1AS7A

Structure of alcaligenes faecalis nitrite reductase at cryo temperature
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of nitrite bound to copper-containing nitrite reductase from Alcaligenes faecalis. Mechanistic implications.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords NITRITE REDUCTASE
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as7A02
2B08A 2PPEA 5I28A 2AANA 1DZ0A 3MBWB 3PLYA 4HALA 2FJSA 4JKNA 2XX0A 3GDCA 3FU7B 1MG3C 1JXGA 3QJVB 1X9UA 2JXMA 1AS6A 4YSDA 4UF7C 1J5CA 1QHQA 3UADA 1BQRA 4JHVA 4KO6A 1RZPA 5B1KA 4RH4A 1ET5A 1BQ5A 2VW6A 4GYBA 1ZPUA 3ERXA 2FT6A 3TBBA 2X87A 1PNDA 1W8EA 2PCFA 2BO0A 2WSDA 4BWTA 1JZJA 1JXFA 1KBVA 2HXAA 3CDZA 3DTUB 1KGYE 3NJJA 4NB7A 1AOZA 2LLNA 5D4HA 4E9RA 4F2FA 2W88A 2DYSB 5PCYA 1JZEA 4M4RB 1GSKA 2FQDA 1QNIA 1AS7A 2XXFA 4A2FA 2XV3A 1A3ZA 4F2EA 4G70B 2VSKB 3ZIYA 2XXGA 1A4CA 4GP8B 1KV7A 3CVBA 1ETJA 2UXFA 3ABGA 3OQRA 5F7BA 3ZBMA 1E67A 2XX1A 4P5RA 1SFHA 1ET8A 2BZCA 3H56A 2FQGA 2CCWA 5I5IA 4YSOA 4G71B 2EILB 3NSFA 2PPDA 7PAZA 1TKWA 3UABA 4HHGA 3ABLB 3NT0A 2YAHA 2FT7A 3OD3A 4YVUA 3PXLA 5I6MA 2IDFA 1B3IA 4HHWA 2QT6A 1XB6A 4DP4X 4CSZA 1GR7A 2CAKA 3UAAA 1N70A 2J5WA 3H4HA 3CVDA 4M3HA 2FQFA 3IBOA 4BXSV 1NDTA 3FS9A 3NJMA 2VW7A 1AZUA 2H5UA 3TU6A 4GXFA 5F7AA 1J9SA 1GYCA 4Q89A 2ZONA 2CALA 2J55A 3AW5A 4MFHA 5I6LA 1AZBA 3X1FA 3AZUA 5B1AB 2QDWA 3WKQA 2BP0B 3FU8A 4HCGA 3H4FA 1CYWA 2I7OA 2BP8B 2YAFA 4KOBA 1AS8A 1W6LA 1XMEB 2XYBA 3NYKA 1ZV2A 3D12B 3PAZA 1ASQA 4A2GA 1IC0A 1NICA 5FC9A 3PCYA 4PCYA 4E9WA 2YXVA 4UANA 3T6ZA 3WIAA 3FYEB 4DP7X 2EIJB 2OCCB 7PCYA 3T6XA 5I5JA 4KNSA 1PAZA 1PF3A 1HAWA 3AY2A 1OE2A 4DP2X 2WO3B 1YLBB 4AI7A 2MTAA 3NJNA 3NJIA 1SF5A 4A2DA 2YQBA 4AX3A 1CYXA 1HFUA 2BZ7A 3L45A 2BP0A 3WNJA 4W1TA 2IDQA 1SDDB 2XVBA 5AFAA 4KO5A 1WS7A 1IBZA 2I7SA 2VMJA 4HIPA 5E9NA 3OMAB 1OE3A 2GIMA 3TA4D 1RKRA 1NTDA 1CC3A 4DPCX 1OV8A 5I6NA 3WNIA 1TU2A 2PCYA 5I6KA 4FAAB 2RACA 1JZFA 5D4JA 1NWPA 4DP1X 4P5SA 2H47C 4ENZA 2WO2B 2HX8A 3FU7A 3CG8A 4KNTA 4G7RB 1V10A 1PCSA 2VM4A 3FQYA 3FSZA 4UAHA 4YSTA 3IN0A 1ZDQA 4G7SB 2IWKA 2UXGA 2IDSA 3CVCA 2B3IA 1AZNA 3EH5B 3QJRB 2X88A 2GI0A 1SDDA 3FSVA 2OJ1A 5I5MA 3NSCA 3OMIB 2A3TA 2HX9A 2IH9A 4AKPA 2OV0A 1MZZA 1ZIAA 3IEAA 1J9RA 1OCOB 3QJUB 4A66A 4YSAA 2PP9A 2VM3A 1PLCA 5B7MA 1ADWA 1BEXA 5A7EA 1OCZB 3AG3B 4YSCA 5B3SB 1AACA 1NIFA 2BWDA 3ASOB 3WKPA 3U25A 2XV0A 3SBQA 4YVNA 3T6VA 3WI9A 1R1CA 2DY2A 1M56B 3UACA 3S8GB 3T9WA 1M9WA 3AG2B 2FTAA 2IDUA 1QLEB 1TEGA 3QPKA 2QDVA 1BYOA 2FT8A 5LDUA 2UXVA 1GS6X 3CDZB 4N8UA 4A2EA 2DV6A 1RCYA 1WA0X 1BAWA 4DPAX 1W6WA 2J56A 4L0PB 5IY5B 3QJQB 4BXVA 5B7FA 2XV2A 2QPEB 4YSSA 3DIVA 3FYIB 2FWLB 2BHFA 2P80A 1A4AA 1XB3A 1A65A 3PAVA 1XB8A 2DWTA 1NIEA 3UAEA 1MG2C 1VLXA 4KO9A 2BP8A 2H3XC 1OCRB 2IAAC 1J5DA 1CUOA 1MDAA 4CSPA 1JXDA 2YAOA 4WTQA 2GB2A 2Q9OA 3GXUB 3T71A 3NJKA 1IBYA 5ANHA 2EIMB 1SFDA 1OCCB 2YAMA 2AZUA 2R7EA 5EHFA 4A68A 1EZLA 1AAJA 3HEIB 2IH8A 4E9YA 1NZRA 4ZK8A 1ILUA 3NJLA 4JHUA 2GC4C 3NJGA 5B1JC 4YSQA 1RZQA 3QJTB 3QQXA 1NPJA 1SHXA 3NSDA 4BDVB 1NINA 2PPCA 1HAUA 2JFCA 2HX7A 3X1EA 4YSUA 4A2HA 2W8CA 1EHKB 4EF3A 4W9ZA 4PAZA 1WS8A 4AKQA 4E9QA 4E9VA 3NJHA 4WKXA 2AZAA 2YAPA 3AG1B 2J57A 3C75A 3FQ1A 3IE9A 1NWOA 1OE1A 2EINB 1WA2X 4DP5X 4YSPA 3X1GA 2EIKB 4HZ1A 4DP6X 3OMNB 1FA4A 3G5WA 2VSMB 3EH3B 1GS8A 3ZDWA 1M57B 3EHBB 3S8FB 1AQ8A 1ID2A 4BWUA 1AG0A 1BXUA 1ASPA 1X9RA 2IDTA 1GW0A 1JZIA 5I6PA 1WAEA 3SBPA 1SHWA 1GY1A 1UATA 4HAKA 3TBCA 5I26A 1A8ZA 5B1BB 1L9SA 1BXVA 3NP4A 2HZHA 2QPDB 3EF4A 2YARA 3BVDB 1L9TA 4KNUA 3GYRA 3S3CB 2Q5BA 2BW4A 1BXAA 1PLAA 2CBPA 3QJSB 2XUWA 4KOCA 4QLWA 4YL4A 1V54B 4HCIA 1L9OA 2TSBA 1FWXA 2NRDA 2HLEB 4DP9X 8PAZA 3JT2A 1NIDA 2BWIA 2YAEA 2PP8A 2HRGA 1NIAA 2AFNA 4E9TA 4K9JA 5B7EA 2CJ3A 3X1NA 1PLBA 4TXVB 4A67A 2DWSA 1IUZA 2HRHA 1JERA 3JTBA 2IWEA 3RYMA 4X4KA 1KCBA 1SF3A 2Y1AA 1NIBA 5D4IA 3HB3B 1AANA 3NP3A 4F7KA 1ZDSA 1AR1B 3N55A 3FT0A 2BW5A 2ZOOA 3PAUA 3BQVA 3FPYA 2P80D 5I6OA 3SBRA 2GBAA 2AVFA 1AIZA 3MX0B 2XLLA 1L9QA 1AZCA 1ASOA 2JKWA 3FPXA 3KW8A 1SJMA 2MRYA 2FQEA 4Q8BA 2ZWNA 4GP5B 2I85A 3FSWA 4E9SA 1GY2A 1KBWA 2PPFA 4BDVA 2XU9A 6PAZA 4YSEA 1DYZA 1J9TA 1IKOP 2PLTA 1PMYA 3FU9A 1PY0A 6PCYA 1AZRA 4AKOA 2YAQA 3V9EA 1L9PA 2UX6A 1TEFA 2GHZA 1E5ZA 4DPBX 1OOWA 2VW4A 4FA7B 4DP0X 3S3BB 4BK5C 1PNCA 3S3DB 2PPAA 1E30A 1PZAA 3ABKB 1GS7A 4NAJA 1KCWA 1FFTB 1N68A 3FQ2A 4G72B 4G7QB 5TK4A 1PZCA 3DKHA 3N2JA 2PP7A 2GSMB 3UGEA 1MZYA 5PAZA 1AG6A 1J9QA 4N4YB 5TK2A 3OM3B 4KO7A 1CURA 3ASNB 2VN3A 2Y69B 2IWFA 3X2QB 1E65A 1T5KA 1JVOA 1URIA 1KYAA 1NPNA 3CZUB 5B1JA 2FNWA 2UXTA 3SQRA 3NJFA 3NSYA 1JVLA 5AZUA 2CUAA 1ZIBA 1F56A 1ET7A 1JZHA 1I53A 1OF0A 2UX7A 3TASA 1JOIA 2E86A 2TSAA 1BYPA 4E9XA 1KDJA 1JZGA 1V55B 3PPSA 2GC7C 1L9RA 2ZXWB 4QKTA 3ABMB 3ZX1A 2XWZA 3X1BA 2DYRB 4YSRA 4GY4A 1KDIA 4AZUA 3IN2A 1SNRA 3WG7B 2YXWA 4BWWA 4GP4B 3V9CA 3KW7A 3AG4B 4HCFA 9PCYA 2N0MA 5AKRA 1A4BA 1PZBA 2R7EB 1WA1X 1BQKA 4DP8X 4NERA 1ILSA 3T6WA 3EH4B 3FSAA 1E5YA
chains in the Genus database with same CATH superfamily
