1ARTA

X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from escherichia coli in open and closed form
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray crystallographic study of pyridoxal 5'-phosphate-type aspartate aminotransferases from Escherichia coli in open and closed form.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase(aminotransferase)
total genus 132
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1artA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1artA01
4KYOA 3LG0A 5FT5A 1W7NA 2ZUKA 2BKWA 1J32A 4KAMA 4MQPA 1ASDA 1ASCA 2Z9UA 2BWPA 2FNIA 2W8WA 3AOWA 3FQ7A 3MEBA 4J8LA 3NNKA 5G4JA 2ZY3A 3QPGA 1IX8A 2OATA 2C44A 5C6UA 2QBTA 2YKVA 2D63A 4WD2A 1BKGA 1B5PA 1MDXA 2QLRA 3DODA 3DR7A 4QGRA 3FTBA 1MDOA 2EH6A 3F9TA 3MAFB 4A0RA 3CAIA 3PDBA 4U2HA 3RBFA 2BIGA 3GJUA 5G09A 4KXKA 3B1EA 3FRKA 1BQDA 2DOUA 4ISYA 3AEMC 2E7JA 3HL2A 5K8BA 1N2TA 3NUIA 1LS3A 4PFNA 4ZDOA 1TARA 4R8DA 3WZFA 3MADA 2CJGA 4IXSA 5F8VA 4O6ZA 3VP6A 1YJYA 3BCAA 1U08A 2EGYA 2BI9A 4XQ2A 1PFFA 2BIEA 3VK4A 1UU0A 4UQVA 2CB1A 3MAUA 3NU7A 4UHOA 3M5UA 2W7LA 3QBOA 2O0RA 2YKUA 2VMVA 2DKJA 1ZC9A 3AENB 1Z3ZA 4GE7A 2VGVA 3JZLA 3LV2A 4PVFA 2XH1A 2C0RA 3BV0A 3GZDA 4WP0A 1ASMA 3VAXA 1KKPA 1GD9A 3JU7A 1BJNA 3WKSA 2E7UA 4XJLA 1TOKA 4Y0DA 3FCRA 1QZ9A 2QB2A 3AV7A 4WYDA 3ZZKA 4A0GA 1DJUA 2R5EA 3LVJA 2HP2A 3LVLB 1DGDA 4JEVA 1AKAA 4IX8A 3E2FA 1AMQA 3EZ1A 1BJWA 1M0PA 2YCTA 3PD6A 4JEXA 1Y4IA 2VMOA 5F9SA 4WYCA 1D7UA 1AMSA 2FQ6A 4U1TA 1ARTA 1AKCA 2JG2A 2W8UA 3PIUA 4B9BA 2OKJA 4BA4A 1WYTA 4W1WA 4F5HA 2VMUA 2ORDA 2CY8A 2WKAA 1Z7DA 5HXXA 1YIYA 3A9XA 1W7LA 3RCHA 3DZZA 2X8UA 3DC1A 3GR9A 1B9IA 1CZEA 1FG3A 3EIAA 1CQ8A 2VMPA 1AHGA 4JF0A 4N0BA 3USFA 1RVUA 2D64A 1DGEA 4WYFA 5FT4A 3UE8A 2D7ZA 5G2QA 5TF5A 1CL2A 2O7CA 2YCNA 3AEJA 1EJIA 2R0TA 1YOOA 5DJ9A 4LNLA 3E2YA 4AOAA 4W1VA 3LY1A 3NYUA 1AHXA 4IYOB 5HHYA 1M0QA 1TASA 4ZSYA 1J04A 4Y0HA 2VI9A 3ELEA 3NYSA 2D65A 3DXWA 4F5FA 4DGTA 3AEPA 4Q75A 4OCAA 2WK7A 5G0AA 3AELA 2CSTA 1TOEA 3BWOA 3K7YA 4EFFA 1G7XA 1OHYA 4WLJA 2HUUA 3EUCA 3ATHA 1G4VA 3BC8A 1GC2A 1VP4A 3GWPA 3FQ8A 2OGAA 4GDYA 3BCBA 4HVKA 5M49A 1ZOBA 1AMAA 3MC6C 3P1TA 1WKHA 3K28A 1H1CA 2AY2A 2QA3A 3NDNA 1TATA 3ELPA 4N0WA 1RV4A 4TN4A 4CBRA 1ECXA 1SZSA 1WYVA 4OMAA 3HLMA 4P7YA 2TPLA 2OGEA 2FN6A 2X5FA 4XJMA 4CVQA 1AJSA 2AY8A 2W7MA 3TATA 4F5KA 8AATA 4M2KA 1H0CA 3RUYA 3NX3A 3AOVA 4WYGA 3R9AA 1ASLA 2VIAA 1GDEA 4JEYA 2Q7WA 1KMJA 1ASAA 1YJZA 2ZSMA 4RKDA 2D61A 3I16A 1IBJA 2R5CA 1JS3A 4XJPA 3TQXA 2VMYA 2BI5A 4R5ZA 2VLFA 5BJ3A 2YHKA 2EZ2A 5DX5A 4ZWVA 1S0AA 4CXQA 3W1IA 3GSBA 1XI9A 3H14A 4PFFA 5G4IA 4EMYA 2VMWA 1M0NA 3WGBA 4K2IA 4AH3A 3GZCA 4UHNA 3WY7A 2AY5A 3LVMA 3G0TA 4NOGA 3PDBB 2X3LA 3NTJA 3PAAA 4IY7A 4TV7A 4RM1A 3BS8A 4WXGA 1GCKA 5EQCA 3CQ6A 3FDBA 4ZLVA 1AIBA 3EI5A 4FL0A 1ASFA 3A9YA 3ASBA 1C7NA 5E3KA 3LWSA 3COGA 1C4KA 2VGSA 3GBXA 3ISLA 4ADEA 1OXOA 3NUBA 4A6RA 1BT4A 4W8IA 5DB5A 1CS1A 1I29A 2AY4A 2JJEA 4Q31A 1AJRA 2BWNA 2CJDA 3MAFA 2WK8A 3PA9A 1PMOA 1O62A 3ACZA 1C0NA 3A9ZA 3AEOA 1WYUA 3HQTA 2CJHA 4RIZA 3A2BA 3CQ4A 1X2AA 1X0MA 4EB7A 1GC4A 2V1PA 3GZDC 3I4JA 2HOZA 4ZWMA 5JAYA 3QI6A 5FT6A 2JJFA 3E6GA 4CXRA 4F5JA 1KL1A 1BJOA 3FDDA 2BYLA 4IW7A 2RFVA 3BN1A 3KE3A 4E77A 2ZP7A 1D7SA 1IAXA 2ZJGA 3DU4A 4WBTA 3FVUA 3BWNA 1FC4A 5LHAA 2VI8A 4LC3A 3W1HA 5LH9A 2CFBA 2QMAA 1AICA 2JISA 1G4XA 4Q76A 1OHVA 1RVYA 3UWCA 1CQ6A 2Z20A 2HORA 4Q6RA 1N8PA 2GSAA 1ASGA 1YJSA 2W7GA 2VYCA 1WYTB 2X5DA 5E5IA 4OBVA 1KMKA 1LC7A 2CH1A 2AEUA 3HVYA 1B5OA 2DGLA 3ECDA 1SZKA 4OBUA 4OC9A 3RCHB 3EZSA 4ZM3A 1AHFA 1EQBA 1S08A 3NU8A 2OQXA 1UU1A 1CL1A 2OKKA 1AY8A 3JTXA 1TOJA 2AY7A 4MKJA 4F5IA 3N5MA 1SVVA 2Z1ZA 3VK2A 3AEJC 1QISA 1YIZA 1IJIA 1N31A 5IWQA 4OYTA 3LVKA 2HZPA 2YOBA 1TOGA 2G6WA 3NYTA 1V2FA 4K2BA 1DKAA 5EIGA 1BS0A 3ZRPA 3N75A 2HOXA 2D7YA 2Z61A 2EO5A 1I41A 2VIBA 2JGTA 2PO3A 3HBXA 2BWOA 2VMSA 1V72A 4GE4A 4MQRA 1VEFA 4GRXA 1S07A 2VGZA 2W7IA 3IHJA 3L8AA 3VOMA 4AZKA 3OKSA 4R5FA 2HUIA 2W7DA 2HOYA 5EUDA 1VJOA 2W8TA 1W7MA 2GQNA 4Y0IA 4LW4A 4IXZA 1AHYA 3WCNA 4A0FA 1AX4A 4WLHA 3JW9A 1M6SA 2VMRA 1ELUA 2VMTA 4ZSWA 1I48A 2YCPA 3FFHA 1ARSA 3R4TA 4MGRA 4WXBA 3WX9A 5D5SA 1IX6A 4M2MA 5M46A 4ADBA 2HUFA 4ITXA 3PJ0A 1E5FA 3E2ZB 3I5TA 4BMKA 4FFCA 4F5MA 4WB0B 4DQ6A 4ZDLA 1ORDA 1MDZA 1GC0A 2Z1YA 5EUEA 3WGCA 4ADDA 2BYJA 1JF9A 1KL2A 4BHDA 1IAYA 1LW5A 4OT8A 2VMZA 3H7FA 4A72A 1S06A 1OXPA 2VGWA 5FT8A 1MGVA 2D5YA 3KKIA 4DBCA 1LW4A 1ASEA 3WCOA 5M4BA 2GMUA 3TCMA 2C81A 4OTLA 9AATA 2ZYJA 1QJ5A 4BA5A 3FSLA 2NMPA 2CANA 3PDXA 4W5KA 2BI3A 4A00A 2CH2A 2XBNA 3N0LA 3T32A 3QM2A 1OATA 3ZRRA 1LKCA 4PIWA 3II0A 1ARHA 4ATPA 2CTZA 1GEXA 4WXFA 3RBLA 4ZM4A 5I92A 1CJ0A 3FZ8A 5EUNA 3WKRA 1RV3A 4A0HA 1AAMA 3B1DA 4M2JA 2JJGA 2HP1A 3FZ7A 3FD0A 2CINA 1B4XA 1T3IA 1QGNA 1V2EA 2WK9A 5BJ4A 3DXVA 5DJ1A 2FNUA 4E3QA 1S09A 5G2PA 1PG8A 2EZ1A 1GC3A 4CBSA 2W7JA 1BJ4A 2Z9XA 3DRDA 2Z67A 1ZODA 1WYUB 2QB3A 4E1OA 4JEWA 4ADCA 1M4NA 3AEMA 3MKJA 4I8AA 4K2MA 5J8QA 4JF1A 1QITA 4ZDPA 1EG5A 4ZASA 3CBFA 2FYFA 1O69A 5D95A 5AX8A 1SPAA 1MAPA 4MKKA 1BJOB 1AY5A 1I43A 3D6KA 4MQQA 1O61A 1M0OA 1P3WA 1X28A 4W1XA 3HT4A 1O4SA 2PB0A 2VGUA 3FVXA 4UHMA 1AAWA 3TFUA 1B8GA 2F8JA 2DKBA 1ASNA 3EI8A 3EI9A 3FZ6A 3PPLA 3KGWA 1W23A 3BWNC 4RJ0A 3UAKA 4L0OA 1SFFA 1GBNA 2E54A 2YKXA 2C7TA 3E9KA 3L44A 3PD6B 4UOYA 3QGUA 3B46A 4RLGA 4WYAA 4XK1A 2Z9WA 4HF8A 3VK3A 3W1JA 3AENA 2BIAA 3ZZJA 1C7GA 1M7YA 2ZSLA 2GB3A 1FG7A 3IF2A 3P6KA 2VMXA 2GMSA 1YAAA 2ZY5A 1IUGA 1WKGA 3EI7A 3QHXA 3FKDA 3FVSA 1JS6A 3G7QA 2E7IA 3A8UX 1LC5A 5EAAA 2AEVA 2VMQA 1GEYA 2ZC0A 3EI6A 1X29A 2AY9A 4LNJA 1QJ3A 3Q8NA 2YRRA 4R2NA 1BW0A 3RI6A 4IXOA 1D2FA 3OP7A 1UKJA 1AIAA 4GEBA 4A6UA 4TMRA 4ZAHA 2D66A 4A6TA 2DR1A 1LK9A 5EIGB 3EIBA 4W91A 2O1BA 4XAUA 1IX7A 3HDOA 2AATA 2W8VA 4BQ0A 1ASBA 5M4DA 1TPLA 4ITGA 2V0YA 4E3RA 1TOIA 2BI1A 4RAEA 3PGYA 4F4EA 2BHXA 4WYEA 3BB8A 4H51A 2W7HA 1ARIA 4F5LA 2W8JA 3DYDA 3F6TA 1AY4A 1YNUA 3K40A 1BQAA 1ELQA 4J5UA 4ATQA 2R2NA 1B9HA 1LC8A 1XEYA 2EPJA 2VMNA 4GSAA 4RKCA 3JWBA 4JE5D 4JEZA 5EFSA 1M32A 4LW2A 4P3MA 1DTYA 1V2DA 1SZUA 2AY1A 4MY5A 1MLZA 1UU2A 1WYVB 3HMUA 1D7VA 1QIRA 5HDMA 4XEWA 1DJEA 3E77A 4IYOA 3MBBA 3ASAA 5EAVA 1D7RA 1AJSB 3DR4A 1ARGA 4AZJA 1WSTA 4F5GA 3AATA 2PB2A 4XJOA 1AHEA 3B8XA 4EU1A 1KKJA 1C9CA 1MLYA 2R5CB 3NRAA 4MSOA 1DFOA 4RITA 3FQAA 1OHWA 3BCXA 2W7KA 3WLXA 1AMRA 7AATA 2ZY4A 4GE9A 2DGMA 3F0HA 2W7FA 1W3UA 2DGKA 2ZY2A 2YKYA 1SF2A 3CQ5A 4RJYA 1CZCA 3MC6A 4AO4A 1JG8A 1MAQA 3QN6A 2VLHA 1AKBA 2Z9VA 2AY3A 3TFTA 3ZRQA 3JWAA 3KGXA 4AO9A 2YRIA 1C7OA 1DJ9A 3G8MA 2FM1A 1CQ7A 1G7WA 4B98A 2AY6A 2JJHA 4JE5A 4EB5A 2BI2A 3E2ZA 1IVRA 4WB0A 5E4ZA 2W7EA 3B1CA 4LNMA 1E5EA 3GETA 3FFRA 1PMMA 2VGTA 1GEWA 3RQ1A
