1AS8A

Structure of nitrite bound to reduced alcaligenes faecalis nitrite reductase at cryo temperature
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of nitrite bound to copper-containing nitrite reductase from Alcaligenes faecalis. Mechanistic implications.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 83
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1997-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1as8A02
4E9RA 3OMAB 2Y1AA 1N70A 3TBCA 4GP8B 1WAEA 4TXVB 2PP7A 1KYAA 1QNIA 2GHZA 2PCFA 2X88A 4JHUA 3WNJA 4DPCX 3NSCA 3WG7B 3NSFA 4DP6X 1OOWA 1NDTA 4HHWA 4BXVA 4DP8X 1J9QA 1ZIBA 2DWSA 3CVBA 4BXSV 3NJGA 1ET8A 1A3ZA 2AVFA 2VM3A 1L9SA 3NJFA 3FPYA 4BDVA 4AKQA 3UABA 2PPEA 2QPEB 3PLYA 1AZRA 1NPJA 5AZUA 4A2FA 1ZDQA 4YSDA 3V9EA 3T6WA 2BZ7A 3SQRA 1JZIA 4G72B 4WKXA 1A65A 1BQ5A 3H4FA 3CDZB 1TEFA 4G7QB 3TBBA 3SBPA 2YAQA 2JKWA 2YARA 1EZLA 1E65A 3T6ZA 6PAZA 1MZYA 2CUAA 1JXDA 2H47C 3FSZA 2J56A 3MBWB 3NJJA 5D4JA 2DWTA 1F56A 2EIMB 2GBAA 1AS6A 1M56B 5TK2A 4HCFA 4RH4A 2DY2A 2YXWA 4KOCA 1XMEB 2BHFA 1ETJA 3NT0A 2VW6A 3S8FB 3EH4B 4HHGA 1SNRA 4E9VA 4AX3A 2XX0A 4E9XA 1E67A 1GYCA 1A4AA 1AG0A 7PAZA 1MDAA 1X9UA 1GR7A 2GSMB 1J9SA 2LLNA 4NAJA 2WSDA 3D12B 1AR1B 2J57A 3FT0A 5I28A 2IWKA 2IWEA 1NIEA 2FQEA 4QLWA 4DP0X 2Y69B 4P5RA 4Q89A 1JERA 3AG1B 3OM3B 1ASPA 4NB7A 3ASOB 4WTQA 1A4CA 1J9TA 4KNSA 8PAZA 2BP8A 3RYMA 2MTAA 3V9CA 2FQFA 1AOZA 3EF4A 2FT8A 4A2HA 2BWIA 3WKQA 3T6VA 3S8GB 1XB3A 4L0PB 3SBRA 2ZXWB 1BYOA 3DIVA 2XU9A 3NSDA 2FQDA 3C75A 2QDWA 2JFCA 3N55A 2VW4A 3FQ2A 5I6KA 1NZRA 1MG2C 1PZCA 1ILUA 2OCCB 1TKWA 3FPXA 4CSPA 1V54B 2VN3A 3TU6A 1L9QA 1ET5A 2EIKB 3X1EA 2UXGA 2XUWA 2YAHA 3IEAA 3KW7A 2I85A 1A8ZA 4HCIA 3NJKA 2CALA 2Q5BA 3UGEA 1RKRA 1NIBA 1CC3A 1KDIA 5B1AB 4YVNA 4P5SA 1IC0A 4E9YA 3QJVB 4GY4A 4YSQA 3FU7B 3PCYA 3TASA 1OCRB 1T5KA 4JKNA 3EH3B 4YSUA 2VW7A 5AFAA 3OQRA 2FQGA 3ABLB 5IY5B 1FFTB 3NJNA 1AAJA 2CAKA 2XV3A 1CUOA 1AS7A 2IDFA 2IH9A 3NP3A 1PAZA 3FYEB 2CCWA 3FSVA 2VMJA 3NJHA 3QJSB 2BP0B 5I6OA 2GC4C 4A67A 4M3HA 3ZDWA 4AKOA 4AKPA 1JXGA 2PPAA 3AW5A 4KO7A 2IWFA 4GP4B 3NJLA 5B7MA 2PP9A 1OV8A 3MX0B 2ZWNA 4KNUA 1HFUA 5I5JA 3ZBMA 1E5ZA 1AIZA 1GSKA 3FU8A 1JVLA 1SHXA 1JZFA 5B1JA 3WNIA 2FNWA 3CG8A 5B1BB 1OE1A 1I53A 1XB6A 2ZONA 7PCYA 5I6NA 1HAWA 2UXFA 3U25A 1KV7A 3T71A 1AZNA 3ABGA 2YAFA 3SBQA 3EH5B 4GP5B 3ZX1A 4A2EA 2J55A 1AG6A 1PNDA 3OMIB 4KO5A 1PNCA 4BWTA 2VSMB 1NIDA 1GY1A 4DPAX 1OE3A 4GXFA 3ERXA 3S3CB 1ZDSA 2UX7A 1AZCA 1IBYA 2DV6A 1ZPUA 1SDDB 1ZIAA 3NJMA 4G70B 2HZHA 2YAOA 3DKHA 1NIFA 1YLBB 1JZHA 1KBVA 3WKPA 1L9OA 1OE2A 2XXGA 1SHWA 3ABKB 1V55B 3H56A 4DP4X 1QHQA 2GI0A 1ADWA 1AANA 1OF0A 3FQ1A 1NIAA 1HAUA 1KBWA 2IDQA 2BO0A 4KNTA 5E9NA 2W88A 5B1KA 4NERA 1JZJA 1L9RA 3IBOA 4UANA 2UXVA 3IE9A 1PLBA 4JHVA 1BQKA 3H4HA 1CYWA 1BXVA 4E9WA 3EHBB 2EILB 2R7EB 4F2FA 4F2EA 2IAAC 1XB8A 3FQYA 5D4IA 2GIMA 2PLTA 3GDCA 4KO6A 3CDZA 5EHFA 1AZBA 2PP8A 1SF5A 3L45A 1WA2X 1ASOA 1WS8A 4A68A 1QLEB 5I26A 