1ARQA

Relaxation matrix refinement of the solution structure of the arc repressor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
b'MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARC REPRESSOR
publication title Nuclear magnetic resonance solution structure of the Arc repressor using relaxation matrix calculations.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Gene-regulating protein
total genus 15
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 1993-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1arqA00
1MYLA 2CPGA 1Q5VA 2BJ8A 2HZVA 1X93A 3FT7A 2JXHA 2K1OA 4ME7E 1BDVA 3GXQA 2K6LA 3QOQA 4HV0A 2KELA 1B01A 2BJ1A 1ARQA 1U9PA 1PARA 1B28A 1BDTA 2CADA 2WVBA 2CAXA 4FXEA 1EA4A 1P94A 2CA9A 2JXIA 3VW4A 2K9IA 2WVDA 1MYKA 3LGHA 2BJ9A 2WVCA 1ARRA 2HZAA 1NLAA 2CAJA 2WVEA 4D8JA 1BAZA 2GPEA 2BA3A 3H87C 2RBFA 2BJ3A 1IRQA 3VEBA 2H1OE 3OD2A 1QTGA 2WVFA 2JXGA 2BNWA 3VEAA 3FMTA 2BSQE 2BNZA 2K5JA 1MNTA 2K29A 2BJ7A 2AY0A
chains in the Genus database with same CATH superfamily
2HZVA 2BJ8A 1X93A 2A2BA 4NRTA 2Q2KA 2CKWA 3SFUA 3QOQA 2JBVA 1ARQA 4NRUA 1BDTA 3UPFA 2B43A 2K9IA 1MYKA 3LGHA 3NNEA 2HZAA 2CAJA 2BJ3A 2BSQE 2KOEA 1MNTA 2K29A 2BJ7A 2CAXA 2KKEA 3IR7A 1MYLA 2UUWA 3FT7A 2K1OA 2WK4A 2UUTA 4HV0A 1PARA 2CADA 2CA9A 2WVDA 2BJ9A 2WVCA 1ARRA 3LJPA 2GPEA 2BA3A 3G5OA 2RBFA 2WVFA 2BNWA 3NAHA 3QIDA 3VEAA 3UR0A 2CPGA 2JXHA 1BDVA 2K6LA 4LQ3A 3SFGA 1B01A 1SH0A 2BJ1A 1U9PA 2WVBA 4FXEA 4LRVA 1EA4A 3VW4A 2ADLA 4O4RA 4D8JA 3H87C 3VEBA 3UQSA 1Q16A 3OD2A 3NAIA 1QTGA 3BSNA 2JXGA 4MJWA 2K5JA 2AY0A 1SIWA 1Q5VA 2AN7A 4LQ9A 4ME7E 1OG7A 3GXQA 3BSOA 2KELA 1B28A 3H5XA 1P94A 1SH3A 2JXIA 4AAIA 1OHNA 1NLAA 2WVEA 3H5YA 1BAZA 2H1OE 1IRQA 4QPXA 3FMTA 1SH2A 2H3AA 3NO7A 2BNZA
chains in the Genus database with same CATH topology
1MYLA 2CPGA 1Q5VA 2BJ8A 2HZVA 1X93A 3FT7A 2JXHA 2K1OA 4ME7E 1BDVA 3GXQA 2K6LA 3QOQA 4HV0A 2KELA 1B01A 2BJ1A 1ARQA 1U9PA 1PARA 1B28A 1BDTA 2CADA 2WVBA 2CAXA 4FXEA 1EA4A 1P94A 2CA9A 2JXIA 3VW4A 2K9IA 2WVDA 1MYKA 3LGHA 2BJ9A 2WVCA 1ARRA 2HZAA 1NLAA 2CAJA 2WVEA 4D8JA 1BAZA 2GPEA 2BA3A 3H87C 2RBFA 2BJ3A 1IRQA 3VEBA 2H1OE 3OD2A 1QTGA 2WVFA 2JXGA 2BNWA 3VEAA 3FMTA 2BSQE 2BNZA 2K5JA 1MNTA 2K29A 2BJ7A 2AY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYL A;  2CPG A;  1Q5V A;  2BJ8 A;  2HZV A;  1X93 A;  3FT7 A;  2JXH A;  2K1O A;  4ME7 E;  1BDV A;  3GXQ A;  2K6L A;  3QOQ A;  4HV0 A;  2KEL A;  1B01 A;  2BJ1 A;  1ARQ A;  1U9P A;  1PAR A;  1B28 A;  1BDT A;  2CAD A;  2WVB A;  2CAX A;  4FXE A;  1EA4 A;  1P94 A;  2CA9 A;  2JXI A;  3VW4 A;  2K9I A;  2WVD A;  1MYK A;  3LGH A;  2BJ9 A;  2WVC A;  1ARR A;  2HZA A;  1NLA A;  2CAJ A;  2WVE A;  4D8J A;  1BAZ A;  2GPE A;  2BA3 A;  3H87 C;  2RBF A;  2BJ3 A;  1IRQ A;  3VEB A;  2H1O E;  3OD2 A;  1QTG A;  2WVF A;  2JXG A;  2BNW A;  3VEA A;  3FMT A;  2BSQ E;  2BNZ A;  2K5J A;  1MNT A;  2K29 A;  2BJ7 A;  2AY0 A; 
#chains in the Genus database with same CATH topology
 2HZV A;  2BJ8 A;  1X93 A;  2A2B A;  4NRT A;  2Q2K A;  2CKW A;  3SFU A;  3QOQ A;  2JBV A;  1ARQ A;  4NRU A;  1BDT A;  3UPF A;  2B43 A;  2K9I A;  1MYK A;  3LGH A;  3NNE A;  2HZA A;  2CAJ A;  2BJ3 A;  2BSQ E;  2KOE A;  1MNT A;  2K29 A;  2BJ7 A;  2CAX A;  2KKE A;  3IR7 A;  1MYL A;  2UUW A;  3FT7 A;  2K1O A;  2WK4 A;  2UUT A;  4HV0 A;  1PAR A;  2CAD A;  2CA9 A;  2WVD A;  2BJ9 A;  2WVC A;  1ARR A;  3LJP A;  2GPE A;  2BA3 A;  3G5O A;  2RBF A;  2WVF A;  2BNW A;  3NAH A;  3QID A;  3VEA A;  3UR0 A;  2CPG A;  2JXH A;  1BDV A;  2K6L A;  4LQ3 A;  3SFG A;  1B01 A;  1SH0 A;  2BJ1 A;  1U9P A;  2WVB A;  4FXE A;  4LRV A;  1EA4 A;  3VW4 A;  2ADL A;  4O4R A;  4D8J A;  3H87 C;  3VEB A;  3UQS A;  1Q16 A;  3OD2 A;  3NAI A;  1QTG A;  3BSN A;  2JXG A;  4MJW A;  2K5J A;  2AY0 A;  1SIW A;  1Q5V A;  2AN7 A;  4LQ9 A;  4ME7 E;  1OG7 A;  3GXQ A;  3BSO A;  2KEL A;  1B28 A;  3H5X A;  1P94 A;  1SH3 A;  2JXI A;  4AAI A;  1OHN A;  1NLA A;  2WVE A;  3H5Y A;  1BAZ A;  2H1O E;  1IRQ A;  4QPX A;  3FMT A;  1SH2 A;  2H3A A;  3NO7 A;  2BNZ A; 
#chains in the Genus database with same CATH homology
 1MYL A;  2CPG A;  1Q5V A;  2BJ8 A;  2HZV A;  1X93 A;  3FT7 A;  2JXH A;  2K1O A;  4ME7 E;  1BDV A;  3GXQ A;  2K6L A;  3QOQ A;  4HV0 A;  2KEL A;  1B01 A;  2BJ1 A;  1ARQ A;  1U9P A;  1PAR A;  1B28 A;  1BDT A;  2CAD A;  2WVB A;  2CAX A;  4FXE A;  1EA4 A;  1P94 A;  2CA9 A;  2JXI A;  3VW4 A;  2K9I A;  2WVD A;  1MYK A;  3LGH A;  2BJ9 A;  2WVC A;  1ARR A;  2HZA A;  1NLA A;  2CAJ A;  2WVE A;  4D8J A;  1BAZ A;  2GPE A;  2BA3 A;  3H87 C;  2RBF A;  2BJ3 A;  1IRQ A;  3VEB A;  2H1O E;  3OD2 A;  1QTG A;  2WVF A;  2JXG A;  2BNW A;  3VEA A;  3FMT A;  2BSQ E;  2BNZ A;  2K5J A;  1MNT A;  2K29 A;  2BJ7 A;  2AY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...