chains in the Genus database with same CATH superfamily
4KYOA 3LG0A 5FT5A 1W7NA 2ZUKA 2BKWA 1J32A 4KAMA 4MQPA 1ASDA 1ASCA 2Z9UA 2BWPA 2FNIA 2W8WA 3AOWA 3FQ7A 3MEBA 4J8LA 3NNKA 5G4JA 2ZY3A 3QPGA 1IX8A 2OATA 2C44A 5C6UA 2QBTA 2YKVA 2D63A 4WD2A 1BKGA 1B5PA 1MDXA 2QLRA 3DODA 3DR7A 4QGRA 3FTBA 1MDOA 2EH6A 3F9TA 3MAFB 4A0RA 3CAIA 3PDBA 4U2HA 3RBFA 2BIGA 3GJUA 5G09A 4KXKA 3B1EA 3FRKA 1BQDA 2DOUA 4ISYA 2FKIA 3AEMC 2E7JA 3HL2A 5K8BA 1N2TA 3NUIA 1LS3A 4PFNA 4ZDOA 1TARA 4R8DA 3WZFA 3MADA 2CJGA 4IXSA 5F8VA 4O6ZA 3N7NA 3VP6A 4H63Q 1YJYA 3BCAA 1U08A 2EGYA 2BI9A 4XQ2A 1PFFA 2BIEA 3VK4A 1UU0A 4UQVA 2CB1A 3MAUA 3NU7A 4UHOA 3M5UA 2W7LA 3QBOA 2O0RA 2YKUA 2VMVA 2DKJA 1ZC9A 3AENB 1Z3ZA 4GE7A 2KFPA 2VGVA 3N4XA 3JZLA 3LV2A 4PVFA 2XH1A 2C0RA 3BV0A 3GZDA 4WP0A 1ASMA 3VAXA 1KKPA 1GD9A 3JU7A 1BJNA 3WKSA 2E7UA 4XJLA 1TOKA 4Y0DA 3FCRA 1QZ9A 2QB2A 3AV7A 4WYDA 3ZZKA 4A0GA 1DJUA 2R5EA 3LVJA 2HP2A 3LVLB 1DGDA 4JEVA 1AKAA 4IX8A 3E2FA 1AMQA 3EZ1A 1BJWA 1M0PA 2YCTA 3PD6A 4JEXA 1Y4IA 2VMOA 5F9SA 4WYCA 1D7UA 1AMSA 2FQ6A 4U1TA 1ARTA 1AKCA 2JG2A 2W8UA 3PIUA 4B9BA 2OKJA 4BA4A 1WYTA 4W1WA 4F5HA 2VMUA 2ORDA 2CY8A 2WKAA 1Z7DA 5HXXA 1YIYA 3A9XA 1W7LA 3RCHA 3DZZA 2X8UA 3DC1A 3GR9A 1B9IA 1CZEA 1FG3A 3EIAA 1CQ8A 2VMPA 1AHGA 4JF0A 4N0BA 3USFA 1RVUA 2D64A 1DGEA 4WYFA 5FT4A 3UE8A 2D7ZA 5G2QA 5TF5A 1CL2A 2O7CA 2YCNA 3AEJA 1EJIA 2R0TA 1YOOA 5DJ9A 4LNLA 3E2YA 4AOAA 4W1VA 3LY1A 3NYUA 1AHXA 4IYOB 5HHYA 1M0QA 1TASA 4ZSYA 1J04A 4Y0HA 2VI9A 3ELEA 3NYSA 2D65A 3DXWA 4F5FA 4DGTA 3AEPA 4Q75A 4OCAA 2WK7A 5G0AA 3AELA 2CSTA 1TOEA 3BWOA 3K7YA 4EFFA 1G7XA 1OHYA 4WLJA 2HUUA 3EUCA 3ATHA 1G4VA 3BC8A 1GC2A 1VP4A 3GWPA 3FQ8A 2OGAA 4GDYA 3BCBA 4HVKA 5M49A 1ZOBA 1AMAA 3MC6C 3P1TA 1WKHA 3K28A 1H1CA 2AY2A 2QA3A 3NDNA 1TATA 3ELPA 4N0WA 1RV4A 4TN4A 4CBRA 1ECXA 1SZSA 1WYVA 4OMAA 3HLMA 4P7YA 2TPLA 2OGEA 2FN6A 2X5FA 4XJMA 4CVQA 1AJSA 2AY8A 2W7MA 3TATA 4F5KA 8AATA 4M2KA 1H0CA 3RUYA 3NX3A 3AOVA 4WYGA 3R9AA 1ASLA 2VIAA 1GDEA 4JEYA 2Q7WA 1KMJA 1ASAA 1YJZA 2ZSMA 4RKDA 2D61A 3I16A 2EYQA 1IBJA 2R5CA 1JS3A 4XJPA 3TQXA 2VMYA 2BI5A 4R5ZA 2VLFA 5BJ3A 2YHKA 2EZ2A 5DX5A 4ZWVA 1S0AA 4CXQA 3W1IA 3GSBA 1XI9A 3H14A 4PFFA 5G4IA 4EMYA 2VMWA 3H9XA 1M0NA 3WGBA 4K2IA 4AH3A 3GZCA 4UHNA 3WY7A 2AY5A 3LVMA 3G0TA 4NOGA 3PDBB 2X3LA 3NTJA 3PAAA 4IY7A 4TV7A 4RM1A 3BS8A 4WXGA 1GCKA 5EQCA 3CQ6A 3FDBA 4ZLVA 1AIBA 3EI5A 4FL0A 1ASFA 3A9YA 3ASBA 1C7NA 5E3KA 3LWSA 3COGA 1C4KA 2VGSA 3GBXA 3ISLA 4ADEA 1OXOA 3NUBA 4A6RA 1BT4A 4W8IA 5DB5A 1CS1A 1I29A 2AY4A 2JJEA 4Q31A 2A1VA 1AJRA 2BWNA 2CJDA 3MAFA 2WK8A 3PA9A 1PMOA 1O62A 3ACZA 1C0NA 3A9ZA 3AEOA 1WYUA 3HQTA 2CJHA 4RIZA 3A2BA 3CQ4A 1X2AA 1X0MA 4EB7A 1GC4A 2V1PA 3GZDC 3I4JA 2HOZA 4ZWMA 5JAYA 3QI6A 5FT6A 2JJFA 3E6GA 4CXRA 4F5JA 1KL1A 1BJOA 3FDDA 2BYLA 4IW7A 2RFVA 3BN1A 3KE3A 4E77A 2ZP7A 1D7SA 1IAXA 2ZJGA 3DU4A 4WBTA 3FVUA 3BWNA 1FC4A 5LHAA 2VI8A 4LC3A 3W1HA 5LH9A 2CFBA 2QMAA 1AICA 2JISA 1G4XA 4Q76A 1OHVA 1RVYA 3UWCA 1CQ6A 2Z20A 2HORA 4Q6RA 1N8PA 2GSAA 1ASGA 1YJSA 2W7GA 2VYCA 1WYTB 2X5DA 5E5IA 4OBVA 1KMKA 1LC7A 2CH1A 4K05A 2AEUA 3HVYA 1B5OA 2DGLA 3ECDA 1SZKA 4OBUA 4OC9A 3RCHB 3EZSA 4ZM3A 1AHFA 1EQBA 1S08A 3NU8A 2OQXA 1UU1A 1CL1A 2OKKA 1AY8A 3JTXA 1TOJA 2AY7A 4MKJA 3N4SA 4F5IA 3N5MA 1SVVA 2Z1ZA 3VK2A 3AEJC 1QISA 1YIZA 1IJIA 1N31A 5IWQA 4OYTA 3LVKA 2HZPA 2YOBA 1TOGA 2G6WA 3NYTA 1V2FA 4K2BA 1DKAA 5EIGA 1BS0A 3ZRPA 3N75A 2HOXA 2D7YA 2Z61A 2EO5A 1I41A 2VIBA 2JGTA 2PO3A 3HBXA 2BWOA 2VMSA 1V72A 4GE4A 4MQRA 1VEFA 4GRXA 1S07A 2VGZA 2W7IA 3IHJA 3L8AA 3VOMA 4AZKA 3OKSA 4R5FA 2HUIA 2W7DA 2HOYA 5EUDA 1VJOA 2W8TA 1W7MA 2GQNA 4Y0IA 4LW4A 4IXZA 1AHYA 3WCNA 4A0FA 1AX4A 4WLHA 3JW9A 1M6SA 2VMRA 1ELUA 2VMTA 4ZSWA 1I48A 2YCPA 3FFHA 1ARSA 3R4TA 4MGRA 4WXBA 3WX9A 5D5SA 1IX6A 4M2MA 5M46A 4ADBA 2HUFA 4ITXA 3PJ0A 1E5FA 3E2ZB 3I5TA 4BMKA 4FFCA 4F5MA 4WB0B 4DQ6A 4ZDLA 1ORDA 1MDZA 1GC0A 2Z1YA 5EUEA 3WGCA 4ADDA 2BYJA 1JF9A 1KL2A 4BHDA 1IAYA 1LW5A 4OT8A 2G7JA 2VMZA 3H7FA 4A72A 1S06A 1OXPA 2VGWA 5FT8A 1MGVA 2D5YA 3KKIA 4DBCA 1LW4A 1ASEA 3WCOA 5M4BA 2GMUA 3TCMA 2C81A 4OTLA 9AATA 2ZYJA 1QJ5A 4BA5A 3FSLA 2NMPA 2CANA 3PDXA 4W5KA 2BI3A 4A00A 2CH2A 2XBNA 3N0LA 3T32A 3QM2A 1OATA 3ZRRA 1LKCA 4PIWA 3II0A 1ARHA 4ATPA 2CTZA 1GEXA 4WXFA 3RBLA 4ZM4A 5I92A 1CJ0A 3FZ8A 5EUNA 3WKRA 1RV3A 4A0HA 1AAMA 3B1DA 4M2JA 2JJGA 2HP1A 3FZ7A 3FD0A 2CINA 1B4XA 1T3IA 1QGNA 1V2EA 2WK9A 5BJ4A 3DXVA 5DJ1A 2FNUA 4E3QA 1S09A 5G2PA 1PG8A 2EZ1A 5KTBA 1GC3A 4CBSA 2W7JA 1BJ4A 2Z9XA 3DRDA 2Z67A 1ZODA 1WYUB 2QB3A 4E1OA 4JEWA 4ADCA 1M4NA 3AEMA 3MKJA 4I8AA 4K2MA 5J8QA 4JF1A 1QITA 4ZDPA 1EG5A 4ZASA 3CBFA 2FYFA 1O69A 5D95A 5AX8A 1SPAA 1MAPA 4MKKA 1BJOB 1AY5A 1I43A 3D6KA 4MQQA 1O61A 1M0OA 1P3WA 1X28A 4W1XA 3HT4A 1O4SA 2PB0A 2VGUA 3FVXA 4UHMA 1AAWA 3TFUA 1B8GA 2F8JA 2DKBA 1ASNA 3EI8A 3EI9A 3FZ6A 3PPLA 3KGWA 1W23A 3BWNC 4RJ0A 3UAKA 4L0OA 1SFFA 1GBNA 2E54A 2YKXA 2C7TA 3E9KA 3L44A 3PD6B 4UOYA 3QGUA 3B46A 4RLGA 4WYAA 4XK1A 2Z9WA 4HF8A 3VK3A 3W1JA 3AENA 2BIAA 3ZZJA 1C7GA 1M7YA 2ZSLA 2GB3A 1FG7A 3IF2A 3P6KA 2VMXA 2GMSA 1KAFA 1YAAA 2ZY5A 1IUGA 1WKGA 3EI7A 3QHXA 3FKDA 3FVSA 1JS6A 3G7QA 2E7IA 3A8UX 1LC5A 5EAAA 2AEVA 2VMQA 1GEYA 2ZC0A 3EI6A 1X29A 2AY9A 4LNJA 