3FS9A 1PLAA 4GYBA 5TK4A 1OCZB 1BAWA 2XV2A 1BQRA 4A2DA 1NWPA 1R1CA 2HX8A 3BVDB 3CVCA 4UAHA 2IH8A 4E9QA 4HCGA 1TU2A 4Q8BA 2PPFA 3UACA 1GS6X 2MRYA 4HALA 2XYBA 3QQXA 3T9WA 3OMNB 2IDUA 4DP5X 5B7EA 2E86A 5ANHA 1AACA 4PAZA 2WO2B 5LDUA 2HXAA 1AQ8A 1CURA 3HB3B 3AG2B 4BDVB 2XVBA 2CJ3A 4W1TA 2A3TA 1UATA 6PCYA 3AG4B 4YSRA 4FA7B 2YXVA 1TEGA 1EHKB 2DYSB 1NTDA 4N8UA 1W8EA 4YSCA 1JXFA 2ZOOA 4G7RB 3FSAA 2YAPA 1RZQA 2HX7A 4KO9A 5I6MA 2BWDA 1RZPA 4QKTA 5I5IA 4YL4A 1DYZA 4KOBA 5F7BA 1M57B 3QJTB 1ASQA 3AZUA 3GXUB 1B3IA 2B3IA 2GC7C 3JT2A 5B3SB 2J5WA 1PZAA 2QDVA 2RACA 1A4BA 2N0MA 4X4KA 1BXAA 2PCYA 4MFHA 5I6LA 2YAEA 2XXFA 2QPDB 4E9SA 2IDTA 2IDSA 2VM4A 3GYRA 2XLLA 1NPNA 1FWXA 2AANA 1WS7A 4E9TA 3ZIYA 1JOIA 2YQBA 1BYPA 3KW8A 3DTUB 3T6XA 1KDJA 2P80D 3UADA 2OV0A 4DPBX 1X9RA 1OCCB 2H5UA 3QJQB 2QT6A 3PAZA 2TSBA 3PAUA 1IUZA 2BZCA 4YSAA 2X87A 5B1JC 3S3DB 3WIAA 2HX9A 1IKOP 4BK5C 4YSOA 4FAAB 2H3XC 3FYIB 1W6WA 4W9ZA 1NICA 1V10A 3AG3B 1KCBA 1PLCA 1PMYA 1FA4A 4DP9X 1PZBA 2HRGA 4N4YB 2CBPA 3N2JA 1ET7A 1N68A 5AKRA 1SFHA 1WA1X 1SF3A 2XWZA 1E5YA 3X1BA 2AFNA 1GS8A 1AZUA 1VLXA 2BP8B 1AS8A 2GB2A 2PPDA 1NINA 1J5CA 3CZUB 3FU7A 4PCYA 3X2QB 2FTAA 1RCYA 2W8CA 3X1NA 3QJRB 3PPSA 1NWOA 5I5MA 2AZAA 2WO3B 1J5DA 2YAMA 2EIJB 2FWLB 4DP7X 4YSSA 1GW0A 4YVUA 5D4HA 1SFDA 1L9PA 3FSWA 3HEIB 4ENZA 2Q9OA 5A7EA 2BP0A 3QPKA 4BWUA 2UX6A 5B7FA 4M4RB 1J9RA 1ZV2A 2XV0A 2FJSA 2OJ1A 1URIA 3OD3A 1PY0A 3UAEA 2P80A 3G5WA 3TA4D 1MZZA 2I7SA 1JVOA 1CYXA 1OCOB 3IN2A 1DZ0A 1IBZA 3PXLA 4AZUA 3ASNB 4CSZA 4DP1X 4F7KA 3PAVA 4DP2X 3FU9A 9PCYA 2TSAA 1GS7A 4HZ1A 1JZGA 2HRHA 5FC9A 2UXTA 2I7OA 1W6LA 4UF7C 1ID2A 5PCYA 1SDDA 4A66A 3NP4A 2B08A 4YSPA 2FT7A 1SJMA 2JXMA 2PPCA 4ZK8A 2DYRB 1ILSA 1WA0X 2NRDA 3NSYA 3AY2A 3QJUB 3S3BB 3CVDA 1BXUA 1KGYE 3ABMB 4A2GA 2BW5A 3IN0A 2VSKB 4G7SB 3X1FA 2EINB 2HLEB 4AI7A 1MG3C 1KCWA 2FT6A 3X1GA 3JTBA 5F7AA 4HIPA 4G71B 4K9JA 2AZUA 4EF3A 3BQVA 2R7EA 3NYKA 1BEXA 1JZEA 1PF3A 4YSTA 4YSEA 4HAKA 3WI9A 2BW4A 1GY2A 2XX1A 5I6PA 1L9TA 4BWWA 5PAZA 3UAAA 3NJIA 1M9WA 1PCSA 1E30A
chains in the Genus database with same CATH superfamily
2WM0A 4PJCA 1L5GA 2CDFA 2C1OA 4HJJL 5E5UB 4P5TA 3TIDA 4QT5B 2JJUA 1H9DA 3MRKB 4QF1B 4DIXA 4WK0B 4WO4C 4X4MA 3VFNA 4G9DA 3HZKA 3QP3A 4F3FA 1G7HA 3QIWA 1S9WA 4PJ6A 1I1AC 5L2KE 5DFWH 3V4VA 3L3KB 3CVBA 4BXSV 1S7QA 5AWNL 1CR9L 4PRPB 3NCBB 1UT9A 3VXOB 4Y1AB 5IB4A 3VD9A 1NBQA 3QPXL 5I6XC 1DL7H 5KSAA 4A37A 4HISA 2XIIA 4YX2H 2MPAL 3ME0B 1JDAA 2BERA 2IO5A 4CUCA 3NRFA 1A2YB 2X4UB 4JFFD 5DI8A 4Y2OB 4C83A 3PWUA 3KLQA 4E0RB 4KKQA 4HLZG 5KANG 2VL5A 5L4MA 2EUWA 4I2XE 3CDZB 4MMXB 4ZOBA 4AZ8A 1R3JA 3QG7L 1SJHB 2XQBH 4FJYA 2VN6A 1G87A 5E5RB 5EZJB 4WFFE 4OFQA 5L0QC 1FNGB 1I9JH 1JXDA 4P2OC 1OPGH 2CH8A 1RSFA 3MBWB 5EUOA 2E6JA 4BFNA 3P2BA 1UA6H 3QGVA 3NQIA 4KDVA 1FZMA 4WI8A 4CJ0A 1NJ9A 3TA3B 1UXSA 4JQXA 4YDVB 5TK2A 5MP6L 4D9RE 4I1NB 3W0WE 2WYZA 5GJSL 5DD0L 1JUFA 4WEBH 5ISZD 5TF1L 4IOFC 2GJPA 2VDNH 2W07A 3WUWG 1ZT7B 