1AS7A

Structure of alcaligenes faecalis nitrite reductase at cryo temperature
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of nitrite bound to copper-containing nitrite reductase from Alcaligenes faecalis. Mechanistic implications.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as7A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as7A02
1N70A 2X88A 2BZCA 4KO7A 9PCYA 4FAAB 1J9TA 1ETJA 1FWXA 2ZONA 4DP9X 3NJMA 2GBAA 3DTUB 1AG0A 3FYIB 3PCYA 2B3IA 1JERA 2Y1AA 2XX1A 3FT0A 4X4KA 4A2DA 1KV7A 1L9TA 2PPFA 1AAJA 2IH8A 3S3BB 1ZDQA 4BDVA 3N2JA 1NIFA 2XWZA 1L9PA 3ZDWA 1JZGA 2GC4C 4F2FA 2GB2A 2GSMB 3ZX1A 2DY2A 3UACA 1AZUA 5I5JA 1I53A 3JT2A 1NICA 1OCRB 5B7EA 3FSWA 2J57A 2VSMB 4F7KA 4KOCA 3MBWB 4PAZA 3AW5A 1PZCA 1JZJA 2J55A 2EINB 2YAEA 4YSQA 2JKWA 1AZRA 1OE3A 2Q5BA 3PLYA 1J9SA 3OM3B 2TSBA 3X1FA 1A4BA 4AI7A 3MX0B 1JZIA 4K9JA 3ERXA 1A65A 2A3TA 4JHUA 1AS8A 3PPSA 4KNSA 2BW5A 2WO2B 1R1CA 5ANHA 1E5YA 5B7FA 4WKXA 2XXGA 4DP5X 1NIBA 4GP4B 3FU8A 4N8UA 2VM4A 2UX6A 2FQFA 1ZPUA 2NRDA 2EIKB 1KGYE 4DP6X 1IKOP 1WS8A 3G5WA 4GP5B 1ASOA 2QT6A 3KW8A 1AOZA 2OCCB 1ET8A 1SDDB 3QQXA 5LDUA 4HCIA 4YSEA 4TXVB 3T9WA 3NP3A 2P80D 2DWTA 1ASPA 2FJSA 1ADWA 5B1JC 1GYCA 1DZ0A 2Y69B 1GR7A 1CYXA 2IWEA 3OMIB 4NERA 2J56A 1PLCA 1HAWA 2IDTA 3WKPA 3AG3B 2WO3B 3OQRA 4DP2X 4F2EA 1KCWA 1CYWA 1BXUA 1IBZA 4W9ZA 1GY1A 1V55B 1AZNA 2UXGA 3TA4D 1L9OA 3X2QB 1GS7A 2N0MA 1SJMA 3RYMA 2R7EB 4E9VA 2JFCA 1QNIA 1RCYA 2PP9A 1PNCA 4E9WA 4KO5A 1W6WA 2PCYA 2HXAA 2GC7C 4GXFA 2FT8A 5F7AA 3HEIB 4QKTA 1M57B 2OV0A 2PCFA 3NJFA 4FA7B 2PPEA 3UADA 2AZAA 2VSKB 1ID2A 2PPCA 5I26A 2BWIA 2HRGA 2OJ1A 2PLTA 3NJIA 2UXTA 4HZ1A 2CCWA 4HHGA 4KO9A 3UABA 3NSCA 3X1BA 3T71A 1DYZA 2BP8A 4G72B 2J5WA 3ABLB 1AG6A 2W8CA 1J9QA 2IDQA 2EIJB 4L0PB 1NWOA 1ILUA 4YVUA 2BP0B 3QPKA 3BQVA 2QPEB 1TEGA 4QLWA 4YSOA 3NP4A 1BXVA 3ABMB 1QLEB 2I85A 1KCBA 2IDSA 3JTBA 1EHKB 2BO0A 2VW6A 4N4YB 4MFHA 3TASA 1WAEA 1JZHA 3OMAB 1NPNA 3QJSB 5A7EA 1E30A 2CJ3A 1A8ZA 4ENZA 1JZFA 3CG8A 8PAZA 1A4AA 3NJNA 5AFAA 3X1NA 1A4CA 1N68A 1CUOA 4E9YA 3WKQA 4YSPA 1VLXA 1BAWA 3SBRA 3GXUB 1AIZA 1JZEA 1WS7A 3SQRA 3S8FB 1JXGA 2IAAC 3C75A 4BXSV 1MZZA 1SNRA 1BYOA 3IN0A 1SF3A 1X9RA 4DPCX 2IDFA 1CURA 2IDUA 4PCYA 3GYRA 1WA2X 2FT7A 3QJVB 1KDJA 2HLEB 4YSSA 2YAOA 1PMYA 1OOWA 1XMEB 2LLNA 3IEAA 3FPYA 5D4HA 2XLLA 3FQYA 2EIMB 3EHBB 3NJKA 3V9EA 1TU2A 2ZOOA 1QHQA 1AZCA 4DP0X 1ZIBA 1MG3C 4NB7A 4AZUA 5B1BB 4BK5C 1ET5A 2P80A 1OCOB 2EILB 1NDTA 1RZPA 1AACA 1PY0A 1WA0X 3IE9A 4BXVA 5B3SB 1NINA 5I5IA 4KNTA 5I6PA 2E86A 2YQBA 4Q89A 5I5MA 3L45A 2AFNA 4KOBA 4YVNA 6PAZA 1SDDA 4AKOA 3KW7A 1AS6A 1KBVA 2MRYA 1M9WA 2IWKA 4E9XA 4A67A 1PZBA 4CSPA 1JVLA 1JXFA 1ZDSA 1KBWA 4A68A 3CDZB 3T6ZA 3TBBA 2MTAA 1V54B 2DYSB 1JOIA 2UXFA 2PPAA 3EF4A 4E9TA 1F56A 3PAZA 4G7SB 3NT0A 3CZUB 2H5UA 1XB6A 2PP8A 3IBOA 3FU7B 2I7SA 3H4FA 5F7BA 1A3ZA 2FWLB 3NYKA 3PXLA 2CALA 1W6LA 2HRHA 2HX7A 1SHXA 3X1GA 3UGEA 1IUZA 2PPDA 4BWWA 4G71B 3T6VA 2R7EA 1GS8A 1ZIAA 1NTDA 2DYRB 1PLBA 5AZUA 2FTAA 4HIPA 3ASNB 1FFTB 4GP8B 1MDAA 2W88A 2H3XC 3EH4B 3ZBMA 2HX8A 4M4RB 5TK2A 1OE2A 1PNDA 5D4JA 2Q9OA 3FS9A 3N55A 1BQRA 2VMJA 1NPJA 1SF5A 3UAEA 3WNIA 1E65A 2UXVA 2XU9A 1OF0A 3ABGA 3WNJA 2FQDA 2XYBA 1AR1B 3WG7B 4UANA 4AX3A 3X1EA 1PAZA 4W1TA 3S8GB 2BP0A 2WSDA 3PAUA 5I6MA 1SFDA 4A2HA 4AKPA 3ZIYA 3NSYA 5E9NA 5FC9A 2FQEA 5B7MA 3FU9A 2I7OA 1WA1X 3FSZA 1L9QA 3CVDA 3S3CB 3UAAA 3FQ2A 5D4IA 1KDIA 2BW4A 3QJRB 3PAVA 4HCGA 1RKRA 4AKQA 2YAMA 2CBPA 4DP8X 5IY5B 1OCCB 3AG4B 1OCZB 4JKNA 5PAZA 1SHWA 2VN3A 3ASOB 4KNUA 1ET7A 2H47C 1XB3A 4HCFA 2GIMA 4YSTA 5PCYA 4NAJA 1KYAA 3T6WA 1B3IA 1NIDA 2CAKA 2JXMA 1FA4A 2GHZA 3TBCA 1HFUA 2ZWNA 4DP4X 4P5SA 4GY4A 2GI0A 5B1KA 4HAKA 2XV3A 7PAZA 2FNWA 1SFHA 3BVDB 1HAUA 1PZAA 2AVFA 2YXWA 3FYEB 3ABKB 3T6XA 4CSZA 5I28A 4YSDA 3DKHA 3FSVA 2X87A 2DV6A 2QPDB 5AKRA 4A2EA 1L9RA 2YAHA 1URIA 1V10A 1NIEA 4KO6A 2AZUA 3NSFA 2HX9A 2UX7A 4BDVB 2XV0A 1E5ZA 3IN2A 4YSAA 1GS6X 2ZXWB 4JHVA 5I6NA 4UF7C 1J5DA 6PCYA 3FQ1A 2YAQA 1NZRA 4BWUA 4DP1X 2YARA 2XX0A 3FSAA 1EZLA 3CDZA 3H4HA 5I6OA 1ILSA 3QJQB 1NWPA 1L9SA 3OD3A 2CUAA 2BWDA 4HHWA 1BQ5A 3CVBA 2B08A 4G70B 1PCSA 3AY2A 2XXFA 3EH5B 2QDVA 2YXVA 4P5RA 2RACA 2AANA 3FU7A 7PCYA 4G7QB 4A2GA 2BZ7A 3QJUB 1GW0A 4E9QA 2FQGA 4YL4A 1TEFA 5I6LA 3FPXA 2IWFA 1OE1A 2IH9A 1RZQA 4YSRA 2TSAA 3NJHA 4EF3A 1XB8A 1CC3A 4GYBA 1AQ8A 2PP7A 2VW7A 4M3HA 3EH3B 4A2FA 3NSDA 5I6KA 2VM3A 3GDCA 5TK4A 1BQKA 1BXAA 3DIVA 2FT6A 1MG2C 1TKWA 3NJJA 1BEXA 1NIAA 3S3DB 3WIAA 1UATA 4E9RA 1PLAA 1ASQA 1IBYA 3SBPA 1GSKA 1MZYA 2XUWA 1E67A 5B1AB 4DPBX 4UAHA 4YSUA 3AG2B 2XVBA 3U25A 1J9RA 2XV2A 3NJLA 4ZK8A 4A66A 1AS7A 2BHFA 1J5CA 4YSCA 3AG1B 3H56A 2YAPA 3AZUA 2YAFA 1GY2A 5EHFA 4HALA 2DWSA 1BYPA 3CVCA 3NJGA 1AANA 3HB3B 1IC0A 3WI9A 1JVOA 1JXDA 2HZHA 1PF3A 4Q8BA 2QDWA 4RH4A 1OV8A 1X9UA 4G7RB 4E9SA 3TU6A 1ZV2A 4DP7X 1T5KA 1W8EA 3OMNB 3SBQA 1YLBB 3V9CA 4BWTA 4WTQA 4DPAX 1AZBA 3QJTB 2VW4A 2BP8B 1M56B 5B1JA 3D12B
chains in the Genus database with same CATH superfamily