1QJ3A 3Q8NA 2YRRA 4R2NA 1BW0A 3RI6A 4IXOA 1D2FA 3OP7A 1UKJA 1AIAA 4GEBA 4A6UA 4TMRA 4ZAHA 2D66A 4A6TA 2DR1A 1LK9A 5EIGB 3EIBA 4W91A 2O1BA 4XAUA 1IX7A 3HDOA 2AATA 2W8VA 4BQ0A 1ASBA 5M4DA 1TPLA 4ITGA 2V0YA 4E3RA 1TOIA 2BI1A 4RAEA 3PGYA 4F4EA 2BHXA 4WYEA 3BB8A 4H51A 2W7HA 1ARIA 4F5LA 2W8JA 3DYDA 3F6TA 1AY4A 1YNUA 3K40A 1BQAA 1ELQA 4J5UA 4ATQA 2R2NA 1B9HA 1LC8A 1XEYA 2EPJA 2VMNA 4GSAA 4RKCA 3JWBA 4JE5D 4JEZA 5EFSA 1M32A 4LW2A 4P3MA 1DTYA 1V2DA 1SZUA 2AY1A 4MY5A 1MLZA 1UU2A 1WYVB 3HMUA 2WB6A 1D7VA 1QIRA 5HDMA 4XEWA 1DJEA 3E77A 4IYOA 3MBBA 3ASAA 5EAVA 1D7RA 1AJSB 3DR4A 1ARGA 4AZJA 1WSTA 4F5GA 2QSRA 3AATA 2PB2A 4XJOA 1AHEA 3B8XA 4EU1A 1KKJA 1C9CA 1MLYA 2R5CB 3NRAA 4MSOA 1DFOA 4RITA 3FQAA 1OHWA 3BCXA 2W7KA 3WLXA 1AMRA 7AATA 2ZY4A 4GE9A 2DGMA 3F0HA 2W7FA 1W3UA 2DGKA 2ZY2A 2YKYA 1SF2A 3N4RA 3CQ5A 4RJYA 1CZCA 3MC6A 4AO4A 1JG8A 1MAQA 3QN6A 2VLHA 1AKBA 2Z9VA 2AY3A 3TFTA 3ZRQA 3JWAA 3KGXA 4AO9A 2YRIA 1C7OA 1DJ9A 3G8MA 2FM1A 1CQ7A 1G7WA 4B98A 2AY6A 2JJHA 4JE5A 4EB5A 2BI2A 3E2ZA 1IVRA 4WB0A 5E4ZA 2W7EA 3B1CA 4LNMA 1E5EA 3GETA 3FFRA 1PMMA 2VGTA 1GEWA 3RQ1A
chains in the Genus database with same CATH topology
4KYOA 3LG0A 5FT5A 1W7NA 2ZUKA 2BKWA 1J32A 4KAMA 4MQPA 1ASDA 1ASCA 2Z9UA 2BWPA 2FNIA 2W8WA 3AOWA 3FQ7A 3MEBA 4J8LA 3NNKA 5G4JA 2ZY3A 3QPGA 1IX8A 2OATA 2C44A 5C6UA 2QBTA 2YKVA 2D63A 4WD2A 1BKGA 1B5PA 1MDXA 2QLRA 3DODA 3DR7A 4QGRA 3FTBA 1MDOA 2EH6A 3F9TA 3MAFB 4A0RA 3CAIA 3PDBA 4U2HA 3RBFA 2BIGA 3GJUA 5G09A 4KXKA 3B1EA 3FRKA 1BQDA 2DOUA 4ISYA 2FKIA 3AEMC 2E7JA 3HL2A 5K8BA 1N2TA 3NUIA 1LS3A 4PFNA 4ZDOA 1TARA 4R8DA 3WZFA 3MADA 2CJGA 4IXSA 5F8VA 4O6ZA 3N7NA 3VP6A 4H63Q 1YJYA 3BCAA 1U08A 2EGYA 2BI9A 4XQ2A 1PFFA 2BIEA 3VK4A 1UU0A 4UQVA 2CB1A 3MAUA 3NU7A 4UHOA 3M5UA 2W7LA 3QBOA 2O0RA 2YKUA 2VMVA 2DKJA 1ZC9A 3AENB 1Z3ZA 4GE7A 2KFPA 2VGVA 3N4XA 3JZLA 3LV2A 4PVFA 2XH1A 2C0RA 3BV0A 3GZDA 4WP0A 1ASMA 3VAXA 1KKPA 1GD9A 3JU7A 1BJNA 3WKSA 2E7UA 4XJLA 1TOKA 4Y0DA 3FCRA 1QZ9A 2QB2A 3AV7A 4WYDA 3ZZKA 4A0GA 1DJUA 2R5EA 3LVJA 2HP2A 3LVLB 1DGDA 4JEVA 1AKAA 4IX8A 3E2FA 1AMQA 3EZ1A 1BJWA 1M0PA 2YCTA 3PD6A 4JEXA 1Y4IA 2VMOA 5F9SA 4WYCA 1D7UA 1AMSA 2FQ6A 4U1TA 1ARTA 1AKCA 2JG2A 2W8UA 3PIUA 4B9BA 2OKJA 4BA4A 1WYTA 4W1WA 4F5HA 2VMUA 2ORDA 2CY8A 2WKAA 1Z7DA 5HXXA 1YIYA 3A9XA 1W7LA 3RCHA 3DZZA 2X8UA 3DC1A 3GR9A 1B9IA 1CZEA 1FG3A 3EIAA 1CQ8A 2VMPA 1AHGA 4JF0A 4N0BA 3USFA 1RVUA 2D64A 1DGEA 4WYFA 5FT4A 3UE8A 2D7ZA 5G2QA 5TF5A 1CL2A 2O7CA 2YCNA 3AEJA 1EJIA 2R0TA 1YOOA 5DJ9A 4LNLA 3E2YA 4AOAA 4W1VA 3LY1A 3NYUA 1AHXA 4IYOB 5HHYA 1M0QA 1TASA 4ZSYA 1J04A 4Y0HA 2VI9A 3ELEA 3NYSA 2D65A 3DXWA 4F5FA 4DGTA 3AEPA 4Q75A 4OCAA 2WK7A 5G0AA 3AELA 2CSTA 1TOEA 3BWOA 3K7YA 4EFFA 1G7XA 1OHYA 4WLJA 2HUUA 3EUCA 3ATHA 1G4VA 3BC8A 1GC2A 1VP4A 3GWPA 3FQ8A 2OGAA 4GDYA 3BCBA 4HVKA 5M49A 1ZOBA 1AMAA 3MC6C 3P1TA 1WKHA 3K28A 1H1CA 2AY2A 2QA3A 3NDNA 1TATA 3ELPA 4N0WA 1RV4A 4TN4A 4CBRA 1ECXA 1SZSA 1WYVA 4OMAA 3HLMA 4P7YA 2TPLA 2OGEA 2FN6A 2X5FA 4XJMA 4CVQA 1AJSA 2AY8A 2W7MA 3TATA 4F5KA 8AATA 4M2KA 1H0CA 3RUYA 3NX3A 3AOVA 4WYGA 3R9AA 1ASLA 2VIAA 1GDEA 4JEYA 2Q7WA 1KMJA 1ASAA 1YJZA 2ZSMA 4RKDA 2D61A 3I16A 2EYQA 1IBJA 2R5CA 1JS3A 4XJPA 3TQXA 2VMYA 2BI5A 4R5ZA 2VLFA 5BJ3A 2YHKA 2EZ2A 5DX5A 4ZWVA 1S0AA 4CXQA 3W1IA 3GSBA 1XI9A 3H14A 4PFFA 5G4IA 4EMYA 2VMWA 3H9XA 1M0NA 3WGBA 4K2IA 4AH3A 3GZCA 4UHNA 3WY7A 2AY5A 3LVMA 3G0TA 4NOGA 3PDBB 2X3LA 3NTJA 3PAAA 4IY7A 4TV7A 4RM1A 3BS8A 4WXGA 1GCKA 5EQCA 3CQ6A 3FDBA 4ZLVA 1AIBA 3EI5A 4FL0A 1ASFA 3A9YA 3ASBA 1C7NA 5E3KA 3LWSA 3COGA 1C4KA 2VGSA 3GBXA 3ISLA 4ADEA 1OXOA 3NUBA 4A6RA 1BT4A 4W8IA 5DB5A 1CS1A 1I29A 2AY4A 2JJEA 4Q31A 2A1VA 1AJRA 2BWNA 2CJDA 3MAFA 2WK8A 3PA9A 1PMOA 1O62A 3ACZA 1C0NA 3A9ZA 3AEOA 1WYUA 3HQTA 2CJHA 4RIZA 3A2BA 3CQ4A 1X2AA 1X0MA 4EB7A 1GC4A 2V1PA 3GZDC 3I4JA 2HOZA 4ZWMA 5JAYA 3QI6A 5FT6A 2JJFA 3E6GA 4CXRA 4F5JA 1KL1A 1BJOA 3FDDA 2BYLA 4IW7A 2RFVA 3BN1A 3KE3A 4E77A 2ZP7A 1D7SA 1IAXA 2ZJGA 3DU4A 4WBTA 3FVUA 3BWNA 1FC4A 5LHAA 2VI8A 4LC3A 3W1HA 5LH9A 2CFBA 2QMAA 1AICA 2JISA 1G4XA 4Q76A 1OHVA 1RVYA 3UWCA 1CQ6A 2Z20A 2HORA 4Q6RA 1N8PA 2GSAA 1ASGA 1YJSA 2W7GA 2VYCA 1WYTB 2X5DA 5E5IA 4OBVA 1KMKA 1LC7A 2CH1A 4K05A 2AEUA 3HVYA 1B5OA 2DGLA 3ECDA 1SZKA 4OBUA 4OC9A 3RCHB 3EZSA 4ZM3A 1AHFA 1EQBA 1S08A 3NU8A 2OQXA 1UU1A 1CL1A 2OKKA 1AY8A 3JTXA 1TOJA 2AY7A 4MKJA 3N4SA 4F5IA 3N5MA 1SVVA 2Z1ZA 3VK2A 3AEJC 1QISA 1YIZA 1IJIA 1N31A 5IWQA 4OYTA 3LVKA 2HZPA 2YOBA 1TOGA 2G6WA 3NYTA 1V2FA 4K2BA 1DKAA 5EIGA 1BS0A 3ZRPA 3N75A 2HOXA 2D7YA 2Z61A 2EO5A 1I41A 2VIBA 2JGTA 2PO3A 3HBXA 2BWOA 2VMSA 1V72A 4GE4A 4MQRA 1VEFA 4GRXA 1S07A 2VGZA 2W7IA 3IHJA 3L8AA 3VOMA 4AZKA 3OKSA 4R5FA 2HUIA 2W7DA 2HOYA 5EUDA 1VJOA 2W8TA 1W7MA 2GQNA 4Y0IA 4LW4A 4IXZA 1AHYA 3WCNA 4A0FA 1AX4A 4WLHA 3JW9A 1M6SA 2VMRA 1ELUA 2VMTA 4ZSWA 1I48A 2YCPA 3FFHA 1ARSA 3R4TA 4MGRA 4WXBA 3WX9A 5D5SA 1IX6A 4M2MA 5M46A 4ADBA 2HUFA 4ITXA 3PJ0A 1E5FA 3E2ZB 3I5TA 4BMKA 4FFCA 4F5MA 4WB0B 4DQ6A 4ZDLA 1ORDA 1MDZA 1GC0A 2Z1YA 5EUEA 3WGCA 4ADDA 2BYJA 1JF9A 1KL2A 4BHDA 1IAYA 1LW5A 4OT8A 2G7JA 2VMZA 3H7FA 4A72A 1S06A 1OXPA 2VGWA 5FT8A 1MGVA 2D5YA 3KKIA 4DBCA 1LW4A 1ASEA 3WCOA 5M4BA 2GMUA 3TCMA 2C81A 4OTLA 9AATA 2ZYJA 1QJ5A 4BA5A 3FSLA 2NMPA 2CANA 3PDXA 4W5KA 2BI3A 4A00A 2CH2A 2XBNA 3N0LA 3T32A 3QM2A 1OATA 3ZRRA 1LKCA 4PIWA 3II0A 1ARHA 4ATPA 2CTZA 1GEXA 4WXFA 3RBLA 4ZM4A 5I92A 1CJ0A 3FZ8A 5EUNA 3WKRA 1RV3A 4A0HA 1AAMA 3B1DA 4M2JA 2JJGA 2HP1A 3FZ7A 3FD0A 2CINA 1B4XA 1T3IA 1QGNA 1V2EA 2WK9A 5BJ4A 3DXVA 5DJ1A 2FNUA 4E3QA 1S09A 5G2PA 1PG8A 2EZ1A 5KTBA 1GC3A 4CBSA 2W7JA 1BJ4A 2Z9XA 3DRDA 2Z67A 1ZODA 1WYUB 2QB3A 4E1OA 4JEWA 4ADCA 1M4NA 3AEMA 3MKJA 4I8AA 4K2MA 5J8QA 4JF1A 1QITA 4ZDPA 1EG5A 4ZASA 3CBFA 2FYFA 1O69A 5D95A 5AX8A 1SPAA 1MAPA 4MKKA 1BJOB 1AY5A 1I43A 3D6KA 4MQQA 1O61A 1M0OA 1P3WA 1X28A 4W1XA 3HT4A 1O4SA 2PB0A 2VGUA 3FVXA 4UHMA 1AAWA 3TFUA 1B8GA 2F8JA 2DKBA 1ASNA 3EI8A 3EI9A 3FZ6A 3PPLA 