;  1MUZ A;  2JM8 A;  3GBQ A;  1T3S A;  2DL7 A;  1AOJ A;  3H41 A;  4K11 A;  3IQL A;  4HCK A;  2KE9 A;  2FRW A;  4RTV A;  2ESW A;  2LX7 A;  2K2M A;  2SRC A;  2CT3 A;  2M51 A;  3EG0 A;  4X1V A;  1E6H A;  2DE0 X;  1YNZ A;  4JJD A;  1VYT A;  3M0S A;  2EYZ A;  1ZUY A;  1E7O A;  1TUC A;  1SHG A;  2DJQ A;  4HVV A;  2MIO A;  4OMP A;  1UJY A;  4IIO A;  4LUE A;  2KXD A;  1X43 A;  4HXJ A;  2FEI A;  2D0N A;  1ZBJ A;  2EBP A;  1UEC A;  2EGE A;  2MCN A;  2H8H A;  3H0I A;  4Z89 A;  1ZUK A;  2XMF A;  1ZUU A;  3M0U A;  1AWO A;  2L0A A;  2YSQ A;  1Z9Q A;  1M3A A;  2LNH B;  3SEM A;  1JXO A;  2EPD A;  4CC3 A;  1AZE A;  3JV3 A;  1ABO A;  2OAW A;  2HBW A;  1TG0 A;  3VS4 A;  1NYF A;  3TSZ A;  2B86 A;  4OMO A;  4E6R A;  5EC7 A;  2ROT A;  4GBQ A;  1WIE A;  1SHF A;  1BU1 A;  1AZG B;  1I07 A;  2DF6 A;  3NMZ C;  1LCK A;  2AZV A;  2LZ6 B;  1KIK A;  3I5S A;  2EGA A;  2K79 A;  2KT8 A;  4EIK A;  1SPK A;  3PE0 A;  2V1R A;  2KRM A;  3REB B;  2BZ8 A;  3UA7 A; 
#chains in the Genus database with same CATH topology
 2HQE A;  5IHK A;  3A8M B;  1X2Q A;  4QQD A;  1B7T A;  3HHT B;  1W70 A;  2HNI A;  2YRD A;  4M7D E;  3V8K A;  4FYY B;  2QDL A;  2EQJ A;  2WSF E;  2EQI A;  3OSS C;  4KRT A;  4DBF A;  1M2O A;  2VUB A;  4C8Q G;  2H3E B;  1GCP A;  2P4T A;  2RHX A;  2O88 A;  1U3O A;  2EKH A;  3EGD A;  3J80 E;  2MWO A;  2M16 A;  4XTY A;  4D8K A;  3ZL7 C;  2CZ7 B;  5GAN 4;  3REA B;  3I9Q A;  1BI0 A;  1UHF A;  1OPK A;  2KVQ G;  2OTJ T;  4EMK C;  3CD6 A;  1Y96 A;  3EHR A;  4M77 C;  2LQN A;  2ECZ A;  1QVG A;  1WZO A;  3VRY A;  2E64 A;  4X9C A;  2RJC A;  3GF5 A;  3H9N A;  2EYY A;  4N4G A;  3UDC A;  1QWF A;  1HSQ A;  1UFF A;  1XTD A;  1VQP Q;  2YUN A;  2KSS A;  4PFO A;  5KYU B;  2O4X B;  3TU4 K;  4BUG A;  4J9D A;  3GOX A;  1BIB A;  5KYY B;  1YHQ A;  4MZT A;  2HEQ A;  2EGC A;  1K0S A;  2JVV A;  1VQK Q;  4Y91 A;  4JJN K;  1M9S A;  3I55 Q;  1QKX A;  4OMF B;  3VS6 A;  3DLM A;  1OU8 A;  2FVU A;  1ZQ1 A;  2IVW A;  4PJO E;  3CMA A;  3MP1 A;  3L42 A;  3LGL A;  3CD6 T;  3RIR A;  4E7H A;  1NBE B;  4J9I A;  1GL5 A;  1K8A R;  2K7A A;  4LN2 A;  1X27 A;  3HFN A;  2QI2 A;  1G83 A;  1IB8 A;  1NJI U;  1BI2 A;  1Q86 C;  1UGQ B;  2BKD N;  4PJO G;  1JJ2 A;  1H8K A;  3OA6 A;  3QWX X;  2A0F B;  2ZPG B;  4M78 E;  4LNP A;  5GAN 6;  2LJ3 A;  2QDY B;  4HT8 A;  1OU9 A;  3BDU A;  5I2M A;  3OS5 A;  4RG2 A;  4OMN A;  1YHQ T;  2OTL Q;  1FMV A;  3GLX A;  1UHC A;  1WYX A;  1QVF P;  4NS5 A;  2KDS A;  5GAN d;  2F5T X;  4OGC A;  1SSF A;  4O5V A;  5IAY A;  2QQB A;  1Q82 U;  2MWP A;  3CC4 Q;  2RQU A;  1WGS A;  2CKK A;  1RLQ C;  1JO8 A;  2GNC A;  1IGQ A;  4C5I A;  1KSW A;  5DM7 R;  5GAM j;  1QWE A;  1QCF A;  4KH1 B;  4PJN A;  3ASK A;  4M7A E;  1N8R U;  3SWN A;  2RI3 A;  2XI9 A;  3HL8 A;  2A36 A;  2AKL A;  2CP5 A;  4FT4 A;  2QA4 A;  4NL2 A;  3PNW C;  4RMO A;  1GCQ A;  3CCM A;  1YJW Q;  3VUZ A;  4XU3 A;  1UTI A;  3MEU A;  3CBP A;  3M53 A;  2MOX A;  5KCH A;  4XTW A;  1AEY A;  1U06 A;  1SF9 A;  5GMK j;  3DLL A;  4F7U E;  3CCQ A;  1NG2 A;  4JPB W;  1YCY A;  3QG1 A;  5GAN 7;  3NFC A;  1B34 A;  