3C6EA 3SE4A 1JGUL 4S1QL 2VXSL 5AB2A 3VH8B 4DCQA 1SUHA 3O3EB 5A2CA 1OP5K 5BO0D 4NCC1 5HHOB 3Q3GB 1T0PB 3KYKH 4KK5C 4O2FB 2AJZA 3BP7B 3H3BC 5IFHH 2Y69B 2ZOLB 1MJUL 4NB7A 1B4JH 4WO0A 2W91A 4XH2B 1R3IH 3GTTA 4EUPB 3HHMA 4IRJA 5LVEA 3SYQA 4IJTA 1SVCP 4JQIH 3MV8E 1BYNA 1YJDL 1PLGL 3GK8H 5J3HD 2ITCA 4QHMA 5KYWB 4IMKA 4W68A 4OIAA 5C08E 1ACZA 3WKNA 4HJJH 3N50A 1ZMYA 5JHMA 4QXUL 2YD7A 1S7VB 5LWYL 2X3BA 5L2JB 2K45A 2WVSA 1MCKA 2VQUA 2XN9B 4Z3JA 1OP3H 1R3HA 3QAQA 3BIKB 3WEAA 3T4AA 4F92B 3L3IB 3FQ2A 1INDL 1F41A 5D1QE 3SE6A 5AWNH 5I75C 1CR9H 2WIMA 5LCVL 1DQTA 2E74C 5J6GA 3QWRA 1WHPA 2YBRA 3BT2L 4QRTA 4ZXBA 3QPXH 4WO4B 3N41F 3I9GL 3WBDA 2MPAH 1KELL 5DVPA 1I1AB 2CHZA 1T1WA 3UCQA 2CALA 3LS4L 3POCA 5D4QA 5KG9B 2RTTA 1PZDA 2A74C 2H2PD 3GD1C 3QDHA 2VC2H 5IBUB 5I74C 2GIYA 1YC7A 3ZHFA 4J3VA 2CA3A 2WKGA 3FCGA 1P6AB 4L3EE 1ZEAH 1S5IH 3V6ZA 4H8WC 1TJXA 1BQHA 4O02B 2J5LC 3QG6B 4PWGA 4LF3A 3P9MB 3EZJB 3FU0A 4G8EA 1YYML 1B0RA 3KWTA 3V6OE 5L6YH 1NBCA 1CLZL 1HHKA 1UQSB 4F1ZA 4E41D 5ID0A 1ES0B 5BZDA 2ZUQC 4LIQH 4YZWA 4MHHG 4JNXA 5IMKA 2XV3A 2WYHA 5L0QB 3L4WA 2XN1A 1TFPA 4P2OB 5DD0H 2FO8A 5GJSH 4AW4A 3BH9B 4ZFFB 2WLYA 2A1WL 5T1LD 4AQOA 1H6FA 4N2GA 2VDRL 5TF1H 3OF6D 3UZEC 1GTNA 1I8KA 1KN4L 4PWJA 1U21A 4G6ML 5INDA 3BQUA 4B6ZA 4GG6F 1JGUH 4PREA 5AALA 3QEGH 1ZHLB 4U7SA 1FL6B 3SQOL 4Z7OB 1J0KA 5ADPL 4N0UE 3A47A 1UD6A 1XZWA 3AS1A 3K8LA 3UOAB 4HV8B 1ZHBB 4RMQA 5HP5A 5E94A 4OJFL 3KGSA 1XSKA 1YY9C 3ZZLA 3QORC 1QSFE 1SHXA 3DX2A 2XTJC 4KI5C 2E46A 3ULUC 2FO4A 5GGTA 4I7ZC 4XNXL 4PJIB 4PLJC 5AB0A 5FYLL 1MJUH 3N43F 1LVEA 1U91A 2UY7A 1U8HA 1CVRA 1JFQL 5A7BA 3Q01A 4HUWB 1KJMB 3OMZA 1YJDH 2DMKA 2MHAA 3ARBA 3VSTA 5BZXA 1B90A 4LEOA 1I3RB 3U83A 4AE1A 4FXGC 4WFHD 4JUSA 4QXUH 4X7TB 1NIDA 5AD0B 1OE3A 1FG9C 1ORSB 4QD2E 5DUPL 2Z6FA 5IVXA 4KTEL 4BKTC 3JTSB 3NAAL 3VJ6A 4G8GD 2WXNA 3EDJA 4JFFE 4AQAA 1INDH 3DROA 3GBLA 1C1EH 3FUKA 3GRWL 4KY1L 1SN0A 5LCVH 3EXLA 2ROYA 1T5WB 1DBJL 3ZGIA 2JXMB 3MROA 2H9GB 5C0RL 3RAJL 2X0UA 3BT2H 2LTQC 4HUMB 1KULA 2IVFC 3WTVA 1EHLH 5F44A 4KZDL 2QFPA 1YUHA 4RFEB 5CD3B 4BZYA 3LAFA 2B14A 3KWUA 3IF1B 1I7ZB 5E8NA 2IDQA 4R4BA 3SEPA 3MQIA 3P30H 3K7UA 3MUGB 2XQ0A 3LS4H 4UANA 1DVSA 1UTDA 4WI0B 1LEGA 5I17A 2KKQA 4CN4A 1G9EA 1OF2B 3U6RA 4AK1A 4B27A 2R7EB 5ITFB 4KHTH 2D03L 1XB8A 2YEQA 1DQVA 5DJ2A 2WVUA 4IIQC 2F53E 2A74B 3EYUL 5TK4A 4GYBA 1YYMH 3F7VA 5E8OA 4TUJB 4L1LA 5F7EL 4DKAA 4ODSL 5ABZA 3BVDB 3GSOB 5L4FA 5IJDC 1FZKB 2EJ1A 2VR4A 5BJTA 4E9QA 1FVEA 2P46B 2ZX5A 4Q4EA 1KF9B 4H44C 1TYJA 2J5LB 3U4EA 4EO5A 1GC1H 3HZYA 1GS6X 2A1WH 3H9HB 1II4E 2VDRH 1OY3B 3LKPA 5F1OB 3QUXA 1QA9B 1KN4H 1RQ5A 4EI6A 4UYPA 3NABL 4WW2C 4OR1A 2ZUQB 3QISA 1SOQA 2VISB 3IDYC 2NPLX 4N0FA 4OJEH 5IBTL 1MVUA 5ADPH 5C0IA 3RVUC 5I76B 5E2TL 3TIEB 4ZMVA 1NTDA 4XB3A 2AV1B 4OJFH 1BGXL 4YSCA 5KVEL 2WNKA 1AOHA 1OVZA 4MZ3A 1NGZA 4UOZA 5I6MA 5FYLH 3K0YA 1DYZA 1JFQH 5A2AA 3QORB 4RBPK 2XTJB 1KXHA 3QC6X 4EI5C 3D25B 3HE6A 4KZ0A 5KWYC 1FYTE 2R2EA 