3KGWA 1W23A 3BWNC 4RJ0A 3UAKA 4L0OA 1SFFA 1GBNA 2E54A 2YKXA 2C7TA 3E9KA 3L44A 3PD6B 4UOYA 3QGUA 3B46A 4RLGA 4WYAA 4XK1A 2Z9WA 4HF8A 3VK3A 3W1JA 3AENA 2BIAA 3ZZJA 1C7GA 1M7YA 2ZSLA 2GB3A 1FG7A 3IF2A 3P6KA 2VMXA 2GMSA 1YAAA 2ZY5A 1IUGA 1WKGA 3EI7A 3QHXA 3FKDA 3FVSA 1JS6A 3G7QA 2E7IA 3A8UX 1LC5A 5EAAA 2AEVA 2VMQA 1GEYA 2ZC0A 3EI6A 1X29A 2AY9A 4LNJA 1QJ3A 3Q8NA 2YRRA 4R2NA 1BW0A 3RI6A 4IXOA 1D2FA 3OP7A 1UKJA 1AIAA 4GEBA 4A6UA 4TMRA 4ZAHA 2D66A 4A6TA 2DR1A 1LK9A 5EIGB 3EIBA 4W91A 2O1BA 4XAUA 1IX7A 3HDOA 2AATA 2W8VA 4BQ0A 1ASBA 5M4DA 1TPLA 4ITGA 2V0YA 4E3RA 1TOIA 2BI1A 4RAEA 3PGYA 4F4EA 2BHXA 4WYEA 3BB8A 4H51A 2W7HA 1ARIA 4F5LA 2W8JA 3DYDA 3F6TA 1AY4A 1YNUA 3K40A 1BQAA 1ELQA 4J5UA 4ATQA 2R2NA 1B9HA 1LC8A 1XEYA 2EPJA 2VMNA 4GSAA 4RKCA 3JWBA 4JE5D 4JEZA 5EFSA 1M32A 4LW2A 4P3MA 1DTYA 1V2DA 1SZUA 2AY1A 4MY5A 1MLZA 1UU2A 1WYVB 3HMUA 2WB6A 1D7VA 1QIRA 5HDMA 4XEWA 1DJEA 3E77A 4IYOA 3MBBA 3ASAA 5EAVA 1D7RA 1AJSB 3DR4A 1ARGA 4AZJA 1WSTA 4F5GA 2QSRA 3AATA 2PB2A 4XJOA 1AHEA 3B8XA 4EU1A 1KKJA 1C9CA 1MLYA 2R5CB 3NRAA 4MSOA 1DFOA 4RITA 3FQAA 1OHWA 3BCXA 2W7KA 3WLXA 1AMRA 7AATA 2ZY4A 4GE9A 2DGMA 3F0HA 2W7FA 1W3UA 2DGKA 2ZY2A 2YKYA 1SF2A 3N4RA 3CQ5A 4RJYA 1CZCA 3MC6A 4AO4A 1JG8A 1MAQA 3QN6A 2VLHA 1AKBA 2Z9VA 2AY3A 3TFTA 3ZRQA 3JWAA 3KGXA 4AO9A 2YRIA 1C7OA 1DJ9A 3G8MA 2FM1A 1CQ7A 1G7WA 4B98A 2AY6A 2JJHA 4JE5A 4EB5A 2BI2A 3E2ZA 1IVRA 4WB0A 5E4ZA 2W7EA 3B1CA 4LNMA 1E5EA 3GETA 3FFRA 1PMMA 2VGTA 1GEWA 3RQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYO A;  3LG0 A;  5FT5 A;  1W7N A;  2ZUK A;  2BKW A;  1J32 A;  4KAM A;  4MQP A;  1ASD A;  1ASC A;  2Z9U A;  2BWP A;  2FNI A;  2W8W A;  3AOW A;  3FQ7 A;  3MEB A;  4J8L A;  3NNK A;  5G4J A;  2ZY3 A;  3QPG A;  1IX8 A;  2OAT A;  2C44 A;  5C6U A;  2QBT A;  2YKV A;  2D63 A;  4WD2 A;  1BKG A;  1B5P A;  1MDX A;  2QLR A;  3DOD A;  3DR7 A;  4QGR A;  3FTB A;  1MDO A;  2EH6 A;  3F9T A;  3MAF B;  4A0R A;  3CAI A;  3PDB A;  4U2H A;  3RBF A;  2BIG A;  3GJU A;  5G09 A;  4KXK A;  3B1E A;  3FRK A;  1BQD A;  2DOU A;  4ISY A;  3AEM C;  2E7J A;  3HL2 A;  5K8B A;  1N2T A;  3NUI A;  1LS3 A;  4PFN A;  4ZDO A;  1TAR A;  4R8D A;  3WZF A;  3MAD A;  2CJG A;  4IXS A;  5F8V A;  4O6Z A;  3VP6 A;  1YJY A;  3BCA A;  1U08 A;  2EGY A;  2BI9 A;  4XQ2 A;  1PFF A;  2BIE A;  3VK4 A;  1UU0 A;  4UQV A;  2CB1 A;  3MAU A;  3NU7 A;  4UHO A;  3M5U A;  2W7L A;  3QBO A;  2O0R A;  2YKU A;  2VMV A;  2DKJ A;  1ZC9 A;  3AEN B;  1Z3Z A;  4GE7 A;  2VGV A;  3JZL A;  3LV2 A;  4PVF A;  2XH1 A;  2C0R A;  3BV0 A;  3GZD A;  4WP0 A;  1ASM A;  3VAX A;  1KKP A;  1GD9 A;  3JU7 A;  1BJN A;  3WKS A;  2E7U A;  4XJL A;  1TOK A;  4Y0D A;  3FCR A;  1QZ9 A;  2QB2 A;  3AV7 A;  4WYD A;  3ZZK A;  4A0G A;  1DJU A;  2R5E A;  3LVJ A;  2HP2 A;  3LVL B;  1DGD A;  4JEV A;  1AKA A;  4IX8 A;  3E2F A;  1AMQ A;  3EZ1 A;  1BJW A;  1M0P A;  2YCT A;  3PD6 A;  4JEX A;  1Y4I A;  2VMO A;  5F9S A;  4WYC A;  1D7U A;  1AMS A;  2FQ6 A;  4U1T A;  1ART A;  1AKC A;  2JG2 A;  2W8U A;  3PIU A;  4B9B A;  2OKJ A;  4BA4 A;  1WYT A;  4W1W A;  4F5H A;  2VMU A;  2ORD A;  2CY8 A;  2WKA A;  1Z7D A;  5HXX A;  1YIY A;  3A9X A;  1W7L A;  3RCH A;  3DZZ A;  2X8U A;  3DC1 A;  3GR9 A;  1B9I A;  1CZE A;  1FG3 A;  3EIA A;  1CQ8 A;  2VMP A;  1AHG A;  4JF0 A;  4N0B A;  3USF A;  1RVU A;  2D64 A;  1DGE A;  4WYF A;  5FT4 A;  3UE8 A;  2D7Z A;  5G2Q A;  5TF5 A;  1CL2 A;  2O7C A;  2YCN A;  3AEJ A;  1EJI A;  2R0T A;  1YOO A;  5DJ9 A;  4LNL A;  3E2Y A;  4AOA A;  4W1V A;  3LY1 A;  3NYU A;  1AHX A;  4IYO B;  5HHY A;  1M0Q A;  1TAS A;  4ZSY A;  1J04 A;  4Y0H A;  2VI9 A;  3ELE A;  3NYS A;  2D65 A;  3DXW A;  4F5F A;  4DGT A;  3AEP A;  4Q75 A;  4OCA A;  2WK7 A;  5G0A A;  3AEL A;  2CST A;  1TOE A;  3BWO A;  3K7Y A;  4EFF A;  1G7X A;  1OHY A;  4WLJ A;  2HUU A;  3EUC A;  3ATH A;  1G4V A;  3BC8 A;  1GC2 A;  1VP4 A;  3GWP A;  3FQ8 A;  2OGA A;  4GDY A;  3BCB A;  4HVK A;  5M49 A;  1ZOB A;  1AMA A;  3MC6 C;  3P1T A;  1WKH A;  3K28 A;  1H1C A;  2AY2 A;  2QA3 A;  3NDN A;  1TAT A;  3ELP A;  4N0W A;  1RV4 A;  4TN4 A;  4CBR A;  1ECX A;  1SZS A;  1WYV A;  4OMA A;  3HLM A;  4P7Y A;  2TPL A;  2OGE A;  2FN6 A;  2X5F A;  4XJM A;  4CVQ A;  1AJS A;  2AY8 A;  2W7M A;  3TAT A;  4F5K A;  8AAT A;  4M2K A;  1H0C A;  3RUY A;  3NX3 A;  3AOV A;  4WYG A;  3R9A A;  1ASL A;  2VIA A;  1GDE A;  4JEY A;  2Q7W A;  1KMJ A;  1ASA A;  1YJZ A;  2ZSM A;  4RKD A;  2D61 A;  3I16 A;  1IBJ A;  2R5C A;  1JS3 A;  4XJP A;  3TQX A;  2VMY A;  2BI5 A;  4R5Z A;  2VLF A;  5BJ3 A;  2YHK A;  2EZ2 A;  5DX5 A;  4ZWV A;  1S0A A;  4CXQ A;  3W1I A;  3GSB A;  1XI9 A;  3H14 A;  4PFF A;  5G4I A;  4EMY A;  2VMW A;  1M0N A;  3WGB A;  4K2I A;  4AH3 A;  3GZC A;  4UHN A;  3WY7 A;  2AY5 A;  3LVM A;  3G0T A;  4NOG A;  3PDB B;  2X3L A;  3NTJ A;  3PAA A;  4IY7 A;  4TV7 A;  4RM1 A;  3BS8 A;  4WXG A;  1GCK A;  5EQC A;  3CQ6 A;  3FDB A;  4ZLV A;  1AIB A;  3EI5 A;  4FL0 A;  1ASF A;  3A9Y A;  3ASB A;  1C7N A;  5E3K A;  3LWS A;  3COG A;  1C4K A;  2VGS A;  3GBX A;  3ISL A;  4ADE A;  1OXO A;  3NUB A;  4A6R A;  1BT4 A;  4W8I A;  5DB5 A;  1CS1 A;  1I29 A;  2AY4 A;  2JJE A;  4Q31 A;  1AJR A;  2BWN A;  2CJD A;  3MAF A;  2WK8 A;  3PA9 A;  1PMO A;  1O62 A;  3ACZ A;  1C0N A;  3A9Z A;  3AEO A;  1WYU A;  3HQT A;  2CJH A;  4RIZ A;  3A2B A;  3CQ4 A;  1X2A A;  1X0M A;  4EB7 A;  1GC4 A;  2V1P A;  3GZD C;  3I4J A;  2HOZ A;  4ZWM A;  5JAY A;  3QI6 A;  5FT6 A;  2JJF A;  3E6G A;  4CXR A;  4F5J A;  1KL1 A;  1BJO A;  3FDD A;  2BYL A;  4IW7 A;  2RFV A;  3BN1 A;  3KE3 A;  4E77 A;  2ZP7 A;  1D7S A;  1IAX A;  2ZJG A;  3DU4 A;  4WBT A;  3FVU A;  3BWN A;  1FC4 A;  5LHA A;  2VI8 A;  4LC3 A;  3W1H A;  5LH9 A;  2CFB A;  2QMA A;  1AIC A;  2JIS A;  1G4X A;  4Q76 A;  1OHV A;  1RVY A;  3UWC A;  1CQ6 A;  2Z20 A;  2HOR A;  4Q6R A;  1N8P A;  2GSA A;  1ASG A;  1YJS A;  2W7G A;  2VYC A;  1WYT B;  2X5D A;  