5KE3 A;  5IH2 A;  4PFP A;  3QDF A;  1RAE B;  4AG2 C;  4RTY A;  1KD1 R;  2RJF A;  5LJ3 d;  3PFS A;  4RTT A;  4C0G A;  2XHC A;  4QQG A;  1SRM A;  1YIT A;  1KC8 R;  4PK4 A;  2CSI A;  3CCV Q;  4C8Q C;  3JCM Q;  5FW9 A;  4AG1 C;  1M3B A;  1M30 A;  1WNL A;  2NUZ A;  1TTH B;  4FT2 A;  2KYB A;  2CP6 A;  4M7D D;  4DOV A;  1RI0 A;  2CH4 W;  4LDW A;  3CCL Q;  3GNG A;  4AT1 B;  2QA4 T;  1K73 C;  2COZ A;  2JTM A;  1X6B A;  2A08 A;  1AWJ A;  1BBZ A;  3EG3 A;  4AFS C;  3MHX A;  4LDY A;  3OY9 A;  1ZBX A;  2JN0 A;  2HCK A;  4KUL A;  3PIP A;  1UUE A;  1O75 A;  1R77 A;  3WVE B;  1JU5 C;  3CCQ T;  1NLO C;  2EYX A;  3A8L B;  2RMO A;  5CQY A;  5L8R E;  1PG5 B;  2WAC A;  1W2B P;  5IXB A;  1WA7 A;  4RUG A;  1WHJ A;  1I81 A;  5HK0 A;  1YIT T;  2R5M A;  4AFU C;  2DZC A;  4C92 B;  1QCN A;  3OYK A;  4F14 A;  1I1J A;  2DBK A;  1JQQ A;  1YWO A;  3OYN A;  4OP0 A;  2EQU A;  1Q7Y R;  2EQM A;  4DBR A;  3P8D A;  4IUR A;  1Z9Z A;  4J83 A;  4Z02 A;  1M27 C;  2DER A;  2PUO B;  4DEX A;  1SEM A;  3ZBD A;  1C1A A;  1OUL A;  3THK A;  1HK9 A;  4M75 E;  1N5Z A;  4E47 A;  1SKU B;  2GGR A;  4XK8 E;  2CZ0 B;  3VKI A;  1WQW A;  1WFW A;  3JCM X;  4F17 A;  1UG1 A;  4LXC A;  2DBM A;  2KRS A;  2ZZD A;  4PJO D;  4IUP A;  1VQ8 A;  5GAN 8;  1ABQ A;  3OYJ A;  2LDM A;  1KQS P;  1QP2 A;  2HSP A;  2D8J A;  2NUT B;  2RJD A;  5AYF A;  3QJ6 A;  5LJ5 h;  2O9S A;  1PM3 A;  1OZ2 A;  1NLP C;  4BI3 A;  4J5Y A;  3ER0 A;  3JCM V;  4J8O A;  2JMC A;  3M54 A;  2XID A;  2M0Y A;  4OB3 B;  3V8L A;  2DXB A;  2EFI A;  5L23 A;  1UDL A;  5I11 A;  1MND A;  2E10 A;  5KH6 A;  1HD3 A;  4M78 D;  3EFR A;  1NE8 A;  1D3B B;  5GAM e;  3JCM h;  5GAO l;  1QVG S;  2X4J A;  3X24 B;  5KYN A;  3GBQ A;  4QQ6 A;  1WJS A;  2NLU A;  2DL7 A;  4A4E A;  1C6V X;  1VQN A;  1KQ2 A;  4RTV A;  4BI4 A;  5GAM h;  2ESW A;  2K2M A;  3JRZ A;  3CPW P;  2LX9 A;  2M51 A;  2GQV A;  3EG0 A;  5HK3 A;  5FRM A;  1VIE A;  1MMD A;  4P5N A;  2VGM A;  5GMK e;  2DEU A;  4M7A D;  2HD0 A;  2P84 A;  3OB9 A;  4C0Z A;  4EMK B;  4CRI A;  1ZUY A;  2K3X A;  2IG0 A;  1TUC A;  4M77 B;  1Q86 U;  2DKG A;  4LUE A;  3G6E Q;  3EG9 B;  2EBP A;  5GMK h;  4HA8 A;  2EGE A;  1VQL A;  2K5F A;  2NUP A;  3X26 B;  1AWO A;  4M7D F;  4M7D A;  1Z9Q A;  3G1J A;  1VQN T;  2EWN A;  2JUF A;  2MYS A;  3OW2 P;  3EH2 A;  4E7S A;  1JJ2 S;  2EJF A;  1XQH A;  3LWH A;  4MZP A;  5DLQ E;  2HBW A;  3P8H A;  1TG0 A;  3RMS A;  1VQ4 T;  3TSZ A;  4OB2 B;  4Y28 E;  1QP3 A;  3CC2 Q;  5CVI A;  3OYD A;  2ROT A;  2E6N A;  1BU1 A;  3I56 Q;  1VQ5 A;  1LCK A;  2RI5 A;  2RJE A;  1JB0 E;  4DA4 A;  1FXX A;  4XU2 A;  1X6O A;  1VQO Q;  2FZC B;  2K79 A;  4BY6 C;  1TXQ A;  4FW1 A;  2E4H A;  2KRM A;  3REB B;  2BZ8 A;  2ABL A;  2OI3 A;  3VRZ A;  4EMH A;  1PWT A;  3O5Z A;  4OB0 B;  3CCR A;  3DB3 A;  1M90 R;  4J6X A;  3FB9 A;  3RNJ A;  5IN1 A;  2QEX Q;  4MDX A;  4JJB A;  4R0K A;  1RAB B;  1R8O B;  2EYW A;  5CKH A;  3CXC A;  1VQ5 T;  5EG2 A;  1TS9 A;  1K73 U;  3EG2 A;  1K8A U;  2YDL A;  3SHW A;  4M75 D;  2FPD A;  4NOY A;  1H64 1;  1N8R C;  3RDV A;  1U8R A;  2XU8 A;  4KH0 B;  5IHI A;  