5EV7A 1JS4A 2XV6B 4RWYL 3MRDB 3N40P 5D71H 2C7FA 4BFGA 2UVEA 4YHLL 1KPVB 4HK0A 1HZHH 4LOUD 5F7NC 3GDCA 1SOSA 3ATBA 2B1HL 3WTYA 1RAMA 2DKMA 2FHFA 4ZI8A 3CVHA 5IBLC 1BW8A 1C08A 3GGWB 4N5UA 4G9FE 1KIUB 3GUTA 4N2BA 5GJSH 2XZCL 3ME0A 5ITBL 1NOLA 4P5MB 1A7NL 3OKMB 4KJPC 5KSBE 4ISVA 3I9GL 1H0DB 5IR1B 1MREL 3F7YA 4U05A 4I3RH 2IANB 2VUOA 4NRXB 5C09B 3RVVD 2CO4A 1TUPA 1M7UA 3HG5A 4JCLA 4MLSA 4XPAL 3X14A 2CH8A 4AK1A 2EDWA 3BZFB 3AU0A 1IGCL 2XN0A 1A2YB 3FC8A 5DD3H 3ESOA 3O6ML 3QCTH 2D3NA 1U8PB 3O6KH 5JDSB 2YKLL 1EA9C 5K9JL 5CJXA 1LL1A 4S1SL 5K39A 1IGML 3HG1D 4DESA 1NFDF 4NWUH 2WKLA 4PR5B 4LBAA 5CEZH 1V7NL 4N0RA 2D31A 1FAIL 4AVIA 1A4CA 4MSWA 3VG0H 1DVFB 4GAJH 3VG9C 1DL7H 1KV7A 1XEDA 4JO1H 4QNPE 5I1AA 5C08D 5IKCA 3LMJL 4P5RA 1ET8A 5C09E 5TE6H 2XQYG 3IXTA 3ARFD 4XNUH 5IW1B 5BQDA 4YSOA 4UNVA 4L5FL 1FNSL 2I27N 4L1TA 2ARJA 3NSFA 4PJCB 1CI5A 1HE7A 1ZT1B 3ARRA 3BAIA 3IDJA 3TT3L 4DOHE 4QAWA 1RZKC 3ZE1F 3SDAA 3MV01 4RMSA 3SCMD 4M6ML 5ALCH 1HC1A 2IPKB 4ZUVA 3LKNB 4JVPA 2FJUB 1TR7A 4P2RE 1AMYA 4JUTA 5CP7B 5I6XB 4OD2B 4BA8A 3SDAC 4Q6YA 1OZUA 3HZMB 3ZTCC 1D9KD 4PLKD 5FEBA 3WD5H 4AQOA 1YMMD 2M8XA 2Z31A 1R3HA 2Y6SD 2APXA 3B7RL 1AKJD 2BS9A 1OEZW 1MKFA 2EE0A 3MV8E 5HGGS 1X9LA 3RRQA 1BZQK 1P4IL 3VGGA 2I7OA 1QKZH 2BP8B 4P59H 5IMLB 3FUIA 3GIZH 3IMTA 5EO9B 5GS1B 1QSED 4Q6IA 3IYLW 3HBPA 2FYYB 3KPMB 4MJ4A 4Y19B 1DQIA 5DHVB 4NNXB 1H3UA 3U0TB 3DARA 3FYEB 5DQJB 3U0PB 3C5JB 2YPVA 1TXKA 3EXLA 3CZJA 3F5WA 2OW7A 4UOQA 1H3GA 1XH3A 3HZVA 4HWEL 5DK0B 1P4LB 5C0BB 4ZPTA 5B38A 1FN4A 4RA0C 3WDIA 3P77B 3CPLB 3Q2CA 2BP0A 1SMOA 1J48A 4NCC2 3KYNB 4NBZB 4XP9H 5EF0A 1PZ5B 2ADIB 4NM4L 1ZEAH 2JIXD 4FQXA 3WEAA 4OD1H 3TA4D 3IJHA 4LPUA 3SDCD 1OV8A 3OHXA 3Q8CA 1LK3L 1D7FA 2AJUH 4MA1C 1ACYL 2EQDA 1IAMA 1TQWA 5B4MC 3HNSH 4JPSA 4Q74A 4UTAL 1U8JB 1NWPA 3MYJA 5E1AA 2F53B 1C1EH 2WLZA 4PMFA 3BZEB 2BJMH 2Q2LA 1GH7A 2YA1A 1PCSA 3CDFA 2Y06H 4BZ2L 2H1XA 3A6CH 5IBTH 2IDSA 3Q6FA 3MV9B 4PUBH 1M05B 4N9GA 2BVOA 2HFGL 4M43H 1OAQL 2X88A 1DBKH 1FZMA 2YGNA 5CF3A 1JZ3A 5I5MA 2NY2C 3NSCA 2HX9A 1L0QA 3NZSA 3VH8A 5IB1B 1HHGB 2IH9A 4HS6A 5DD1L 4Y5YB 3GBNH 2IALA 3WJJC 4I2XA 4S1DC 1J05A 5ACZB 3GM8A 5KVFH 4NKOA 5AZEL 2PYFA 1F4YH 3PWNB 4F2MB 3BKCL 1JF5A 1OCZB 2J44A 4MXWL 2V7NA 3LVTA 2BOCA 5GJSL 3SBQA 5KSBF 3LZQA 1OHQA 1XIWD 3WI9A 4AG4H 4QXGL 4XR8C 1J1PL 2X7LB 5FS5A 5FYJL 3LEVH 1TYRA 3QG6A 2OX5A 2ZWSA 2N1TE 2QADC 2C26A 4LLAA 1FDLH 2Q86B 1HINH 1V7ML 1HNFA 5EUKB 4OZIA 2CGYA 4KJYA 3C09C 4M62H 4N3UA 1JGVH 5DJ0A 3EH1A 1UASA 2ZX6A 2C34A 3HB3D 2Z8WC 5CZVH 4MNQB 4PY7A 2B1AH 4YNYA 3W5NA 4ZPVB 1XAKA 3GMRA 1IC4L 2BSTA 5F9WB 4FABL 2XV2A 3UTTB 2A4EA 3KJ6H 3T4YA 1DANU 2CWRA 2AV7B 2JK5A 4HYTB 1ZHLB 4FFWD 1TZGH 1YDPB 4Y16B 3C6SB 2AP2A 3MO1B 1AKJB 2FECL 1KWKA 1DN2A 1LO2L 4HEME 3MKGA 1UXMA 2EDHA 4LKXA 1YPZF 2F58L 2JKIS 2WVVB 3NA4A 4FFZL 4HSAC 1EZVX 5CCKL 1KJ3L 5IM7B 2H32B 3V9FA 1G87A 1L6ZA 1S7TB 4CSSA 4JHBA 3RI5K 1RIUH 2HKHL 2VLKD 3U1SH 2LR4A 1BQSA 4GSRA 2GB2A 4G6AD 5DYFA 5HYSB 1MCHA 1JE6A 3MA9H 4PJCA 5I71B 4K71B 2OMYA 1FC2D 2EIMB 1OCCB 4AQ1C 3DETC 3JUZA 1T5XB 2AZUA 3N9GL 3ZXAC 4L3CB 4BHUA 1G1YA 3LIZA 4UNUA 2JKTM 3STLB 3HC2A 5J13B 1YCSA 1NLBL 3HNTL 3KWWA 4Y2DA 2PR4L 4ZK8A 4E9YA 3NJLA 5D70L 5HDQL 4Z3TA 1MRFL 1P9MA 1U8CA 4IRSA 1P5UC 4GT0A 4E0RA 3QQXA 1OP4A 1S78C 5DQ9B 5I1CL 1LD9A 2HRPH 5D6DA 3KLAB 3X1EA 2EIBA 2X4OA 4NO0B 4DKAA 4Y4FD 1KB5L 1KB9K 1VESA 1XBDA 3HW7A 1ZXKA 4OTXH 4P9HL 4LSUL 3SGJC 4DKFH 4OI8A 3Q0HA 5B8CC 1AGDB 2CK0H 3FT3B 5C6WH 4NRYB 4PJ6A 3ML9A 3QIBD 2EDQA 3KNBB 1SQ2N 3ULUH 4FFVD 4P5TD 2R0ZL 1B4RA 5FFOA 4W9FC 1E3FA 3TP4A 4ZT1A 1BZEA 2NDGA 3CVIL 5CKAA 4V2CB 1NDGB 5E1IA 3KYNA 1KCVH 1UOVA 5FKPA 1KXQE 5BRZA 2BSRA 3EBAA 2OP4H 2AJVH 4XZUA 4DFHA 3IJSA 5E8OB 2X4RA 1K4CA 2PCPB 4QXGH 1SHWA 3FAWA 3L2MA 3GGWA 4LASH 3S3SA 2ROYA 1BVNP 2Q20A 3O3UN 1J5IA 2XPGB 3CH1A 2B59A 1NAKH 4KUZL 2UY6B 4BGDA 2OK0L 2COQA 1RIVL 3FN9A 2P9RA 5FWRA 4PD4J 2X1XR 4WF7A 2YARA 4HFWA 2BOCB 4PVMA 4UQBA 4NM4H 5ESAB 4E41A 1A6AB 2P5ED 3QFJE 2VQUA 5ABAA 2YA2A 1H9DA 1S7SA 4EN3B 3IFNL 4X99B 5I1EL 3P9LB 4P8QA 5AL0A 1XGYH 4JFOA 4HS6B 2VIRA 4D0DA 4HT1H 2MCPH 2KDGA 3CDYA 2D03H 4GRLB 2R4RL 2V2TA 1R3HB 2CJ3A 1QP1A 2HT4C 3GMQA 1BQHB 4YUEL 4NPYB 1XVSA 2KH2B 2BCKB 4O02L 1AR1D 1T6BX 3V0WL 4QTFA 3F2LA 1YYML 1NC4B 2HUEA 5D1ZD 5EWIL 1SF3A 1GPOL 1NIBA 4WHDA 1Q9WB 1AQKH 1FE8H 4ZNEA 2RMNA 4AZ8A 2Y36H 4P46A 3US0A 3MLZL 1R46A 4NI6A 2HRLA 4NJAH 2J25A 5JHDD 3LTVA 3RL2B 4YQXH 4OT1L 3QCUH 1A47A 2F68X 2Z0UA 4IRZA 1FFNB 3HPJA 4PI2A 2PYED 3CSFA 3MUY1 2H3KA 5DJ2B 3ZMRA 3KXFE 4Y89A 3SPGA 4MAYA 3NPSC 1RD6A 3M07A 5IB3B 1ZTXH 3IDGA 1ZGLM 2ZWNA 1OSPL 2XFGB 4BD4A 3CFTA 4RZCB 5ICUA 3PWPE 1KTLB 4X5WB 3D0VA 1JFQL 5ILTL 1BJ8A 2XWTA 2F15A 2LVCA 5J56B 1ID5I 1JZ5A 1MVFA 2E9JA 5GJTH 3VRIB 4R4BA 1GGCL 5DEFB 3T3PB 2A6KB 2R4SL 3N0AA 3VFVA 3B9EA 4OVVA 5HHME 2FH8A 4DP0X 3N85L 4X9FA 1KCWA 1OKEA 4NFBA 4OF8A 2AJXH 3CHOA 4GKNA 2Z93A 3QNXA 3UAJA 2P5EB 2I26N 1ZPLA 2ZUUA 4FCAA 5FCSH 3APCA 5CJ8A 3DJTA 4KXCA 3UGEA 3O45A 3EO0B 4GQ9L 1AG6A 4HKZB 3GSNB 5HHOB 1OY3B 4JO3L 1FO0B 4A2MA 2BHUA 1OAUH 2FBJL 1UVQA 2G4EA 2H41A 1SVCP 1NPNA 5EOCL 1VSCA 2Y0SA 5T5NG 4B95C 