5E5I A;  4OBV A;  1KMK A;  1LC7 A;  2CH1 A;  2AEU A;  3HVY A;  1B5O A;  2DGL A;  3ECD A;  1SZK A;  4OBU A;  4OC9 A;  3RCH B;  3EZS A;  4ZM3 A;  1AHF A;  1EQB A;  1S08 A;  3NU8 A;  2OQX A;  1UU1 A;  1CL1 A;  2OKK A;  1AY8 A;  3JTX A;  1TOJ A;  2AY7 A;  4MKJ A;  4F5I A;  3N5M A;  1SVV A;  2Z1Z A;  3VK2 A;  3AEJ C;  1QIS A;  1YIZ A;  1IJI A;  1N31 A;  5IWQ A;  4OYT A;  3LVK A;  2HZP A;  2YOB A;  1TOG A;  2G6W A;  3NYT A;  1V2F A;  4K2B A;  1DKA A;  5EIG A;  1BS0 A;  3ZRP A;  3N75 A;  2HOX A;  2D7Y A;  2Z61 A;  2EO5 A;  1I41 A;  2VIB A;  2JGT A;  2PO3 A;  3HBX A;  2BWO A;  2VMS A;  1V72 A;  4GE4 A;  4MQR A;  1VEF A;  4GRX A;  1S07 A;  2VGZ A;  2W7I A;  3IHJ A;  3L8A A;  3VOM A;  4AZK A;  3OKS A;  4R5F A;  2HUI A;  2W7D A;  2HOY A;  5EUD A;  1VJO A;  2W8T A;  1W7M A;  2GQN A;  4Y0I A;  4LW4 A;  4IXZ A;  1AHY A;  3WCN A;  4A0F A;  1AX4 A;  4WLH A;  3JW9 A;  1M6S A;  2VMR A;  1ELU A;  2VMT A;  4ZSW A;  1I48 A;  2YCP A;  3FFH A;  1ARS A;  3R4T A;  4MGR A;  4WXB A;  3WX9 A;  5D5S A;  1IX6 A;  4M2M A;  5M46 A;  4ADB A;  2HUF A;  4ITX A;  3PJ0 A;  1E5F A;  3E2Z B;  3I5T A;  4BMK A;  4FFC A;  4F5M A;  4WB0 B;  4DQ6 A;  4ZDL A;  1ORD A;  1MDZ A;  1GC0 A;  2Z1Y A;  5EUE A;  3WGC A;  4ADD A;  2BYJ A;  1JF9 A;  1KL2 A;  4BHD A;  1IAY A;  1LW5 A;  4OT8 A;  2VMZ A;  3H7F A;  4A72 A;  1S06 A;  1OXP A;  2VGW A;  5FT8 A;  1MGV A;  2D5Y A;  3KKI A;  4DBC A;  1LW4 A;  1ASE A;  3WCO A;  5M4B A;  2GMU A;  3TCM A;  2C81 A;  4OTL A;  9AAT A;  2ZYJ A;  1QJ5 A;  4BA5 A;  3FSL A;  2NMP A;  2CAN A;  3PDX A;  4W5K A;  2BI3 A;  4A00 A;  2CH2 A;  2XBN A;  3N0L A;  3T32 A;  3QM2 A;  1OAT A;  3ZRR A;  1LKC A;  4PIW A;  3II0 A;  1ARH A;  4ATP A;  2CTZ A;  1GEX A;  4WXF A;  3RBL A;  4ZM4 A;  5I92 A;  1CJ0 A;  3FZ8 A;  5EUN A;  3WKR A;  1RV3 A;  4A0H A;  1AAM A;  3B1D A;  4M2J A;  2JJG A;  2HP1 A;  3FZ7 A;  3FD0 A;  2CIN A;  1B4X A;  1T3I A;  1QGN A;  1V2E A;  2WK9 A;  5BJ4 A;  3DXV A;  5DJ1 A;  2FNU A;  4E3Q A;  1S09 A;  5G2P A;  1PG8 A;  2EZ1 A;  1GC3 A;  4CBS A;  2W7J A;  1BJ4 A;  2Z9X A;  3DRD A;  2Z67 A;  1ZOD A;  1WYU B;  2QB3 A;  4E1O A;  4JEW A;  4ADC A;  1M4N A;  3AEM A;  3MKJ A;  4I8A A;  4K2M A;  5J8Q A;  4JF1 A;  1QIT A;  4ZDP A;  1EG5 A;  4ZAS A;  3CBF A;  2FYF A;  1O69 A;  5D95 A;  5AX8 A;  1SPA A;  1MAP A;  4MKK A;  1BJO B;  1AY5 A;  1I43 A;  3D6K A;  4MQQ A;  1O61 A;  1M0O A;  1P3W A;  1X28 A;  4W1X A;  3HT4 A;  1O4S A;  2PB0 A;  2VGU A;  3FVX A;  4UHM A;  1AAW A;  3TFU A;  1B8G A;  2F8J A;  2DKB A;  1ASN A;  3EI8 A;  3EI9 A;  3FZ6 A;  3PPL A;  3KGW A;  1W23 A;  3BWN C;  4RJ0 A;  3UAK A;  4L0O A;  1SFF A;  1GBN A;  2E54 A;  2YKX A;  2C7T A;  3E9K A;  3L44 A;  3PD6 B;  4UOY A;  3QGU A;  3B46 A;  4RLG A;  4WYA A;  4XK1 A;  2Z9W A;  4HF8 A;  3VK3 A;  3W1J A;  3AEN A;  2BIA A;  3ZZJ A;  1C7G A;  1M7Y A;  2ZSL A;  2GB3 A;  1FG7 A;  3IF2 A;  3P6K A;  2VMX A;  2GMS A;  1YAA A;  2ZY5 A;  1IUG A;  1WKG A;  3EI7 A;  3QHX A;  3FKD A;  3FVS A;  1JS6 A;  3G7Q A;  2E7I A;  3A8U X;  1LC5 A;  5EAA A;  2AEV A;  2VMQ A;  1GEY A;  2ZC0 A;  3EI6 A;  1X29 A;  2AY9 A;  4LNJ A;  1QJ3 A;  3Q8N A;  2YRR A;  4R2N A;  1BW0 A;  3RI6 A;  4IXO A;  1D2F A;  3OP7 A;  1UKJ A;  1AIA A;  4GEB A;  4A6U A;  4TMR A;  4ZAH A;  2D66 A;  4A6T A;  2DR1 A;  1LK9 A;  5EIG B;  3EIB A;  4W91 A;  2O1B A;  4XAU A;  1IX7 A;  3HDO A;  2AAT A;  2W8V A;  4BQ0 A;  1ASB A;  5M4D A;  1TPL A;  4ITG A;  2V0Y A;  4E3R A;  1TOI A;  2BI1 A;  4RAE A;  3PGY A;  4F4E A;  2BHX A;  4WYE A;  3BB8 A;  4H51 A;  2W7H A;  1ARI A;  4F5L A;  2W8J A;  3DYD A;  3F6T A;  1AY4 A;  1YNU A;  3K40 A;  1BQA A;  1ELQ A;  4J5U A;  4ATQ A;  2R2N A;  1B9H A;  1LC8 A;  1XEY A;  2EPJ A;  2VMN A;  4GSA A;  4RKC A;  3JWB A;  4JE5 D;  4JEZ A;  5EFS A;  1M32 A;  4LW2 A;  4P3M A;  1DTY A;  1V2D A;  1SZU A;  2AY1 A;  4MY5 A;  1MLZ A;  1UU2 A;  1WYV B;  3HMU A;  1D7V A;  1QIR A;  5HDM A;  4XEW A;  1DJE A;  3E77 A;  4IYO A;  3MBB A;  3ASA A;  5EAV A;  1D7R A;  1AJS B;  3DR4 A;  1ARG A;  4AZJ A;  1WST A;  4F5G A;  3AAT A;  2PB2 A;  4XJO A;  1AHE A;  3B8X A;  4EU1 A;  1KKJ A;  1C9C A;  1MLY A;  2R5C B;  3NRA A;  4MSO A;  1DFO A;  4RIT A;  3FQA A;  1OHW A;  3BCX A;  2W7K A;  3WLX A;  1AMR A;  7AAT A;  2ZY4 A;  4GE9 A;  2DGM A;  3F0H A;  2W7F A;  1W3U A;  2DGK A;  2ZY2 A;  2YKY A;  1SF2 A;  3CQ5 A;  4RJY A;  1CZC A;  3MC6 A;  4AO4 A;  1JG8 A;  1MAQ A;  3QN6 A;  2VLH A;  1AKB A;  2Z9V A;  2AY3 A;  3TFT A;  3ZRQ A;  3JWA A;  3KGX A;  4AO9 A;  2YRI A;  1C7O A;  1DJ9 A;  3G8M A;  2FM1 A;  1CQ7 A;  1G7W A;  4B98 A;  2AY6 A;  2JJH A;  4JE5 A;  4EB5 A;  2BI2 A;  3E2Z A;  1IVR A;  4WB0 A;  5E4Z A;  2W7E A;  3B1C A;  4LNM A;  1E5E A;  3GET A;  3FFR A;  1PMM A;  2VGT A;  1GEW A;  3RQ1 A; 
#chains in the Genus database with same CATH topology
 4KYO A;  3LG0 A;  5FT5 A;  1W7N A;  2ZUK A;  2BKW A;  1J32 A;  4KAM A;  4MQP A;  1ASD A;  1ASC A;  2Z9U A;  2BWP A;  2FNI A;  2W8W A;  3AOW A;  3FQ7 A;  3MEB A;  4J8L A;  3NNK A;  5G4J A;  2ZY3 A;  3QPG A;  1IX8 A;  2OAT A;  2C44 A;  5C6U A;  2QBT A;  2YKV A;  2D63 A;  4WD2 A;  1BKG A;  1B5P A;  1MDX A;  2QLR A;  3DOD A;  3DR7 A;  4QGR A;  3FTB A;  1MDO A;  2EH6 A;  3F9T A;  3MAF B;  4A0R A;  3CAI A;  3PDB A;  4U2H A;  3RBF A;  2BIG A;  3GJU A;  5G09 A;  4KXK A;  3B1E A;  3FRK A;  1BQD A;  2DOU A;  4ISY A;  2FKI A;  3AEM C;  2E7J A;  3HL2 A;  5K8B A;  1N2T A;  3NUI A;  1LS3 A;  4PFN A;  4ZDO A;  1TAR A;  4R8D A;  3WZF A;  3MAD A;  2CJG A;  4IXS A;  5F8V A;  4O6Z A;  3N7N A;  3VP6 A;  4H63 Q;  1YJY A;  3BCA A;  1U08 A;  2EGY A;  2BI9 A;  4XQ2 A;  1PFF A;  2BIE A;  3VK4 A;  1UU0 A;  4UQV A;  2CB1 A;  3MAU A;  3NU7 A;  4UHO A;  3M5U A;  2W7L A;  3QBO A;  2O0R A;  2YKU A;  2VMV A;  2DKJ A;  1ZC9 A;  3AEN B;  1Z3Z A;  4GE7 A;  2KFP A;  2VGV A;  3N4X A;  3JZL A;  3LV2 A;  4PVF A;  