3ALWA 3CZNA 3G6AB 4XMUA 1USQA 2IDTA 2LAAA 2WQAA 3W9DB 1WH0A 4QRSB 3ZKSD 4UNTA 5DUPH 4KTEH 1BM7A 4M8VA 1MLBA 3GNML 3NAAH 2DJMA 1U8QB 1HXYB 3VXSA 2EADA 1O7DC 2Z8WC 2BNRE 2MQGA 3UADA 3GRWH 3LNIA 3GXTA 4FXGB 4KY1H 1HJBC 5A40E 4NGHL 5C0RH 4MNQD 4U6TA 1KTDB 4URTB 1PTZA 3RAJH 4DUVA 4I1PA 1HSBB 4LSUL 2JKJA 1QO3B 4MDIB 1MNNA 4G6FB 1YQVL 3GMOB 1FPTL 5C0AA 1NCAH 3WEOA 2KT6A 3PAYA 4JPQA 4OZGB 4BH7A 1SLUA 1KGWA 4FLHA 4HWZA 5IF0B 5FK9B 3C2SA 3K2UL 4U6XA 2LTQB 2AKRA 3IRPX 3JQOB 4J3TA 3IGLA 3HCVB 2D3NA 1IM9B 4MAYA 4D0BA 5EZLB 1BF5A 3L2LA 1JXJA 4JJ5B 1SJVA 4NRZA 3KPRB 5AG8A 1SBSL 4QGYA 1NKRA 5ANME 1N7ML 1IZKA 4AYSA 4PJ8A 4GQPH 4M7ZB 3PFQA 2X4TB 3APMA 3EYUH 3OPUA 3VXUB 3CIAA 2PPDA 4NZTL 4JZOB 1NLBH 2WBWB 2LV4A 3CZUB 4DZBA 4N8VB 5F7EH 2DYPA 2VQ1A 3MRGA 4PCTA 4ODSH 1UJ3C 4XNQA 3S2CA 3S4SB 1NWOA 3H42L 4IIQB 1OW0C 5A3IC 4B97A 1IIKA 1MFBH 2AZAA 5CEXB 1RMFL 2OMUA 4AYDC 1QASA 3O4LD 1Z0NA 4X7SL 4WNQA 1HOCA 4HK0B 4MQ7B 1MI5E 1N4XL 3ZTDC 4IM8A 2X6CA 3W9EB 3NABH 1EAJA 4PJGB 5E1IA 4NT6A 1J0YA 2F54D 2KDYA 3DDGA 4BUGA 2UVFA 4ICWA 4JQIA 3TO4D 1AGDB 2Y3AA 3MUHL 4U49A 5B7FA 1JWUB 4XZ4A 2QTEA 3TX4A 1U8CA 3JWNC 1BGXH 2HFFB 3DX9A 3I50L 5BS0B 5E08H 2X44D 4LCYB 1EWHA 4OCYH 3T2NL 3G5WA 1Q0XL 1FNAA 4Z7AA 3HZMA 1F90H 3IDYB 4WFHE 3GINA 2IPKB 3EBIA 3SDAC 3HE7A 4PJDE 1U36A 3G3LA 1DZ0A 2A7BA 4Y8AA 4G8GE 4N1EA 5CR1A 2IAND 1TCMA 1F6LL 4YNYA 4EVNB 2C7FA 1XF4A 4PJHA 5CUSL 5L4JA 2FGZA 3DGGA 5IW6B 3QEQD 5F3FA 3LOWA 2KQMA 3UFIA 1A4JB 1J8SA 2HRHA 5JW4N 1A22B 1PW3A 3Q2WA 3DLQR 2I7OA 1XAUA 2WBXA 3GNMH 4GRWH 3EJZC 4EI5B 5AEAA 3TBYA 4HPOL 5I19L 2FSEA 4AYEC 3IFNL 4Z23A 4NGHH 3UBGA 3ZYOA 1IBGL 3D39D 4LSUH 1I7TA 1YQVH 1FPTH 3OAUH 32C2B 1HHHA 3LHPH 4HKXA 2ARWA 5E6RB 1L6PA 1LO2H 4HF5L 1WA0X 4UDTB 3ZY7A 4IBZA 3WCYA 4B9CA 2J2ZB 4IRSC 3GSNL 3SD5A 5CP3H 3LPGA 3K2UH 2GCYA 4X6FA 2VSKB 3RWEA 1KYFA 2ZKHL 5IESL 3GJFB 4X4XA 4N2HA 3UDWC 5GZOC 3ESNA 2XSKA 4JUTA 1QRND 4I77H 4UQBA 1SBSH 5BZWB 5IQLA 4BUQA 5E9DB 3MRRA 4XXCA 1KACB 2CGYA 2ZF9A 2F18A 3VXMD 1N7MH 2VLLA 1PKQE 3HG5A 4QRUA 5D1XD 5E6UB 3W39A 4EXPX 1ZANL 1H6UA 4NZTH 1KWKA 1MCHA 4WEUD 5PAZA 5EG6C 3VTTA 1G1YA 2HFTA 1AHMA 2JWYA 4H2AA 5BOJA 2Z0BA 5HI3D 3TV8A 1BMGA 3H42H 1TR7A 1RMFH 1X5HA 4CC0A 3B5GA 3MNZA 4X7SH 2BSDA 1R5WB 3O81A 2CXGA 1N4XH 4J28A 5CGMA 1MRCH 1OL0A 4HHWA 3VI4E 1UJ3B 1MCPL 2BSSB 3AMKA 3DXAB 4XMPL 3CAFA 2CO1A 4BXVA 4Z7OF 4WFGD 1ZGLP 2DWSA 3QA3A 3SPVB 4YZFF 4D0CA 4A6YL 2G2PA 3GI9H 2YRLA 1U2HA 2D7NA 4WSGA 3ZR5A 2P5EA 4F2MA 5I8CA 4M48L 5CEZL 4UOQA 3T2NH 4PVBA 1C16A 1B6DA 3VFTB 1TMQA 1VADA 2YMOA 3R06B 3QZWA 4QCIB 3UBXA 3DX4A 3T09A 1WFUA 2HT2D 2J12B 4ZDHA 3FTYA 4I88A 2HLFC 3RJOA 4IBQA 2OX5A 3BVNA 2ZSVA 3MRIB 4U1NA 3BGMA 4KZEL 4HDIA 5IWLC 3Q06A 1OO2A 3C2AH 4MNQE 5EC2A 1HL9A 3SDAB 4DEPC 2GYSA 2DF3A 3T6ZA 1ZT4B 2OCFD 3BWAB 2VLRB 2IC2A 1I1YA 2MNUA 4I0PD 2IPTL 3RIFF 2J56A 2F5BL 4OLXH 8CGTA 2XA3A 1IE5A 1ZLDA 1ONQA 4HU2A 5DJCB 5EN3A 5I19H 4LCUB 4KKLC 3IFNH 1CD1A 2JLLA 4OJYA 