2A37 A;  3M57 A;  2GTO A;  2LT1 A;  2X35 A;  3JCM b;  3M58 A;  4VUB A;  1PSF A;  2VV5 A;  3A8G B;  4ZGE B;  1H3Z A;  1B07 A;  2X4X A;  1RAA B;  3C4S A;  2MMP A;  3CCR T;  4PNO A;  2CDT A;  2E5K A;  4M78 F;  4M78 A;  4L59 A;  1S72 Q;  1BB9 A;  3OS2 A;  2GTJ A;  1VYU A;  2K2V A;  1HXD A;  2CP3 A;  2E65 A;  1QKW A;  2Y4X A;  4A63 B;  5CK9 A;  3QZ5 B;  2AKK A;  2L3Q A;  2ED0 A;  4C8Q B;  2COY A;  1VQP A;  2KNB B;  1N9R A;  1W6X A;  5GAN f;  1G5V A;  1X6G A;  4WF2 A;  4A4K A;  3KXT A;  2RQR A;  8AT1 B;  4HVU A;  2C06 A;  4JLI A;  4M7A F;  4M7A A;  1UGR B;  3QXE B;  1VQK A;  4E7J A;  2CZ1 B;  1QQJ A;  1UGV A;  3I55 A;  4J9H A;  5KYY A;  1ZA2 B;  3L2R A;  3SDZ A;  1UGS B;  4IKF A;  2XDD A;  3UAT A;  2K6D A;  2YLB A;  2YUP A;  4HCB A;  1V76 A;  3RKX A;  2RHI A;  2LCS A;  5D6W A;  3SFM A;  2FPE A;  2M0O A;  2AHJ B;  1KD1 U;  1IRX A;  3ULR B;  4M4Z A;  3SWN C;  4F7U F;  4F7U A;  3NPF A;  3V7S A;  1ZX6 A;  4LE9 A;  2DRK A;  4A4H A;  1G3W A;  2YXY A;  1AD5 A;  1P92 A;  1W1F A;  2KRO A;  1VQP T;  1WHG A;  2PTK A;  4MDW A;  1K9A A;  4XTV A;  1AWX A;  5LJ3 f;  2J6K A;  2RQW A;  3EH1 A;  2DZ9 A;  2L5Q A;  5KYW B;  1QW1 A;  2OTL A;  1WHH A;  4FSX A;  9ATC B;  1VQK T;  3I55 T;  2X4W A;  3OYA A;  2X3W D;  4KT0 E;  4RTZ A;  4E7Z A;  1QCO A;  1IZ6 A;  3CC4 A;  1ZSZ A;  1MGQ A;  2YHT A;  5LJ5 g;  3RKW A;  3UF4 A;  2W10 A;  2JS0 A;  4M7D G;  3OYF A;  3R6O A;  3CBO A;  1M3C A;  2FHD A;  4QW2 A;  3RKY A;  5ECA A;  4XU1 A;  1SSH A;  1T0J A;  1YJW A;  5CIU A;  3JCM g;  1EFN A;  4JZ3 A;  1WJQ A;  1QVF S;  1Y7X A;  4ELZ C;  2D6F A;  3FLG A;  2HBP A;  2OTL T;  4ATO A;  4GY5 A;  1IHW A;  4C0F A;  2RM4 A;  5GAO n;  3NGP A;  2DLP A;  4ELY C;  5GAM g;  2HL3 A;  1OQK A;  4XAX B;  1JRI A;  1WDX A;  2DM1 A;  2LQK A;  4J9G A;  3VV0 A;  3CC4 T;  2RQT A;  4M75 F;  4M75 A;  4HVW A;  2CT4 A;  3CCV A;  4HKE A;  3QSU A;  4JJC A;  5IHN A;  1PKT A;  1PRL C;  1G2B A;  2KT1 A;  1LVK A;  7AT1 B;  4Y92 A;  2DTH A;  3VS3 A;  3CCL A;  1Q95 G;  2QQA A;  4PJM A;  2NWM A;  4EDU A;  1YJW T;  1J3T A;  1MV0 B;  1KJW A;  4E7L A;  2C0T A;  2JM9 A;  1VQ6 Q;  3G7Z A;  2LRQ A;  1M1K C;  2AIR B;  3DB4 A;  5A0D A;  5LJ5 j;  2ZPF B;  5HCK A;  3WXM B;  1H92 A;  2E5Q A;  4PFZ A;  3L2Q A;  1D0Z A;  5CKF A;  4LD9 K;  3S3N A;  1KK7 A;  1NPR A;  4LUD A;  1G3T A;  2XDB A;  1Q81 R;  2AK5 A;  3CCS Q;  3NTK A;  2E70 A;  2CP2 A;  5A2Q E;  4IUU A;  3MJX A;  5LJ3 j;  2JS2 A;  3CCL T;  1T0H A;  4FW2 A;  3E2U A;  3HTR A;  2DL5 A;  1RAD B;  3CMA T;  4CC2 A;  4M78 G;  1OEB A;  2GQI A;  1EZZ B;  1ZSG A;  3G71 Q;  1WXT A;  3VU3 C;  5GAO m;  4FIB A;  2V1Q A;  2OAU A;  1UB4 A;  2DMO A;  1PHT A;  1GRI A;  4A4F A;  1FYN A;  1D1C A;  1I0C A;  3OS0 A;  3I35 A;  4J9F A;  2LJ1 A;  2PVD B;  1WXB A;  3JAM E;  4BY6 B;  1YBY A;  4BI8 B;  3M0R A;  4PLL A;  1XNI A;  3CXC S;  2LQW A;  2KY9 A;  2ROL A;  1BI3 A;  1VOM A;  3LH5 A;  4C5E A;  4M7A G;  5D7U A;  2FO0 A;  1MNE A;  1Y07 A;  2XG8 D;  2EJ9 A;  5M9O A;  4E7K A;  3LWI A;  5GJV B;  2ZPB B;  3T9N A;  4KGV B;  1JBM A;  4E7I A;  3CD6 Q;  1PC0 