2CDEB 2G4GA 3RA7H 4ZOCA 1AQKL 4K3EL 3H42L 1UXWB 3RIKA 1PZ3A 3QIWA 4G42B 4JO2L 4Q0XL 1ZLWK 2H41A 3MJ9H 4GIPD 3FYIB 4EBQL 1IFHL 3DVIA 4CJ0A 5F72S 1ROWA 3P4OA 2X6VA 3UJIL 3EG9A 4V1DE 5GISL 4X4KA 1T1WA 2CNZA 5DU7A 2YRLA 1L9TA 4WEUD 1ZDQA 4WWKD 5KBKA 1U2HA 4AEHH 3F7VA 3F8UB 3MZTA 3HCVB 4FXKA 2XWTA 3H7BB 4PJAE 4YGVB 1NAKL 1NCIA 1MIEH 1WGOA 1U3HC 4IHBA 1HK6A 5K1NA 5D70L 1T1YA 4W9EC 1G7HA 5AG9A 1B9KA 4ORGA 4P23D 4FFVD 1YNTF 4FYSA 4WTWA 4MAYA 1SVZA 4B7IA 3TA3D 4KTGA 3QNZA 1FNGA 1N7MH 5DMGC 3RL2B 4FXGC 4M93C 2NCEA 4P9MH 2QVKA 4G6AC 4QXGL 2EINB 1HL9A 5H4ZA 4RGOL 2CKBB 4J3TA 1G9MC 3N41B 3A47A 3DX8A 4YUEL 3U4BL 1Z9PA 3PL6A 2R1YB 2JIXB 2TSBA 5FOJA 2HFEA 5KUMA 3Q3GA 4XMZA 5TF1L 2DF3A 3W0WE 4JFPA 4EUPB 5E08L 1MCPH 2Y24A 1T5XA 3M46A 3HIZA 4JN2B 4KXBA 4RA0C 5MENA 2WN3A 4NZTH 4DQOL 3DX6A 1KFAL 4LOUD 1LVEA 4MMXC 4PJ9C 4Q9QH 2A73A 2EIKB 1UENA 3APMA 1OANA 2WXLA 4MNGB 4NPJA 2EUWA 3PJSB 2G5BB 1S7SA 3Q5OA 3RVTD 3Q8FA 4B95C 2AHIA 1IMHC 3MA9H 32C2B 3IMWA 4FQXD 3N9GH 4NX0A 1VFBB 1CJYA 2GBTA 4GSDH 3T8XB 3MFFB 1GZHA 4FULA 3TVMA 1UYWH 3NAAH 3HS0B 1YN7A 3VFTA 3RQ3A 4KY2A 3V0WH 4CNIA 4TOYL 1KCSL 5IBTL 4HGWA 2C34A 1Q9LB 2D3LA 2UYLB 4FE9A 2A9NH 3MMEB 4XNMA 3Q8CA 1YYMH 4NP4L 3E6HA 3KBFA 1RLBA 3A21A 3IM1A 4F9LA 4F3FA 4XMLH 3VRJA 2V7NA 3MU3A 4AQ1A 3DNKA 4YMPA 1T89C 1F3RB 4RETB 5SWZD 1QA9A 3MLSL 3MVSA 5IQ9B 3WLBA 1N8ZA 3QDGB 3FUMA 4R2GD 2A6DA 2EO1A 3GINA 3TO2B 3BWAB 1SJMA 2ZUUA 3LVEA 2GABA 3LKOA 5DVKA 1RCYA 2PR9A 4NN5C 1YUHB 1UJ3A 1OARH 4KK5C 5I19L 4HKXB 2AQPA 3BC9A 3MUGA 1F6LL 4RLDA 3S7GA 4KQ3L 2PCFA 4GT0A 4C59B 3TEWA 1QPXA 2HRGA 2AJXH 2IAMB 1KPRA 2GTZB 3RY4A 3U36B 4B53A 1TYJA 5FX3A 2V2XA 2HP4A 3J8F7 4G72B 1EQWA 1AG6A 4LKXB 2IDQA 3DGDA 3CZFA 1QVOA 2KZWA 1N3NA 5HDQH 5CILH 2KQMA 2F54B 2L04A 4M7KL 4NZ8A 2NYYC 5BJTA 2R8SL 2VJ8A 4CN6A 1DQLL 4LLUA 3VFPA 3FF7A 3OC8A 4WI9A 1A7QH 4UZSA 1HXYB 5IQLA 1R3IH 2IGFH 3ILEA 5CMAA 5EF3A 3QJSB 5IJKC 1RFDH 4OQTH 5J1AA 2HTLD 1IVTA 2BIMA 2PYEA 4MNHB 5L9DH 4N0YH 2VO8A 2ZZUT 3CIQA 3NG5A 3I6LD 1QFUH 4XXWC 5D1QB 1AIFA 3QFJB 3NSJA 1RK1B 1ZLSH 3TN0C 1QSEE 4Y2NA 4JFWA 1SMOA 1XGYH 4RFNC 3NRFA 1ZHBB 1VF5C 3BOVA 2CUIA 3RI5K 3V9FA 4AMKH 1SNRA 5AYQA 5IIEB 2IPKA 3C9NA 1INDL 4YWGL 3KLLA 3FSOA 2CO6A 1WA2X 4ELME 5ICXB 3HI5H 2HLEB 5JTWA 3B56A 3EOTL 4AXWA 1JYNA 4LKCA 2BMKB 1D7BA 3ES6A 1RVFH 2XKNA 4IJ3C 2IQ9L 1MXDA 3LNEA 4PJEF 2NUTB 2P80A 4YPJA 2C3XA 4LNVA 5CJBA 1TTAA 3APDA 1MEXL 3BD4A 3BP7B 4G8AC 4XBEL 4J3OH 4NKMB 1VACA 5DC0A 2ESVD 4Q89A 4HIHB 3E2HB 2PWDA 4D9RD 2TRYA 2VH5H 4Z7UE 1JZ4A 4N2DA 2AV7A 2AQ1A 1S2EA 3EBIA 3O4LB 1HIML 3ARQA 5J8OA 2MTAA 4GMTH 4OCMC 4AENB 5L2JB 2O6CA 5I1IH 1H9VA 1UACL 1AO7A 3VGDA 3MCKB 3V55A 3BRDA 5ADOH 4XCNA 4LF3A 4H8WL 3PAZA 3NT0A 3PWJA 5GS2H 1ZLWH 3TO4C 3LIZA 2VL5A 1VERA 4U1MB 3K3QA 1XVSA 4XNYL 3DX0A 3DJSA 4A04A 1IGTA 4NC2B 2YEZA 4OV6F 5KSBA 3JTSB 1SHSA 1OGAB 3X1GA 2PPDA 5DD6B 4LOFA 1WBZB 3O2DH 4PJBB 4LCUA 4BH8A 1WK0A 1GS8A 4PRDA 1O5PA 3O8XA 4F7PA 2PTTA 4PJCE 5IGXL 3HHSB 4GP8B 5HHPB 5EO9B 1A5FH 2W88A 4R96B 4GUOA 3CK0L 4FC3E 2O30A 5E0FA 4WWPA 1LDSA 3WN5B 3Q6FA 2APVA 4J4PD 2AQNA 3PABB 4YZFE 3UAEA 3EW3B 3US9A 1KJ2A 3DARA 3QZWG 3S4SA 4JHAH 2LLLA 3GLAA 4PJ7E 1N0XL 5K9OA 3S5LB 3AT8A 4HP5A 1ZV5A 4RDQF 1WZ1L 1TFPA 4BGDA 2OCJA 4W1TA 1AMXA 4MNQE 4DH2A 4HA1A 3T2LA 5IZ7A 1RZ8A 4MKMA 4A2HA 4I85A 4ZX3A 3SO3C 5EO1A 5E9NA 3UROR 3D4GA 4C4KO 1A6UL 4C55A 1I8KA 1Y6MR 7FABH 1LP9F 2A9BA 4M61A 2PR4H 1J0KA 4Y1SA 4OZGF 3BD3A 3RGHA 2ZPKH 4NUMA 3VWKD 1RP9A 2HUHA 4JM2F 4U1HB 4KKCC 1IEBB 2AMGA 2KLRA 2QMKA 4ZODA 3RY6A 2WM0A 4RMUA 3QFGA 5KYYB 4LLWA 4OU3A 3EYSL 5DZJA 4MDJA 1ND0A 1QR1B 2BOLA 3HI1B 2C3WA 2Q7YA 2AJUL 5PCYA 4APQC 4YAQB 2ITCB 4A2LA 2ICEA 4MCZB 4RGNE 1A2YB 1WFUA 4FZ8H 1OAJA 1BQUA 1UCBH 4YHMH 4TVPL 4OFVA 1TQVA 2DMCA 2DWEA 4P9HL 2QL1A 4L8SA 1UB5A 2P5WE 2ROYA 1JUFA 3GBNL 4TSCL 2UZYA 2ZCLL 2NXZB 3IPEA 5HGDB 2WYZA 3HG1E 8CGTA 4Z7WA 3UIYA 2Z6FA 4LQ1A 5EEYA 4LCWE 2CUMA 3DO3A 3K91A 5F7WC 2ZOKA 3EOBB 3U6XA 2APWA 4V1DB 2X4SA 1JZ7A 4IOIA 4IJTA 1IGYA 2PXYC 4Y7MA 5E1AB 3E6FB 4NDMA 1Z7JA 1AKJA 3VX0A 2OK0H 1WAPA 2YD8A 4UIMA 5GZOC 4Y1AA 3C2AH 3NSFA 2HX9A 2MFNA 4Y89A 4N2GA 5D7JD 3ECBB 4PH8A 4OLYL 1EHXA 2GJPA 3LN5A 3ZY7A 2KHAA 1NZRA 2ZKYA 4FQQB 4POUB 3F04A 3T2PA 3CDZA 2EE0A 4CADB 4DEPB 2JLLA 5IOPA 3RWIB 1NFAA 5EU6A 4BCYA 4F8NA 4JGUA 2EH8L 1U8CA 2BNQA 3MLWL 2NNRA 5AB1A 1DSWA 4J3OD 1G1KA 4HGMA 2I27N 4TTDD 5DSCB 3AS0A 3DI3B 4Y4KA 2JMRA 2O61A 4OKDA 4RAUA 4U2YA 4ZSOE 5BQ7A 4H20L 2AXGA 3PJLA 4HDIA 2AK4B 4UQ9A 1CI5A 3DPBA 4DGIL 2GSIB 3ZMEA 1P7QD 2J8UA 3AU0A 4YXKL 4CVZB 5CLYA 3K1DA 1J18A 4IRSC 2IXQB 3E3QC 4OKVA 4LEBA 4M43L 2VC2L 1VEOA 2VLME 3EO0A 5GS2D 3UH8A 3WIFA 3S5ZA 2VDPL 3AFLA 1E4JA 1OTTC 3VA2C 2EDYA 2H45A 3IJSB 3INUL 4X9YA 3ETSA 5DFVC 3STZA 5T3XE 4FQJL 1OSZB 3RGVD 5E24E 3L3JB 4F7EA 2YQ3A 5JNYA 1TJGH 5F6IB 4Z7QF 2EXSA 1Z5YD 4APXB 3MOAL 2K9FB 3KPOA 4C4KT 3KE0A 2L7JA 2B1AL 3LZFL 3GBLA 3N5AA 3H0TA 5J1TC 4UQIM 4M7LL 2X6MA 1W0VA 1T22B 1XF3A 5FO2A 1CF8H 4IKNA 4QHPA 4WGKA 1MJUL 1YHPA 3KLAB 2J20A 1I3GH 4FXKC 1FBIH 4NNXB 5FO7B 3ZXAC 2MCAA 4IGBD 2N1TE 4HH9B 4EUPG 2XA8H 1MRFL 4JVUA 4BSVA 4Z7NE 5LG6A 2B5IB 2OQJA 4NZRL 4X6EA 