1IBGH 3RY6A 3GSQA 4DGUA 3LZRA 5FO7A 3SO3C 2EVJA 3QEUB 4TVSa 3LZQA 2YZ8A 3ZRFC 4F37F 2DLTA 1SNRA 3GSNH 1NC4A 2AQQA 4ZT1A 5ABAA 4YHNB 2ZKHH 1HEZA 5IESH 2VR7A 2XX0A 3OC8A 4KRMB 5CILH 1P7QA 1MDAA 2HKHH 1V7NL 2IFGA 3LH9A 3VGGA 2CIIA 4AE0A 1KZQA 5CJ8A 4PJ7E 4PBWD 4XN8A 4GMSL 4IRSB 5IK3A 1DQQA 5FKPB 3F58L 3HFML 3O4LE 3FFCB 4KKCD 1ZANH 5JW3L 4WTQA 4YQXL 1A4CA 2L7EA 4YHKH 2KLRA 5B3JE 2Q6WA 3EZ8A 1MCWM 1B0IA 3J2PA 2F54E 5BQDA 4PV9A 4BSVB 1Z5YD 1FG2B 5HDBB 4OV5A 3F7KA 3RIAK 3DMMD 1W91A 3V79C 1X5JA 3CDYA 3NZ8A 3WNPA 4XNYL 3UAFA 4XMPH 1A9EA 3CXDH 3N3EA 3SDDA 3WNNA 3V2AR 4KXDA 4A6YH 4R2GC 4H13C 5SWZB 2DH2A 4N1HB 2FBJL 4M48H 5CEZH 5AOJA 5HI5D 5K9KB 5I16A 2I85A 4GAJL 1MNUL 5DEZA 3MFFB 2Q5BA 3T4YA 1NMCC 5FYKU 2Z4QA 1R5VB 5CGYD 3VA6A 4KI5F 2Z65C 3LKSA 4MDRA 3UXFA 3DHJA 5I1DB 4OZFG 4YVNA 3U0PB 3QQ4B 2BSTA 5IEHB 4J3BA 3FC8A 1F1DA 4ORZC 1BG1A 5KN5A 3EOAA 2EVHA 1Q94A 2YC1A 5FYJD 2F7RA 5I1AA 2IPTH 4NSKB 4RGOL 3RWIA 5KVDE 4XO9A 3QEHA 2F5BH 2MWCA 4M56A 4OV6F 2CXKA 4Y1AD 4NS0A 4DEPB 3PDOB 1S3KL 5JXAL 2N1KA 1ZA6A 1PAZA 2Y36L 4N2AA 1UJTA 4OZGF 3K6OA 4HSQA 2JTDA 4CMMB 3M17A 3VXME 3QUYC 2RMNA 4YS4A 5CM1A 2VLKA 4OCSH 1A7BA 4K2UL 3ZRSA 1JYXA 2K0RA 1EJ8A 5J6HB 5F3BB 2ZUYA 1BVNT 5D7LE 5F0MB 5EC1B 1V7NH 3SO3B 1AGFB 4DGYL 4KJWC 4NDMB 4N25A 3AAZA 1KLGA 4RISL 4P46C 3GUTB 1C5BL 3HFMH 1RUPH 3G5ZB 1R0AL 1BD2D 3GSVB 4NQUA 1MIEL 3WN5C 4YQXH 2AXJA 3HUJA 1DDHA 4L9LC 1K5NA 2OL3A 2YD3A 4YLCA 1MWAL 3TA3D 3B9DA 2W81C 5DURD 5EU6D 5ACMA 4DJMA 4L0ZA 4GG6E 5HGDA 1PJWA 4ZUSA 4H8QA 3CC1A 3Q44A 4GP5B 4A2EA 5ACZA 5JIIA 1S7SA 2HJLB 3OZ9H 3FO9B 4NOFA 2XY1A 3DYMA 3FBKA 3VH8G 5EZIL 4ELKA 4XNYH 1XIWA 4PJGF 2OYKA 3S3CB 1GGUA 1TCRA 1SDDB 1XSOA 3IXTB 1D6VH 4KC3B 1YLBB 1B88A 1NGXA 3PY9A 4HK3J 1EO7A 2BVUA 3ARDC 4RAVA 4J3OC 4ETQA 1A7PH 5HHOD 3SDXA 4KTGA 2VTFA 3ABZA 4GH7B 4OLYH 2O93L 1EDHA 3UTSE 4XX1E 4NENA 1MNUH 3ZE0F 1G7IB 4R2GB 2FX8L 2FJUB 2OMVB 2ZAIA 4ZSOA 5C92A 2WLLA 2IH3A 1WCBB 2MEJB 1B0WA 4WJ5B 2CJUL 3GS7A 4HX1B 3FNKA 2X89A 3JWDC 4LASL 4WWID 1NMCB 1NFDB 4DKEH 4HXAH 2XN9D 2I9LB 3WAJA 4IMLA 1RU9L 1BIIA 3RHWF 1TZAA 3HG2A 4M1DL 3UPCA 1UM4L 4YEEA 5CP3A 2M8XA 2YS4A 3BW9B 3L1OL 4OBRA 1OCZB 1FNHA 1UWFA 2XPYA 5DRZB 1NWPA 3U4KA 3ETSA 1A3RL 4DW2L 1S3KH 3DWTA 4K0OA 5HPMA 4NNXA 3H3PL 2JV6A 3L4VA 4WO4D 5C0DA 4B7IA 1HHGA 3NJVA 5BV7L 3AQXA 1I1AD 2Y36H 4Y16C 3BAEH 4TUOA 5F8RC 3WFHA 2DZEA 3V4PL 4FQXA 2ZOKA 1J12A 3HFFA 1FO0B 5ANHA 1UACH 1D5MA 4LCIH 3AG2B 1UGKA 3INUL 3Q48A 1B2YA 1T6VN 3O0LA 4WEEA 1AC0A 4DOHB 4KBPA 1FLTX 1WBZA 2VZUA 3V0HA 4ZO8A 5C9KA 5DHYB 3I6GA 4DGYH 5D2LF 1XVSA 1E50A 5T5FA 4HH8A 4JEGB 4OIFA 3QUYB 4W4OA 5EO9B 2WGXA 4NQED 1TVDA 4RISH 2OTPA 3G9VA 4HFUL 1C5BH 1FFNA 5EEUA 1BZ9A 5IHUL 1FAKT 4DVRL 1MIEH 2A6IA 3MUY1 4R3SB 1MWAH 2C8NA 2NYYC 5DGQA 2GT9B 5FHAL 3PL6D 5EIIB 3D2TA 4NKQB 4X8XA 1EH9A 2H6OA 4P46B 2H32B 4P2OD 1LP9A 5GZNC 2CO7B 4IHBA 5DVLA 3WN5B 4RSYA 2Q76B 2QPDB 4U1SA 1GZQA 2OTWB 1KXQA 4P59L 5EZIH 4OUUB 4ADIA 4HCRA 