2XH1 A;  2C0R A;  3BV0 A;  3GZD A;  4WP0 A;  1ASM A;  3VAX A;  1KKP A;  1GD9 A;  3JU7 A;  1BJN A;  3WKS A;  2E7U A;  4XJL A;  1TOK A;  4Y0D A;  3FCR A;  1QZ9 A;  2QB2 A;  3AV7 A;  4WYD A;  3ZZK A;  4A0G A;  1DJU A;  2R5E A;  3LVJ A;  2HP2 A;  3LVL B;  1DGD A;  4JEV A;  1AKA A;  4IX8 A;  3E2F A;  1AMQ A;  3EZ1 A;  1BJW A;  1M0P A;  2YCT A;  3PD6 A;  4JEX A;  1Y4I A;  2VMO A;  5F9S A;  4WYC A;  1D7U A;  1AMS A;  2FQ6 A;  4U1T A;  1ART A;  1AKC A;  2JG2 A;  2W8U A;  3PIU A;  4B9B A;  2OKJ A;  4BA4 A;  1WYT A;  4W1W A;  4F5H A;  2VMU A;  2ORD A;  2CY8 A;  2WKA A;  1Z7D A;  5HXX A;  1YIY A;  3A9X A;  1W7L A;  3RCH A;  3DZZ A;  2X8U A;  3DC1 A;  3GR9 A;  1B9I A;  1CZE A;  1FG3 A;  3EIA A;  1CQ8 A;  2VMP A;  1AHG A;  4JF0 A;  4N0B A;  3USF A;  1RVU A;  2D64 A;  1DGE A;  4WYF A;  5FT4 A;  3UE8 A;  2D7Z A;  5G2Q A;  5TF5 A;  1CL2 A;  2O7C A;  2YCN A;  3AEJ A;  1EJI A;  2R0T A;  1YOO A;  5DJ9 A;  4LNL A;  3E2Y A;  4AOA A;  4W1V A;  3LY1 A;  3NYU A;  1AHX A;  4IYO B;  5HHY A;  1M0Q A;  1TAS A;  4ZSY A;  1J04 A;  4Y0H A;  2VI9 A;  3ELE A;  3NYS A;  2D65 A;  3DXW A;  4F5F A;  4DGT A;  3AEP A;  4Q75 A;  4OCA A;  2WK7 A;  5G0A A;  3AEL A;  2CST A;  1TOE A;  3BWO A;  3K7Y A;  4EFF A;  1G7X A;  1OHY A;  4WLJ A;  2HUU A;  3EUC A;  3ATH A;  1G4V A;  3BC8 A;  1GC2 A;  1VP4 A;  3GWP A;  3FQ8 A;  2OGA A;  4GDY A;  3BCB A;  4HVK A;  5M49 A;  1ZOB A;  1AMA A;  3MC6 C;  3P1T A;  1WKH A;  3K28 A;  1H1C A;  2AY2 A;  2QA3 A;  3NDN A;  1TAT A;  3ELP A;  4N0W A;  1RV4 A;  4TN4 A;  4CBR A;  1ECX A;  1SZS A;  1WYV A;  4OMA A;  3HLM A;  4P7Y A;  2TPL A;  2OGE A;  2FN6 A;  2X5F A;  4XJM A;  4CVQ A;  1AJS A;  2AY8 A;  2W7M A;  3TAT A;  4F5K A;  8AAT A;  4M2K A;  1H0C A;  3RUY A;  3NX3 A;  3AOV A;  4WYG A;  3R9A A;  1ASL A;  2VIA A;  1GDE A;  4JEY A;  2Q7W A;  1KMJ A;  1ASA A;  1YJZ A;  2ZSM A;  4RKD A;  2D61 A;  3I16 A;  2EYQ A;  1IBJ A;  2R5C A;  1JS3 A;  4XJP A;  3TQX A;  2VMY A;  2BI5 A;  4R5Z A;  2VLF A;  5BJ3 A;  2YHK A;  2EZ2 A;  5DX5 A;  4ZWV A;  1S0A A;  4CXQ A;  3W1I A;  3GSB A;  1XI9 A;  3H14 A;  4PFF A;  5G4I A;  4EMY A;  2VMW A;  3H9X A;  1M0N A;  3WGB A;  4K2I A;  4AH3 A;  3GZC A;  4UHN A;  3WY7 A;  2AY5 A;  3LVM A;  3G0T A;  4NOG A;  3PDB B;  2X3L A;  3NTJ A;  3PAA A;  4IY7 A;  4TV7 A;  4RM1 A;  3BS8 A;  4WXG A;  1GCK A;  5EQC A;  3CQ6 A;  3FDB A;  4ZLV A;  1AIB A;  3EI5 A;  4FL0 A;  1ASF A;  3A9Y A;  3ASB A;  1C7N A;  5E3K A;  3LWS A;  3COG A;  1C4K A;  2VGS A;  3GBX A;  3ISL A;  4ADE A;  1OXO A;  3NUB A;  4A6R A;  1BT4 A;  4W8I A;  5DB5 A;  1CS1 A;  1I29 A;  2AY4 A;  2JJE A;  4Q31 A;  2A1V A;  1AJR A;  2BWN A;  2CJD A;  3MAF A;  2WK8 A;  3PA9 A;  1PMO A;  1O62 A;  3ACZ A;  1C0N A;  3A9Z A;  3AEO A;  1WYU A;  3HQT A;  2CJH A;  4RIZ A;  3A2B A;  3CQ4 A;  1X2A A;  1X0M A;  4EB7 A;  1GC4 A;  2V1P A;  3GZD C;  3I4J A;  2HOZ A;  4ZWM A;  5JAY A;  3QI6 A;  5FT6 A;  2JJF A;  3E6G A;  4CXR A;  4F5J A;  1KL1 A;  1BJO A;  3FDD A;  2BYL A;  4IW7 A;  2RFV A;  3BN1 A;  3KE3 A;  4E77 A;  2ZP7 A;  1D7S A;  1IAX A;  2ZJG A;  3DU4 A;  4WBT A;  3FVU A;  3BWN A;  1FC4 A;  5LHA A;  2VI8 A;  4LC3 A;  3W1H A;  5LH9 A;  2CFB A;  2QMA A;  1AIC A;  2JIS A;  1G4X A;  4Q76 A;  1OHV A;  1RVY A;  3UWC A;  1CQ6 A;  2Z20 A;  2HOR A;  4Q6R A;  1N8P A;  2GSA A;  1ASG A;  1YJS A;  2W7G A;  2VYC A;  1WYT B;  2X5D A;  5E5I A;  4OBV A;  1KMK A;  1LC7 A;  2CH1 A;  4K05 A;  2AEU A;  3HVY A;  1B5O A;  2DGL A;  3ECD A;  1SZK A;  4OBU A;  4OC9 A;  3RCH B;  3EZS A;  4ZM3 A;  1AHF A;  1EQB A;  1S08 A;  3NU8 A;  2OQX A;  1UU1 A;  1CL1 A;  2OKK A;  1AY8 A;  3JTX A;  1TOJ A;  2AY7 A;  4MKJ A;  3N4S A;  4F5I A;  3N5M A;  1SVV A;  2Z1Z A;  3VK2 A;  3AEJ C;  1QIS A;  1YIZ A;  1IJI A;  1N31 A;  5IWQ A;  4OYT A;  3LVK A;  2HZP A;  2YOB A;  1TOG A;  2G6W A;  3NYT A;  1V2F A;  4K2B A;  1DKA A;  5EIG A;  1BS0 A;  3ZRP A;  3N75 A;  2HOX A;  2D7Y A;  2Z61 A;  2EO5 A;  1I41 A;  2VIB A;  2JGT A;  2PO3 A;  3HBX A;  2BWO A;  2VMS A;  1V72 A;  4GE4 A;  4MQR A;  1VEF A;  4GRX A;  1S07 A;  2VGZ A;  2W7I A;  3IHJ A;  3L8A A;  3VOM A;  4AZK A;  3OKS A;  4R5F A;  2HUI A;  2W7D A;  2HOY A;  5EUD A;  1VJO A;  2W8T A;  1W7M A;  2GQN A;  4Y0I A;  4LW4 A;  4IXZ A;  1AHY A;  3WCN A;  4A0F A;  1AX4 A;  4WLH A;  3JW9 A;  1M6S A;  2VMR A;  1ELU A;  2VMT A;  4ZSW A;  1I48 A;  2YCP A;  3FFH A;  1ARS A;  3R4T A;  4MGR A;  4WXB A;  3WX9 A;  5D5S A;  1IX6 A;  4M2M A;  5M46 A;  4ADB A;  2HUF A;  4ITX A;  3PJ0 A;  1E5F A;  3E2Z B;  3I5T A;  4BMK A;  4FFC A;  4F5M A;  4WB0 B;  4DQ6 A;  4ZDL A;  1ORD A;  1MDZ A;  1GC0 A;  2Z1Y A;  5EUE A;  3WGC A;  4ADD A;  2BYJ A;  1JF9 A;  1KL2 A;  4BHD A;  1IAY A;  1LW5 A;  4OT8 A;  2G7J A;  2VMZ A;  3H7F A;  4A72 A;  1S06 A;  1OXP A;  2VGW A;  5FT8 A;  1MGV A;  2D5Y A;  3KKI A;  4DBC A;  1LW4 A;  1ASE A;  3WCO A;  5M4B A;  2GMU A;  3TCM A;  2C81 A;  4OTL A;  9AAT A;  2ZYJ A;  1QJ5 A;  4BA5 A;  3FSL A;  2NMP A;  2CAN A;  3PDX A;  4W5K A;  2BI3 A;  4A00 A;  2CH2 A;  2XBN A;  3N0L A;  3T32 A;  3QM2 A;  1OAT A;  3ZRR A;  1LKC A;  4PIW A;  3II0 A;  1ARH A;  4ATP A;  2CTZ A;  1GEX A;  4WXF A;  3RBL A;  4ZM4 A;  5I92 A;  1CJ0 A;  3FZ8 A;  5EUN A;  3WKR A;  1RV3 A;  4A0H A;  1AAM A;  3B1D A;  4M2J A;  2JJG A;  2HP1 A;  3FZ7 A;  3FD0 A;  2CIN A;  1B4X A;  1T3I A;  1QGN A;  1V2E A;  2WK9 A;  5BJ4 A;  3DXV A;  5DJ1 A;  2FNU A;  4E3Q A;  1S09 A;  5G2P A;  1PG8 A;  2EZ1 A;  5KTB A;  1GC3 A;  4CBS A;  2W7J A;  1BJ4 A;  2Z9X A;  3DRD A;  2Z67 A;  1ZOD A;  1WYU B;  2QB3 A;  4E1O A;  4JEW A;  4ADC A;  1M4N A;  3AEM A;  3MKJ A;  4I8A A;  4K2M A;  5J8Q A;  4JF1 A;  1QIT A;  4ZDP A;  1EG5 A;  4ZAS A;  3CBF A;  2FYF A;  1O69 A;  5D95 A;  5AX8 A;  1SPA A;  1MAP A;  4MKK A;  1BJO B;  1AY5 A;  1I43 A;  3D6K A;  4MQQ A;  1O61 A;  1M0O A;  1P3W A;  1X28 A;  4W1X A;  3HT4 