4WW1B 2YAPA 3AZUA 5CJ8A 2EIZA 4JKWA 2DAVA 1FZJA 2H0FA 1WBYA 3RWFB 1T0MB 4HPOH 1EXGA 2X0UA 5EU4B 4TNGA 4MSWB 2VLRB 3KYMB 4UIKL 4Y19A 2Z3FA 1HQRA 3MV7D 5MP6H 1PF3A 3N43F 4N2HA 4FFZH 3L5HA 2BCKA 2P49B 3DUHA 4OZFH 5DMGD 5EUOF 2K6YA 2YLKA 1F4WH 3PL6C 4HGKC 4RMBA 3P0YL 4G6AD 2YSSB 2G75B 3JV6B 1TZHA 4KQ4L 5FYJE 1YLBB 3VVVA 2ZYSA 3BJLA 3LXUX 3HHRB 4YHLH 2W0KA 3O11B 3UTSD 1GIGL 2O5NA 3TH2T 3JUZA 3VXMA 1JERA 3ULVL 1WCBB 2A74C 2JKTM 2B1OA 1BVLB 4J23A 3RWJB 1XIWC 4B9FA 1QLEH 1ZHKB 3BJ91 5ANMA 3PCYA 1NCJA 3AQDA 3U2IA 4CMMA 5I1LA 1JTPA 2VLKB 4FF9A 1HZLA 2Y1AA 3QUMH 2FIKB 2O93L 4M5ZH 1GZHC 3TVMC 3IMRA 1MHHA 3IRZA 4L8DA 3RHWF 4KX8A 4P5MB 2AEIT 3GMPA 4DUWA 4PP2B 1H3PH 1JHTA 4XBPA 4UM9B 3L7FB 3W9DB 2HMIC 5T8IA 2HFFA 3WY3A 1HS6A 3ZRCC 2R29L 2WWKT 4ZBJA 1E43A 1RP8A 3WFCL 4F9LC 4NNPH 3FH5A 3MJ7B 1CFNA 4ODVL 2VWEE 3FXIC 5DRZA 1LEIA 4Z3GA 2F19H 2C3VB 3L3HB 2JK5A 3QEUA 3U2SB 1QBLL 2OMTB 3S3SA 3FN0H 4TVSa 1CI3M 5FF6B 3PQYE 3SDCC 4ZMZA 1ORSA 1IBFA 1UJ3C 2R39A 2QSCL 4JFEA 3MV11 5KVEH 2ZP0T 4PV8B 2BVEA 3PXJA 3MLTB 3VB8A 3ZKQD 2F5BH 4BINA 1KXHA 4X4YA 1QOKA 5LUMA 4Q6KA 5IROA 3L5JA 3N44B 5D71H 3KJ4C 2ENQA 4HS8L 1XR8A 1VPOL 4U1SB 3SPVB 1ZJBA 5LWYH 1AYRA 2HT4C 1JRHL 1D5RA 5ILTH 4IEFB 5KOVC 2FEJA 4D0DB 5BRZB 5C7XH 1JGLL 1H0DB 3FONA 3LH2L 5ESVA 2HT2C 4TUKL 1HL8A 1TVHB 4NIKB 2BNRD 2VZOA 1O5DT 2DWTA 2BIIA 15C8L 2VSCA 2FJSA 1RZ7H 4LHQB 2NXYC 1A1NA 4KVNH 1Q38A 3GIZL 3TT3H 2FECL 3EDEA 3GBML 4WO4A 2BC4B 1J5HA 1KLFA 1ZS2A 5L0QC 3SGDI 1XH2A 5D1ZB 3MR9B 3KWTA 5C08E 5I1DB 1G7PA 3NEEA 4JE0A 1VZIA 5IB5A 4JKPL 1PD6A 3B9EA 3CZLA 3D51A 4LK4A 3KLQA 4K3JL 2HT3C 3HE7B 5F21B 5F7EL 4X7SL 4N3TA 3X2QB 1ZAGA 1C5CH 4L4TE 5A2IH 4PJCB 3PV6A 4AGQA 3SBWA 3AT0A 2R7EB 3WIHH 2JFCA 4HV8B 1EMTH 3BGMA 1PNCA 3QNYA 3TN0D 2IPTL 1U4FA 4I89A 1G9HA 4KI5E 5F1IA 3U6RB 5IMLB 3VD2A 5TDNA 3W11D 4M9OA 3QYMA 2E9WA 1Q72L 5EO0B 4Y9EA 5KVGL 2VSKB 1ID2A 4DKTA 3KPQA 3HI6L 4LQFL 2Z93B 2PCPA 4HUMB 2WIIA 4X99B 3LSOB 3PU7A 5K39B 5ISZA 3L08A 2Z7UA 3MRCA 4GT7A 4ZDHB 1UM6L 5D6CB 4L8BB 3BSGA 2FO4A 3V79C 4PRNB 1EEUA 4DUVA 1OO2A 1PIGA 1IGIL 1BV8A 3V4VL 4ZMXA 1DUZA 2PABA 4RGMC 3K8LA 3ARUA 3EJTA 4HKJB 4WF7A 4KK6C 1P7BA 5ICZB 1S3KH 1A7OH 3QCUH 4OSUL 1BJ1J 3JWOC 4KUZL 1Z2KA 3WE1A 2QSTA 1KJMA 3CD4A 3OJ2C 1IAOA 4G1MB 1MFCH 3P2BA 2JKIS 5AUMB 1A4AA 1QX1A 1MHEB 2DEWX 1XCWA 1FO0H 2OMWB 5TE7L 3RFZB 1LEKB 2CO4A 1DUYA 2WYHA 2FWOB 4KDVA 1G0DA 4FZEH 4NQDE 1B88A 5JXEA 1CU4H 2ROXA 2VDQB 2BHUA 4MRBA 4HJ1A 1KNOB 3L1OH 4KC3B 5D9SA 3S5LG 3KS0J 2IANB 2V8LA 2ZOLA 4ZFFB 4M8QB 1U30A 1WFOA 3DIFB 4PCYA 2ORBL 1DSFH 3D2TA 5D5MB 4I5BB 5EZLA 3O8XC 4TSAH 4N1CA 5J12C 4HWEH 2CLZA 1XR9B 5KYXB 1KPVB 3ULSB 1FZOA 2ADFH 3U48A 3X14A 3O3DA 3K4ZA 1E4WL 4QHMB 2XN1A 3CFIC 3VXRE 2KERA 3FFCB 1IQWL 3G08B 4NJAL 2ICWB 3CZJA 1DQKA 2J1ZA 2R1XA 1AFVH 1F13A 3ARYA 4NSKA 4PY7B 1NC4A 4M1GH 1MFEH 3IDGB 3DIDA 5F7HA 5J3HD 3OAYK 1HYRC 5D2LE 4MZIA 4HLZG 1GC1C 2F68X 4RFOH 4KTEH 2UY6B 1AS6A 4YDJA 5E8DL 1M9WA 1DN0A 3KWUA 4AVJA 5ALCL 1ZDSA 4LL9A 2AJYL 3SDXE 1T6WA 2AJSH 3MFGB 5FFGA 2ZXGA 2ZX5A 1FPTH 3CVHL 1KBGL 2UXFA 3W37A 3HMXL 1WVZA 3EAKA 5SWZE 3U1SH 1SBBA 4UU9A 4DZBB 3O2VL 3BPLB 2H5UA 2EAEA 1TO5A 1R3KB 5I1HL 1BJ1H 3LN4A 2QQLH 3IMSA 2EDQA 1FFNB 2QELA 4KJQC 5D1XE 1HSAA 4I9XA 4KHTL 5I8KL 3F12B 5C7ZA 3RWGA 4UB0H 1MFDH 3BAIA 4ETYA 5D72H 1T7ZA 2Y36L 1OD7A 5I76B 4KKCD 2CALA 4U3CA 1RD6A 1Z6JT 1S7QB 3IJHA 4H25A 1NFDF 2XFGB 3OB8A 1AHWC 1MI5E 5I1CL 1DJZA 3VYPA 4X80H 3KWWA 3UC2A 4LSSL 4EI0A 5CZVH 5CJOL 3V5DA 4APQD 1CDIA 4X8JB 1KTKE 4ZPTA 2H3XC 5DK0A 1HILB 4PJFE 1CD1B 3KS0H 4NN6C 5F88B 3TIDB 3FS9A 1FHGA 2VMJA 4NUJA 1BMWA 3CDGB 2D0GA 1FFPB 3ATEA 4MMYA 2RHEA 4OCXL 1CL7L 2DICA 2WNGA 4OM1L 4QI3A 1WH0A 5LGHH 3CC5B 3WNJA 5L2KA 3FQUA 3GMOB 4XNZC 1X5HA 1TNMA 3FQWA 4ODXB 5ADPL 4J3BA 1P0SE 2VAJA 2PXYD 2I5YL 5I6MA 4PGCA 2J3SA 4UOJA 3IAPA 5LO7A 1D5MA 3LRMA 1CG9B 3UYOD 2QQNL 4XHJC 1LJMA 4OV5B 1EO8H 4NQXB 4ANUA 5GZOD 1EFXB 4EN2A 3UAAA 1P9MA 4YS4A 5C0BA 5MEOA 3ZSSA 3B3IB 4LAJH 3UTTA 1FG2A 4DEWA 1RKRA 2NTFA 1I9IH 4FNQA 5HGAA 5E95B 5H35A 1TTBA 4PW4A 2J6EL 3HBPA 3WOVA 2W59A 4BZ1L 3BAYA 5JHLA 4JFDA 3BN9C 1G0XA 5TE4H 4N2IA 4PJIE 4DTGL 2E46A 3S5YA 3O3EB 3KVDD 2JTDA 3T6WA 1JYVA 2CKBL 3HZ3A 5E4AA 2PYFB 5E9DE 3FB7B 5KUKA 4PRPD 1NGZB 2GI0A 3ZL1A 3QUKA 2VMEA 4WGWB 5A2LH 1HJBC 1A6AA 5IWLA 1JMZA 2R59A 4FNLL 3JV5A 4Y16A 3OHXA 1NLDL 4N8CH 3VFVB 3VXSD 2X4OB 1OPOA 3LCYA 4CSZA 4JM0A 1WEJL 4IK6A 2ESVE 3X11A 5AVTB 1W72B 1QQDA 2YSTA 1KPUB 1E5BA 3LRSB 1FL5B 4BSWA 3I6KB 1UT9A 2R2EB 3LEVL 2NY3D 3FRUA 3OKDB 5E99L 1UD3A 3UG3A 1OTTD 4R26L 4YDKL 5KBNC 3C08L 1YDPA 4XR8C 3UXFA 1YMHB 3VG0L 3QIUB 1KB9K 2A1WL 4LARL 4LCYB 5TF0A 3IN2A 2ENYA 4ZMLA 3RIFK 2XG4B 1QSFE 1OZTG 5KSUA 3HPJA 3WJJA 4UF7C 3ASWA 3QIWD 2K3TA 4O51A 1ZPLA 3FUDA 4HHAB 2V9UA 1HCVA 3DUUB 1MXGA 5E4EC 5EU5B 1YEIL 3TIEB 3OD3A 3QPQD 3VFNA 3UEZA 2LGNA 2DJMA 3MRJA 4HHWA 2JKJA 3AY2A 3QHFL 2G9HB 3TT1H 1YPZA 4P5RA 5K59F 2V3EA 1X5MA 1RURL 5J9PB 3U9UB 3UBXI 2FSEA 2QGBA 4H2CA 2DLGA 4K55A 2WXFA 1GHFH 5DDHB 4LNRB 5GRYA 3GSWA 1E9OB 5DJ8B 1QKZL 3ZO9A 3KPSE 3A4EA 4QOKE 