5I0WA 4UIMB 2ATPA 2EH8L 1FVEB 1L5GA 1I7RB 4MNHA 2H7WA 4J3VA 1Z9PA 1IKFH 1ZIBA 1OTTD 2EO9A 4X5RA 4L4TD 1ET7A 1F3DH 1YY9C 3ULUL 1S3KH 5GHWL 3MGOB 4PS8A 3F65A 5A6IA 1OQXA 3WY4A 1I1YB 1V55B 2QMKA 4M7JL 2A9MH 4H0IA 4R3SA 5AD0B 1OGTB 3T3PE 3ABMB 4XOBA 1KYFA 4YXLH 1CLCA 1XH2A 4GAJL 3WV0A 5J13C 2BSRB 2MKWA 3K6FA 4KDWA 3ZYIA 4AGQA 4JN1H 3TYFB 3QUYA 4H0LC 3TEYA 4NC2B 3RHWF 3EKCA 1WD8A 3UTSB 1P1VA 5T5FA 3LRSB 5EIQA 5DHVH 3HVNA 3DRTB 1F4WL 3FSAA 4WEBH 4CSTA 5KANG 1BQKA 4DIXA 1ORQB 1U3JA 2APBA 3FTYA 1ILSA 1I3GH 1TTFA 3HE6D 4M9PA 4M8RA 2B20A 4CVXB 3B3BA 4GAAA 1HHJA 2XG5A 1E5YA 1RZIB 2NR6D 3GBLA 5JIDA 4CC4C 2GJJA 4R4FH 2A6KA 2W07A 3CN4A 3T0EC 1BVKA 3K72B 1FI8C 4L8SA 4E0RB 2E8ZA 2FJSA 1UACH 4JKNA 4AJVA 1U0QA 4WI0B 1A14H 3DGGA 1DBBL 4N9OB 1N5YL 1EANA 2PETA 1ZHNB 4KQ0A 3LN5A 1G6RA 4KO6A 1FH2A 2ZAGA 1AOHA 3Q6GH 2NTFA 4KTEH 3DX6B 4U1JB 4P46D 2WV3A 3JVGC 4QOKE 5J3HC 5C07B 3CCHA 3RZWA 2D7TL 3WXWL 3D8MA 5CAYB 1Q1PA 2OMWA 3B4NA 1U8CB 1YYLH 2Y22A 3D18A 3K72A 4L8SB 1OLZA 1SJHA 2VOTA 3MZTA 4RFEA 3VD5A 4ZXBD 3WJMB 3KLHD 1MUJB 2OCJA 5DO2D 5BMFL 3K1DA 1AY1H 2QSQA 2C9UA 2JKJA 4Z7WA 4IU2A 3SBWC 4Z3IA 3MQIA 1JZEA 4M4RB 5HHVL 5ETUA 4Z7IA 2BSSA 5B1CA 1ZHLA 2DQJH 3CU1A 1C7SA 4PLJC 4L2LA 1WZ1H 1U9KA 2VSKB 2X4TB 5C0AE 5I74B 5A1AA 2PMZA 4XWGH 4N2KA 4AQ1A 5LBSA 4C4KO 3SSGA 4BV1A 1JV2A 1CD1A 2FO4A 5T1LB 3AT9A 5AOLA 3D30A 4OT1H 1BBDL 3QQ3A 4NP9A 1N3NA 2UWEE 5AKVA 3J8F7 4PJCF 5LNGA 2XICA 5EEYA 2IBZX 2Q86A 4Z7VF 3FTZA 3MLVL 3D09A 3QW9A 1KTRL 9CGTA 2EILB 5DT1L 2UZXA 3IMUA 4EI0A 4P2QD 2NW2A 1IJNA 3KPSD 3BJLA 1BF5A 1YVLA 2LFGA 2QKIA 1PZSA 3M7FB 3MRCB 3PWJB 1QRNB 1EHLL 2DQGL 5I6MA 1DEDA 1K3IA 1BX2A 4MBOA 3BZ4B 3WTSA 1DVUA 1DQLL 1UWGL 5C0NC 5GGUA 4R4NC 1RUQH 1QFWL 4M3HA 5HI3C 1XZ0B 4WFHE 3RTLA 1PZDA 2ALWA 3E8VA 3TU6A 1LNUA 1S78D 4LDLB 4F92B 4YBHA 4B9IA 5I1HL 3H54A 1HE8A 3OHMB 5KSAA 3OSKA 3CMOL 3JVFC 1SOQA 4I0CC 4WFFE 5M7QA 4FTDA 5LGHL 3W0WE 4XP1L 1P84J 2CBTA 3FU0A 1KTCA 3SDDC 1BPVA 4YHML 3LS5L 1ZHKA 4RRPM 1U8IA 4JKKA 1KV3A 4QEGA 5ACZA 2DWXA 3IU4L 4ENED 5HSFA 1XHHA 3QBTB 1NICA 4RIRB 5KOVC 3WJLA 1AGEA 4OM1L 5E2VH 2W0FA 2OSLA 3LDBC 1RQ5A 4CU7A 4AIZA 2FATL 5TF1L 5TE7L 3T77B 4LXFA 1WD9A 1NCHA 3NESA 1B90A 3REVA 1A21A 4WEMB 3QHFH 2V2XB 3IMRA 3DOSA 4OZHE 2K1MA 2ICEA 3IAGC 2CLVA 3RB7A 1L4IA 1OM9A 1JIBA 5JOFA 4MNGE 2FJGA 2FBRA 3L45A 4WEUD 3R7RA 2R56L 1FO0L 2X89D 5J1TC 1KBPA 2HAZA 4HIPA 2EUXA 4U2YA 2FIKB 1QYGH 1CC3A 2HN7A 1B0RA 1CFNB 4UINL 2ITCB 5CWSA 1IAKA 1KBGH 3GMNA 4N2GA 2BC4A 2AQPA 4PJ7F 4AJYV 1S7WA 4P5SA 5JIIA 1GKOA 5GGQH 5E56A 2BIHA 3V55A 3DSFL 5KYXA 1NJ9A 2NNFA 5GRYA 2NZ9C 4L1LA 4JFUA 5D7JB 5F1OB 1YN6A 3I3EA 4ZAKD 4G43A 2ZKHH 1SDDA 5D1XB 4WU5A 3HI6L 1U6AL 2FX8H 1F02I 2QR0B 2KBGA 3D06A 1X3DA 4UQ2B 3UG3A 4NSKB 4E42A 43C9B 1FFOA 4A7UA 3KBHE 2EKSA 1TETH 5D7JD 2C4FU 5H4YA 1EHLH 3V52L 3VMOA 3IM1A 2J2ZA 2N3JA 3PL6A 5DO8A 3N50A 3VD3A 2WQXA 3TONA 4EDWL 3TBSB 1A6AA 4IOFD 3TVMD 4G8GA 4PJFF 4LNVA 4XNBA 3VXNA 2Z31D 4MJ6A 2XOTA 5D7JA 3WFEL 4BA0A 4Y1TA 4TSAL 2P8MB 2OMZA 5HGDB 1GTNA 4UTBA 2XHNA 5CJXC 4HKJB 3A3YB 4J3WA 5E2WH 3SODB 3HFMH 3F7LA 5FV2A 5IQNA 4XWGL 1QLEB 2Y4SA 3AUVA 5JPMC 4YDNA 1BYOA 4Z76A 4JZJB 4H8HA 5DZLA 1BBDH 1IBGH 4A2EA 1HU8A 2YPKB 5HPMB 1OAKH 4AUJA 2DMKA 5L2JB 2JI1A 5C7ZA 4O58L 1A66A 1PD0A 1G1CA 4AMWA 2X6AA 1IGMH 4HDIA 2QPEB 1TVHA 2X3CA 5F7HA 2P80A 4UILH 5AG9A 2XQBL 4LK4A 2GAZB 3LN5B 1CGUA 4Y4KB 4ZYKA 4G11A 2A4ZA 3L3HA 3V5HA 2RH0A 2Q7YA 2H3XC 3LN9A 4DK5A 3G6AB 4G6ML 2DLHA 2B4CH 2O4EA 4M7ZB 4CSPA 1TQBC 4XO4A 4AW7A 4Y4KC 3SE8L 3GSXB 1JYXA 3HRZC 1A6UH 4MA1B 5EHFA 4GG8A 3RU8L 3TVMC 4ES9A 1I7UA 3QDAA 4N26A 2DMCA 3SDXB 3QEGL 5KBDA 1JPTH 2E59A 2OI9C 4GIOA 3BZ4A 1V3JA 5GRUL 3O4OB 4YSQA 4ZUSB 4MNGB 4JZJC 1NPJA 3QUYB 2NXYB 3UBXB 1HAUA 2BHYA 2HX7A 2JFCA 5DURD 2R0KL 1E6OL 4EF3A 1RIHH 1EO8H 3HKFA 3LZRA 5F7YC 4FQXC 3CMOH 4XPAH 3RDJA 5TF1H 3ML8A 4G1EB 1XR9A 1WAAA 2H4EA 1AR1C 4U1SA 3SQBB 3UTQA 3CLFH 5DJDB 3KPOB 5F3HA 1ZVHA 3H2PA 4K3DH 4Y9GA 3U36A 4LLVB 3UTPE 1DO5A 2VDRB 3PWJA 1EMTL 5CEZD 1KYOJ 3NABH 1NGXA 4ZFOB 2B2XH 3OGOE 1M57B 1RV6X 4E41E 1EZUA 3VWJB 1Q0YL 3RL1B 5D71L 4JHWL 2X4QB 1SXZA 2NR6C 3JSSA 1NGWB 2FSEA 5FGRA 4JDTL 4ODBD 3DPBB 1IAKB 2OR9H 2BVPA 3EJCA 2BNQB 3SDCB 4Y4KD 3HFML 1Q94B 5IW6B 1BFOA 3NP4A 1SYSA 1G0YR 3MRFA 2NQCA 4NQSA 1WSST 4PHXA 3MBEB 3PE9A 1X7SA 1KELH 4PJHA 5HJBA 4GUPA 4QLWA 3ATAA 4PY8I 1SN5A 1J05B 1UXWA 5ALCL 1EFXA 3B8SA 4AVKA 2XY2A 4PJXA 3HHMA 1N5AA 5FAAA 3EGXA 5A2LH 3QYNA 5M94B 4QRBA 3ALPA 3MRQA 3JV4B 4YAQA 1U2HA 2K78A 4WWNA 5CSGA 1R19A 4AGOA 2Z91B 5EU4A 2J1KA 4KH2A 2QVTA 1IUZA 3BE1H 3LRKA 2VJ0A 2X38A 1RZIA 4DZ8A 1L0YA 1CGSH 2WQRA 4MMXA 3B7UX 3ARDC 4HUUB 2C7UB 5DEGA 2GW5A 3DGGB 3I02B 3IU3B 1NFIB 2LU3A 1HOCA 3BQVA 3PAUA 3OKOB 4QXTA 3KPRE 3ISYA 1H5BC 4K8RH 2GCYA 3BFOA 5FGBA 5L8JB 4FFZA 5L8KB 1L9QA 2EVJA 4LRIC 3WFZA 1BVNT 3KW8A 1DFBL 2R69L 3TJEL 3BIKA 1PG7W 3R18A 4MXQD 3BLBA 2W60B 3C5ZB 3UTPD 3HS0B 4WVRA 5GGUB 4PW4A 1BF2A 5ICYB 5JQ6L 2D9QB 1FIGL 2PLTA 3GRWH 3OMZA 3MGOA 4QF1B 5EU6B 5TE4H 5LGJB 4N2HA 2W59A 1MH5B 1IE4A 1JNHB 2ARWA 2J8UA 2BY1A 4R7NA 