A;  4IUQ A;  1MUZ A;  1UEB A;  2L3R A;  4C0D C;  1BIA A;  1AOJ A;  3H41 A;  4K11 A;  2QQR A;  4F7U G;  2VXE A;  4E2F B;  3QII A;  1VQ9 A;  2LX7 A;  5D6Y A;  2YWW A;  2VAS A;  4X34 A;  4ZGD B;  4M7D C;  3OYG A;  2PVO B;  2KK4 A;  4ZN1 A;  3M4Y A;  1K8A C;  4BE0 A;  3CCM T;  1IRE B;  2DYI A;  2KQW A;  3CEY A;  1FWZ A;  1KQ1 A;  1SHG A;  2DJQ A;  3M55 A;  4XU0 A;  1ACM B;  4HVV A;  2VXF A;  5GAM d;  3CCJ Q;  2MIO A;  2XD0 A;  1WQ7 A;  2LNV A;  3C94 A;  4OMP A;  4QKU A;  2KXD A;  3CC7 Q;  1UEC A;  2MCN A;  3S3M A;  1M90 U;  1YI2 Q;  4BDZ A;  2V8K A;  2GF7 A;  3G6E A;  1FMW A;  4XQ3 A;  2K4Y A;  1VQ7 Q;  4M77 F;  4M77 A;  2CP0 A;  1M3A A;  1RL2 A;  2P0P A;  3EG9 A;  1VQ9 T;  2YLC A;  3C12 A;  5LL6 S;  3JV3 A;  5FRO A;  4R55 A;  3UPU A;  3HFO A;  2ATC B;  2DD4 A;  2EJG A;  3TEE A;  4OMO A;  2P0K A;  1WPY A;  3Q1J A;  2EAY A;  1MHN A;  1WIE A;  1SHF A;  4GBQ A;  3JB9 D;  4KUD K;  3EGX A;  1YJ9 Q;  2LZ6 B;  3LYI A;  3CC2 A;  3I5S A;  3HPW A;  5LJ5 e;  2I2L A;  3HP9 A;  1PSE A;  4BDY A;  2QQ9 A;  4JRI A;  3I56 A;  2JOY A;  4PJO C;  4M75 G;  1M2V B;  4XTX A;  4IUV A;  2MF2 A;  3SWN B;  4JRK A;  3G6E T;  4FYX B;  4J6Y A;  1N6A A;  3UA7 A;  1VQO A;  4RTW A;  1KD1 C;  1MMN A;  1TSF A;  2MPX C;  8ATC B;  3JCM e;  1KC8 C;  1GFC A;  4Z8A A;  2MI6 A;  5LJ3 e;  1CKB A;  2M02 A;  3N5B B;  2HZY A;  4L6V 5;  1YIJ Q;  2YRC A;  1RI9 A;  1OZ3 A;  2QAZ A;  1B34 B;  2L3P A;  1R0B G;  3QUI A;  4M78 C;  3G4S Q;  4J7I A;  4WCI A;  4N0A C;  2DL8 A;  2RD1 A;  5LJ3 h;  3LGF A;  4C92 E;  3X28 B;  2ZPE B;  5J3B A;  2QEX A;  3CC2 T;  2COW A;  3MEV A;  1QVP A;  4ZNX A;  1K9M R;  4RCB A;  2RHY A;  4ORZ A;  1OV3 A;  4OGE A;  2J7I A;  3I56 T;  1NJI R;  2QK0 A;  2RF0 A;  1VQ8 T;  3M9Q A;  1QVF A;  1U5S A;  4N4I A;  2X9H A;  3HRS A;  2L89 A;  4AFQ C;  1QLY A;  3TRE A;  4QT7 A;  2HKN A;  3BW1 A;  2L8D A;  2RPN A;  4ZTJ A;  2RH2 A;  5CCA A;  5I22 A;  1ZHI A;  4JRQ A;  1M1K U;  3ZFJ A;  1X2K A;  3LW5 E;  2FL7 A;  1HYO A;  4N4H A;  3TCJ A;  1GBR A;  3QZ9 B;  2VWF A;  1Q7Y C;  4KGX B;  2HKQ B;  2YT6 A;  5FWC A;  5GMK i;  1YP5 A;  3TVT A;  2DA9 A;  1D09 B;  2Y90 A;  1NZ9 A;  3OYI A;  3VS7 A;  1Q82 R;  1S72 A;  2K9G A;  2DJZ A;  4CI0 C;  2V8J A;  2QEX T;  1YJN Q;  3CPF A;  2HQH A;  4ZTF A;  3MET A;  2JZ2 A;  3M5A A;  3CCE Q;  3EAE A;  2C0O A;  1OOT A;  4HCZ A;  1OX9 A;  5CKB A;  2J06 A;  3J7A F;  4DEY A;  1ZA1 B;  3BE3 A;  3OYY A;  3ME9 A;  3F70 A;  2QTX A;  3BY7 A;  3MPU B;  3FRN A;  2D0Q B;  3OMC A;  2DPP B;  3H6Z A;  2K57 A;  3L2Z A;  1M1G A;  2F69 A;  3E19 A;  4RCC A;  2LT4 A;  2YUO A;  2CH4 A;  1OPL A;  1RAH B;  1M1F A;  3RES A;  3GP8 A;  1ZSZ C;  2MK5 A;  4RTU A;  3FIF A;  4BE2 A;  5KYX A;  3PVQ A;  3UT1 A;  1S72 T;  2O9V A;  1VQL T;  2WSC E;  2K3B A;  2O31 A;  3QDR B;  3UWN A;  3MCA B;  2RN8 A;  4JUV A;  1WJR A;  2R58 A;  3TQ7 P;  1C0M A;  1K4U S;  1BK2 A;  1QVG P;  2DNU A;  4KBM B;  1V1C A;  4M77 E;  1BCM A;  3QKJ A;  1HJD A;  1IO6 A;  1W2B A;  3JB9 F;  1CKA A;  3LLR A;  4QVD A;  5GAN 3;  3CME Q;  3CCU Q;  1Y71 A;  4JDS A;  1AVZ C;  