3OAZH 5A1AA 2W94A 4ZMXA 5J0BA 4KQ3H 3FF7A 5KVFL 1ZHKA 2V7NA 1UCBL 4H0LC 3RPKA 2XKSA 5CMAB 2AXWA 4BK5C 4MKMA 3RL2B 4W9ZA 4L8SA 1N0LB 3O0RL 2JF1A 4LL1A 3A0OA 3ARDB 1S9VA 2FX8H 3CH1A 5AB1A 2YUVA 4LQFL 4U3SA 5JXED 2Y7QA 2ICEA 3S34L 4TNVF 4PRPE 4PS4L 4Y1AE 5K9OA 1TTUA 1RLWA 4LASH 1OB1B 2RBLA 4OUOA 2ZYRA 1H3XA 3A22A 1VLXA 4KFZC 4PCSA 3WHXB 1F1GA 4JRYB 1AS8A 5C0GB 4M1DH 1K2DB 1Q8MA 1UM4H 3BHBA 4TM9A 4BFIA 3L1OH 3ZT5A 4X4YA 4PW9A 3ZE1F 1EO8L 2DRUA 1A3RH 1TLKA 4DW2H 2R4SH 2A6JA 3FCSB 1SLWA 2R0ZL 3CMOL 3H3PH 3L4ZA 2QVIA 3NA4A 1KCVL 4GAGL 5BV7H 3QUZA 1HT6A 3AQDA 1AR1D 5T1DL 4Y5VC 4LOUC 3HAEB 1MOEA 3AREA 3LXCA 2LT9A 1D7DA 4YXLL 1X5LA 3IDXH 5HHXL 2EDFA 3SKOA 2VN5A 1F3JA 3KL0A 2X1PA 3INUH 3MGTB 3EFDL 4JLRB 4LOFA 3VYOA 3GXNA 3QH3B 5DEFA 4Y16B 1YPZA 5IB1A 3TEXA 2RIKA 4R4FL 1AIFB 3UAEA 2JJTC 2P80A 1P5VB 4AV0A 3L3OA 1KPUB 3OWRA 4XN1A 5IHUH 4DVRH 4OLEA 3CFQA 1BMZA 4KJPC 5IIEB 2IQAA 4UB0H 5KEZA 5EORL 5L8JB 5FHAH 2APBA 5DJDB 3UYPA 4AZUA 2VR9A 1FFPA 3DUSA 2J20A 3U7YL 1TOXA 5HHOE 4BFKA 1JZGA 2OYMA 4PBXA 1EXUA 4LDLB 4NI3A 2V37A 3MLVL 4XOBA 1P6WA 5LO7A 5AKSA 1Q9KA 4NZDA 4MXWL 5JO5B 4LNRB 2WZ6A 5H94B 1V3LA 4MQSB 5KVFH 4LOVA 1LWRA 4IBTA 3NN8B 3TWCL 1KG0B 1RZJC 4URKA 2BNQB 1YNLL 4FQHB 3H7LA 3QJUB 3EDEA 2NRDA 1RZIB 2XN9E 4H88L 4Z7UA 3W5MA 1BXUA 4DN4L 3UMTA 1RK0A 3QNYA 2COVD 3E7JA 3S37X 3VSQA 1YY9D 3X13B 3QORD 2WYIA 3QXTA 3ULUD 1M7DA 1ZTXE 1DVYA 2YOCA 2NNFA 4GG8B 3QBTB 3AT8A 3FF8A 2Y2YA 3NYKA 3VX0A 4G83A 5DHVB 4OLUH 3QUKA 2XKNB 4KJYB 2NW2A 2VZSA 1F8TL 4AQZA 1NCIA 1TEYA 2GK2A 5KVMC 4FYSA 1U8LA 1LLAA 4Z7WA 1LWJA 4PJBA 2HKFL 4HH9B 1EO8H 1BPLB 2R0ZH 3CQQA 3BZDA 2ZF8A 3QIBC 1MHHA 1KCVH 2X88A 2JKRM 1O5PA 1IJ9A 4KTYA 2YR3A 2AW2A 4L8CB 4YXLH 3X11A 5HHXH 5D9SA 1RUAH 4DP8X 1ACYL 5E2UL 4GUQA 2Z9TA 4OJCA 4XBEH 4Y5VB 4LESA 4LBEA 2Q3XA 3KPRD 3BIBX 3NJFA 4TSCH 3DK2A 2AITA 3HRZA 5FB8A 4LSTL 4HWEL 1TZGL 1AD0A 3FQRA 1J8HA 2BCKA 3VXUD 4XNDA 3EGSA 3GSRB 3UZVB 3J7HA 1KGUA 3S4SG 4PGDB 1IMHC 4Z7OE 4Y4KC 3BXNB 5FHBL 5DSCA 2YEZA 3R8QA 1TXKA 3H6JA 3U7YH 3LVEA 1N5AA 4FNRA 2MCAA 3BSZL 3OKLB 1QUNB 5BUPA 4BD4A 2V6HA 1FQ9C 4PJIE 2D31B 3QULA 2KDGA 2NNAB 4MLIA 4U1KB 1XF3B 4JFDA 5HJDA 1R6VA 4MXWH 1KTBA 3CZFB 2PWEA 5JORA 5AVUB 1RJYA 5BS0D 5HHQA 1JWMA 1NC2B 3D3VB 5E0FA 1YNLH 5ICUA 1IKNC 3C6LC 4WU5B 5FW8A 3L9RA 2V9TA 5HVFB 1LMIA 3N06B 1YAZA 2ZX6A 3D18A 5DS2A 4HHGA 3ARFC 3VXTA 1RJLB 5JIMA 4LGPB 3BPOC 2FLMA 4DN4H 1CBJA 3Q8CA 5JW4Q 1EFXD 5DJXB 2HTLC 1KYOK 2IADB 4G9FB 1A4AA 3MOBH 4AGMA 5IQ7L 4QHLB 1W0VA 2CM5A 1NFDF 4EQ3A 3DX3A 1IGJA 5C09A 4J3WA 3AJ7A 4W4NA 2CUMA 3LZLA 3K6IA 4FKHA 1GVIA 1W72B 2HCZX 2W65B 2MQ3A 3O2WL 4HEPG 4HUXB 1F8TH 4WGVB 3QNZA 3HRPA 4NUGH 2YD4A 3MJGX 4ZTPL 3V9CA 2HKFH 3B9AA 3FU3A 2Y2TA 4HWBH 3FCTB 4A2HA 1X5FA 1O9ZA 3CZLA 4AVHA 3DUUB 4X98B 4NQVB 5EEYA 1M3JA 4OQTA 1E4WH 1WZ1H 2XU9A 2UYLB 3C75A 5HGHA 4HPHA 4Z1PA 1MFAL 5EN2A 1K8DA 4MD0A 4DZ8A 5HGAA 2CIKA 2QQNL 3FSOA 4JKMA 4MBOA 5F1KC 5H4ZA 1ACYH 1KIUA 2P47B 5GGSY 