5DJDB 4LDLB 3TESA 2X6CA 1L4IA 1BJMA 4WHTB 5C0JA 1YMME 5SX4I 5BVPH 1AY1H 3MI6A 3PL6D 2XFXA 2DIJA 2FL5B 2F58L 5C0NC 5I6KA 4KRPC 3Q13A 4XPBL 4ZFOA 1BXAA 5GGQH 4A7UA 1T4WA 1AXSA 4OI8A 2H1XA 3JWOH 4NZFA 5MEND 3EJSA 2FJGA 2XWXA 3IMBA 5E8NA 1MJ7L 3NTCL 2ZCHH 3BWUF 4EI5C 3LY6A 2H2PC 3D05A 2C4XA 2ZKHL 5CWSA 1XAKA 3MNVA 2OW7A 1TITA 1UZ8A 1XHHA 3OKMA 4PRBB 1J48A 3LIZH 2V17H 4H1LH 3RFRA 4P46A 5KEZA 5GRWA 2JCCB 3GSQA 2FYVA 2X3BA 1PG7W 1QI3A 4X5PA 1MCDA 5JHDB 3TVMD 2ADIB 5F9JB 2GUOA 1CFVH 1CLYH 2ID5A 5E6SB 5FIEA 5CR8A 2CJUH 5BXFB 4J3XA 1QFWM 4L5FL 1I7ZA 3QEQD 1U8PB 4XP9H 5E8PA 3WMSA 3IJEA 1I9EA 4QGYA 2R4SL 1P7HL 2I07B 4Z3JA 3E0GA 3VQLA 4X2UA 5F1KC 1SJXA 5AW1B 1OW0A 3QWRA 4PI2A 1BAFL 4QTIH 3ZYOA 1KY7A 3AWFA 3UZVA 3WNOA 4OFKA 4HU8A 1CBJA 3MLRH 4XCEA 3IDYC 4F92B 1RUAH 1PDKA 5DEGB 5JOFB 3SJVA 1FIGH 2YK1L 3BKYH 4KUCD 2A2QT 4WTQA 3IAQA 4JO4L 3GEWB 1I3VA 5DFWH 2OZ4L 1GC1H 5D1XC 4TLUA 1DQTA 4G1EB 3A4AA 5EEZA 1F00I 3VFSB 1EJOH 1QBMH 5E4OA 5KSAA 5HHQA 3P4MA 3NJMA 5H94B 1QO3A 2YD2A 2L0DA 2IALA 5I8EA 1KSRA 3P30L 1ZEAL 1KXVC 5DD3H 5E8OA 4P23B 5E6UB 4OLVH 1A1OA 2HT4D 3AJ7A 4NHCL 4Q2ZB 2YD5A 4TRPL 5KVDL 1JG9A 3TA3B 2W91A 1MW2A 3ET9F 4BDVA 1NIFA 3FOLB 1GGCL 2BVTA 1G7MA 5I71B 3WIIL 1TNNA 2GC4C 2GJRA 2P8MA 2XWBB 1I7TB 5D7IF 5DS2A 4V11A 2P48B 1KB9J 3BVXA 4X8XA 2GSMB 1IC1A 4IMLA 5IB2A 1Z3GH 5AOJA 2DIBA 2V7HA 1ORQA 4L4VE 1I82A 3TS8A 1QBBA 5KS9E 3UTZA 1MIML 4CJ1A 1SOSA 3RX7A 5ACMA 1BLIA 4G6MH 2GK2A 3FCSA 2PTUA 2BHYA 2YAEA 4BFFA 4FABH 2WZ6A 3W5NA 1QEWA 4HZLA 1GH7A 1RZIB 2PYED 2YWZA 1W80A 3DSFH 4FFYL 3SBWC 1R3LB 2HT3D 3MX0B 2B2XL 4ZMAT 4O02H 4OUOA 4FQPA 1K8DB 4FQXB 3RDTC 1CO1A 1E6JH 2J4WH 4GI8A 4GRWB 1CGVA 3OKYA 2XXGA 3EBGA 1LD9B 3VI4A 5DCCA 5CD3A 4IBSA 1J1OL 2FBRA 4I77L 2XG5A 2WLYA 1D6EB 4XC1H 5TH2B 2B0SH 5CEYB 2HYMA 4N24A 3VRIA 3NABH 4QLRA 5FYLH 1OAZL 1N10A 3WCYA 2OMXB 4JANB 1WBXB 4JPIB 2W38A 3MGTB 4AJWA 3THML 2P80D 5DMIH 1ASPA 4TPRL 3KJ6H 1RMFH 1EERB 4PFEA 2VDNH 5E7BA 1GYCA 5KAQG 4PB9H 4R2GB 3ECUA 1NLBL 4NERA 1H3VA 1CFSB 2WKGA 4LMQE 4DVRL 5I1EH 1G6RA 1BP3B 1DVFA 4WDIB 3RRQA 1G1CA 1QZNA 2VDMB 1CB4A 4MXWH 4N2CA 5EN2B 3SPCA 1E3FA 3V2AR 3NSXA 1NL0L 4OI9A 3ARBA 3NCYS 1ECZA 3WEXB 1BG1A 1AO7D 1L9OA 5AAMC 2XHNA 4PBXA 3HZVA 3CPUA 5KSVA 4ZTOL 2YMXL 4Z0BL 1JNLH 3C5XA 3VE0B 2XVKA 2PCYA 3DOSA 4NWTL 2L7QA 2WQ8A 3UTSE 1CVSC 1I1AA 1VEPA 3HEIB 4XMPL 5BW7A 3NIDF 3HC0A 3QHZH 4JPVH 3L3OB 2EDRA 4LVOB 2FRGP 3IRPX 1YEEL 4FQIL 2VERN 4KZDL 2PLTA 5DTFB 2ZCZA 4JRXA 4GAGL 1D5BB 2UWEF 3X1BA 3O8XD 3HNSH 5DEZA 4QRRA 1I8IA 1WJ3A 3DROA 3QCVH 4P2OC 2CJTA 4AGLA 4YVUA 2AXFA 3AQXA 1YC8A 3ZTNL 4UTAL 1BYNA 3PHQB 1OWRM 1S9YB 4DAGH 1JN6B 3KL0A 5J6GA 4QYOB 3ECQA 4N9OB 1W2KT 5AZEH 3TASA 3OJDB 3LYRA 4K23L 5TPWL 5B8CC 2HVJB 2O6PA 3O3AA 3OSVA 4Y4HB 4X5WB 3N42F 5IG7A 2ATAA 1E30A 4CSTA 4OD1H 4XMXA 4HS6A 2F6AA 4K3DL 3D30A 3VXOB 4C4UA 4PJIB 1LO4L 3UZEA 3D5OF 3WL9B 5LAXB 5L6YH 3BWZA 2DLEA 1I9RH 4IU3A 1TZIB 1VFAA 1A14H 4L29B 4YSPA 2EVIA 4ODBD 1FV1B 2Y1YA 2X12A 1E4XH 4HWZA 4AIZA 3SBRA 4UQ3A 4JM4L 4FL4B 2V2TA 4Q7DA 2A83A 3CZEA 1QLFA 2P9RA 4HUWA 4JRYE 4LLDB 1JK9B 2OTUA 1ONQA 5K93A 1T3FA 1D5XB 5EU3A 5LNGA 4KJQD 3ZRFC 2AJVL 3CBRA 2IMNA 3L54A 4IMKC 5IVZA 1QD0A 3KBPA 3CSYB 4MTMA 4WFHD 4G8EB 1HEJC 2ZKWA 1U8NB 2WBXA 5DJXA 1N0LB 2X1OA 1ZA3B 1MRCH 3NVQA 4KKPA 2AEWA 2YGQA 1ZK9A 4TUUA 3UGXA 4PRIB 5AKSA 3AT9A 2WXQA 5FO9A 2RBLA 3OKNA 3K6SB 1XSOA 4BFBD 3BRFA 2XWJA 1XD1A 1FAIH 4KNTA 1WZLA 3ALPA 1T4KA 4ETQA 3IKCB 1I7RA 5ACZA 4KMQA 1WZKA 2WC7A 5EF2A 4TQEH 3BN3B 3EIFA 4HS3B 2R29A 1EEQA 1DEEB 5GS1B 2VNCA 3HBQA 4YHOL 4P57B 1AKJD 1TETL 2ALAA 1S7VB 5CBEB 3V8CA 1E8WA 1P9MC 4C4BA 1K6QL 1M6OB 3MV9A 2EDLA 1BFTA 1GAFL 1BVKA 3GT6A 4XHJD 1NGPL 3K6FA 5F93C 3JZ7A 1EZSA 3LDBB 3SN6N 5F2FA 3QC5X 1KXQA 5FYLD 1OTSC 2JKRM 4ZX5A 4DUXA 2G9KA 4HIJA 5F7BA 4MA3B 4KRLB 5DJZA 5H37G 4PG9A 2X1QA 5EU6D 1F4YH 3LPWA 2DQEH 5CINL 5EOTB 3UGEA 2BNQD 3HZYA 4JQXA 3X3GH 1PIFA 4WSKA 3T6VA 1B2YA 3PPEA 5JPMA 4WY7H 4XVSL 1M2VA 3P3TA 4Y4KD 4A63A 2CO7A 1ZXQA 1GW6A 2K4WA 2Y7QA 1OQXA 1S9VB 2VITB 4FJ6A 4X50A 5BRPA 2DQHL 4LFHD 2YOAA 1LE9A 4ALAL 4CDHA 5G55A 1UVQB 1JPTL 3T3ME 3VWKB 1UZ6E 2ADJB 3V6FA 2P8PB 3WG7B 1U21A 3OAUH 4N87A 3MUHL 1XF2B 2X40A 1RERA 4G80A 3VMPA 1KEMH 2EEFA 1L7IL 1HHKA 3EOAA 5KOMC 2BP0A 3TPUA 2GG1A 4PV9B 2VZVA 4X8GA 3OF6A 1W0WA 4X9HA 5DFAA 4ZTPH 2I9TA 2HG5A 4UT6L 3MRDA 3Q2CA 5AL0A 1KN2H 4IBYA 5F7LB 1H3XA 4JDZB 4HOXA 1N5AA 4HCGA 3TJHC 3W2DL 5D7LA 5IY5B 1PKQE 5DJYA 1S8DB 3BDYH 1YECL 1F42A 4ZMYA 3WS3B 1BM3H 2YD4A 5JR1H 5EBLA 1CFTA 1YN6A 2J1WA 3Q44A 5I0XA 3NIFF 2H3KA 1MKFA 1U91B 4LLQA 3D3VE 4PJGE 1VENA 2AQSA 3ML8A 3C6SA 1RUML 4RIRA 3SDDB 1CDCA 3UOAB 1S4IA 3M86A 4EVNB 4YHKL 3IS0X 3TURA 2Q3XA 1RPQA 4U6HB 5C3LD 5CXPA 4Y19D 3RTQA 5DR5L 4HK3J 5D7JB 5D93C 4PJEA 5EPMA 5BOJA 4J3VA 2X87A 2PCXA 4HXBL 5DC4B 2R2HA 4PJHF 5C0FA 5JQ6L 4GFXA 3GI8L 5DJ2A 3EGDA 1AJ7L 1URIA 1H8NA 3HLAB 1NIEA 3VI3F 2BNUA 2FK9A 4L3AA 3VRLF 2CGRH 5IEKA 4X7DC 2LFEA 5C0ND 3D69A 3ZDZB 1HHHB 1OLLA 1YQVH 2O5ZH 3B8SA 1OVZA 2WBJA 3P0VL 3VXMD 1BQSA 4UINH 3QZWA 3JWDC 3BSZA 1B9ZA 1UKTA 