3SQOH 3VXSA 2Y06L 2Y1YA 1FORH 3S3DB 1JMXA 1FCCA 4JW3A 1I3UA 4GIPD 3T1FA 1NC2D 2DQHL 5HBBA 2HFGH 4W4NA 5H4ZA 3V4VL 4PGBA 2YD9A 1S3KL 1ACYH 2K9UA 3W5MA 5TFSL 5KVFL 1EO5A 1BMGA 4X7DC 4DGYL 1QLEL 1C1EL 1F4YL 4ZNCD 1AZVA 1MWAL 5TK2A 2LOEA 3ESPA 4RAVB 1CIUA 1CICD 2VN3A 4WHCA 3QI9A 2FGWH 2WOBA 1F42A 4AJWA 1HWHB 3OKLA 2C1OA 4AITA 3JZYA 3NQIA 1DBKL 5EF2A 4WHTA 3HG2A 5DLML 5C6PB 1B0IA 3NIGF 1YEIH 1W0WA 5D4QA 5DSCA 4OJFL 4JKLA 1EEYA 4XI5D 4U1HA 3RURA 3JTSB 3ECBA 5ANME 3DX8A 1MCCA 1I7TA 3CZFB 1QOKA 2VL5A 1YA5A 3CCHB 3T0DA 1L9RA 3H9SB 1A4KA 2MQGA 3S48A 5I8CA 2WB1A 4AV5A 1SLXA 2DJUA 3OKNB 3VXPB 3BE1L 3JZ7A 4XBEH 5LCVA 3UC0H 2BP5M 5MEQB 3MRIA 3N6YA 2CK0L 3IMSA 1AJ7H 3VD7A 2I69A 5B4MD 4BCZA 2W07B 1XL6A 4OGXH 1E5UI 3ILPA 2FGZA 3LXCA 5E9DE 3B2VL 4FQCH 1CFQA 1OB1B 1TFPA 3EGDA 5FX3A 5EULV 5L4MA 3ULUC 3F6IA 43C9A 1LO4H 1IIKA 4I8DA 4PV9B 2Z92A 1FNHA 4HX1B 4IW4C 4TPRH 4J27A 2GTZB 3T0EB 3R4RA 5C08E 4QXUL 4ZTPL 3RUGB 1FZKB 2VO8A 1RZGB 3IGAB 4PV1C 2IPUG 3HNVL 5FYKL 3DYMA 2CZNA 4NZJA 3FQTB 2BXYA 3NFNA 5CD3A 4UAOB 4ZYKB 1KOAA 5HGBA 1FFQA 2LE9A 3C8DA 3LHAA 4HH9A 4J6RL 5EMYA 3EZ8A 4GFXA 2J1WA 4HJSA 4JLRA 5BO1H 1B0RB 1CFNA 3ROOA 3O9WD 1ZPUA 3IDMB 1MLBB 5D1QE 1EIBA 4DGIH 2GJZB 3L1OL 2ED9A 5E6UB 2PCFA 2ATAA 2FUQA 4KVNL 3ZUNC 1S8DA 5IVZA 1TTBA 1RZFH 1JXFA 4XNXH 1KGYE 1VZGA 2IADA 3ILQD 4WJ5A 4FA8A 3BT2H 5D4HA 3QPQC 4EDXB 4LU5L 3N1QC 1CJYA 4TYUA 2MCPL 2Y1VA 3V2AR 1TG8A 4B7LA 1R17A 1NMCC 5L7XL 1WEJH 2MCG1 1C12B 5BS0E 3E38A 4D7BA 4Z7NE 1CLYL 1CGSL 3VFUA 2ICCA 4XPGH 3VFWA 3VFNB 1M6UA 3FF7A 3FFCA 4G70B 2VITA 3UBXA 3T8XB 2X40A 3WIHH 4IDJL 3O8XB 5E03A 2VDLH 3EDEA 4NS0A 5F1IB 4Z6AT 1FL3A 4G9FA 3L3OC 2OMVB 4LHQB 1DUZB 1NGQL 4K94H 2VXSL 1K4CB 4P3CH 4PJGA 3EJUA 3IDXH 4QJ5B 1MREH 1Y1UA 5C1MB 2Y5TA 2UZIL 5E5MB 1E7UA 3IS0X 5C2BL 1OTSC 3DMMA 4KDVA 2JV6A 4Y5YA 4LAJH 3JWNE 1VACB 2K7QA 3VCLA 3LS5H 3NT0A 4B97A 2ATKA 4JRXE 1LNUB 1FNAA 4DEPB 3GEWB 4TNGA 2IDFA 5IOKA 4AL8H 3FB7B 1UD4A 2YD5A 4DP4X 3BUYB 4U6HA 3ZSTA 1LE9B 3HZ3A 1AE6H 1HZHL 3AREC 3GIVA 3HZKA 2FQFA 3FUJA 2VC2H 3QDJB 2FATH 4MJID 5CBEA 2APTA 5I75B 2H5UA 3EH2A 4GBXC 4YHNA 4UQAA 5CZRA 5DCCA 4WNJA 4IMLB 4L4JA 2FB4L 4OB5L 3ZDXE 5E6SB 4NP4L 3QUMB 3OKKB 4F7EA 5B1AB 5D6CA 3VU2A 3N40F 2JJSC 2ZX5A 3BVTA 2HT3C 1AS8A 4FMKA 3IAQA 5GSRA 3TS8A 5L88H 1FN4B 4C4UA 5AYUL 3LV3B 3LX9A 5KSUB 3ZY7A 5FC9A 3WN5C 2CBQA 4ABVA 4JB9H 1TQCB 3REWB 3VW3L 2YXVA 4DVBA 1MNUL 2WKOA 4PGDA 4RGOH 3IJ7A 1BJ1J 2VZVA 2BVPB 4X6EB 5D5ME 3KDPB 2NYZA 5C9KA 4L48A 1OE2A 5IHUH 3BSZH 5JXAH 5K9OA 5CLZA 1A6VH 3NJIA 5HYQB 2VLJE 3VXUB 3X12B 4UZSA 1MCPH 4W1TA 4YFLF 4PY7B 2IFFH 2WBJC 3NCXA 5G55A 3TN0C 4ADGA 3PWPA 1OD9A 1EAOA 5FF6A 2YEQA 2VE6B 2P1YA 3GHEH 1PG7X 1M1SA 3GI9H 4F7CB 4GEJA 5EZIH 3NH7H 1CXHA 2E7BA 3V4LA 4XCNA 5CMAA 4XMTA 4DP1X 3P40A 5E1GA 5IMOB 4P4KB 1RULL 4I5BA 3KMDA 2X2UA 3LIZL 3MRLB 4TSAH 4C54A 5IHZB 2R4SH 4HUXA 5D2LE 2Y6SC 5E95B 4OQ1A 4HCRH 4ELKA 2A7BA 3ASWA 2HN7B 3MDJA 1OP3H 2F7RA 2N59A 2HTLD 1FH5L 2Y36L 4NN6B 3BCFA 1T6WA 3OMIB 4QRAA 4RLDA 3T0EE 3ULSA 2CA4A 3IGUA 4MCMA 5K9QI 2NYYD 3ESVF 3M88A 1JWUA 1SLUA 3BESR 2F1AA 4YSAA 3PHQA 5I76B 1DUZA 1J7VR 4FF9A 4HLEA 2FO4B 1E4XH 4TS6A 4H8QA 4F8QA 2BWDA 1VFOA 4FQIL 4FEMA 3KLSA 1QRNE 3SOTA 4FLRA 1JGIA 4E2OA 3B9DA 1M1XA 3QEHB 3L3IB 4KTEL 1KGCE 1UA6H 3GI8H 1UEMA 3CFNA 4QRQB 4L9LB 5FM8A 3RVWD 3MV7A 2OYMA 1THCA 2PW1B 1NANI 1QSFA 4U6TA 1KZYA 2VDPL 2DYPA 3KDMA 2VRQA 1KG0A 4DPAX 1W6WA 3F5WB 4NC1E 5ECJE 5EZOL 3QJQB 1I3GL 1UZ6E 2H2PC 4YSSA 3FYIB 1QBBA 4PJ7A 2KHAA 3IS1X 4LDEB 3OPZH 4ZFFA 1A6ZB 3FH7A 3L4CA 4CNIB 3EYUH 3E9TA 1P7KA 3IFLL 4KO9A 1E28B 1E6OH 4J7RA 1T21A 2BJML 4FKKA 4GG6F 3ZDYE 3QULA 1PX3A 5A6LA 2EUWA 4J39A 1LP9E 4AC2A 4I1PA 4BZ2H 2YD3A 3DX7B 3KCWA 4ZOCA 3TBSA 1GHFL 3T2QA 1MVUB 1F3DJ 5EF3A 2WXLA 4X6DE 1DDHA 1TIUA 2YUVA 3UO1H 4CW1A 3K6SB 2FR4B 3IPFA 4ZW3A 2O93L 5HYFA 4AUUA 1KC5H 2LV4A 4HS3B 3KYOA 2EABA 4UU9B 1AE6L 2GC4C 4J3OG 4AXWB 2Z31B 3JV6A 3TF4A 4CGUB 3UIYA 5C2UB 3V0AC 3RVWC 3REWA 1OT2A 4XMKL 3UPCA 3KEHA 2YOCA 1FYTD 3RHWK 1MJJA 3WOVA 1FH5H 3ARXA 3GD1C 1N8ZA 2EO1A 1XCXA 4FXGA 1LO5A 3BVVA 4U6YB 4RAUB 1OE1A 2EINB 2Y72A 1QHPA 3CFBB 3PWPD 1SJHB 2QV4A 4U4BA 5EZLB 2YLKA 2ZCLL 4MCNA 4RFNC 3Q6FB 3EHBB 4TUJA 1KPUA 2YBGA 4MRBA 4WNQB 3WTUA 1VEMA 1BWMA 2RIKA 2F8VA 2NY2B 3U4KA 3GRWL 3VA6A 5D96B 4JFYA 3ZYZA 3H3PH 1FO0A 2XTJE 1WF5A 1CWVA 3EJZC 1FFPB 2CHZA 4G7VH 3WFHA 1MSPA 2GK0A 4G6AC 3L5HA 3KPRA 5AVRB 1ULVA 3AM8A 4OIIH 2EE2A 3BVDB 3WNNA 4CVXA 2L7UA 5EUOB 1QSFE 2BW4A 4PU2A 5INCB 1RHHA 4Q2ZB 2CBPA 3DTXA 5DRZB 4HCIA 12E8L 4OQTL 1U3HD 3IFPB 3GLAA 3O6FC 3BQUC 4HCRA 4DCQA 3GUTB 1FSKC 32C2B 3FT1A 2PW2B 4QAMB 4JQXA 4CJ0A 3R1GL 3EW3B 2IWGA 4XOEA 5EG6C 4HEPG 1HOEA 5LHDA 3QFGA 1OXYA 1PLBA 1M2VB 1QR4A 2R59A 4FP8L 4Z7AA 5K59E 4JY6B 3KS0J 2VITB 2P5EE 1XGPA 1EDHA 2IH3A 5EBWB 1JERA 3DSFH 3EGSA 3OLGA 4M29A 3QIBC 4DGVH 2VXVL 1KB3A 3Q2NA 4YFDB 2OFQA 3IKCB 4N6QA 4X4KA 3ZT7A 1VJSA 4NM8L 5BRZB 1QD0A 3VG0L 1R34A 4Y1AD 4ZUUB 5C0DB 4XNDA 1HQ4B 2WUCL 3L5XL 4OLWH 4PQXA 1JI1A 3RFZB 1ZKAA 3OZ9L 1OAXL 4U1HB 4ETQB 1D5XB 5FHAH 5FUCE 2CIKA 1JMZA 