4J7F A;  3S6W A;  2L2P A;  2P0Q A;  5IT9 E;  4JLG A;  4M77 G;  3A98 A;  2CUB A;  5C6S A;  4M75 C;  1TUG B;  3URG A;  2O2O A;  1BKB A;  2R5A A;  4L5G A;  2VKN A;  1I5O B;  3TSW A;  4B9W A;  1LPL A;  4DQ2 A;  1UGP B;  2F2X A;  2E1H A;  2Y4Y A;  1QMC A;  2I0N A;  4GLM A;  3NTI A;  2KEA A;  5CO7 A;  2CSQ A;  2JT4 A;  3GNF B;  2QAS A;  1VQ4 Q;  2D8H A;  1JJ2 P;  2DVE A;  2ZPI B;  2HAX A;  3VUB A;  5FU6 C;  1OI1 A;  1KQS A;  2E41 A;  4C0D B;  1ZLM A;  1YWP A;  5GAO p;  2IIM A;  2V26 A;  1K0X A;  3EG1 A;  4M7D B;  4MMK A;  4Z88 A;  2FZG B;  3L2W A;  3QHS A;  5KYU A;  1UJ0 A;  2O4X A;  4C92 D;  2KRN A;  2DRM A;  3VS5 A;  3OQ5 A;  1KFZ A;  2F2W A;  1NYG A;  2CP7 A;  2JTF A;  4UC4 A;  1GBQ A;  5CKD A;  3H0H A;  4CC4 B;  2AZS A;  3PT9 A;  1K1Z A;  2PNI A;  3H8Z A;  2FB7 A;  1SRL A;  3VS1 A;  1BCO A;  1NM7 A;  1RLP C;  1KG1 A;  2CGH A;  5FWB A;  1VQ6 A;  3X20 B;  3CPW A;  1XJW B;  1M90 C;  1WHK A;  1KC8 U;  2RI2 A;  2QXF A;  1GCQ C;  1PD1 A;  2CZ6 B;  4LDU A;  3DKM A;  4QVZ A;  4IIM A;  3HRU A;  3RMQ A;  4PKC C;  5FU7 C;  5CKE A;  4OMM A;  2A7Y A;  3CCS A;  3GIB A;  4JZ4 A;  3BFM A;  5FRN A;  3PGG A;  4OB1 B;  2FPF A;  3MP6 A;  1MV3 A;  2XDP A;  1G3S A;  3VYH B;  2DX1 A;  1FMK A;  2WSE E;  2QQS A;  2RQV A;  1W4S A;  2PZ1 A;  4ZN3 A;  3G71 A;  1X69 A;  4C8Q E;  1Q86 R;  2G6F X;  1YFN A;  5KE2 A;  3OW2 A;  4J9C A;  1VQ6 T;  1D0X A;  3HSB A;  4PJO B;  2QTV A;  3H0F A;  4LDX A;  2ZGW A;  1T3L A;  2ZCF B;  2NYS A;  5GAM f;  5CR2 A;  3QYH B;  3KUF A;  3GPL A;  1CSK A;  3L2U A;  3FJ5 A;  4F16 A;  3E9G A;  4FYW B;  4LDV A;  4LD6 A;  1Q7Y U;  5LJ3 g;  1VA7 A;  4WTO B;  2RHZ A;  3QBY A;  3CCS T;  1X75 C;  2BTT A;  3QPH A;  2VB6 A;  4PLI A;  5A0G A;  3MKD A;  1BYM A;  3EFO B;  1T3S A;  3MEW A;  4M78 B;  2MAM A;  3M56 A;  2KE9 A;  2PU9 B;  4M77 D;  2CT3 A;  3E9F A;  3G71 T;  1IHV A;  4X1V A;  3OYC A;  1YNZ A;  3A8H B;  2DTO A;  3NTH A;  5GAN j;  4KGZ B;  4Q5W A;  1VQM Q;  4HCC A;  1MMG A;  2GFA A;  1BI1 A;  4XTZ A;  2RO0 A;  4M7A B;  2DFU A;  2QG9 B;  4PJJ A;  2FEI A;  1WHL A;  2D0N A;  3JB9 G;  2RK1 A;  2XKO C;  1O9S A;  2DO3 A;  2H8H A;  3H0I A;  2GCX A;  1U1T A;  4Z89 A;  3OBW A;  4ZGJ B;  1ZUK A;  3CCJ A;  1AHJ B;  1ZUU A;  3CC7 A;  3SEM A;  1YI2 A;  3A8O B;  2EPD A;  3JCM c;  4CC3 A;  5J39 A;  1U1S A;  4F7U B;  5GMK l;  3PTA A;  3MO8 A;  1VQ7 A;  2OAW A;  1K73 R;  2JNG A;  3CCV T;  2JJ9 A;  3VS4 A;  1NYF A;  5CQX A;  5DLO A;  1K9M U;  2B86 A;  3EFS A;  4NL3 A;  3WVD B;  4C92 F;  4C92 A;  5EC7 A;  2LCC A;  3QJY A;  1VIF A;  3NMZ C;  2OTJ Q;  4JS4 A;  2AZV A;  2EGA A;  4EIK A;  4A54 A;  4DBH A;  4AMC A;  3PE0 A;  3CCJ T;  1YJ9 A;  1W2B S;  1ZSZ B;  4CC7 A;  3CC7 T;  3OMG A;  2DXC A;  5GJW B;  3EGD B;  1YI2 T;  3PMI A;  1M5Q 1;  4OMQ A;  2G3R A;  1Y0M A;  4KUI A;  3JCM J;  3FEO A;  6AT1 B;  1VQ7 T;  4FYV B;  3M0T A;  1M2V A;  2LQ8 A;  2O01 E;  1EX4 A;  1RUW A;  1EIF A;  2HSE B;  2IPO B;  4OML A;  1Y96 B;  4B6M A;  2YUQ A;  2KXC A;  2LP5 A;  3CBM A;  2NUT A;  2AT1 B;  1PKS A;  5LJ5 d;  1NEB A;  2RA2 A;  1YIJ A;  2PUK