4JHVA 4G6JH 3FQ1A 2YAQA 3ECVA 5HGHB 3DC0A 1BBDH 2H2PD 3K7UA 3ZE2E 2D9CA 4XNUH 1PLGL 1AGBA 3ROOB 3WXWH 4M3KB 3OL2A 5FW7A 1P7QB 1Q94A 1QI5A 1JV5B 2YXVA 4J3UA 2I32A 4AZ8B 4GOSA 4F8QA 4G7QB 1XEUA 3DV6B 1DN2A 1XGQA 3PDOA 2VXSH 4Y2DA 3GB7B 3QQ9C 2WLKA 4N2NA 4Q0XH 3WUWB 3DVGB 1V7NH 2ZG2A 3RGVB 4EBQH 1HJCA 1IFHH 3EGSA 3ZDXF 3IFOB 4PJXA 2QADC 1AQDB 2WWMC 1GGBL 4LSRH 3SDAC 3O9WA 1XB8A 3IFNL 4Y9FA 2D0HA 1U2YA 3M07A 3RWCA 3H2PA 1C8QA 3O45B 1UKQA 3D39A 4GAAA 2CIKB 3SZKC 2DQCH 3WXVH 3OX8B 4A2FA 4NFBA 3MRBB 3O4OC 2Q0ZX 1IGML 4JFED 1C1EH 2HWZL 3PWLB 1Z3RA 1BQHA 4MJ5A 3REVB 1Q1JL 1BEXA 1RULH 4IGBB 3GRWL 3WIAA 5KSAC 1MFAL 2HKHH 5IROD 4L3EA 1ED3A 1KB5B 3HMXA 3F00A 2CR0A 3JZYA 4HUXB 5KN5A 1MZYA 5C0IA 1SJHA 2NUPA 1O6SB 2AF2A 1R5WB 4LLAA 2O26U 4RGOH 2EKSB 3BIKA 4DOHB 1B3JA 4DPBX 3QR2A 1DJSA 3TEZA 3EYUH 3MV7B 4NKDA 1TYRA 4P4RA 1JWUA 2BDNL 3SSGA 3Q2LA 2A5UA 5E08H 3PGFL 4E41B 4GH7B 3QT2A 4RESB 3QQ4B 4L9LA 3SCMA 5KW9H 2XWEA 2CDFB 3AS2A 1GPOL 1R24A 1JWSA 2B9AA 2OMNA 2XA3A 4I3SL 4S2SB 3OJMB 5A6IA 3HN8A 1CGSH 3MO1A 3R06A 2B1HL 4O9HL 4L0YA 2VDQL 2C1PA 3LNGA 5GJTH 2Q76B 3GUFA 1JXKA 2FBOJ 3KR3H 3B4NA 5IMKA 4H40A 4GW1A 1OV8A 2EYRB 1ZY9A 3QUXA 3WTVA 3WHE1 4C56A 2N0KA 4TUOB 4U1LA 4MMXB 5TD4A 3RIAK 5HHME 4MLIA 1EVUA 3MJGX 2X4TA 1A6WL 1JGDB 2XI9A 1Y7VA 1I8MB 3QJTB 1UKSA 1YA5A 4FCAA 4ADIA 5KJRL 2GJZB 3RDTD 3VQ2C 2ADGB 1SMAA 2F5AL 4LSTL 4MMZC 9PCYA 1J9TA 1DANT 4LRIA 2R9HD 4WU7B 3R8BB 3ZDYB 4DP9X 1IBDA 5DT1H 3RWDB 2VZUA 1CR9L 1JCVA 4KTYA 3HCVA 1RSFA 4ERSH 2AXWA 3H7BA 3FT3A 3CMOL 2VLJE 2CKNA 4HT1L 4WUUE 5I0ZA 1BVNT 1X4XA 3N2JA 4MA7L 4UMSA 4YJZL 5ISZD 1BPVA 2J6EA 5SWSD 5DZLA 5JHLH 4ZI8A 3UJTL 4GB9A 1RPKA 2X6AA 3RL2A 4YE4L 3PUCA 1B4RA 1C5DB 3BKML 4AVKA 3H8NA 2I25N 1NCWL 4EIBA 2J57A 2K4AA 2KQNA 2MIZA 4O5LH 1JGVH 2GJ6B 2JIXA 2R1YA 5DRNA 3ARBC 1NMAH 1KIQB 2DBLL 3GSUB 4KZ0A 5IW6B 1QWHA 1MHCB 2IWGA 3ZQWA 4EUPA 2Q5BA 3PS6A 2X4RB 4JN2A 1YEFH 5DVOA 3GHPA 1NMBL 4F7MB 4MS8C 4K9JA 2VQUA 1TCRB 3MOQA 3BEVB 4AWJC 2XY2A 2XTJD 4XO5A 4ANVA 5EIVA 5B39B 2CDGB 1OZUA 2EYSB 2BNRB 2RB8A 3QXDB 1NEPA 2EIEA 32C2A 4BZ2L 1AD0B 2F61A 3KPRE 4K7PX 5MENE 4URTB 1KTDA 4TUJB 1FVDA 1KGYE 3MLUH 2JJSA 4K94C 5FUCE 2AI0L 2JLPA 4N8PA 4XPAL 1DLFH 5IEHB 1Z9SB 3QUYC 5HI3C 1Q9LA 3V0JA 1A6PA 2FLRT 2V8MA 1T1ZB 4JHWH 5JHBA 1VGEH 2C8NA 4XN1A 3MMEA 1KFGA 1QFHA 2C9XA 4JZJA 1DQDL 5DZNA 4D8PA 1XT5A 4KGJA 5SV4A 5IQ9A 3E7JA 1EUUA 1E27B 3H3KA 4Q56A 3QDGA 2ZUSA 2CPCA 4DGYL 3TN0B 3TO2A 2P42B 3BWAA 4RFNB 5FDWA 2VGLM 5EA0L 5AD0B 2EC8A 1AZNA 3BAKA 4YC2C 4FTVA 3T2NL 1YUHA 2QVFB 4WJG3 1WD8A 3TTYA 1GS7A 2W65B 1BZ8A 4AVHA 4G6KL 5E2TH 1UFGA 1F90H 3LB6C 3RNQA 4B5ZA 3LKRB 3I3BA 4LPTA 5JMOC 3FH8A 1CZ8L 4IJ3B 5EU7E 3U36A 1PAMA 3CUPA 4EKXA 3GNMH 1EXUB 2FGWH 4OZFB 5CCHE 5E94A 5CEZE 4FQHB 1HKFA 3G5ZB 3NJIA 5AVWB 4LRNL 1CMOA 3TYGL 4RMSA 4AEIL 3JWDH 2ZUTA 3CV5A 4ZX6A 1K4DA 2ZSWB 4FHJA 2F54A 43C9A 5IT2H 1BEYH 1PGRB 1UWEL 3VW3L 1FH5L 1T04A 1FP5A 4HJIA 3ZKSD 3O6ML 3M1CA 2ZYHA 3OKLB 4KKLD 3WENA 1Q9OB 4X4ME 2VTFA 4JPQA 4DO5A 4AW4A 2M1KA 2XRAH 4G3YH 1BXVA 2OJZL 1QLEB 1EZVX 1RZGB 3ZOAA 3NIGF 2NW3A 2VW6A 1KZYA 1KG0B 3QUMB 1XQ4A 3OMAB 1S7RA 1S6NA 4XVOA 3K0YA 1CGYA 1JGUL 2ZX7A 2EEBA 2AQ3A 3FU5A 3ZYJA 3QFJA 1R75A 3B2VL 3MHZA 1MLCA 5HI4C 3HC2A 2Y25A 3D07A 4QXUL 3VX1A 5JORB 2XN9E 2X38A 3DYPA 3RBSA 4FQ2H 5IIEA 3BMVA 5HPMB 3QDJA 4JFZL 4NRYB 1AGFA 3FCGA 5EIIB 4KJPC 5EZJA 3QPXH 3BPNC 4WTXA 2O72A 3B7TA 1N67A 3PUUA 3IN0A 3CHRA 2OMVB 4UWQB 4UQCA 1OTSD 1X9RA 3OG6B 4FI8A 2BMKA 3ZT6A 2WJ5A 2FE0A 1JJUA 2JJWA 4JQXC 3ZGIA 5I75B 5FA3A 3QJVB 1EAPA 4JFDD 2EADA 4YSSA 3IMUA 5JPMC 3RLSA 1PX8A 3ARPA 3BP7A 1MPAL 4UQDA 4UTCA 1NGXB 1AZZC 3DTXA 4DP0X 1MG3C 3F58H 4Y88A 3IMVA 4HIHA 1TVBA 2C1OA 1BSIA 2IBBA 3FT4B 1H3GA 3JSSA 4Y2OB 5FFLA 3BLBA 1A9EA 5KJ7E 4ZQTA 2DWDB 4UDUA 4Y16D 2UUDK 4OVUA 2JWYA 3IU4L 2E86A 2JQZA 3L45A 3O4LA 3SO3B 3LNHA 4FKHA 1LO5A 4YVNA 2VZTA 4AENA 5FK9A 5L2JA 3B1UA 3EYSH 4X6BA 5FFOA 3NQIA 1JHLH 1QFWH 3GSOB 4F8OA 1CIDA 4NCC1 3DO7B 1OAQL 4XI5C 2H6OA 1TLKA 2F74B 2WINB 1QYGH 3CAFA 4TVPH 1NCNA 3P9LB 3JWNE 4FHKA 3DSNA 4F37F 1KCLA 1AO7E 3VGEA 3QEGL 2F9BT 3MLVH 3LKQA 4APQB 1OGAA 4LOVA 1C5BH 2CHDA 1RZFL 3M45A 3SPHA 5IVXB 3TJHD 1U8LA 4OH2A 3UPCA 2BWQA 4OZHE 2WUBL 2OTWB 5HHPA 5EO9A 1HC1A 1MWOA 4K7PH 3P73B 3TNMB 1L5GB 4F8TA 2GTWB 5C0DB 2ATPB 4H8HA 2DJ4A 3L2MA 3VMOA 3S88L 1MHPL 3WN5A 3LZLA 4IHOA 5G5DB 4EDXA 4UYQA 1LQBC 4CVUA 5F9WC 1UA7A 5I1AA 2WAHA 1SXZA 3CHSA 1F6FB 4KU1A 1BF8A 4J3OG 4MB5A 4OLYH 2G30A 2PXYB 1FFOB 1QW8A 1NANI 5TDPB 3DVFA 3D4ZA 1SF5A 1UOKA 2G2PA 1OM3H 4M48H 4W9IC 1JS4A 3AGWA 1E65A 5IBLC 3EHBC 4XX1E 3SGJA 3KXFE 2AEOA 2JE8A 4FMFA 3WFDH 2XJKA 1YYLL 1NAMA 5ECJE 2Y5TB 3QE5A 5I15L 4IU2A 1G6RH 3GHBL 2IBZY 3GO1L 3W82A 1SFDA 3IFPB 4H20H 3UGUA 3HA0A 2G60L 2XZCH 1OGTB 3BW9A 1IEBA 5D7EA 5IVOA 3WUWG 2YN3A 4YXKH 4I1NB 2JCWA 4PRPB 3DRQA 1UH2A 1ZOXA 3HKFA 4CKVX 4XBGA 1QWNA 5LGYA 2Z4QA 2ITCA 2WXOA 3FUFA 1SHWA 4U3SA 3V4PH 3T3PB 3V4UH 2QLVB 3INUH 1GTNA 4ABVA 3VXSB 3ZE0B 1FO0B 2GAZB 1WAAF 2OSLA 2QTEA 3PIQA 3V52L 4HFUH 4N90E 1RIHL 5HGDA 1OEZW 4WFHE 5T33H 