1F45A 3LH2H 2XLLA 3WDHA 1M7DB 3S4SB 4ZFOL 1TF4A 1NCWH 3MACL 3KPQB 3MUHL 1YQVH 1GL4B 2EDBA 3QFJA 1Q9OB 3O4LA 3QEUA 3T3MF 1H5BA 3V0FA 3LN4B 4KKQA 2XRAL 4YWGH 5CD3B 5DMKA 2ADJB 2IV9A 4U3SA 1RUQL 3V6FB 3PNWA 2XVGA 2DWYA 1BD2A 3VXMD 1A6TB 4LRNH 5ITBH 3MREA 1L9PA 4PJXB 3SDAB 5HHMD 2VW4A 4O9HL 2CXGA 1NM4A 2ENJA 3NIDB 2W65B 1NUFA 3BP5B 2HWZL 4NQSB 3U6RB 4WJG3 3P1VA 3KBFA 4U1GB 1TJIL 1LTXA 3PP4H 5IW6A 3FB5A 4IOSA 4Z3JA 3V7AG 1OALA 1FHNA 5C0BD 3MNMA 2MCAA 3LKOB 3QZWB 4UT7H 1QR1B 4N4YB 2I9TB 1J87A 3V4VA 4FKEA 5DZNA 4BINA 4PB9L 3EOBA 4MCYA 1Z1WA 3L7FA 3D25B 4HKXB 4KVNH 5I0VA 2N0KA 2I24N 1SUJA 1ZA3B 4ANUA 4ELMB 4X6DF 2X4SA 1SVBA 3H8NA 1DP0A 4XNXL 1I3RB 3WEXA 4LVNB 4KY2A 1TJHH 1QNZH 1BOGB 4LLWA 1FIEA 3HBGA 4KVCH 1JOIA 1QQDA 2VR7A 1YUKB 4WTXA 1NGZB 1NEZA 2VABB 1BYPA 8FABB 4HMEA 2P5WA 4HJGA 1ZGLB 4C4KT 3QXUA 2MQCA 3FT3A 2VERN 2OMUB 3WIIH 4M6MH 4HHAA 1QBLL 2QTVA 4PJIF 1I1AC 2XWZA 2A99A 3TEXA 3V0GA 5M95B 3MKKA 3A47A 3G5ZA 1YRKA 2G2RA 4PRNB 4MA7L 4PJDA 3ZDXB 4QDGA 1KDIA 3IN2A 4YGAB 1JYVA 4BFKA 4FFVC 1R5VA 2NNXA 2CQVA 2WQ8A 3T1WA 3K6NA 1IFHH 2PW2A 5FA4B 3S98A 4HSQA 4QLRA 5HDBE 1F11A 3O81A 3SDXA 5DRWB 1EGJH 3PDGA 4IBVA 1ECYA 2HPOA 1WC7A 3ZL4H 1QZNA 1U6AH 1WDAA 5FYLD 2HJLA 4YDJA 4I18C 3II3A 6CGTA 2Y9RT 1A1MA 4WFGE 4NUMA 1J0YA 3MLYH 1DZ0A 5KG9A 1KYDA 1MH5A 4NQCB 3ZTJH 1H8NA 1JWMA 4NWTH 1PVHA 2GJZA 3BGAA 4PJAA 1T89A 1DLFL 5DMIL 3H9HA 4Y19E 3ALWA 2OR9L 5IBTL 2OTWA 3M1BB 2IFGA 4YSDA 4EI5C 1KZQA 1CDCA 2PYEA 3PUUA 1KJMA 3DK2A 1ANUA 1J86A 1J1PH 5ISZB 1LO0H 4MAYD 2EYTB 3TTSA 2E8YA 3BVNA 1HCVA 2ZP9A 3BKJL 1LO3H 4PRPA 2VR5A 1HOCB 1TVBA 1TZAA 3CLFL 5DR5H 5I0YA 2PWEA 1T03H 1YZZA 1HI6B 2H0JA 5E94B 3IDUA 1JBJA 3F7VA 3LNGA 2OX5B 4RGOL 1JD7A 4NNYA 2CRMA 3B5TA 3SN6N 5EBWA 3GC3A 2QFRA 3GWJA 1Z66A 4R90H 3M7OA 2W81C 2XXGA 3SGKA 3AWFA 1A1NB 1Y18A 3AROA 2IG2L 2UXFA 2OYPA 2UZYA 4MKTA 1NFDB 1L9NA 1G7PA 4RGNE 4DQAA 4ZSOA 3PGDB 3VXPA 3IMWA 4K3DL 3NIGB 4N0YL 1IGTB 1A4KB 3Q9PA 1DSFL 1QPXA 1N59B 1D5MA 4LB8A 6TAAA 2KDYA 1T80A 4YH6A 3G6JE 5AQ0A 1UZ8B 2I5YL 2WW8A 3GJFA 3L9EA 2XETA 2IAMD 5AZ2H 5LB1A 5E6RB 2J8UE 3FO9A 5DD6A 3DV4B 3T65A 1H15B 1LJMA 1ITBB 2CJUH 4HUKB 2XJLA 1YY8B 4LLMA 3P0YL 1B3IA 4JPVL 4Z3HA 2DF3A 5B8CA 5J1SC 2UYLA 3L3HB 1XB6A 2NQDA 3UAAA 2J5WA 5D7LD 1A3QA 1G7JA 1U8JA 4Z0XA 2V7HA 2YSSB 1CLVA 1I1CA 4G8IA 1AYRA 1HL8A 1PYWB 1FL6B 4WFHD 1NDMA 5G4MA 1EGJL 5IW3A 3TNNA 4ILDA 5IREA 1NBYA 3JYBA 1C5BH 2BIIA 2O5ZL 3F12B 5E51A 1NCGA 1TO4A 3BAEL 1ZT1A 3MV7D 2DLEA 4PRBB 3AAZA 2AEOA 5D93B 3CFBA 1EFXD 5I30H 4M5TA 4U2ZA 1CYWA 2PR4H 3CPLA 4KOBA 4PGBB 3WFCL 3SJVA 3MLYL 3P4NB 3WDJA 1ROWA 2F53E 2WTRA 1KLGA 1HL5A 3ARVA 3UTOA 4HIIB 5B3JF 5AW9B 4X4ZA 1ASQA 3TF7C 1OP5H 1HYSD 2VLKB 1KN4L 1ZK9A 2ED8A 2CA3A 3G9VA 3MRMB 3Q1EA 3GHEL 4GB9A 5EH1A 4KQ4L 4MA3A 2O6EA 1KB5H 1UCBH 2X0VA 2JLPA 1UXSA 4J3SA 4LSSH 2W0FB 3NSJA 5JA8B 4FXGC 3B9KD 3QPXL 2DEXX 3ATFA 3VH8G 1INEL 1Y1DA 5K39B 3UBXI 3HBQA 2DQCH 1XD1A 3FSOA 3P0GB 2VC2B 1I1AA 4M61B 2MTAA 2VJ8A 2IAMC 4IRJB 4F9PC 4AX3A 3HC0A 2VDQB 4I3SL 1MVUA 1U91B 1WYJA 1T0MA 3VGDA 4N2FA 1FGNH 5FKAA 1P7HL 3SDXE 2BDNH 3OMAB 1QBLH 4WFGD 3E6HB 4IOIB 5AOKA 4DPCX 1IL1B 5IQLA 2VDQH 3RAJL 2JJTC 4NLHA 3P54A 5FYLL 4R84A 2EDEA 2Z4TA 4QXWA 4D8OA 3BQUD 1TYEB 3HA0A 4FADA 2D3VA 1NAKL 3MRRA 2OK0H 1IBHA 2R4RH 5MEOA 2IMNA 4BFIA 1GA2A 2X4OB 2IPKA 5D7LB 4ZUVB 3RGVC 3ZO0A 3HUJE 4KTDH 1GHFH 5IFAH 5GISL 4X4YA 4UT6A 4LARH 4M1DL 3STZB 3QJRB 1LYQA 4IBZA 1QFUH 3FSVA 3OG6B 4HEPA 3WNOA 3CFKA 1XGYL 4P2OC 1KEMH 3EOAB 4U6YA 1WT5C 4GNKB 2Q10A 1KMGA 4PJBA 3Q3GB 4OFVA 4H8WL 4PJ8D 4BCYA 3GK8L 3ZZLA 3RWIB 4J1UA 4OAWA 2FJFB 1TQUA 4XE0A 2APVA 5DJAB 4ANXA 1XF2B 1XGRB 1D5RA 3KVDD 2NTSP 4JFEA 2A74B 5B39B 4FFYL 5D1QC 2DY2A 2BNQA 1AHMA 1KSRA 2IPUK 5TPWH 4YHPB 4OZGE 5EOQL 1NBZA 4LKXB 4ZXBC 1K8IB 1Y6KR 1BQHG 1LO3L 4X8JA 3Q3GA 3B2XA 2F5AL 4N2DA 3FULA 4QRUB 4UT9A 2OJEA 3VA2C 1BOGA 4H26A 4LLWB 1DN0B 2JJUA 4WRLA 4Z7UA 5A43C 2C9VA 2OI9B 1TITA 3NACH 4MZ2A 1CFSB 1XSKA 2YKKA 4BSVB 1DANT 1BD2E 2B7DT 3UBHA 5F9JB 2XC8A 2YLHA 3L3KB 4PJBE 5T3XL 2XQYK 4KJQC 4U6HB 4BK5A 3GJFH 5FGSA 4H8PA 4LRIA 5E5UB 4HWZB 3DYPA 5FV1L 1C5CL 1X4YA 3PJSA 4OFYA 4B0MB 4X9IA 3UMNA 4DO5A 1J5DA 2EIEA 1QRNA 4M8UA 5C86A 4PG2A 3BUDA 4H2CA 3II2A 4NQDE 4LL4A 4I77H 1MHEB 1VGKB 2XKSA 4XBGB 4MLIA 2EJ1A 3K46A 3LPGA 1IBYA 4NKQB 4QYAA 1FGVL 4YDVA 2Q6WB 2ZXDA 3OKYA 4GG8B 1B0WA 4ANWA 5F7LB 1GCYA 2XTJB 2Z31C 4RDBA 5GGTA 3QE5A 1QKZL 4URKA 1XIWC 4PRPE 1FL3B 4G9FB 2OZ4A 1U3HC 1RK7A 4QRPB 1OGAA 1PG7H 3DXAB 4AYGA 5EEWA 1QPKA 2A9NH 2D8KA 3IPEA 4MA3B 1K3ZA 3C6EA 4U1KA 4XB3A 2VAAB 5D8JH 4ZS6D 5LQBL 3QZMA 4KKPA 1N26A 1IIIA 3RFRA 1ZLEA 3GM0A 4N0FA 1CDUA 1HX0A 2QELA 2VDPB 3FQ1A 4Z7UE 4JJ5B 2JB5H 3QJHA 4X7CC 1JP5A 3HZYA 4ODUB 3Q7JA 1TZHA 2EECA 2NR6A 5BV7L 4AIEA 1FA4A 4GKZB 5BCAA 4I1RA 4PD4K 3T2NH 1QSEE 1HILA 4WW2F 3FU6A 4N2CA 2NY3C 3P77A 4JB9L 4L18A 3SO5A 2CDEB 4UIKH 4J3BA 3AQXA 4WI6A 2OQJB 4Z0XB 2AK4B 1NAMH 3NCYP 1WAEA 3D39B 1MJUL 1UACL 2XA8H 1PKQB 3I74A 4KRLB 4XVOA 5CGYD 3RWGA 3ULVE 4BFFA 1VB9A 3OHXC 1L9SA 2HZHA 3P11H 2MIZA 1O6SA 2XN9B 3SYOA 1R24B 