4AYGA 3UTQA 3QIBB 4N2NA 5JLZA 1TZIA 1YEGL 3A6OA 4QJ3B 3S3SA 2VYRE 5HGBB 2GTWB 4LSTH 4HWEH 1TZGH 4RIRB 1QHOA 5ALCL 3SY0B 3IEAA 2AEIT 1UVQA 4V2CB 5EBWA 5B38A 1KV3A 2YMTA 5EEVA 2Z7ZA 2BP5M 2DQIL 1RP8A 3LEXB 1JZ8A 4M5ZL 2P4AB 1U8IB 1RKRA 3WLBB 2VAAB 5GGVL 3B2PA 5IMLA 2A0LC 3CSFA 5CLTA 2P28B 4LMQI 4PJFA 1JPGB 1IX2A 3CC5B 3PWNB 5E7FA 3IKCB 2Y5QA 4OU3A 4LRIA 3IDMB 1IC0A 4KVCH 4PEEA 5AYUL 2Z64C 3PQYB 1EIBA 1DBAL 2EH7L 3BSZH 5D7JA 3STZA 5F0JB 4JREC 3F7YB 1YMMD 3DXAD 2GUOB 1I7UA 3PWVA 4Y4KB 5EU3A 2CLZA 5DD3L 2KI6A 1HSAB 4C4BA 4EKJA 3OX8A 1BBJA 3OQRA 2O72A 2P7TA 2WLZA 5KSVB 4TVUA 4TOYL 4IEFB 4ALAL 2XTJE 4KI5E 3KWWB 3ULUE 1KJ2L 2HTKC 3SE3C 4P2YA 1AGEA 5DF0A 5GHWL 1CIDA 3M46A 2R1WA 2WTRA 3S5ZA 3BVUA 2EYRA 1PZ5A 4PQXA 3JTTB 4MA3B 4X99B 1UB5A 2G2RA 4XVJL 1TTGA 4JRXD 3UBHA 2O4EA 2Q7YA 2XWJA 2Y1ZA 5HPOA 5JPMA 4HJIA 3IGUA 3MRMA 3C6LB 3RWJA 5IQ7H 3KS0H 3SDAD 5LQBL 3ARFB 1HQRA 2FNWA 3BPOB 5EFIB 1CFSA 2HAZA 1QBAA 3O2WH 1W16A 1CICA 2BMKA 5ESAA 2AJVL 1JGDA 3G04B 5FO8A 1KPVA 4H20L 4Q0XH 1F3RB 1DN2A 3L7FB 1A6VH 1IT9L 4XE5B 2OXGA 2WPGA 3FOLA 3E0GA 2YAFA 3ALPA 3FO2A 3IDNA 5E51A 2VDMB 4AIOA 4EIUA 2P48B 3L9BA 3M8OL 1ED3A 3H7BA 4LKXA 1INEL 2X4QB 3KPRE 4RQQA 4X8JA 5TDOA 2H41A 3EJZD 4Z77A 5D7SH 4PJEA 1SQMA 5F1IA 2H2SD 3HIZA 1MW2A 5I8OH 2HUEA 5CSBA 5C07A 3VXUE 4UM9D 1MFAH 3ZQWA 2XVLA 4WKZB 2FWOB 4Y4FA 3ZUCA 4BGLA 3RPIA 2HA1A 2FJFA 3MNWB 3VW3L 4OTXH 2YQ2A 5ESVB 1FN4A 4BHUI 1D5BA 3IE4A 3HC0A 4MX7A 4N0YL 3U46B 4IRSD 3QUMH 5KJ4A 5ALCH 2B39A 4CNIB 2FJHB 1GOFA 3FUFA 1AANA 1DJWA 4YHIB 3IFPB 1KBWA 3ARPA 3OTTA 5IT2L 2DQIH 1N64L 3VFPB 4M5ZH 4AT6A 2C4FT 3UIZA 3ASWA 4MJ6B 1K8IB 5GGVH 3S0PA 2UXVA 3F65A 4M62L 4XBPA 3V0DA 3RLSA 3BE1H 4FHBD 2C5DC 1LK2A 2VQ4A 2DN7A 2R0WL 5AYQA 3T8XB 4YGAB 2YK1L 3QT2A 5BS0E 3FQYA 4FKKA 2H26B 3HG1D 5AYUH 4P5MB 4OFKA 3V0WL 3V6FB 2EH7H 1KIQA 4X83A 2DQTL 3REWB 1VHPA 4JFXA 4NHCH 4OCRL 3SQBA 5C2BL 2OMXA 3I02A 3KLKA 5FXCH 2BSEA 4E5XA 1BAWA 5MENA 4NUMA 2OMYA 3WKML 3I9PA 3QPQC 5EF1A 3ZTNL 4TOYH 4YDKH 4CSSA 4JREB 1KJ2H 2HG5B 3UC0H 1NEZA 2R1XA 4MNGA 1WP6A 4G8FA 2VDOB 2W9EL 3R0NA 2DM4A 2WO2B 2BY1A 1ORQA 1ZKAA 3GKWL 4MA8L 4N85A 5JIHA 2K6YA 4LLYA 1UATA 2ZZUT 3R1GL 4JO2H 4WFED 3EO1B 5EEXA 3VXRA 1RHFA 3IJYA 3AFLA 1W8EA 4Z7IA 5K59E 4QAMB 2WB7A 5LQBH 3FSAA 4BGDA 5IQ9B 3A67L 2HLFD 5LGHL 5L4IA 4N6RA 1O7DE 1DVFC 1RZPA 4MJIA 2QQQA 5I5IA 2AJVH 2OK0L 3U1PA 1KB5B 4HLZH 1I85A 4JW3A 1IT9H 1QHPA 5I8EA 1RD6A 1WBXB 4LPCA 5D1ZC 3LKOA 3M8OH 5INCB 3RVWC 3L6FA 3VI3F 1EANA 3P0VH 5I6LA 1BZ8A 1CLYL 1AP2A 1OSPH 3EGXA 4QMEA 4RX4A 5E9DE 4BKLA 2PW1B 4PN6A 2Q3AA 1EXGA 1KTJA 4U2YA 2Q1EA 2IH1A 4UT6L 3FUNA 5AW2B 1AYRA 3BAYA 5EPMB 1KCRH 3VW3H 3D4ZA 3OLIA 4QO1B 4Z3HA 2X6AA 4JPVL 2HVJB 5D1ZI 4F8PA 3BEVB 2TSBA 4UTAH 3MV9B 3GGWB 3UEQA 1NAML 2HLAB 2M1KA 4E9LA 1I8LA 1YYCA 1N64H 3AG3B 3DXAE 4FFTA 3LDBC 1CGWA 4P2QD 4M62H 2V3FA 4QHNA 3TBWB 1M6UA 5TFSL 1P2CB 2ADGA 5AKRA 1MW1A 3UTPD 2YK1H 4KROD 2EIBA 2XTLA 5F9WC 1E9OB 2BVTA 