A;  1O4S A;  2PB0 A;  2VGU A;  3FVX A;  4UHM A;  1AAW A;  3TFU A;  1B8G A;  2F8J A;  2DKB A;  1ASN A;  3EI8 A;  3EI9 A;  3FZ6 A;  3PPL A;  3KGW A;  1W23 A;  3BWN C;  4RJ0 A;  3UAK A;  4L0O A;  1SFF A;  1GBN A;  2E54 A;  2YKX A;  2C7T A;  3E9K A;  3L44 A;  3PD6 B;  4UOY A;  3QGU A;  3B46 A;  4RLG A;  4WYA A;  4XK1 A;  2Z9W A;  4HF8 A;  3VK3 A;  3W1J A;  3AEN A;  2BIA A;  3ZZJ A;  1C7G A;  1M7Y A;  2ZSL A;  2GB3 A;  1FG7 A;  3IF2 A;  3P6K A;  2VMX A;  2GMS A;  1KAF A;  1YAA A;  2ZY5 A;  1IUG A;  1WKG A;  3EI7 A;  3QHX A;  3FKD A;  3FVS A;  1JS6 A;  3G7Q A;  2E7I A;  3A8U X;  1LC5 A;  5EAA A;  2AEV A;  2VMQ A;  1GEY A;  2ZC0 A;  3EI6 A;  1X29 A;  2AY9 A;  4LNJ A;  1QJ3 A;  3Q8N A;  2YRR A;  4R2N A;  1BW0 A;  3RI6 A;  4IXO A;  1D2F A;  3OP7 A;  1UKJ A;  1AIA A;  4GEB A;  4A6U A;  4TMR A;  4ZAH A;  2D66 A;  4A6T A;  2DR1 A;  1LK9 A;  5EIG B;  3EIB A;  4W91 A;  2O1B A;  4XAU A;  1IX7 A;  3HDO A;  2AAT A;  2W8V A;  4BQ0 A;  1ASB A;  5M4D A;  1TPL A;  4ITG A;  2V0Y A;  4E3R A;  1TOI A;  2BI1 A;  4RAE A;  3PGY A;  4F4E A;  2BHX A;  4WYE A;  3BB8 A;  4H51 A;  2W7H A;  1ARI A;  4F5L A;  2W8J A;  3DYD A;  3F6T A;  1AY4 A;  1YNU A;  3K40 A;  1BQA A;  1ELQ A;  4J5U A;  4ATQ A;  2R2N A;  1B9H A;  1LC8 A;  1XEY A;  2EPJ A;  2VMN A;  4GSA A;  4RKC A;  3JWB A;  4JE5 D;  4JEZ A;  5EFS A;  1M32 A;  4LW2 A;  4P3M A;  1DTY A;  1V2D A;  1SZU A;  2AY1 A;  4MY5 A;  1MLZ A;  1UU2 A;  1WYV B;  3HMU A;  2WB6 A;  1D7V A;  1QIR A;  5HDM A;  4XEW A;  1DJE A;  3E77 A;  4IYO A;  3MBB A;  3ASA A;  5EAV A;  1D7R A;  1AJS B;  3DR4 A;  1ARG A;  4AZJ A;  1WST A;  4F5G A;  2QSR A;  3AAT A;  2PB2 A;  4XJO A;  1AHE A;  3B8X A;  4EU1 A;  1KKJ A;  1C9C A;  1MLY A;  2R5C B;  3NRA A;  4MSO A;  1DFO A;  4RIT A;  3FQA A;  1OHW A;  3BCX A;  2W7K A;  3WLX A;  1AMR A;  7AAT A;  2ZY4 A;  4GE9 A;  2DGM A;  3F0H A;  2W7F A;  1W3U A;  2DGK A;  2ZY2 A;  2YKY A;  1SF2 A;  3N4R A;  3CQ5 A;  4RJY A;  1CZC A;  3MC6 A;  4AO4 A;  1JG8 A;  1MAQ A;  3QN6 A;  2VLH A;  1AKB A;  2Z9V A;  2AY3 A;  3TFT A;  3ZRQ A;  3JWA A;  3KGX A;  4AO9 A;  2YRI A;  1C7O A;  1DJ9 A;  3G8M A;  2FM1 A;  1CQ7 A;  1G7W A;  4B98 A;  2AY6 A;  2JJH A;  4JE5 A;  4EB5 A;  2BI2 A;  3E2Z A;  1IVR A;  4WB0 A;  5E4Z A;  2W7E A;  3B1C A;  4LNM A;  1E5E A;  3GET A;  3FFR A;  1PMM A;  2VGT A;  1GEW A;  3RQ1 A; 
#chains in the Genus database with same CATH homology
 4KYO A;  3LG0 A;  5FT5 A;  1W7N A;  2ZUK A;  2BKW A;  1J32 A;  4KAM A;  4MQP A;  1ASD A;  1ASC A;  2Z9U A;  2BWP A;  2FNI A;  2W8W A;  3AOW A;  3FQ7 A;  3MEB A;  4J8L A;  3NNK A;  5G4J A;  2ZY3 A;  3QPG A;  1IX8 A;  2OAT A;  2C44 A;  5C6U A;  2QBT A;  2YKV A;  2D63 A;  4WD2 A;  1BKG A;  1B5P A;  1MDX A;  2QLR A;  3DOD A;  3DR7 A;  4QGR A;  3FTB A;  1MDO A;  2EH6 A;  3F9T A;  3MAF B;  4A0R A;  3CAI A;  3PDB A;  4U2H A;  3RBF A;  2BIG A;  3GJU A;  5G09 A;  4KXK A;  3B1E A;  3FRK A;  1BQD A;  2DOU A;  4ISY A;  2FKI A;  3AEM C;  2E7J A;  3HL2 A;  5K8B A;  1N2T A;  3NUI A;  1LS3 A;  4PFN A;  4ZDO A;  1TAR A;  4R8D A;  3WZF A;  3MAD A;  2CJG A;  4IXS A;  5F8V A;  4O6Z A;  3N7N A;  3VP6 A;  4H63 Q;  1YJY A;  3BCA A;  1U08 A;  2EGY A;  2BI9 A;  4XQ2 A;  1PFF A;  2BIE A;  3VK4 A;  1UU0 A;  4UQV A;  2CB1 A;  3MAU A;  3NU7 A;  4UHO A;  3M5U A;  2W7L A;  3QBO A;  2O0R A;  2YKU A;  2VMV A;  2DKJ A;  1ZC9 A;  3AEN B;  1Z3Z A;  4GE7 A;  2KFP A;  2VGV A;  3N4X A;  3JZL A;  3LV2 A;  4PVF A;  2XH1 A;  2C0R A;  3BV0 A;  3GZD A;  4WP0 A;  1ASM A;  3VAX A;  1KKP A;  1GD9 A;  3JU7 A;  1BJN A;  3WKS A;  2E7U A;  4XJL A;  1TOK A;  4Y0D A;  3FCR A;  1QZ9 A;  2QB2 A;  3AV7 A;  4WYD A;  3ZZK A;  4A0G A;  1DJU A;  2R5E A;  3LVJ A;  2HP2 A;  3LVL B;  1DGD A;  4JEV A;  1AKA A;  4IX8 A;  3E2F A;  1AMQ A;  3EZ1 A;  1BJW A;  1M0P A;  2YCT A;  3PD6 A;  4JEX A;  1Y4I A;  2VMO A;  5F9S A;  4WYC A;  1D7U A;  1AMS A;  2FQ6 A;  4U1T A;  1ART A;  1AKC A;  2JG2 A;  2W8U A;  3PIU A;  4B9B A;  2OKJ A;  4BA4 A;  1WYT A;  4W1W A;  4F5H A;  2VMU A;  2ORD A;  2CY8 A;  2WKA A;  1Z7D A;  5HXX A;  1YIY A;  3A9X A;  1W7L A;  3RCH A;  3DZZ A;  2X8U A;  3DC1 A;  3GR9 A;  1B9I A;  1CZE A;  1FG3 A;  3EIA A;  1CQ8 A;  2VMP A;  1AHG A;  4JF0 A;  4N0B A;  3USF A;  1RVU A;  2D64 A;  1DGE A;  4WYF A;  5FT4 A;  3UE8 A;  2D7Z A;  5G2Q A;  5TF5 A;  1CL2 A;  2O7C A;  2YCN A;  3AEJ A;  1EJI A;  2R0T A;  1YOO A;  5DJ9 A;  4LNL A;  3E2Y A;  4AOA A;  4W1V A;  3LY1 A;  3NYU A;  1AHX A;  4IYO B;  5HHY A;  1M0Q A;  1TAS A;  4ZSY A;  1J04 A;  4Y0H A;  2VI9 A;  3ELE A;  3NYS A;  2D65 A;  3DXW A;  4F5F A;  4DGT A;  3AEP A;  4Q75 A;  4OCA A;  2WK7 A;  5G0A A;  3AEL A;  2CST A;  1TOE A;  3BWO A;  3K7Y A;  4EFF A;  1G7X A;  1OHY A;  4WLJ A;  2HUU A;  3EUC A;  3ATH A;  1G4V A;  3BC8 A;  1GC2 A;  1VP4 A;  3GWP A;  3FQ8 A;  2OGA A;  4GDY A;  3BCB A;  4HVK A;  5M49 A;  1ZOB A;  1AMA A;  3MC6 C;  3P1T A;  1WKH A;  3K28 A;  1H1C A;  2AY2 A;  2QA3 A;  3NDN A;  1TAT A;  3ELP A;  4N0W A;  1RV4 A;  4TN4 A;  4CBR A;  1ECX A;  1SZS A;  1WYV A;  4OMA A;  3HLM A;  4P7Y A;  2TPL A;  2OGE A;  2FN6 A;  2X5F A;  4XJM A;  4CVQ A;  1AJS A;  2AY8 A;  2W7M A;  3TAT A;  4F5K A;  8AAT A;  4M2K A;  1H0C A;  3RUY A;  3NX3 A;  3AOV A;  4WYG A;  3R9A A;  1ASL A;  2VIA A;  1GDE A;  4JEY A;  2Q7W A;  1KMJ A;  1ASA A;  1YJZ A;  2ZSM A;  4RKD A;  2D61 A;  3I16 A;  2EYQ A;  1IBJ A;  2R5C A;  1JS3 A;  4XJP A;  3TQX A;  2VMY A;  2BI5 A;  4R5Z A;  2VLF A;  5BJ3 A;  2YHK A;  2EZ2 A;  5DX5 A;  4ZWV A;  1S0A A;  4CXQ A;  3W1I A;  3GSB A;  1XI9 A;  3H14 A;  4PFF A;  5G4I A;  4EMY A;  2VMW A;  3H9X A;  1M0N A;  3WGB A;  4K2I A;  4AH3 A;  3GZC A;  4UHN A;  3WY7 A;  2AY5 A;  3LVM A;  3G0T A;  4NOG A;  3PDB B;  2X3L A;  3NTJ A;  3PAA A;  4IY7 A;  4TV7 A;  4RM1 A;  3BS8 A;  4WXG A;  1GCK A;  5EQC A;  3CQ6 A;  3FDB A;  4ZLV A;  1AIB A;  3EI5 