B;  1A0N B;  3OYB A;  1S1N A;  1TWB A;  3E1S A;  2GBQ A;  3RR6 A;  2DL4 A;  3G4S A;  2DL3 A;  3L2V A;  2DAQ A;  4FSS A;  3OYL A;  4BB7 A;  1YJ9 T;  4GLK A;  2XK0 A;  3VYG A;  1YCS B;  4BD3 A;  1D3B A;  1PNJ A;  4DOW A;  3JCM d;  3OYE A;  4M75 B;  5HY6 A;  1KQS S;  2J6O A;  1TH7 A;  2M9U A;  3R6N A;  2HL5 C;  4C8Q D;  2X51 A;  3S3O A;  2JMA A;  2LCL A;  4RG8 A;  1YHQ Q;  1WLP B;  3NHN A;  3SD4 A;  2LC4 A;  1GXI E;  1Q81 C;  3M59 A;  4OF1 A;  3CMA Q;  1YIJ T;  4EMK A;  4BAC A;  2CRE A;  3QYG B;  5FU6 B;  3KFV A;  3ZEH A;  5GAN 2;  3QWY A;  4AFZ C;  3G4S T;  2QGG A;  2Z0W A;  1H3H A;  5GAN e;  1LNX A;  3PMT A;  2X3X D;  1YJN A;  3CPW S;  3RUX A;  2SEM A;  3CCE A;  2DD5 A;  1GFD A;  3EHQ A;  5IXF A;  2E3I A;  2BZY A;  2D9T A;  2DVJ A;  5GAN h;  3CXC P;  2BE9 B;  1TU0 B;  3PIO A;  1XOV A;  1I8F A;  2VGN A;  4HT9 A;  4IUT A;  2RK2 A;  2BUD A;  3HKS A;  2E3H A;  5A0L A;  1PCX A;  3LH0 A;  2VC8 A;  3OBY A;  2E12 A;  3VS2 A;  4F04 B;  3BDL A;  1K76 A;  1RAI B;  3C0C A;  4TVR A;  2KBT A;  4EMG A;  2W0Z A;  2RB6 A;  3U23 A;  4V2S A;  1B3Q A;  2HQX A;  3OW2 S;  4D8D A;  2DEQ A;  2PQW A;  2V8I A;  3KBG A;  1YJN T;  2QA4 Q;  5FU7 B;  2RNA A;  4PJL A;  3CCM Q;  2A28 A;  3CCE T;  1KHC A;  1WI7 A;  1WXU A;  2F2V A;  2OJ2 A;  3OS1 A;  4J6W A;  2J05 A;  4J9B A;  4XTU A;  3CCQ Q;  3L1A A;  1D1A A;  3M0P A;  2EW3 A;  4ESR A;  1FX7 A;  3J81 E;  3CME A;  1IXD A;  4J9E A;  3CCU A;  1TOV A;  4PL6 A;  2BZX A;  3OSV A;  1YIT Q;  4MML A;  2ENM A;  3AHU A;  3FJP A;  1VQO T;  3RER A;  1YN8 A;  4A4G A;  2DXU A;  3FC3 A;  3SB2 A;  3RBB B;  3VJP A;  3VS0 A;  4C92 G;  2JW4 A;  3P8B B;  1VQ9 Q;  4M7A C;  2L3S A;  2FG0 A;  1ARK A;  1WHM A;  3LX7 A;  3AT1 B;  4RTX A;  1UE9 A;  3UA6 A;  2X4Y A;  1JEG A;  1AWW A;  2FYK A;  1V29 B;  2ED1 A;  4II1 A;  2DXT A;  2HDA A;  2KGT A;  4EPC A;  1WX6 A;  3A5Z B;  1MMA A;  1VQ4 A;  2JTE A;  3HRT A;  1PRM C;  3OYH A;  1I5L A;  2LJ0 A;  3CME T;  3CCU T;  1N8R R;  2P4R A;  4R56 A;  4RKU E;  3V7C A;  2DTI A;  1I4K 1;  3PVL A;  4C8Q F;  4C8Q A;  4OVA A;  3FDR A;  2QYZ A;  5GAN 5;  5I21 A;  2JXB A;  2KAF A;  1RAC B;  2VVK A;  3JSC A;  3V7R A;  5C0M A;  2OX7 A;  2K3Y A;  3EGX B;  2F5K A;  5KCO A;  1LJO A;  3QO3 A;  2DIQ A;  2DIL A;  2EVR A;  1M8V A;  3I5R A;  2K5I A;  2KI7 A;  1JXM A;  1RAF B;  1OYX A;  1M8M A;  4JS5 A;  4FL6 A;  1VUB A;  3JB9 H;  1NPP A;  4ANJ A;  2CUD A;  1SG5 A;  1RAG B;  1KHI A;  1VQ8 Q;  2J6F A;  3MP8 A;  4FM4 B;  2EKO A;  1DJ7 B;  2BIV A;  1E6G A;  1OX8 A;  1K9M C;  1TUD A;  2KYM A;  2KR3 A;  3V8J A;  1NJI C;  1N27 A;  2H3J A;  2CYZ B;  1VYV A;  4FCY A;  4DBQ A;  2FRY A;  5J26 A;  3JCM P;  5KYW A;  1G3Y A;  3CQT A;  3EGU A;  2E6Z A;  3M0Q A;  4A53 A;  3JCM W;  1AT1 B;  5DY9 A;  4YTL A;  3O8V A;  2D1X A;  2DIG A;  1LOJ A;  4B9X A;  1R0C B;  2LMJ A;  4ME7 A;  2C0I A;  2DYB A;  1NEG A;  5HKC A;  1Y57 A;  4BE1 A;  2DK3 A;  1Q82 C;  1D0Y A;  1VQN Q;  1D1B A;  5I2S A;  1Q81 U;  3MEA A;  1M4Z A;  5D6X A;  4PJO F;  4PJO A;  3X25 B;  2JM8 A;  4QVC A;  2A3L A;  3IQL A;  2HMA A;  4HCK A;  2FRW