3QUKB 4KNUA 3CFCH 4P5KB 2G4GA 1U91A 4OB5H 1G6VK 3PJLA 4M43L 4PWJA 2WB7A 2EYSB 2DI8A 3P9WB 4JPWL 1A4JB 1SLVA 3DRQA 4HKBB 2K6WA 4Z7NF 1H3TA 5IIEA 3UPAA 1WZAA 4P2RB 3S5YA 5GRJL 1UWEH 4XGZB 1MNNA 3DO7A 1NBCA 2A9BA 4XXCC 3X1NA 4FXKC 4XAWL 2X4TA 2EO7A 3LKQA 4MQXC 5CUSH 3UCQA 3BP6B 1SLWA 4N90D 4Y2LA 5ESQB 4Z77A 3MOAH 4RZCA 4JN1L 5GISH 1IGJB 3B1TA 4FNRA 3SE9L 1ZGLP 3FCUB 4KFMA 4R5VA 5EBMB 3BXNA 4C47A 1YEDA 5CCGE 3LKNA 2QZ5A 1CCZA 2XQ0A 3MGAA 3NGBC 2DMGA 4L3ED 5IFHL 2W9DL 3LSOB 2R1WA 2I07A 2YRBA 4AQAB 2P80D 3MLWL 3SBRA 1DBML 1XR8B 3MLVH 3WUWG 4F7EB 1JWSB 2X05A 4DEUA 4UZUA 4OKDA 3VUAA 2WMPB 4PJ5E 2QLYA 3AB0B 5CZXC 4TUUA 3S36X 1RHFA 4POUB 1HDMA 3ULVH 4GXUN 4AL8L 4EVNB 3DWTA 3ZTNH 3EYQD 3ZDXF 3H2QA 4UV7H 1O75A 1QBAA 1PY0A 2I9LB 1AZRA 1C16A 1XTLA 3IJ8A 4ONGL 4JFOB 1KUMA 3JV0A 4L2YA 5D1QB 3ARED 1XIWA 2JB6A 3ABKB 4BE6A 5IVXB 4ODTH 1ORQA 3KM2A 3ZKQD 4KK5C 3IWUA 4FC3E 5IG7B 1QSEB 3MX0A 5EOTB 5TK4A 3PFQA 2ED6A 5E4IA 3GI9L 2VLME 2WNKA 3NH7L 4WW2C 5TH2B 3SKOA 5DFAA 1OPGH 4XVSL 4YEFA 2CLRB 1OGAE 4JFED 2ZYSA 4XRCA 3VRLF 2ZOKA 4KK6C 1E0OB 2ZYRA 3DIFA 2Z7YA 4PTTA 5D1ZC 2E7DA 2CO7B 2P44B 1WZ1L 1DUYA 4OQTA 2XT1B 3H9SA 3EFOB 3RTQB 4RSVA 3H42L 3O6LH 5FK9A 3ZL2A 5I74C 4IIQA 4L1HA 1CT8B 3IT8D 3UO8B 4TNWF 3O11B 1T3FA 3VWKD 2GJ6A 3AREB 1QX1A 3QUHA 5E00B 2ENYA 2XIBA 2ZNXA 3CFIC 3N42B 3TASA 5FO8A 5K9JH 1UB6A 4LCYA 1PPIA 4WGWB 5KW9H 1F4XL 2X1PA 5K69A 4HUUA 4HKXA 2DQUL 1MY7A 3F83A 1CTNA 5ISZA 1X7TA 3ZRSA 3ZR6A 4LKCA 1XF4A 2DM2A 2ZXWB 1I7ZB 4F93B 2C9SA 4GW1B 4UQ3A 5KBNC 1WWAX 2AVGA 4JFEB 3ALXA 3B2UD 1HESA 1RVFL 3FFOA 3LMJH 4A1RA 3CJJA 1KN2H 4JM4L 4DGUA 3NK3A 1P0SE 4JG5A 3WUZA 5JLZB 2BOBA 1L0PA 1MW1A 3STLA 3MUGA 1H6FA 1S9WA 2F1EA 1A4BA 2BNRA 4KHXH 4EZMA 1EXUB 2FHCA 4XCEA 4XN2A 4AENB 3Q2VA 2LVEA 2XWCA 4HAGA 4XXCA 1TQTA 2CJUL 1EHXA 4G59C 4UYPA 1DEEA 5E5LA 2EEXA 3OPZL 1BD2D 2K6ZA 3VRIA 1M71B 5IHZA 1F6AB 3MV11 1NEUA 5HVHB 4F37K 3ECUA 4L3EE 4RMQA 2EH7L 1QLEH 2D03L 5FW8A 5CD5C 4U1JA 5EO9A 2GSIB 1A6ZA 3N1PC 4K7PH 3N41B 4J3TA 1D9KA 2J4WL 3KZ8A 2E27L 3QUYD 3V4UL 2VW6A 4GYBA 2KPNA 3S4SA 3MR9B 2ZD0A 2J6EH 1NDGA 4DK3A 1MEXL 4FQ2H 5GGRA 4ZW5A 1UWYA 1FAKT 2BXZA 1DN0A 1X5JA 3FKUS 4H26B 2B0SH 4XX5A 2R9HC 4JJHA 4LSTH 1KGCD 3QEQE 1KB5A 4U6VL 2W88A 4QHLB 1F2XK 3H53A 4R8WL 4XXDA 3ENEA 3R1GH 5KVGE 3B2UC 1GSKA 3CZKA 3PDOB 1BSIA 3IBEA 2GSGA 2R1XA 3BDBA 4HUWB 4A2FA 2K4AA 2FH6A 4PJDE 1PS3A 5CKGA 5GS2H 4JG0L 4JBSA 1VENA 2H0PA 3IPBA 5GS0C 1VA9A 1IQWH 3KLLA 3WAKA 4FN0A 3VX0A 4J1UB 3WAJA 3D1MC 4Q9BA 5I8KL 2NSQA 1LQSR 2VRAA 5JIKA 4R0LA 3AMKA 1CDJA 1OAKL 5EU5A 1VFBB 2B9AA 4G6MH 5JHAA 1AGCA 1JD9A 4QHMB 1GGCH 5BRQA 5I5IA 1LQBC 1ZT4B 3HI6H 4PWEA 3UBGA 2ZCKH 1GTFA 4CMHB 4Z7VE 1KTDB 1DJHA 1JI2A 2VMDA 3GIZL 2VISB 5BUPA 1K8DB 3FMGH 3OBAA 1SM3H 1NCDL 3PXLA 4JG9A 4ZTPH 2A73B 4X9YA 2XJKA 3LY6A 3L3JA 4CA4A 2A77L 1J1OL 2A6DB 4DO6A 3MRLA 1LE9A 3C9NA 5E4OA 1QI4A 2Z4QB 3CVDA 4OIIL 4QO1A 2PXYC 1X7QA 3WCYA 3QPXH 4BIKA 1QZ1A 1INEH 4NDMA 2BNQD 3IJHB 3E80A 4Z7QE 1VAHA 1M7DA 3AW5A 3DJRA 1BAGA 1NL0H 1U58A 3O3DB 3X11A 1TJMA 4NQVB 2PWGA 2BP0B 2NT1A 1SRDA 4PJCE 2YAFA 2YK1H 2Q8BH 5BJTB 1XMEB 4CL7A 5J6SA 3CHSA 1ZV2A 5I16B 1GVIA 4NRYA 2YPVH 5D9SB 3TO2B 3NABL 2AV1B 1YPZE 3KWXA 1QFWM 3FUKA 1X6LA 4QTIH 4U1IA 1XF3B 2CKBA 4E9WA 2DKSA 2OBGA 4G7YH 4OZFB 3U0TA 3TBTA 1I8UA 3WIAA 1UB5A 3PFUA 1P53A 3UIZA 1AXIB 3TPUA 2CRZA 1QTYT 4LAQL 1E6JH 1TKWB 5F0LB 1UYWL 3CXDL 2OSYA 4AI7A 5E94A 4F2MA 3BRFA 1LEIA 3QXDA 2FB4H 4NYLA 1XXFC 2BZ7A 1JDAA 2ZSVB 3MJWA 5EIVA 2AXWA 5JW5B 1SDDB 4OZIF 4U6VH 4JFXA 5G4NA 2GJPA 3ZQXA 3O2VH 3FH5A 3IDMA 4KXDA 4I89A 3MLRL 3U83A 3DV6A 4X80H 3QEGH 5C0ND 3KL0A 1Q94A 1TU2A 3L81A 3QXVA 4ESKA 4X8GA 4Z3GA 3AB0C 1HNYA 2RACA 2ITEA 2EDJA 2X2HA 4Q0XL 2F53A 4LPTA 2LU7A 1QI3A 5A16A 3EYFA 3PIQB 3A22A 3F7RA 1YPZA 3FQYA 3LKPB 4MDIA 1DJYA 2Z65C 5EOQH 1ZDQA 3HE6A 4L3AA 2X1WL 5AW0B 2DLFL 3UH8A 3EH5B 2XWJA 1JRHI 5GGTH 1M7XA 3GUFA 1WC7B 1Q1JL 4GG6E 4XC1H 1UFUA 3OZ9H 3PQYB 3C6LC 1MI5D 1ZMYA 1B2WL 1OCOB 2VXUL 3QJFA 3S36L 1HHIA 3T3ME 1AQDA 2X6MA 1IGYA 2VM3A 5C0BA 1RZJL 1KCRL 3AS3A 3MAWA 1G7PB 2F54B 1G4RA 3D2TA 2OMZB 5HGDA 2VDRL 4I0PC 3LQAL 1JG9A 1W2KT 1LILA 4FS0A 2FHBA 4NZUH 3U7WL 1IT9H 1XV8A 2OMUA 1V3MA 2ADGB 5AOZA 4XH2B 5KBKA 5F72S 4YHIA 3VXSD 1DJGA 2VL5B 4JR9H 3HUJA 3QQ9D 2YUXA 4OF5A 3BWSA 1RIUL 2HKHH 4U49A 3U1SL 4C56E 3CVIH 2G5RA 5LDUA 3ULSB 1CS6A 3ECBB 1HHGA 4OLYH 3V8OA 5JOPD 3KPLB 2EYRA 5I73B 1ZV5A 2Y24A 3DHPA 4QRRB 2XNAB 3DJSA 1YNLH 3U4EA 4WWKD 3PHAA 1A22B 4LHUD 3QJXA 2PYEB 1I8AA 5KYXB 5AAPA 3BPNC 4CN4A 3RVTC 4RGNC 3V5DB 1A65A 2D4DA 3BKYL 4HPYL 4N86A 5EORH 4AE0A 1WQVT 2YD8A 2GAZA 2FDBP 5LAPA 1M6OA 5DUMH 3POHA 4WWKA 5LQBH 2VE6A 3FN0H 2IAAC 3LIZH 5CIPA 1RZGA 3IGAA 2TRHA 2WUBL 3DX0A 4ZX3A 1QFPA 3O3AB 5GZND 3MPCA 2YAOA 1WJ3A 7FABH 4LMQI 4K23H 5KS9F 5L2JA 5D1ZB 4Z7VB 1YEJH 4PV9A 1SFDA 4YDLC 1NGYB 5DD5H 2NXYC 2XFXA 3EUUA 15C8H 2BLFA 4JFQB 2D73A 4XNZC 1E3ZA 3D39E 3HLKA 3VXRD 1S5IH 5K9OB 3WE6B 3K3QA 4CN6A 2WIIA 5ECGA 3W0WA 4YHYB 2ICEC 2DWEA 2VR8A 4GBXD 4AIZB 1MIMH 2PPCA 3KS0H 4DWHA 5F8RC 4A2HA 1G94A 1X44A 3DDGA 3AU1B 