1ARQA

Relaxation matrix refinement of the solution structure of the arc repressor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance solution structure of the Arc repressor using relaxation matrix calculations.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Gene-regulating protein
molecule keywords ARC REPRESSOR
total genus 15
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1arqA00
2BJ1A 2JXGA 1Q5VA 4ME7E 1ARRA 2K6LA 2HZVA 2K9IA 4D8JA 2GPEA 3QOQA 2H1OE 3LGHA 2HZAA 2BNWA 2CAXA 1BDTA 1MNTA 2WVDA 3H87C 1NLAA 3OD2A 2BNZA 2AY0A 1BDVA 2CPGA 3FMTA 2K29A 2WVCA 2CA9A 3VW4A 1ARQA 1P94A 2JXHA 3FT7A 1B01A 2BA3A 4HV0A 2RBFA 3VEBA 2BJ8A 1PARA 1MYKA 2JXIA 1IRQA 1X93A 2CAJA 2WVFA 3VEAA 1EA4A 2BJ7A 1MYLA 2CADA 2BJ3A 2K5JA 1B28A 2WVEA 3GXQA 2BJ9A 2BSQE 1QTGA 1BAZA 4FXEA 2K1OA 2WVBA 1U9PA 2KELA
chains in the Genus database with same CATH superfamily
2BJ1A 1Q5VA 2HZVA 1ARRA 3H5YA 2H3AA 4D8JA 3BSOA 3QOQA 1OG7A 3UQSA 3FMTA 2CA9A 3IR7A 4HV0A 3NNEA 4O4RA 3NAIA 1EA4A 2BJ7A 2A2BA 2BJ3A 2K5JA 2ADLA 2BJ9A 2Q2KA 4LRVA 3G5OA 3SFUA 2KELA 4QPXA 2K6LA 4NRTA 2H1OE 3LGHA 1BDTA 3H87C 1NLAA 3QIDA 2AY0A 2CPGA 2WVCA 3FT7A 3VEBA 1PARA 2WVFA 1MYLA 2UUTA 1B28A 3H5XA 2WVEA 3GXQA 3SFGA 1BAZA 4FXEA 2K1OA 2WVBA 1U9PA 4LQ9A 1B01A 2JXGA 4ME7E 1Q16A 2KKEA 2GPEA 2HZAA 1MNTA 1BDVA 4MJWA 2K29A 3LJPA 3VW4A 1ARQA 2JXHA 1SIWA 4AAIA 2BA3A 2RBFA 2BJ8A 2JXIA 2WK4A 1IRQA 1X93A 2CAJA 2CADA 2JBVA 3NAHA 1OHNA 1QTGA 3UPFA 3BSNA 2AN7A 3UR0A 1SH0A 4LQ3A 2K9IA 2BNWA 1SH3A 2CAXA 2WVDA 3OD2A 2BNZA 2KOEA 4NRUA 1P94A 1SH2A 2CKWA 2UUWA 1MYKA 3VEAA 2B43A 3NO7A 2BSQE
chains in the Genus database with same CATH topology
2BJ1A 2JXGA 1Q5VA 4ME7E 1ARRA 2K6LA 2HZVA 2K9IA 4D8JA 2GPEA 3QOQA 2H1OE 3LGHA 2HZAA 2BNWA 2CAXA 1BDTA 1MNTA 2WVDA 3H87C 1NLAA 3OD2A 2BNZA 2AY0A 1BDVA 2CPGA 3FMTA 2K29A 2WVCA 2CA9A 3VW4A 1ARQA 1P94A 2JXHA 3FT7A 1B01A 2BA3A 4HV0A 2RBFA 3VEBA 2BJ8A 1PARA 1MYKA 2JXIA 1IRQA 1X93A 2CAJA 2WVFA 3VEAA 1EA4A 2BJ7A 1MYLA 2CADA 2BJ3A 2K5JA 1B28A 2WVEA 3GXQA 2BJ9A 2BSQE 1QTGA 1BAZA 4FXEA 2K1OA 2WVBA 1U9PA 2KELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ1 A;  2JXG A;  1Q5V A;  4ME7 E;  1ARR A;  2K6L A;  2HZV A;  2K9I A;  4D8J A;  2GPE A;  3QOQ A;  2H1O E;  3LGH A;  2HZA A;  2BNW A;  2CAX A;  1BDT A;  1MNT A;  2WVD A;  3H87 C;  1NLA