A;  4FL0 A;  1ASF A;  3A9Y A;  3ASB A;  1C7N A;  5E3K A;  3LWS A;  3COG A;  1C4K A;  2VGS A;  3GBX A;  3ISL A;  4ADE A;  1OXO A;  3NUB A;  4A6R A;  1BT4 A;  4W8I A;  5DB5 A;  1CS1 A;  1I29 A;  2AY4 A;  2JJE A;  4Q31 A;  2A1V A;  1AJR A;  2BWN A;  2CJD A;  3MAF A;  2WK8 A;  3PA9 A;  1PMO A;  1O62 A;  3ACZ A;  1C0N A;  3A9Z A;  3AEO A;  1WYU A;  3HQT A;  2CJH A;  4RIZ A;  3A2B A;  3CQ4 A;  1X2A A;  1X0M A;  4EB7 A;  1GC4 A;  2V1P A;  3GZD C;  3I4J A;  2HOZ A;  4ZWM A;  5JAY A;  3QI6 A;  5FT6 A;  2JJF A;  3E6G A;  4CXR A;  4F5J A;  1KL1 A;  1BJO A;  3FDD A;  2BYL A;  4IW7 A;  2RFV A;  3BN1 A;  3KE3 A;  4E77 A;  2ZP7 A;  1D7S A;  1IAX A;  2ZJG A;  3DU4 A;  4WBT A;  3FVU A;  3BWN A;  1FC4 A;  5LHA A;  2VI8 A;  4LC3 A;  3W1H A;  5LH9 A;  2CFB A;  2QMA A;  1AIC A;  2JIS A;  1G4X A;  4Q76 A;  1OHV A;  1RVY A;  3UWC A;  1CQ6 A;  2Z20 A;  2HOR A;  4Q6R A;  1N8P A;  2GSA A;  1ASG A;  1YJS A;  2W7G A;  2VYC A;  1WYT B;  2X5D A;  5E5I A;  4OBV A;  1KMK A;  1LC7 A;  2CH1 A;  4K05 A;  2AEU A;  3HVY A;  1B5O A;  2DGL A;  3ECD A;  1SZK A;  4OBU A;  4OC9 A;  3RCH B;  3EZS A;  4ZM3 A;  1AHF A;  1EQB A;  1S08 A;  3NU8 A;  2OQX A;  1UU1 A;  1CL1 A;  2OKK A;  1AY8 A;  3JTX A;  1TOJ A;  2AY7 A;  4MKJ A;  3N4S A;  4F5I A;  3N5M A;  1SVV A;  2Z1Z A;  3VK2 A;  3AEJ C;  1QIS A;  1YIZ A;  1IJI A;  1N31 A;  5IWQ A;  4OYT A;  3LVK A;  2HZP A;  2YOB A;  1TOG A;  2G6W A;  3NYT A;  1V2F A;  4K2B A;  1DKA A;  5EIG A;  1BS0 A;  3ZRP A;  3N75 A;  2HOX A;  2D7Y A;  2Z61 A;  2EO5 A;  1I41 A;  2VIB A;  2JGT A;  2PO3 A;  3HBX A;  2BWO A;  2VMS A;  1V72 A;  4GE4 A;  4MQR A;  1VEF A;  4GRX A;  1S07 A;  2VGZ A;  2W7I A;  3IHJ A;  3L8A A;  3VOM A;  4AZK A;  3OKS A;  4R5F A;  2HUI A;  2W7D A;  2HOY A;  5EUD A;  1VJO A;  2W8T A;  1W7M A;  2GQN A;  4Y0I A;  4LW4 A;  4IXZ A;  1AHY A;  3WCN A;  4A0F A;  1AX4 A;  4WLH A;  3JW9 A;  1M6S A;  2VMR A;  1ELU A;  2VMT A;  4ZSW A;  1I48 A;  2YCP A;  3FFH A;  1ARS A;  3R4T A;  4MGR A;  4WXB A;  3WX9 A;  5D5S A;  1IX6 A;  4M2M A;  5M46 A;  4ADB A;  2HUF A;  4ITX A;  3PJ0 A;  1E5F A;  3E2Z B;  3I5T A;  4BMK A;  4FFC A;  4F5M A;  4WB0 B;  4DQ6 A;  4ZDL A;  1ORD A;  1MDZ A;  1GC0 A;  2Z1Y A;  5EUE A;  3WGC A;  4ADD A;  2BYJ A;  1JF9 A;  1KL2 A;  4BHD A;  1IAY A;  1LW5 A;  4OT8 A;  2G7J A;  2VMZ A;  3H7F A;  4A72 A;  1S06 A;  1OXP A;  2VGW A;  5FT8 A;  1MGV A;  2D5Y A;  3KKI A;  4DBC A;  1LW4 A;  1ASE A;  3WCO A;  5M4B A;  2GMU A;  3TCM A;  2C81 A;  4OTL A;  9AAT A;  2ZYJ A;  1QJ5 A;  4BA5 A;  3FSL A;  2NMP A;  2CAN A;  3PDX A;  4W5K A;  2BI3 A;  4A00 A;  2CH2 A;  2XBN A;  3N0L A;  3T32 A;  3QM2 A;  1OAT A;  3ZRR A;  1LKC A;  4PIW A;  3II0 A;  1ARH A;  4ATP A;  2CTZ A;  1GEX A;  4WXF A;  3RBL A;  4ZM4 A;  5I92 A;  1CJ0 A;  3FZ8 A;  5EUN A;  3WKR A;  1RV3 A;  4A0H A;  1AAM A;  3B1D A;  4M2J A;  2JJG A;  2HP1 A;  3FZ7 A;  3FD0 A;  2CIN A;  1B4X A;  1T3I A;  1QGN A;  1V2E A;  2WK9 A;  5BJ4 A;  3DXV A;  5DJ1 A;  2FNU A;  4E3Q A;  1S09 A;  5G2P A;  1PG8 A;  2EZ1 A;  5KTB A;  1GC3 A;  4CBS A;  2W7J A;  1BJ4 A;  2Z9X A;  3DRD A;  2Z67 A;  1ZOD A;  1WYU B;  2QB3 A;  4E1O A;  4JEW A;  4ADC A;  1M4N A;  3AEM A;  3MKJ A;  4I8A A;  4K2M A;  5J8Q A;  4JF1 A;  1QIT A;  4ZDP A;  1EG5 A;  4ZAS A;  3CBF A;  2FYF A;  1O69 A;  5D95 A;  5AX8 A;  1SPA A;  1MAP A;  4MKK A;  1BJO B;  1AY5 A;  1I43 A;  3D6K A;  4MQQ A;  1O61 A;  1M0O A;  1P3W A;  1X28 A;  4W1X A;  3HT4 A;  1O4S A;  2PB0 A;  2VGU A;  3FVX A;  4UHM A;  1AAW A;  3TFU A;  1B8G A;  2F8J A;  2DKB A;  1ASN A;  3EI8 A;  3EI9 A;  3FZ6 A;  3PPL A;  3KGW A;  1W23 A;  3BWN C;  4RJ0 A;  3UAK A;  4L0O A;  1SFF A;  1GBN A;  2E54 A;  2YKX A;  2C7T A;  3E9K A;  3L44 A;  3PD6 B;  4UOY A;  3QGU A;  3B46 A;  4RLG A;  4WYA A;  4XK1 A;  2Z9W A;  4HF8 A;  3VK3 A;  3W1J A;  3AEN A;  2BIA A;  3ZZJ A;  1C7G A;  1M7Y A;  2ZSL A;  2GB3 A;  1FG7 A;  3IF2 A;  3P6K A;  2VMX A;  2GMS A;  1YAA A;  2ZY5 A;  1IUG A;  1WKG A;  3EI7 A;  3QHX A;  3FKD A;  3FVS A;  1JS6 A;  3G7Q A;  2E7I A;  3A8U X;  1LC5 A;  5EAA A;  2AEV A;  2VMQ A;  1GEY A;  2ZC0 A;  3EI6 A;  1X29 A;  2AY9 A;  4LNJ A;  1QJ3 A;  3Q8N A;  2YRR A;  4R2N A;  1BW0 A;  3RI6 A;  4IXO A;  1D2F A;  3OP7 A;  1UKJ A;  1AIA A;  4GEB A;  4A6U A;  4TMR A;  4ZAH A;  2D66 A;  4A6T A;  2DR1 A;  1LK9 A;  5EIG B;  3EIB A;  4W91 A;  2O1B A;  4XAU A;  1IX7 A;  3HDO A;  2AAT A;  2W8V A;  4BQ0 A;  1ASB A;  5M4D A;  1TPL A;  4ITG A;  2V0Y A;  4E3R A;  1TOI A;  2BI1 A;  4RAE A;  3PGY A;  4F4E A;  2BHX A;  4WYE A;  3BB8 A;  4H51 A;  2W7H A;  1ARI A;  4F5L A;  2W8J A;  3DYD A;  3F6T A;  1AY4 A;  1YNU A;  3K40 A;  1BQA A;  1ELQ A;  4J5U A;  4ATQ A;  2R2N A;  1B9H A;  1LC8 A;  1XEY A;  2EPJ A;  2VMN A;  4GSA A;  4RKC A;  3JWB A;  4JE5 D;  4JEZ A;  5EFS A;  1M32 A;  4LW2 A;  4P3M A;  1DTY A;  1V2D A;  1SZU A;  2AY1 A;  4MY5 A;  1MLZ A;  1UU2 A;  1WYV B;  3HMU A;  2WB6 A;  1D7V A;  1QIR A;  5HDM A;  4XEW A;  1DJE A;  3E77 A;  4IYO A;  3MBB A;  3ASA A;  5EAV A;  1D7R A;  1AJS B;  3DR4 A;  1ARG A;  4AZJ A;  1WST A;  4F5G A;  2QSR A;  3AAT A;  2PB2 A;  4XJO A;  1AHE A;  3B8X A;  4EU1 A;  1KKJ A;  1C9C A;  1MLY A;  2R5C B;  3NRA A;  4MSO A;  1DFO A;  4RIT A;  3FQA A;  1OHW A;  3BCX A;  2W7K A;  3WLX A;  1AMR A;  7AAT A;  2ZY4 A;  4GE9 A;  2DGM A;  3F0H A;  2W7F A;  1W3U A;  2DGK A;  2ZY2 A;  2YKY A;  1SF2 A;  3N4R A;  3CQ5 A;  4RJY A;  1CZC A;  3MC6 A;  4AO4 A;  1JG8 A;  1MAQ A;  3QN6 A;  2VLH A;  1AKB A;  2Z9V A;  2AY3 A;  3TFT A;  3ZRQ A;  3JWA A;  3KGX A;  4AO9 A;  2YRI A;  1C7O A;  1DJ9 A;  3G8M A;  2FM1 A;  1CQ7 A;  1G7W A;  4B98 A;  2AY6 A;  2JJH A;  4JE5 A;  4EB5 A;  2BI2 A;  3E2Z A;  1IVR A;  4WB0 A;  5E4Z A;  2W7E A;  3B1C A;  4LNM A;  1E5E A;  3GET A;  3FFR A;  1PMM A;  2VGT A;  1GEW A;  3RQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...