A;  5AT1 B;  5CAI A;  2BE7 D;  2SRC A;  4C5G A;  2LTO A;  5FLX E;  4JRP A;  2QGF B;  1E6H A;  2DE0 X;  1F1B B;  1X01 A;  4JJD A;  2ZAE A;  4X9D A;  1VYT A;  3M0S A;  3INZ A;  2EYQ A;  5GMK m;  3EFO A;  2EYZ A;  2RHU A;  1E7O A;  4O6J A;  2NUP B;  2ZPH B;  2VYT A;  1VQL Q;  2PVG B;  4N0A A;  1IGU A;  2YRV A;  1UJY A;  4IIO A;  1X43 A;  4HXJ A;  2EIF A;  1ZBJ A;  4C92 C;  1VQM A;  1N9S A;  2K5L A;  2M1H A;  2XMF A;  3JB9 J;  3M0U A;  4FU6 A;  2L0A A;  2YSQ A;  2EQK A;  2LNH B;  1JXO A;  5GAO q;  3C95 A;  4C5H A;  1AZE A;  2FZK B;  5KYX B;  1ABO A;  1PD0 A;  2LVM A;  1VQ5 Q;  3A1P A;  3M4G A;  2GFU A;  5GAN g;  2KMT A;  4E6R A;  5LJ5 f;  1AZG B;  1G8X A;  3D7S B;  1I07 A;  2CS7 A;  2B8A A;  2XIC A;  2DF6 A;  3JB9 I;  4MZM A;  5GAO r;  1KIK A;  1VQM T;  2DET A;  2R57 A;  2KT8 A;  4D6W A;  1SPK A;  3OYM A;  2OTJ A;  3JCM f;  1M1K R;  2V1R A;  3CCR Q;  2F1L A; 
#chains in the Genus database with same CATH homology
 4CC7 A;  2ABL A;  2OI3 A;  4RTW A;  3VRZ A;  5IHK A;  1PWT A;  3O5Z A;  1X2Q A;  5GJW B;  4OMQ A;  1Y0M A;  1GFC A;  1W70 A;  4Z8A A;  1CKB A;  2QDL A;  2EQI A;  3M0T A;  3RNJ A;  1RUW A;  4KRT A;  1RI9 A;  1GCP A;  4OML A;  4JJB A;  2L3P A;  4R0K A;  2YUQ A;  2KXC A;  2LP5 A;  2EYW A;  2O88 A;  1U3O A;  1PKS A;  2EKH A;  1NEB A;  4WCI A;  2DL8 A;  3EG2 A;  1A0N B;  1S1N A;  2YDL A;  3SHW A;  2FPD A;  4D8K A;  3ZL7 C;  2GBQ A;  3REA B;  2DL4 A;  4ZNX A;  3I9Q A;  2DL3 A;  1UHF A;  4ORZ A;  1OV3 A;  2J7I A;  5IHI A;  1OPK A;  2RF0 A;  4FSS A;  2A37 A;  2GTO A;  1YCS B;  1PNJ A;  1U5S A;  3EHR A;  2LQN A;  2J6O A;  2ECZ A;  1QLY A;  4AFQ C;  4QT7 A;  3VRY A;  1B07 A;  2RPN A;  2EYY A;  5I22 A;  3R6N A;  2CDT A;  1QWF A;  1HSQ A;  1X2K A;  2E5K A;  2JMA A;  1UFF A;  1BB9 A;  1WLP B;  3NHN A;  1GBR A;  2YUN A;  2VWF A;  2GTJ A;  1VYU A;  2YT6 A;  5FWC A;  1QKW A;  4A63 B;  1YP5 A;  3TVT A;  2DA9 A;  4J9D A;  3VS7 A;  2AKK A;  2L3Q A;  2ED0 A;  2K9G A;  2KNB B;  2HEQ A;  2EGC A;  1K0S A;  1W6X A;  2CRE A;  1X6G A;  2RQR A;  3KFV A;  1QKX A;  4HVU A;  3VS6 A;  3QWY A;  4AFZ C;  2C0O A;  1OOT A;  1H3H A;  2J06 A;  2X3X D;  4DEY A;  1UGV A;  4J9H A;  4J9I A;  1GL5 A;  2SEM A;  2K7A A;  4LN2 A;  1X27 A;  3UAT A;  2K6D A;  1GFD A;  1G83 A;  2YUP A;  3EHQ A;  5IXF A;  2LCS A;  2BZY A;  2FPE A;  2DVJ A;  1H8K A;  2YUO A;  2CH4 A;  1OPL A;  1XOV A;  3QWX X;  3ULR B;  4M4Z A;  3NPF A;  1ZX6 A;  4LE9 A;  4RTU A;  2DRK A;  4LNP A;  3PVQ A;  2LJ3 A;  1AD5 A;  1W1F A;  2KRO A;  2O9V A;  4OMN A;  2PTK A;  1K9A A;  2K3B A;  2O31 A;  3VS2 A;  1UHC A;  1AWX A;  2RN8 A;  2J6K A;  1K76 A;  3C0C A;  1WYX A;  2RQW A;  1K4U S;  2KBT A;  1BK2 A;  2DNU A;  2W0Z A;  3U23 A;  2RQU A;  1B3Q A;  1V1C A;  4D8D A;  1RLQ C;  1JO8 A;  2GNC A;  1KSW A;  2X3W D;  1HJD A;  1QWE A;  2RNA A;  1IO6 A;  1QCF A;  4RTZ A;  2A28 A;  1WI7 A;  1CKA A;  1WXU A;  2F2V A;  2OJ2 A;  2A36 A;  2AKL A;  3UF4 A;  2J05 A;  1AVZ C;  2W10 A;  4J9B A;  2L2P A;  1GCQ A;  2JS0 A;  1UTI A;  3A98 A;  3M0P A;  2EW3 A;  2CUB A;  4ESR A;  2MOX A;  1AEY A;  