3MACL 4R90L 3QC6X 4Z7VB 1VSCA 2EE3A 4MYWB 2NY3B 2XWDA 4K94H 1MFVA 3LZFH 4M1DL 2A77L 2XACC 3QQ9D 1U3JA 3O9WC 5DQ9B 1DDTA 1BD2A 1D5IH 3RKPA 3U7YL 5AAPA 4RWYL 4YSDA 5AW6B 1LL1A 4Z7WE 4UOQA 3RJOA 4FEIA 3IDXL 1Q0XH 1YNLL 2Z4TA 5F44A 2E8ZA 3EG9B 3SJVD 5HYJB 2Z7WA 3VXUE 1A7RL 1T1WB 2WOBA 3V6ZB 4FQQA 5EU7C 4Z7AA 4CADA 4DEUA 1MFBL 1OAYL 4FXKB 4UIKH 3T1FA 4Y1AE 2FATH 2ALWA 3HKZA 1ADQH 1AP2B 5HHOB 3T04D 5KSAD 3TJPA 1A22B 5FM4A 3R7RA 2QR0A 3O0RL 4YLQT 4YH6A 1JZ3A 5KVFL 3LXAA 4ORGB 4ZQKA 1HXKA 2R4RL 3D2UD 5FYLE 5I18L 3AMLA 3DGCR 4FS0A 4G59C 4YXHL 4JM2C 2VDML 2V9QA 5IBUB 3QNZB 2XSKA 1FNGB 3QIBC 4NCDA 3S37L 5EU6E 4YQXL 3B3BA 3KGRA 3IDUA 2GSIA 4G8GE 2XZAL 5CEXA 3PL6B 2OYLA 2H9GB 2W60A 5LG1A 5HYSA 1NFDA 3Q3GB 4QEGA 3EYQC 1IBBA 1T5XB 3EO9H 3VXNA 4QNPE 2X44D 4DVBB 4TVPD 4DKFL 3IJSA 5FDYA 3R0MA 2J8UE 5BRQA 1OSZA 4NYLA 3KLHC 2A74B 3MLXH 2A73B 2BOCA 2K45A 2YXFA 3EJYC 3NEOA 5A6MA 3EFOA 5KWYC 3IFLL 4K15A 1S7SB 4S0SD 2C9SA 1J9CT 1LO0L 3BP5A 4PJBF 2FUQA 2R29H 2WUCL 3GZQA 3TFBA 3TVMB 4LRIC 3S3DB 1PYWB 2VKXA 3AB0C 3VFTB 3RA7L 5IESH 3I3EA 4NNXA 3SKOA 4HGWB 5FO7A 4DW2H 5SWQB 3MJ9L 3LZRA 3QEQB 1VA9A 4OZIE 2CLRB 1PVHA 4XNMB 4JFVA 3E6HB 2WZPA 4JQIL 1T0MA 2X9XA 2V7NB 1F86A 1H3WM 4AQ1B 4AEHL 4MSWA 2X1WL 2UUDH 1QA9B 2HKFH 4PQXA 3RUGA 3WLBB 5B39G 1N8ZB 4P0DA 4QRPA 5IOKA 3T0DA 2A6DB 1MIEL 3MV8E 1TT6A 4HS8H 1X9QA 4WI7A 3BZ5A 3LKOB 2DDQH 1JRHH 2YSSA 3E80A 1DJGA 1UJ3B 4Y1TA 4PS4H 3ZVVA 1N7ML 4U33A 3L81A 3P40A 4Y19E 4HWNA 4AVIA 3MUGB 5LQBH 3ARBD 4X9FA 1KWGA 2WIMA 3KJ4B 2JI1A 3O3BA 1HX0A 2EO9A 3FFDA 15C8H 1ZANH 1H5BC 1KPRB 3L1FA 2D3NA 1JL8A 3GIZH 2V2XB 1ZHKA 1MCPL 2FEDD 2FD6H 5HYEA 1U0QA 1YO4A 1GYWA 3D12B 3MRHA 4AG4L 1R9FA 2FIKA 4NZTL 2YKLL 3VXME 5L8LB 1RY7B 1QVOB 2E4FA 2IJ0C 1IM9B 4BQBA 4M6MH 4Q9QL 4X6CF 5BJTB 4K3JH 1DJXA 2NXYB 3FT0A 4JRXD 4LLUB 5DUBA 3W39A 4A2DA 4X7SH 3MA9L 1NFKA 1L0YA 3L7FA 3N9GL 4MQSB 2AEPH 5L0QB 1NCBL 3LPFA 2XIDA 4GSDL 1EEYA 2KLSA 1UYWL 2CA3A 4PHXA 4XPHH 5J1AB 2NNAB 4F2FA 3HN5A 3EOYG 1MOEA 2PYEB 3UIZA 4DKDC 1JHKH 2CIIA 4Y5VA 3V0WL 1I53A 1A3RL 3O3UN 1NICA 5KBPA 4PJAF 1AIFB 2OL3A 4LPYA 3C5ZA 1PW3A 4OZFG 4F7KA 2C3VA 3L3HA 3C09C 2R23A 2W07B 4N0UA 3U2SA 2OMTA 4QJ4B 3I85A 5FF6A 3HI6H 4RFEA 1WIUA 2FWUA 4J1UA 4XO9A 2OSWA 3RG1C 3V7AG 3HR6A 1PEZA 3QZPA 3C9NB 5FPIA 4FKKA 2RH0A 1MCIA 1UM6H 2AQ2A 2CO6B 2KPNA 4N0RA 4QRAA 2OXGA 5BUPA 3PDGA 5EEVA 4R5TA 3G9VA 3KGUA 2XVGA 4PBDA 4WW2F 3UCRA 4AXWB 4YOKA 3U0PA 2YN5A 4LKCB 3NPZB 3TCLA 3PF2A 3ES6B 2XKNB 5D6DA 3UC0H 3U9WA 1OARL 1UT2A 1CD9B 5BRZA 4JGMA 4M62H 4WNJA 2FR4B 4A7GA 1SJVA 1HHIA 3S2AA 4I13B 5I73C 4X9GA 5D2NE 4M8RA 2CCVA 3BSZH 5KBLA 4KV5E 1IX2A 1WO2A 3FB6A 2DB8A 2ZOWA 3QG7H 4RGMB 4UOW1 3BAEH 5TE7H 5I9QC 2AV7B 4I4WA 1XH0A 4JFTA 1JPGA 1H15A 4OF8A 3T2OA 1OCWH 5EIIG 1JFQH 1FL3A 1KENH 4XAWH 4S0HA 2YJLA 4LLMB 5D1ZA 1HHGA 1AO7B 5A2FA 5HDQL 2E7LA 5CILL 4TULL 4OVVA 3PWJB 3V0VA 5T1JA 3BUBA 2P28B 3KPPA 1G84A 2E0PA 2VL5B 1KCWA 4H1LB 3K6IA 1A7QL 1H6UA 1PCXA 1R3IL 2IGFL 4DZ8B 2ZWYA 4XN2A 4HV8A 1CGTA 2YEZB 1RFDL 3I6SA 4OQTL 5KSBB 3X12B 2C3GA 2N0MA 3N0PB 3SQOH 4ONOA 5L9DL 1WDAA 4N0YL 3MV9D 4Q9RH 3SIKA 2HUEA 4LCUB 1Z9OA 3RHWK 1QFUL 3O8XB 4PRDB 4F7PB 3UAJC 4M29A 1ZLSL 1M4KA 4M6AA 5J12B 5A7BA 1O9WA 2Y7MA 3D52A 1QAWA 4KJPD 3ARDA 4EEEA 2FT8A 2OV0A 3M7FB 3H7LA 3Q6FB 4W9LC 5KYUA 2AJYH 1EHAA 5D6CA 4XMWA 3GRWA 1DVQA 1BQLL 4HHGA 3HI5L 1KBGH 2ED9A 5K9OB 3HMXH 1FYTD 4PRNA 4U4IA 5FHBH 4F7TB 5CBAB 1ERNA 5A2AA 2PKDA 4AYID 4KKQA 1RVFL 1CGWA 3OKKB 4K8RC 1TPXC 4LHUD 4W9FC 1G7JB 3I3DA 3QDAA 5ISZE 2P1YA 4AEEA 1RZ8B 1T66C 1A7PH 2XY1A 2X4NA 1HWHB 3NP4A 1I8KB 3T0XA 2K1MA 1XBDA 4QXWA 2Y36H 1AC0A 4M61B 2QGCA 4WO0A 4Z7IA 4GW4A 2K6ZA 5CSBA 4GUPB 2VH5L 3RFZA 2OMWA 4WSGA 1LEKA 4AGNA 1ETA1 3GPSA 2FWOA 3BVUA 4KTDL 2QQKH 4XMKH 5LNDA 3OF6D 4GMTL 5H8DA 3DO4A 4YEEA 1N5YL 1MAMH 5I1IL 5JHAA 3BPCA 1KNOA 2WQRA 1ND0B 5ADOL 3EADA 5AZ2H 3PGCA 5FXCH 2B9BA 2IANA 2Q7YB 4JFYB 1AHWB 3DIFA 3I9GH 2RIKA 3PRZA 4EN3C 3IDNA 2ICEB 4GPVA 1A1MB 2VXVH 2HH0H 1YEJH 3QH3A 4OCXH 3LS4H 4OM1H 5D7LD 5F3HB 1CLZH 1MCSA 2DWEB 4QMEA 3KVPA 3C60A 1KPVA 2Z91A 4FG0A 1JUFB 3US0A 2UZYB 2MOGA 2VYRE 1FDLH 4POYA 1XMEB 3ZKMC 5GGSB 2ICWA 2XLLA 4M6OH 2W0FB 2EIMB 2VQ4A 1WPCA 3O2DL 4O02B 4AL8L 4XNQA 1TU2A 4ELMF 1ZCRA 4CGTA 3LHAA 4IOIB 3HE6A 4FG6C 1D6VL 3QAZB 3Q01A 4ANXA 4XNZB 3VGGA 1RHHA 1XSJA 1AKJB 1PY0A 3CX2A 3OPUA 2E7MA 5CLXA 3T1WA 1YEGH 4N1HB 3F62A 4PU2A 4KFZC 3SGJC 4K5NA 4KHXH 5CCJA 5IHWA 5AYTA 1KB5L 1P69B 4JHAL 3EHBD 5IBLD 3LN5B 1JVLA 3CDZB 4YHYB 4Z7UF 5IOPB 1R3KA 2N4IA 2G3NA 4LVHC 2WPGA 1HNFA 2VDNB 3B9KC 1U8CB 2BNQB 5K9QI 5CD5C 4XN5A 4IKJA 4J27A 2WBJD 3B6SB 4EUPH 3F12A 5DZOA 2H2SC 7FABL 2NNXA 2PR4L 3KBEA 4Y4KB 2ARJQ 4LDOB 2ZPKL 2BY2A 1B2WH 4RAUB 5HDBE 2F53D 4LCIH 3VFMA 1E4XI 4WJKB 2JJTC 2DL9A 3RJDA 3U83A 4RBPK 4QPEA 1NPUA 1SHXA 3QQ3B 4ZXBA 1CD1A 4BZ2A 5AB0A 1K2DA 2NY2C 3MLYH 4OKVB 3TIDA 4BFOA 2BZDA 1F3JB 3EO0B 4LARH 5DHVA 4JREC 3CDGA 2ZUQC 2WB1A 1MAJA 4Y2DD 2HX8A 4XP5H 2Q2LA 4YHML 3NZ8B 3JQOB 4PJCF 3CC5A 3STZB 2UWEA 1QLRA 2Y2WA 4K2UL 4ODXA 3ULUC 2K78A 3FZUC 4GRMA 1U8OA 2VJXA 