5F1NB 4OGYL 4HUVB 1V3KA 4WHYH 4HKBA 5DLMH 1V7NH 1TJGH 1TQBB 2J2ZB 4ZW6A 2JK5B 1WBYB 4IK6A 5F89B 3MXWL 3CLWA 2VR4A 2HVKB 5CLWA 4JFFE 2NZIA 2Z8RA 3AREA 1E8ZA 4KROB 4X83A 2EIKB 4PCKA 2WQUA 4M6NH 1PQZB 5IHWA 5F0MB 1RJYA 5C09A 1GS8A 1N8OE 1VFMA 5C07A 4YHNB 5EZOH 3N44F 3HE6C 2HG5B 3GBML 4DGYH 4WHYG 4J3OD 4OFQA 4P05A 4YBQC 3RJQB 4MWFB 4QO1B 2IG2H 2CJSA 2J8OA 4JGUA 3QFJD 1SEBB 1O7DC 3P30L 1IMHC 4DQOL 4A04A 1GY1A 5CUSL 3WTWA 2JI3A 5C07D 4RETB 1JHTA 2X7LA 3KWVA 5JPMB 4LLDA 3VSTA 1IM9B 1CXEA 4JG1L 3H9SD 3MRDA 3QUXA 1CE6B 1MF2L 1XH0A 3B3IA 3RY4A 2B77A 2W65A 5C0CB 1ZT4A 5F44A 4Q2ZA 1SY6H 3WO3B 1FGNL 2X70A 2CLZB 2YWYA 1KXTB 4KC3B 4K2UL 5F2FA 4PWFA 4DP9X 4F27A 5GSVA 4MJJA 4GQ9H 1JNHA 4ODXA 4I1NB 1NIAA 2AFNA 1E2ZA 3NCMA 4E9TA 4GQZA 1J8HE 1PLGL 5ESVA 2BVOB 5LVEA 1OAZH 2GBTA 4KPHL 4TULL 2L7QA 1BAFH 4MXVF 5KVFE 1Y7VA 3TYFA 4R7VA 3L2NA 4JFDE 5FOBA 1KTBA 4LLYA 1MJ7H 4CDGC 4K15A 2R27A 5GIRB 4YPJA 4DGIL 5C6TL 3W37A 3GB7B 4D9LL 3NEXA 5DC9B 4ZFOA 2WLIA 1BLIA 2BVQA 2R23A 1GGIH 3C8HA 2RD0A 1KJ2L 3CHPA 4PRID 5D7IB 2XBZA 4YXKH 2IF7A 3VGAC 3QIBA 1BYNA 3NCYS 5ENWA 3GSRA 1G7HA 4JCMA 3GNML 4KROD 1EXHA 4I3SH 1ZE3C 1YEDB 3ARFA 4OCXL 5IESH 3B37A 5DVLA 1BZ9B 3FT2A 1PX8A 3IGFA 2ZE0A 1UOLA 4DZ8B 5C0RL 4R96A 1N6QH 1MPAL 1NUNB 4DJMA 4TLTA 3L5IA 5ICXB 1PQZA 2ARJQ 1B4JL 4QRRE 3SKOB 3F8UB 3KXFB 5GZNA 5IIEB 1TEFA 1N5AB 3SPVA 4LT7A 3COOA 4PJ5A 5DTFA 1R3KA 5HI3D 3TBVA 3ABZA 2GJ6E 3D69B 2G3NA 4I0PA 4NAJA 2FLBT 3BAEH 2ZUXA 4PRIB 1RSYA 4Z7WE 4NEHB 4P9ML 4GRWE 1BFOB 4CGTA 2YZ1A 5KJ7E 1U2YA 1ACZA 4KKAD 5PAZA 3QUZB 1MRCL 4HH8A 1U2CA 1AC6A 2J8HA 3N0PB 3LH8A 5FGCB 2J6EA 3SDDB 2BRRL 3D4ZA 4P4KD 4ODWB 2IWFA 4N8PA 1URIA 2M83A 4WNQA 5B1JA 4B9GA 1CZ8L 2NUTA 5FO7A 1EO8L 1A7QL 1QAWA 3HN8A 5MEPA 2EICA 4OFDA 1FNEB 1UHVA 2DIEA 1FGVH 1I9IL 1NCCH 3OLEA 4JJ5A 1W0WB 1FCGA 1I8KB 4KI5F 3CFJA 1UH2A 3SPJA 4XVTL 4U1SB 3FQUB 4NNPL 3SQBA 1TTRA 3B2DC 3G6DL 4KK9D 1PLGH 5FHAL 4HJEA 2WBJB 3TN0B 1VERA 5F9OL 4F57H 4KKBC 1AXTH 4I85A 4UNTA 1ZVSB 2MEJB 2YRPA 4XNZB 3VXTB 3HMWL 3MXVL 3B43A 2VN4A 3NFNB 5CINH 3APDA 1GJUA 2QSTA 2PKDA 4PJIB 4BWWA 3F58L 4NHCH 3WIFB 4DW2L 1PZ3A 3MJ8B 4ODXB 2AS5M 2E9GA 5L2KE 4HS3A 2MPAH 1IC7H 4IYKA 4EJ1C 5JW3L 3NACL 2H0EA 1OAQH 4HMDA 1NUGA 3QEQA 5CEZE 1P6AB 4RA3A 5D1QA 5JHMA 1NPUA 4FJYA 4W9IC 1I9RH 3KXFA 1Z9OA 5L9DH 2O5YH 1G6RH 1UUSA 1CICC 4K0OA 5HGAA 4IKKA 4OZ4B 1CE1L 1NLBH 4G1MA 3WNPA 3ARGD 1OT4A 4NFDA 4WUKH 4A7TA 1EUUA 3E0GA 2X4UB 1PSKH 4OF7A 5B1KA 3G6JB 3FT4A 2K7PA 4Y4HB 4HLZG 5EO1A 5GGSA 4P2QB 5EU3B 1YEFL 4PRBA 4PRHD 1CQYA 4IIZA 4EOWH 2BO0A 2WSDA 3CPUA 3KAAA 4G8GE 4AYEC 4AQAA 4QRUA 3BWAA 3CDZA 3DTUB 3NJJA 1AGBA 5ABZA 1CXFA 4Y1AA 4L4TA 1UKSA 4FQIH 1HXMB 1TJXA 4WU7A 2NUTB 5J11C 1YEEH 4N68A 5LBSH 1OGAD 2AQ1A 3D4GA 2EAEA 2PN5A 5G2NA 3FL7A 2A9NL 3C60A 2V33A 4FLQA 1QO3A 5KAQF 4OCXH 1ZLUK 3OAUL 2VDOB 2F7IA 5GGVL 2VN5A 4ODVH 3H55A 1Q8MA 2E4TA 1OGAB 3EJPA 1IAIM 3ZHFA 3ARGB 5D93C 4Z7UF 1MCJA 1OSZB 4MA7H 4WENB 5DJZB 4ZS7H 3ZHKA 3NTCL 2DJSA 2E9BA 43CAB 3T4AC 4X4XA 5KVGL 3MLWH 1D5BB 1JHKH 3BJ91 3EOAA 3JWDL 4G71B 4K94C 2EVIA 3OVUB 1X4ZA 3MA9L 5LG1A 1J8RA 4ZOBA 5A2JH 1LMKA 4RZKA 2IGFH 1U95A 3GO1H 5TDNA 3RUGF 4URTB 1URZA 1MRDL 5F8QC 2ZUVA 4AEFA 3ULVL 3FBKA 1EO7A 2E9WA 1YMMB 5E99L 2E46A 1IAIL 3R0MA 4CSZA 4HT1L 5MEOB 3GRGA 3Q06A 1N70A 4P06A 4XCNB 5CBAA 3BUYA 3BWUC 3GXTA 3THML 1SOXA 3SE4A 3G5VA 3AGVA 1AZUA 4S1QL 5DJ6A 2K9FB 2CBOA 1HEZB 1NCNA 2YGQA 2DQIL 1Z5LA 4JPIA 3AZUA 1Z9SB 4FQXD 1NMBH 4U3CA 4KQ3L 3KDMB 4GRWF 5HYQA 3QIUB 4FFTA 5D2NA 5ID1B 1HQRA 1CIDA 1EX0A 3MLTA 3VD9A 4G1EA 4UQIM 2SEBB 3HC3H 3OXRB 5IOPB 3KVQA 4JFPA 5FO2A 3QCTL 1P5VB 1EEUA 4NNPH 4U1KB 1M3IA 3WS6C 4XMKH 3JWNH 4PJ9B 1EXGA 4KXZH 1LP9F 5F9OH 4F57L 1OW0C 3I6GB 7PCYA 4PB0H 3OX8A 4HJJL 1NFKA 4DP2X 1HEHC 1DE4A 4JY4B 2PCXA 5FUCC 4M8VA 2VH5L 3PDDA 1FRGL 4O2EA 3LNDA 4C59B 4A6YB 4OZGF 2C3VB 3B5HA 1HFUA 1NLDL 1XSIA 3BP7A 1C8PA 3WNJA 2YMTA 4TSBL 2HLFD 3BMVA 4RFEB 4CDHA 2J6WA 4UNIA 3L2LA 4F8NA 3G6DH 4KO5A 1WS7A 3EFDL 2VMJA 4X4YB 3I6GA 2YQGA 4P2QA 1JNNH 4WI9A 3PWLB 2OXHB 4X50A 4BZ2A 4F9LA 2UY6A 3GKZA 5JIHA 3PP3H 1Q9LA 1TENA 4JFEE 4NQXA 4UT6L 4JY4A 3CX5K 5CCJA 4LQFH 1B4LA 3QWRD 1FL5B 4OZ4A 2A4CA 3DX9B 4PJ9D 3TEUA 3RFZC 1COBA 4ZS7L 3TO4C 4PJAE 2P8PA 3F84A 4JZOA 3SYQA 1RJCA 2NY0D 4QT5B 4AVHA 1KCKA 4F7PB 4M00A 4NJ9L 4RGNB 1MIEH 4LLVA 4WUUE 4S11A 1S7UB 3PABB 4FQHB 5E5RB 4NUQA 5IJVB 4IS6B 1AD9A 5E4AA 2KLTA 1O0VA 3KPNB 4IGBA 3D0AA 2VCOA 1I1AB 4M61A 4XCFL 4JNXA 1XH3B 3HZVB 3L3GB 1MIML 2XKNA 4Y8DC 1IAIH 4KTYA 3AQZA 3T2PA 5KW9L 4NKDB 3U25A 1WT5A 4J4PA 3TWYA 1OSYA 1P6WA 2ENSA 1F97A 2Z35A 3QC6X 3BH9A 3HE7B 3OR6A 5EU6D 1I3VA 3KL3A 4KDTC 5TDNB 3FQWB 3UACA 1U93B 1TZIA 4GO9A 1PGRB 3Q9QA 1T4KB 1FZOB 4W93A 5I16A 1BFVH 3VGFA 3FN0L 4JO4L 2UUDH 5JIMA 3BW9B 2H6OA 2JCCB 3TESA 1HZKA 4U1LA 4V33A 3D2UA 1AYOA 2RQ8A 4NO5A 5LBSL 1L5GB 4OUUB 1K2DA 5FUOH 4WHTB 2X41A 2B5IB 3LKPA 4V1DB 2HYMA 2VQ4A 2HUHA 5HHQA 1AD0A 3Q44A 2VLJD 2J21A 2RGSA 2Y25A 3O2DL 2ZQKA 4Y4KA 1NIEA 1H8SA 1T1WB 1ZVYA 3DMMD 3NUKA 4HAFA 4CUCA 1CI3M 1MF2H 2BNQE 3PWLA 4GO6B 4OGAC 3U4EB 