A;  3OD2 A;  2BNZ A;  2AY0 A;  1BDV A;  2CPG A;  3FMT A;  2K29 A;  2WVC A;  2CA9 A;  3VW4 A;  1ARQ A;  1P94 A;  2JXH A;  3FT7 A;  1B01 A;  2BA3 A;  4HV0 A;  2RBF A;  3VEB A;  2BJ8 A;  1PAR A;  1MYK A;  2JXI A;  1IRQ A;  1X93 A;  2CAJ A;  2WVF A;  3VEA A;  1EA4 A;  2BJ7 A;  1MYL A;  2CAD A;  2BJ3 A;  2K5J A;  1B28 A;  2WVE A;  3GXQ A;  2BJ9 A;  2BSQ E;  1QTG A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  1U9P A;  2KEL A; 
#chains in the Genus database with same CATH topology
 2BJ1 A;  1Q5V A;  2HZV A;  1ARR A;  3H5Y A;  2H3A A;  4D8J A;  3BSO A;  3QOQ A;  1OG7 A;  3UQS A;  3FMT A;  2CA9 A;  3IR7 A;  4HV0 A;  3NNE A;  4O4R A;  3NAI A;  1EA4 A;  2BJ7 A;  2A2B A;  2BJ3 A;  2K5J A;  2ADL A;  2BJ9 A;  2Q2K A;  4LRV A;  3G5O A;  3SFU A;  2KEL A;  4QPX A;  2K6L A;  4NRT A;  2H1O E;  3LGH A;  1BDT A;  3H87 C;  1NLA A;  3QID A;  2AY0 A;  2CPG A;  2WVC A;  3FT7 A;  3VEB A;  1PAR A;  2WVF A;  1MYL A;  2UUT A;  1B28 A;  3H5X A;  2WVE A;  3GXQ A;  3SFG A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  1U9P A;  4LQ9 A;  1B01 A;  2JXG A;  4ME7 E;  1Q16 A;  2KKE A;  2GPE A;  2HZA A;  1MNT A;  1BDV A;  4MJW A;  2K29 A;  3LJP A;  3VW4 A;  1ARQ A;  2JXH A;  1SIW A;  4AAI A;  2BA3 A;  2RBF A;  2BJ8 A;  2JXI A;  2WK4 A;  1IRQ A;  1X93 A;  2CAJ A;  2CAD A;  2JBV A;  3NAH A;  1OHN A;  1QTG A;  3UPF A;  3BSN A;  2AN7 A;  3UR0 A;  1SH0 A;  4LQ3 A;  2K9I A;  2BNW A;  1SH3 A;  2CAX A;  2WVD A;  3OD2 A;  2BNZ A;  2KOE A;  4NRU A;  1P94 A;  1SH2 A;  2CKW A;  2UUW A;  1MYK A;  3VEA A;  2B43 A;  3NO7 A;  2BSQ E; 
#chains in the Genus database with same CATH homology
 2BJ1 A;  2JXG A;  1Q5V A;  4ME7 E;  1ARR A;  2K6L A;  2HZV A;  2K9I A;  4D8J A;  2GPE A;  3QOQ A;  2H1O E;  3LGH A;  2HZA A;  2BNW A;  2CAX A;  1BDT A;  1MNT A;  2WVD A;  3H87 C;  1NLA A;  3OD2 A;  2BNZ A;  2AY0 A;  1BDV A;  2CPG A;  3FMT A;  2K29 A;  2WVC A;  2CA9 A;  3VW4 A;  1ARQ A;  1P94 A;  2JXH A;  3FT7 A;  1B01 A;  2BA3 A;  4HV0 A;  2RBF A;  3VEB A;  2BJ8 A;  1PAR A;  1MYK A;  2JXI A;  1IRQ A;  1X93 A;  2CAJ A;  2WVF A;  3VEA A;  1EA4 A;  2BJ7 A;  1MYL A;  2CAD A;  2BJ3 A;  2K5J A;  1B28 A;  2WVE A;  3GXQ A;  2BJ9 A;  2BSQ E;  1QTG A;  1BAZ A;  4FXE A;  2K1O A;  2WVB A;  1U9P A;  2KEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...