1O7VA 3O9WD 4OZ4B 2KLTA 5CLZA 4YZFF 5IBUG 2EUVA 2NX5D 1CG9A 3H0TB 3S0PA 3D39D 5EF1A 3LJ3A 1W0VB 4PJ7F 1XF3B 5L2KE 4XB8A 1FNHA 2Y22A 1DANU 4WEEA 1UWFA 2ZXQA 5E4EB 1UOLA 3FU9A 4L2LA 2OK0L 2VMCA 4Z18A 1L9QA 2ZAHA 3WFBH 3DTDA 3WS6A 5SX5K 4L3ED 4X6EB 4AYDC 2E6PA 5C0BE 3DRTB 1FZJB 3UTTE 1AYOA 3O3EA 3SKNA 4QAWA 3MDJA 5CZXD 2PYFA 3FB7A 1TVDA 5DGQA 1X5IA 1U8IB 1L3NA 1XB3A 4JM2D 3HW7A 5C6WH 2A99A 1QWUA 1UWGH 2BCKB 1FA4A 5T1KA 1X7TA 4P5SA 3ZZLA 1RZKC 3MTRA 3SCMD 1TZHB 2J12B 4A7QA 1DVXA 3KLKA 1DBAH 4HKZB 2BVQA 2ZKHH 5IW3A 4H0HB 2FNWA 1KPUA 3AXHA 4PJDB 2NY6C 4L1LA 1THCA 1ZWIB 3I6KA 1PZAA 2AVFA 3FUNA 3HJ0A 3OKDA 3VXMB 5MERB 4PV1C 5BV7C 3V5HA 3QUXD 5E6YA 5I5RA 4EI5B 2G3XA 2MQ0A 35C8H 3ORJA 4C56D 5I1LB 2WXJA 5ANMB 4LCYA 3KLHD 1L9RA 1V10A 3CN1A 4UYPA 3AY4C 5T5NG 2UZXA 2XG4A 4PD4K 3O2WH 1C8PA 1DBJL 4PREB 1IQDA 4WFFE 3VSVA 3EUDA 2UX7A 1MHHB 4L8DB 3C8KA 3HLKA 1M3IA 2COVD 3K8KA 1TJGL 2VXQL 3DUUA 4L4JA 3VO0A 1S9XA 3GMPB 3TIEA 4EZLA 5FECB 1JHTB 2XXCB 4I0PC 1EZLA 2HFFB 2G9HA 3MCYA 1RK0B 3T0EE 1CF8L 4C83A 4HJ0C 4G8IA 3L4CA 1U95A 3U9UA 1CFNB 4UV7H 1LE5A 2B4CC 3DXAE 3LNDA 1I3GL 4NKIH 5DRZB 1FBIL 1LEIB 3HFFA 5DDHA 4G5ZH 4JVWA 3NDYE 2NNCA 2XA8L 2NQ3A 5EOCJ 3QEUB 1RUPH 4W9CC 1YPZE 1GW0A 4LL1A 1ORSB 3IDYB 1YEDA 3FPXA 4HPOL 3TP4A 2IWFA 3ESUF 4JFEB 2ZNWA 3DETD 3G04A 5B3JE 3GC3A 1MFNA 1OE1A 5E7FA 4X4YB 3NJHA 5MP6L 5BUAA 4K8RH 4QRSB 2HJKA 4FFZL 1JBJA 3NZSA 1M2OA 2BSEA 3QARA 1UUNA 3W3BA 1F4WL 1S7UA 43CAB 3DPDA 2JKSA 1LK3H 4XO4A 2F1BA 3TOPA 3QO1A 5J1SC 4JFOA 3EJPA 5ESVB 4YHLL 2V2WA 4UTBA 4QWWC 3BHBB 3HC4H 1XMWA 1NGQH 2JTYA 3E8UH 2AJZB 5DWUH 3SBPA 2JCCA 2QZQA 2FCBA 1EUTA 3TGXA 2ADIA 1A1NB 1QLEL 4O58H 1W15A 2W9EL 4OTXH 2BS8A 5C0CD 2QEJA 5FYKU 2MEJB 1BM7A 1KLFB 4K9EC 2CBOA 3QUML 4M5ZL 5LLIC 2IADB 2RMNA 1A8JH 1G7PB 1U8KA 1JCKA 5IB5B 1TMQA 2MCPL 2WQUA 2R0KL 2FZ3B 4PJ5A 3NJXA 1XH3B 4P2QD 2NY4C 4KAQH 2C9AA 1G5AA 4NBZB 3NRQA 4Z7NF 4N2AA 4LAQH 2DN7A 3QNYB 3RDTB 4QRQB 3TV3H 3WSQL 4NNPL 4XO8A 5TGBB 4Q8BA 5DEGA 5JOFA 3GI9H 5I24A 2QDWA 3B7RL 2VXUL 5TDNB 5DVNA 4JW3A 4LGPB 5EOCH 2C9QA 1XCTB 2F19L 4FTVD 4C47A 4ZW5A 3N40P 1QHOA 1EAQA 1UM4H 3KPQB 3VFSA 3FN0L 4XWOC 2EIDA 4ZAKA 2PCPB 1AZBA 1NAMH 5D6DC 1A66A 2CZNA 2FLMA 4D0BA 5KVEL 1BF5A 3MRCB 5B1JA 5SWSB 4P23A 2F5BL 1BDYA 1JDDA 2BZCA 3P3RA 4Q2ZA 1FGVH 2VXTH 3MRMA 1ETJA 4RBPH 4XB7A 3S36X 4H1LG 5D71L 4P59H 1I85A 4YHIA 4D7BA 5TE6H 5LWYL 1E4KA 1DUZB 5ILTL 2XWBA 1NOFA 2FX8H 4ACTA 2AVGA 2JV6A 3CBJB 3KL3A 2F54D 4TSBH 4PD4J 3NFPA 4ZTOH 5IR1A 1KJMB 1NJ9B 1EANA 5AYUL 1J0ZA 3GMMB 3UACA 4K3HA 2WVVA 4FNUA 1RZ7L 1DBKL 3QJFA 4QRTA 4R83A 4KVNL 3TT3L 1YEEH 1XCQA 2ZWZA 4OIFA 3LEYH 3STBA 5C2UB 3JVGA 4HC1L 2XTJB 1GMEA 4GAGH 3MX0A 4XXCA 5CR1A 1F3DJ 4U31A 4FQXA 1K8DA 4JEGB 1FGNH 2ZOLB 3IAGC 3OM3B 1GGYA 2ARJA 4TVPE 2MNWA 4MASA 1X5XA 1DLHA 2CCLA 5SX5H 5EZLB 1JZIA 1C5CL 3QDJD 4B41A 1DVZA 1HOCB 2CLZB 4JHUA 3N50A 2WNXA 1AS8A 3ARDC 4JG1H 4PJ8C 3WIHL 1FZOB 1EMTL 1OSEA 1D6EA 1R1CA 3UTPD 4JLRA 5TH2A 4DP5X 3QA3B 1OB0A 3FU8A 4KK9D 4ODTH 4K23H 1WFTA 4FJZA 2J5LC 2R1XB 2XQYA 4DP6X 2OMXA 3OZ9H 3WTYA 4JPIA 3QRGH 4K3DH 3QS2A 1T7XA 3QQXA 3SPIA 3DV4B 4FCHA 2EDDA 1UD8A 3CN4A 3IRCA 1MN4A 2V4LA 4YDJB 4HW6A 2OCFD 1ZLEA 1DN0B 4ZW8A 1CFSA 1A02N 1RSYA 4NQCB 4JM4H 1CXEA 5C2BH 2EEAA 4K8RD 3U30B 1YY8A 1DZ0A 2K3HA 1C7SA 3VA6A 5J5EA 4UZGA 3HVDA 3O4LD 3QO0A 1MW0A 2WQAA 4F2EA 4PRHD 1CYWA 5EORH 4NKOB 5CIPB 5HVFB 1A7OL 1RZKH 1IJ9A 1HSAB 4XPGH 3CVIH 3DX2A 3QW9A 4GINA 4JDEB 1MFCL 1G6VK 1QUPA 3FO2B 3KCWA 3MBXH 2FIRT 3IJHB 4H25B 1T83C 3V95A 4X6FB 1FO0L 3JUYA 3VJ6B 3UP6A 3KWWB 1MW3A 4KO5A 3ROLA 5BV7H 1KYOJ 4FZEL 1OGAD 5C9JA 4ZPTB 3TCXA 4EN3D 1CU4L 1F3DH 5DK0B 3C60C 3IDMB 1D5BA 2FHCA 1LO2H 1KB3A 1TENA 2BRRH 3L1OL 3NJFA 5E6IC 1BGXH 3WKMH 3ZR5A 4PGEA 3F7RA 1A64A 4Y9BA 2RFXB 4KI5F 4NRZB 1DSFL 3SOTA 2IFFH 4GQ9H 4KO9A 3KHQA 5FKAA 3UERA 5F7FA 4TSAL 3F65A 3HE6C 4HWEL 5G2NA 2C7UA 1S9YA 3FQUB 1JN6A 4JMNA 4YHPB 2ADFL 3FQWB 4P04A 4UCFA 2YO3A 1UT1A 3P02A 3P77A 5EOQH 4I18C 3QPKA 4QRRE 4H5SB 3OJDA 4PGCB 5ETUB 2HVJA 4JQIA 4NUPA 4Y4HA 1AFVL 3V4LA 1I75A 1GA2A 2B4CH 4U1GC 3RB5A 5ID0A 5MEOB 4ZZKA 1EHKB 4M1GL 5CINH 1MFEL 1DFXA 3WL9A 5LAXA 4MD4A 2NTFB 4LFHG 2E59A 4RFOL 4KTEL 5H35B 2QKIA 1F11A 1DVUA 1FV1A 3A5VA 4GG6E 4IKIA 1HQ4A 1T21A 3SYOA 5F7KC 5AFAA 3KAAA 5C0AE 1QUNA 1FPTL 5FCUH 4BUGA 4JFDB 1A4CA 2K9UA 1DVYA 4NZJA 4PG2A 3X13B 4IW4C 4FMVA 3U1SL 4E9YA 1D5XA 1OQOA 1VLXA 3P0GB 3B9KD 5CD5D 1NMCC 5F9OL 4X6DE 2H2SD 1XGZA 3BLPX 4ALAH 2C7FA 2QQLL 2HN7B 4JVPA 2P5PA 3QUKB 1U8NA 3LV3B 1N0LA 3E1F1 1CFBA 1ZA3A 1A6AB 3GKWH 4M4PA 4RMQA 4UB0L 1MFDL 4ZXBC 4PRIA 5D72L 5FWRA 3S36H 4Y16B 3QXUA 1L7IH 9CGTA 3TC9A 2MOQA 4ODHH 1M7DA 5DMJB 3FPYA 4XVJH 3ZUCA 4B9KC 3EBAA 5INCA 1KT2B 3X11B 3ULVE 1QHQA 4JX0A 1UURA 5CZVL 1X7QB 3IKCA 4BSWB 4IBLT 3FRUB 3SZ6A 1FCGA 4K9EH 1NINA 1YDPB 4HS3A 3S97C 2EDBA 3T4AA 3QUHA 1BD2D 5HJGA 2DBJA 4BV1A 2AKRA 3OGCB 2A0LC 4P57A 3NCJH 3FZUD 1CD0A 1L0QA 5KSUB 3QEHA 1S7VA 2Y6TE 5CBEA 3SD5A 4FTDA 5LGHL 2YFNA 4CSPA 2OL3H 2CE6A 1V54B 1RUMH 5D2LF 4MJIE 1JI1A 4ZJ9A 1U41A 5ICYA 3E9UA 3BPOC 1U93B 