4P9HC 4Y2NA 3T2OA 4OGQC 1UM6H 5AVUB 4WW2A 1CG9A 4YZWA 4PRIA 2WNWA 3QO0A 1HH6A 4OZFH 4U0QB 3E9UA 4GH7B 1G9ML 2O26U 3U9PH 1BZ7B 3SDAD 1HTYA 1WFNA 4BQ8A 5JW4R 4JANB 4LEEA 5C0FB 3GK8H 2G2RB 5SWSA 1U41A 4S1QH 3BKML 2N4IA 3L1FA 1CR9L 4LCUB 3H0TA 3H7BA 3QZLA 4GRMA 2BSDA 4K8RD 1ZLSL 2DQIH 2XTSA 1BWWA 5AVSB 2WVUA 2F8OA 1KIPB 3FK3A 4WKXA 2G3XA 1CXLA 2NSMA 2OMBA 4PJEE 4UV4L 3BFQG 1BGXL 2YR3A 4JY5H 4X98A 2KERA 3R4DA 1OM3H 3HC3L 1EPFA 1W72B 4M7KH 4P3WA 4S1RH 4ZMZA 2E7LA 1TLKA 5C0AA 2WGNB 1SXCA 1NDMB 1AQ8A 2ENQA 4JFYB 2VDNB 4OF3A 2D3JA 1E27B 4OLXL 4A6YL 1S46A 4KK8C 4NENA 2HCZX 5CM1A 4JQIL 1UXLA 1JUFB 2VB5A 3BZEA 5D2NC 1ZLDA 2KZKA 3T0ED 1UATA 2KZBA 1R9FA 4O5LL 1T2XA 1H8OA 1NBVH 5TF0A 4QKXB 3V5KA 1FORL 3FUEA 1BXVA 1H15A 2F7PA 3GF8A 4FE9A 4RAUA 5BVJA 2H2SD 4YMPA 2PR9A 1YNTB 1L7IH 4ZX4A 4XT1C 4A7GF 2EDTA 4KOCA 3LKSB 3W9EB 4GKSB 2WPGA 3O9WB 4FG4A 4ACTA 1NIDA 1IM9A 2BWIA 3MREB 4ZFQA 1Y07A 1OSPH 5INDA 1A8JH 2FK9A 3LEXB 1QHOA 1F8TH 4K9JA 4Y4FC 3UAFA 1EAPA 4ORGA 4TXVB 3R8BB 4HVBA 2LQRA 4HK3J 4YXHL 3MLXL 4UQEA 3GKWH 3L5WB 1BVZA 5L4IA 1MCIA 5LUMA 1DLHB 2SODB 4GS7C 4IMKC 5D7EA 5JDSA 1R5IB 4W6YB 4PTUA 1ZDSA 5GS0D 2P46B 4LQ1A 3FTGB 4IHOB 2W94A 3BDYL 5E00A 5DJ2A 5D96C 4Y9BA 4N2OA 2DM4A 1DQDH 3MTRA 4PGCB 3BH8B 4NUGH 4FTVD 1WBYA 2OJZL 4QYOA 1BF8A 1TMCB 5IR1A 1QVOB 1SJMA 1J8HB 2MRYA 4V2BA 4Q8BA 4XN5A 1T2QH 4D8PB 1KIQB 4PWHA 4V1DA 4XAWH 4GUQA 4RISL 1DYZA 2GIYA 3KE0A 4HZLA 3AS0A 5AW5B 3LNFA 3OL2A 3I9GH 2X1QA 2XG5B 4U1LB 3VI4F 3D7PA 2HG0A 5J06A 1VZIA 3MU3A 5MENA 2G2PA 2BNRD 1G6RL 1NKGA 3CFCL 4S1RL 1Z5HA 4G72B 1R33A 2JJWA 1T6VN 2O72A 4KJQD 2OM5A 3G6AA 4S0HA 2R2CA 4XMUA 1PY4A 4GG6A 5L0QC 3IDIB 2R23B 1J9QA 4K71C 4N8CH 2E4FA 3SE6A 2G9HA 5JDJA 2W9EL 1AKJA 1FBIL 3ZOAA 3EXJA 1KY7A 3G04A 1JGUH 3W56A 1UM6L 2X42A 1MQKL 2CLZA 4TVPH 2UZPA 3ARGC 5ETUB 3RDTA 4KNQA 2FO1A 3VXMA 3D2UD 3NSYA 3EOTH 4DZBA 4GBXB 1E2WA 4ONFH 4F7PA 4L9LC 5FYKU 1A9EA 5SV3A 4QRPE 3T6QC 3SPHA 3LHPH 5LAXB 3O11A 1G9MH 3QC5X 4FFYA 3TIEA 5MERB 4MNHB 3SE4C 5IFHH 2E86A 2AXFA 2VWEE 5L7XH 5F9WC 3HUJB 2IEPA 4KJWD 1I8MA 4HKJA 2HFTA 4NQXB 2X89A 1OWWA 1JTPA 4IBTA 4Q9QH 2HG5A 1A7BA 4YLQT 4XPBL 2AJSL 1C08B 5JMOC 2DYRB 3VFPA 4ZMVA 3NZHL 3VSVA 4PPTA 1SNRA 3NTCH 3WG7B 2YXWA 4P5TC 1PTZA 1F4AA 3V9CA 3J27A 3OR7A 1ECZA 1R6VA 5JHLL 4IJTA 4JHAL 3HAEB 3RILA 5D6DC 5DD0L 3GO1L 3TO4D 4LARL 2DMHA 2CUHA 4NUGL 1J12A 5EC2A 3VO0A 3TIDA 1EJOH 5IROA 1OTUD 3P3UA 5LBVA 4MB4A 3B2PA 3VB8A 4PJ5B 1AVAA 5DTFB 2VDML 3QARA 5FYLH 4ZAKA 4KK6D 3I9AA 3VFSB 1O9VA 4HMCA 2DQUH 2DQJL 5T5NF 1EVTC 3GPEA 3GSVB 5A16B 5EFIA 4KQ4H 4L29A 4NN6C 4J12A 5GQBA 2UWEB 4ERSL 2Y7SA 3PL6D 3CZGA 2DQMA 1FYTB 3VE0B 4H8VA 3ZKXC 5ERWB 2DWEB 4PRHE 4OR1A 1J9CT 5CJQH 2ZPKH 1S3RA 1HEZA 2EDNA 3STZA 1MFNA 3BOVA 5AENA 4ETQA 3D2UB 3O0RH 1KBVA 4ZMLA 3JVGA 4JM2B 2YWZA 2QHRL 1NSNL 1O7VA 4P46B 3UYRL 4GI9A 3QAZC 4KX8A 4FX5A 4AT6B 3LB6C 3REVB 4F8LA 4YBLC 3S88L 1JCKA 2W5PA 1YEKH 1EWHA 3MOBH 4NKIL 3T4AA 3RVUC 1RUPL 1CDGA 3RBSA 1NCBH 3ZBMA 4B5ZA 1E67A 3RNKA 4RIRA 4DQOH 4FD0A 4NHUA 3PWNA 1Q38A 1KXTA 5IB2A 2CPUA 4PUBL 2GITB 3LHPL 4OJCA 5CZXD 4DF9A 4Y5VA 1CD9B 1KF9B 1MWAA 4G6FD 5E6YA 1EAJA 4OZGB 4H0GA 4OJYA 5F7WC 1U3ZA 2AXJA 2WXNA 4KX9A 2O1AA 4R0LC 1G7LA 4KKLC 4TV3A 2YAHA 3TA3C 2PF6A 2KLRA 5C0FA 4MXWH 4I5BB 4HUNB 2VLKA 1GMEA 3C2AH 3W38A 2P47B 5SWQA 3LH9A 2WBKA 4Y8AA 4YHKL 4JCWA 1FNFA 3IBOA 2EIZB 3FS9A 1AGBB 5E8NB 2NLJB 4K7PL 2C1PA 2CALA 1BHGA 4MDJB 3AAZB 4OTXL 4DKFL 2LAGB 3FCBA 4O00A 5DZJA 3BISA 5HY9A 1NBYB 1OCWH 3HZYB 1J8KA 5DI8A 1D5ZA 3NRFA 5GGSB 1AQDB 2FVNA 1RZ7H 2GFBA 3MJ9L 3HHSB 4G6FB 3NDYE 4X0KA 3L5JA 4HPOH 3GXDA 3UAJD 2J20A 4X6CA 1LEKA 3UZEC 1CPUA 3BSZA 1UWXK 4I4WB 4UT9H 5F1NA 3GDBA 4YK4C 4AL8C 4D0CB 1EZVY 4ERSH 4DVBB 2IAND 4EN3C 3CGTA 3ZMEA 2EIJB 1BFVL 1DQQA 4KRNA 1QFWH 4BFEA 1R0AL 5JXEA 2VYRE 5JQ6H 1SXSA 5IOPA 2VIRB 1WLHA 2J71A 1YLBB 2WO3B 4D0DB 3GBEA 3I6LE 5DJ8B 3QXDB 1HIML 3DXAD 4RQQA 2MOQA 4U1MA 1UH4A 1U3HB 4FNLH 4OM0L 1DZBA 4ZSOB 2XBTA 1FLTX 2F6AA 4WU5B 3ZDZB 3FQWA 2D0GA 3PXJA 5T3XD 3UOAB 1KCUL 5GZOC 3HKZA 1HJBC 3HNTH 1ERNA 3BW9A 5KUMA 3OZLA 1SDYA 5IMOA 3WNMA 3UXFA 5CMAB 2EDDA 1NMAH 4P23D 1X6NA 2H6PB 3TPUB 5BJTA 4RMUA 1V10A 2K3HA 5E2WL 3RIAF 3G3LA 1PJWA 4LSQH 3L6FA 2VO5A 4L0ZA 1U4EA 3X3GL 5CSZB 4U1IB 5CGMA 5IB5B 1EJOL 1RMFH 5SV4A 1BBJB 2ZXAA 3SCMB 4ENEC 4KJYB 1WWWX 4R2GC 1ES0B 1J9RA 4A66A 1MFCH 2EC9U 5C7XL 5J7CC 5KS9E 3QWRA 2GQHA 4Y16D 4FNQA 4E41D 4YSCA 1YMME 1WIPA 4JAMB 2XV0A 3BSHA 4YVNA 3T6VA 3QFDA 4AMKL 2V9RA 2NPLX 2VXQL 2XWDA 4PGEB 3Q8FA 4YIQB 2HJLB 1M9WA 1SMDA 1M53A 5L2KD 3L3JB 3UJJH 3APMA 2YJLA 4PYHA 4BQ6A 3LQZB 3ZRCC 4B96A 2GJ6B 5GZOD 4XVTH 2ODHA 4PG9B 1AHWA 1HSBA 1Y0LA 5TGBA 3I3BA 5DMYA 4PJGE 4W9HC 2ZXGA 2C1PB 4MDJA 4AQ8A 3QA3B 3IWVA 3UZQA 2ETWA 1RZJH 3DIVA 4PIRF 1RJLB 1N0LA 4F8OA 2ESVD 3MV7E 4LIQL 2B9BA 3FUHA 5HDBB 3A0OA 4FULA 4QYOB 3BKMH 3C09B 3KCPA 1NGZA 3BPCB 3EJYC 1QWNA 2FGWL 4NQEB 3RGVB 2XA3A 2ZJSH 3DV6B 5HYJB 3CN3A 3RJOA 3PNRB 5ADOL 1FG9C 4B9YA 1MDAA 2VLKE 3QDMA 4JRXB 1JXDA 1AO7E 4HP5A 3ILDA 4LCWA 4JPQA 1JK8B 5D7SL 5D7IF 4XCCH 4OZHF 4XN7A 5IF0B