1U06 A;  1M3C A;  4J9E A;  5ECA A;  2O2O A;  2BZX A;  1SSH A;  1T0J A;  1NG2 A;  4JPB W;  1EFN A;  2VKN A;  3TSW A;  4JZ3 A;  5IH2 A;  2ENM A;  1YN8 A;  4AG2 C;  2F2X A;  4RTY A;  3RBB B;  3VS0 A;  2I0N A;  4GLM A;  2JW4 A;  2KEA A;  4RTT A;  1SRM A;  2CSQ A;  2JT4 A;  2L3S A;  2FG0 A;  3NGP A;  2DLP A;  2CSI A;  1ARK A;  5FW9 A;  4AG1 C;  1M3B A;  1M30 A;  4RTX A;  2D8H A;  2NUZ A;  1UE9 A;  1WDX A;  3UA6 A;  2KYB A;  2DM1 A;  1JEG A;  4J9G A;  1AWW A;  2RQT A;  2ED1 A;  2CH4 W;  4HVW A;  2CT4 A;  2HDA A;  2KGT A;  1WX6 A;  1X6B A;  2A08 A;  4JJC A;  2JTE A;  5IHN A;  1PKT A;  1AWJ A;  1PRM C;  1BBZ A;  3EG3 A;  1PRL C;  1ZLM A;  1YWP A;  1G2B A;  2KT1 A;  4AFS C;  4Y92 A;  2IIM A;  3VS3 A;  2HCK A;  2LJ0 A;  1K0X A;  3EG1 A;  2P4R A;  1UUE A;  2NWM A;  4Z88 A;  1JU5 C;  1UJ0 A;  1NLO C;  2KRN A;  2EYX A;  1J3T A;  2RMO A;  2DRM A;  1MV0 B;  3PVL A;  3VS5 A;  1KFZ A;  1KJW A;  2F2W A;  2C0T A;  2JM9 A;  1NYG A;  1GBQ A;  5IXB A;  1WA7 A;  4RUG A;  3H0H A;  2JXB A;  4CC4 B;  2AZS A;  1K1Z A;  4AFU C;  2VVK A;  2PNI A;  5HCK A;  1SRL A;  4F14 A;  1H92 A;  3VS1 A;  1I1J A;  1NM7 A;  1RLP C;  2DBK A;  1JQQ A;  1YWO A;  5FWB A;  2DIL A;  2EVR A;  1Z9Z A;  3I5R A;  1M27 C;  4LUD A;  2AK5 A;  1JXM A;  4DEX A;  1SEM A;  1GCQ C;  1M8M A;  4IIM A;  3THK A;  1N5Z A;  2GGR A;  2JS2 A;  1T0H A;  4OMM A;  2CUD A;  4JZ4 A;  2DL5 A;  4CC2 A;  1WFW A;  2J6F A;  1OEB A;  2GQI A;  1ZSG A;  4F17 A;  2FPF A;  1WXT A;  1MV3 A;  1UG1 A;  2DBM A;  1E6G A;  2KRS A;  2V1Q A;  1TUD A;  2KYM A;  2DMO A;  1PHT A;  1GRI A;  1FMK A;  2DX1 A;  2KR3 A;  1FYN A;  1I0C A;  3I35 A;  1ABQ A;  1VYV A;  2RQV A;  2PZ1 A;  1X69 A;  4J9F A;  2G6F X;  2LJ1 A;  2FRY A;  2HSP A;  1WXB A;  2D8J A;  3M0R A;  3CQT A;  4J9C A;  2O9S A;  3EGU A;  3M0Q A;  1NLP C;  3H0F A;  2LQW A;  2ROL A;  1T3L A;  3LH5 A;  2JMC A;  2D1X A;  2FO0 A;  2M0Y A;  2LMJ A;  1CSK A;  5L23 A;  1UDL A;  5I11 A;  2C0I A;  2DYB A;  1NEG A;  3FJ5 A;  1HD3 A;  4F16 A;  5GJV B;  1Y57 A;  1VA7 A;  2BTT A;  1MUZ A;  2JM8 A;  3GBQ A;  1T3S A;  2DL7 A;  1AOJ A;  3H41 A;  4K11 A;  3IQL A;  4HCK A;  2KE9 A;  2FRW A;  4RTV A;  2ESW A;  2LX7 A;  2K2M A;  2SRC A;  2CT3 A;  2M51 A;  3EG0 A;  4X1V A;  1E6H A;  2DE0 X;  1YNZ A;  4JJD A;  1VYT A;  3M0S A;  2EYZ A;  1ZUY A;  1E7O A;  1TUC A;  1SHG A;  2DJQ A;  4HVV A;  2MIO A;  4OMP A;  1UJY A;  4IIO A;  4LUE A;  2KXD A;  1X43 A;  4HXJ A;  2FEI A;  2D0N A;  1ZBJ A;  2EBP A;  1UEC A;  2EGE A;  2MCN A;  2H8H A;  3H0I A;  4Z89 A;  1ZUK A;  2XMF A;  1ZUU A;  3M0U A;  1AWO A;  2L0A A;  2YSQ A;  1Z9Q A;  1M3A A;  2LNH B;  3SEM A;  1JXO A;  2EPD A;  4CC3 A;  1AZE A;  3JV3 A;  1ABO A;  2OAW A;  2HBW A;  1TG0 A;  3VS4 A;  1NYF A;  3TSZ A;  2B86 A;  4OMO A;  4E6R A;  5EC7 A;  2ROT A;  4GBQ A;  1WIE A;  1SHF A;  1BU1 A;  1AZG B;  1I07 A;  2DF6 A;  3NMZ C;  1LCK A;  2AZV A;  2LZ6 B;  1KIK A;  3I5S A;  2EGA A;  2K79 A;  2KT8 A;  4EIK A;  1SPK A;  3PE0 A;  2V1R A;  2KRM A;  3REB B;  2BZ8 A;  3UA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...