3KPMB 4OT1L 3N3EA 3SDXF 5DS8A 3D7PA 1EO8L 3U2JA 4HK0B 1YPZB 4F8LA 2XN0A 4OCLC 1SHMA 1I9IL 1SOQA 2Z7ZA 1PZUB 3AS3A 1KXQE 2ZXBA 4DK5A 3LHPH 2YMOA 5JQ6H 2FEEI 3TPKA 4Y5XC 5L8KB 5TE4L 1TTGA 1EAOA 4KXAA 3FO0H 2FTAA 4MA8H 5D93B 1S9VA 3BVWA 3OSKA 4AC4A 4CGUB 5C0JB 3FUKA 3P0VH 4OCYH 4LPXA 3MZGB 4NPYB 3SYQA 4ZO6A 3I50L 3GLDA 4I2XB 2OULB 4ZFOB 2P8PA 4JS7A 4FQ1H 4P2RE 1MCJA 4PJFF 3WNIA 5CGMA 3LZPA 2XU9A 2FJGB 2NY6D 4GEJA 4AUJA 5E8NB 4N8CL 2FQDA 4MJ6A 4P9HC 4KJYB 5CWSB 3MNVB 3FCTB 1BWMA 3GRGA 5GS3A 1UZ8B 4QIRA 3B2UC 4OD2B 2X4UA 1EV2E 4W9HC 5D7SH 3PY9A 1UD5A 3GIVA 1QBAA 4HIIA 2OI9C 2FQEA 2YA2A 5IJBC 2CJSA 4J2QA 3D0LA 4JN1L 5DQDH 4UV4L 4HUKB 4Y0GA 4OQTA 4I0CC 4RZKA 4DP8X 1OCCB 3IFNH 3EJZC 1QSVA 1I7ZB 1OM9A 4IRZA 5H2BB 5A1AA 3DHPA 3IJEB 4ZO9A 1G7LA 5K1JA 1A9VA 1J0JA 4UNIA 3SDDA 5D7LE 4P5KB 4S0TD 4X7TA 1GYUA 5E8EA 5ES4B 4HJ0D 4W4OA 1E28A 1MQ8A 3SKMB 2QADB 4Y9CA 2JXMA 1UOVA 3UAFA 3Q8EA 4U6HA 3TT1L 1FQ9C 1KBBA 4QRPD 5T1MA 3I75A 4PJIF 1MFAH 4XCEB 5JYMA 4Z3HA 4OCNC 5D7JA 1MNNA 5KVGE 3SJVB 3SGEH 3K81A 3O4OB 4OM0H 1VKXB 4FKEA 1MJ8H 5DUJA 1HAUA 4MAZA 3SYCA 4X5LA 3HLAA 1DJIA 5KSAB 3P4MB 2OAAA 1S5IH 4RWHA 1JYWA 4UNUA 4B3EA 2QPDB 3Q2NA 4GG8B 5AKRA 1CDJA 5I8EB 2YAHA 2X1PA 4BJLA 3D2UB 4OBRA 4AQ8A 5GGQL 2XV0A 3H6AA 5HGHA 3VM5A 4BDVB 1G7MB 5IB4B 1KGCD 4HAFA 3JWOL 4JL2A 2B1HH 4O9HH 3VCLA 2ZCHL 3UBFA 1K9TA 4F33A 4IMLB 4EKJA 2ZXEB 1IEHA 2V7HB 1P2CA 2Z9TA 1JV5A 3UTZB 3LIZL 2V17L 5EWIH 3BE1H 2Q8AH 4G70B 2DMKA 4JR9H 3GB7A 4NAQA 4OCWH 2YGVA 4NNYB 1U8JA 4Z7OB 3AMKA 2RACA 3NA4A 1ESOA 1NQBA 1QEWB 1CLYL 2BJMH 1E3ZA 4HZLB 3IFOA 4OF6A 5C0EA 5E1HB 1AQDA 5A3ID 2CJUL 3QJUB 4PLKC 2NY4D 4YHZH 4X5QA 1D9KA 3O2DA 4X42A 3C5ZD 4XP9L 3O45A 1R6VA 5ERWB 4MWFA 5DYFA 4X83A 3MRBA 1DL7H 3IDJB 5G4OA 1MCOH 4HT1H 4DK6A 1D7DA 3LZQA 4PJXE 3VI4B 5CD3B 4G9DA 3ZE1E 4QTIL 2VW7A 1X5GA 5F7YC 3VGAC 2XG5B 1GVIA 3MLRL 1NH6A 1CS6A 3UJTH 3KG5A 1RUAL 1KB5A 1FIGL 1XTMA 2D7NA 4XWOD 3HRPA 5DEJA 1GC1L 1R5WA 1U3HA 1UATA 4YBHA 2A4EA 1I85C 3P9WB 1EJOL 1QBML 3MV7A 3HUJB 2GI7A 2ZJSH 2NNFA 3NN8B 3NPSC 4L3EE 2R0LH 5AVYB 1O7SA 3QR1A 3AAZB 1G6RB 3QXWA 4FXGA 5DD3L 2HAZA 4E41A 4OLVL 1NCOA 1MVUB 4DIXA 1EZUA 5LCVL 5GXBB 3FJTA 1W9XA 3DBXA 5IW1B 3GGWA 1IC5H 4KKBC 1P5UC 4S2SA 3ARBB 1AI1H 1T0OA 4LIQH 5D1ZD 4ZFQA 1SYSA 4HIEA 1S9WB 1BYPA 1J12A 4B0MM 4BZ2H 4BK8A 5DZAA 2BVYA 1WP6A 1Z3GL 3UDWC 3U0TA 3JVGC 3P9MA 1WAAA 3W9EB 5DHVH 4PSPA 4TUOA 5EC1A 4MMXA 3LKSB 4PJ9A 3DOSB 4NENA 3V4PB 4HOZA 4G6ML 1JGDA 3D8MA 4FNSA 4FABL 2ADGA 3CNKA 3CFCH 4N20A 1IGFL 2WNKA 4JRXB 4WU7A 4DHLA 4O02L 3ARFC 3ZJAA 3RWDA 5I6XC 1E6JL 1QI4A 2FNBA 1I8IB 2D9QB 2X88A 3ARDD 3DROB 2JQMA 3NFNA 4N2LA 3V6OC 2V5YA 1ZD6A 2WY3B 2AXFB 5HDLA 5J6GB 2B3IA 4H26B 3A24A 4R6UA 1FJ1B 3NABL 1HKLH 4ZOAA 1T2XA 5AALA 5I1KL 2YFOA 3VDAA 3L4TA 4FXTA 3OR6B 1YNTB 3EF7A 2X0VA 4JB9H 5DMIL 3KJ6L 3ZQ9A 2GJ6A 5C07A 4YBLC 2VDNL 4YC2B 5I5JA 5CN3A 4IU3B 2XQYK 4G43B 4PB9L 3QJOA 4DWHA 3DI2B 4XPTH 1MHCA 1KLGA 1VFAB 1NUGA 1FC1A 5FGCB 4UQ3B 3T08A 2OBGA 3JT0A 4ODWB 2V2TB 4GRLC 2G0KA 4MXWL 2Y2YA 4AEIH 2OTUB 1ONQB 4YR6A 3RPIB 4F7MA 1AZRA 1T3FB 3N1MC 5KS9F 5EU3B 1JRHI 3TZVA 1YNKL 2Z0BA 5EH1A 1E4HA 2EYSA 2H8PB 3P4LA 5IMMB 5IVZB 3MXWH 4PUBH 3MBEA 4JL1A 3PP4H 1HHJA 5DJXB 1ETZB 3PPSA 2OJZH 2ZIDA 1DVSA 5EZPA 4CA4A 5FO9B 3H9HB 3OKNB 1NM4A 1G9EA 4G2AA 4MNGE 3S96A 4LLVA 1NUDA 3C60D 3EYFB 4LGRB 3SYPA 3QHZL 3ILDA 4JPVL 5E6ID 4QR7A 4NKQB 2VXQA 4O00A 3HG2A 1NOAA 4ETQB 3KW8A 5ACZB 5IJKA 4HMCA 4HU2A 1DR9A 4B9GA 3O81A 5LVEA 5CO1A 3TLRA 2VMFA 3HE6D 2PN5A 4KVPA 1FNSH 5F6HJ 4I3RL 4XXWA 3QCVL 2MOVA 4LEXH 1YUKB 1JTTA 1ID5I 4OLXL 3RDJA 3TN0A 4BFGA 1CDBA 1VGKA 1CYXA 2IWEA 4AGMA 4KZCA 5AD0A 2YRPA 2Y72A 3MV9B 4HZAA 4DAGL 5BS0A 1BVKB 3K5SA 1IT9H 3WDJA 5L88H 2QKIC 2BIOA 3GHEH 2J2ZB 2BY3A 5AZEL 4NC1C 5HDRA 4EOWH 2I69A 4HUVA 3BPNB 2LVEA 3QDGE 4HIJB 3OJVC 1CLOH 4OD1L 1AZVA 1MCBA 3HFMH 5DJZB 1HSBA 4P4KA 5I0WA 5L6YL 2QHRH 1ZSDA 2WZ5A 5JPMB 3AM8C 1FYTB 1HNGA 1A14L 1EXUA 1J0HA 2ERJC 4AT6A 3T09A 1M2VB 2HXAA 3IT8D 4TF4A 5AVSB 3CXHK 3G5ZA 2CO7B 1GJIA 4LHUB 2D4FA 5F7AA 3FULA 5DJCA 1MUJA 2ZSWA 2Y7QB 2AZAA 4UTBH 2ZE0A 1OAUH 4HZ1A 4ZXBD 1IIKA 1LE9B 1A7BA 3UABA 4KY1H 4P48A 3A6CL 2J5WA 2YUVA 2PW1A 3V6FB 1MRCL 3DWTA 1RZGA 2KYIA 3B43A 4G80B 4JFFB 1HHKB 3TPUB 2F54E 1HEZA 2BP0B 1KG0A 2X6UA 3C6LC 4W9DC 3QUMA 3RURA 4ADGA 3T4AC 2I9TB 1TJMA 3TO4A 1PU0A 3CMGA 4R4FL 5IK3B 5C6TL 3MRDB 4F80A 2APBA 2WUBH 3TBSB 4ZUVB 4Z8FL 1SBSH 1WAEA 1N5AB 4BRVA 1CDYA 4TQEL 5HPMA 2MNJB 3GPEA 5D7LB 4BFJA 2RAMA 2EABA 5DJYB 1JZFA 5FKPB 3FQ4A 3WGUB 5EIIA 4PJAA 4L5FE 4MXVE 4PWGA 3HNTH 3G5XB 2DLFH 5D1QE 3QFJE 2XYCA 5EBLB 1CFTB 2Z1PA 2E9GA 2OMVA 5ESQA 1HH9B 1CIUA 4H44C 2HLFC 2CU9A 2Y07H 4LLQB 1JZEA 1WIOA 3C6SB 4RIRB 3UZQA 5F9WB 7PCYA 1BYOA 3NCMA 1WTGT 5JPNA 2ZWLT 5I0DA 3Q05A 2RD0A 1BPLB 3ZKXB 3GHBH 1F4YL 2DQEL 2KZ1B 1DVTA 1OAKH 4PJEB 5EPMB 4Y2OA 3ISYA 3X3GL 1XF1A 3W0WA 5LGKA 3EHBB 5T1KD 4JG5A 2G60H 1ZIBA 4ZW6A 3AXLA 5C0FB 3SDYL 4QHNA 5FYJU 5HDOA 2AGJH 5DJ2B 1UD6A 2FHFA 3EGDB 1SVCP 3KM2A 3CFKB 4DF9A 5IEKB 3OPZL 1QFPA 3GSOA 5KVDE 4I8DA 2WBJB 5JW4Q 1S78C