4M5SA 1WAAE 3ZQXA 3KDMB 2LU3A 2JQMA 4IU2A 3BN9C 3WTSA 5C2BH 4NM4L 1NINA 3QARA 1CE1H 4FC3E 4AXWA 4B7LA 4IOIB 3JWNE 4JRXE 4Y2DC 2FLRT 3MLWL 3UGUA 1NGWB 1R5IB 2R27A 3ZTNH 3QJRB 5L2KA 5CLZA 2VITA 3LNHA 1R4XA 1HEJC 4FADA 4HPYH 1KJ3L 2FWLB 3C09C 2G9HA 3HKZA 2EDDA 2W9EH 1XGYL 2VLRE 5D4HA 3MJ8A 4IS6A 3M1OA 4R2GD 3UPRB 3U4BH 1LWHA 4MA8H 3GKWH 4IKNA 5ILTL 1Z66A 3PWPD 2YD0A 4HWBA 5GRZA 4BWUA 1PX3A 3R1GH 3FRUB 4RRPA 4JDVA 3DA0A 1C5CL 5TGBA 1E4KC 3ML8A 1SQ2N 1J0IA 4HT1L 2JK5A 4O51B 1T5XB 3F5WB 4WUKL 5LGHH 1D5IL 4W9CC 4BK8A 5I1KL 1F5WA 2W60A 1B6UA 4TV3A 2P8MB 3NEXA 2I5YL 3IN2A 3WXVH 5DRXB 4Y9FA 5KYXB 2OK0H 1IBZA 1YYLL 3EJPA 1RK1A 1CFNB 3N0PB 4WK4B 4RRPM 1ZY9A 4F7KA 4NQQA 1G7QA 3FQXB 2XCMC 1DVFB 5EDXA 3OGCB 5HY9B 2DD8L 4PJCF 5ESQA 4KI1A 3W0WA 2HPOA 2ZCKL 3I6KB 3FFCE 3ULVF 5FWQA 2OTUA 2UXTA 2WXLA 1I8IB 1D9KD 5D1ZB 1ID2A 1ZHNA 4Y19B 1T1XB 2N7SA 5HVHB 1IFRA 4FNQA 2YSSB 3CZGA 4JPVH 4KJQC 5HDBE 1JDCA 3QUYD 2Q7NA 4CC1A 4PCKA 4AGOA 3TFBA 3N1QC 3EJCA 5JZ7D 4AH2B 3BSZA 1OHQA 4U3HA 4B9GA 4R84A 2AMGA 1E43A 5EIIG 1V7ML 4I1RA 4PG9B 2V7HB 5EO0A 4NNYA 5IMMB 4NJAL 1JN6A 4W6WB 3ZZQA 4ZMNA 4G7SB 3U7WL 1RAMA 1NDMB 1QI3A 3QXVA 4NRYB 5SWZE 3X1GA 4JRLA 1NDGB 2DL2A 3EDKA 2FR4A 5F7AA 4LLDB 5C08A 3DSFL 3ZSSA 3LDBB 4Q4IA 1GY2A 2XVGA 4NM4H 3RU8L 4LLQB 4ENEC 2K6ZA 4NKIL 3GJEA 5I0DA 2H1LM 4AENB 3OGOE 2VDNB 4P06A 4RESB 4QHUA 5F9WB 3OR6A 4CGUB 4YHLL 1B9ZA 5D1QA 4NUPA 1WAEA 4AQ8C 4J3OG 2XKUA 4DKFH 1KJ3H 4CL7A 1NBYA 1VESA 3CX5K 4H25B 3HN8A 4MMZC 3NSFA 4OZHB 4ZFOB 5TE7L 1D2OA 4D0DA 2NTSP 2A9BA 4J3OD 4Y2DB 3GLZA 3FUMA 1A7NL 3TFKC 2WKOF 3KL3A 5CIPB 3SBWA 3BYYA 3SKMB 4HGWA 1ET8A 3OLDA 4J27A 2MJWA 5CINH 3C09B 4GBXC 5DQJB 3HPJA 5DJAB 1X9LA 5EOCH 5LN4A 4AV5A 3GEWB 1TVHB 1BX2B 1C5CH 4Y88A 1Z32X 3L5WB 2P45B 4HT1H 3O6LL 5DQ9A 3WJMA 5CCHE 3FONB 1D5IH 3MBEC 1L3NA 3LRHA 1J5HA 5I1KH 4MCNA 2Q10A 3GC3A 5EBLA 3SQRA 2I5YH 3EYVB 4MB4A 1YYLH 2XZZA 4NHUA 4Y4HD 1GJUA 2W0KA 3S5LA 3H4FA 2B3RA 5F7MC 3V6OA 5A2LH 4PJ9D 3QUMA 3ESUF 3NVQA 1A4KB 1BVZA 2Y22A 5G4OA 2MQ0A 5AVRB 2DD8H 4FQJH 4HKBA 2ZCKH 4YC2C 3W57A 1YEIL 5D6CA 4Z3FA 3QNXB 4Y16D 1TU2B 4P2QE 2HT4C 4OJAA 4G1MB 3L95B 2JB5H 4LARL 4N0UA 3ZO0A 5CCKH 3QFJD 3CH8A 3TF4A 3CFMA 3PJLA 3RIAF 1QSFA 2ITDA 2BK8A 1F42A 5HYSA 4NRXA 1UM6L 4I18A 1EBAA 4NJAH 3QRGL 3QDJB 3U7WH 1J48A 4ZX6A 1GYVA 2WZAA 3EGDB 4GQQA 2ATAA 1KJ2A 1MAML 1RJZA 3AADB 4U31A 2NYYD 1XF2A 3DSFH 1Z9SA 5HJGA 3OHXC 3QJZA 25C8H 5K1JA 1JERA 3WUZA 4BBWA 5GZND 3RU8H 1JI1A 4YHPB 4KNSA 3D30A 5EBGA 1RFDL 3HB3D 1MCRA 4YHLH 3C6SA 4WTWA 4YUEH 4HIQA 4WUUD 3SY6A 1XD1A 1CGUA 1XB3A 1FGVL 3BCDA 1NPUA 1EERB 4NPKA 1NFDE 2YPLB 3ILEA 3QYNA 2PWGA 2FQDA 3B6SB 5DGRA 5E9AA 3OAZK 4OD3L 2JFCA 2O26U 3D7PA 4IBSA 3V5HB 1J05B 1ZS8A 2VO8A 4S0TD 3WEBA 2WLIB 1MG2C 4YPGA 3FPXA 1HH9A 1TKWA 3AXLA 4MMZB 3MACL 4C59B 1RSYA 3LIUA 4BSJA 1UEMA 1K72A 3WY4A 5D96C 3O6LH 2UXGA 3ETTA 3OR7B 4KKPA 4YFLF 3V55A 5I18L 3L5XL 1GYAA 4ZPVB 1G9NH 4GBXB 2F53A 3LQZB 2AEQH 2X4SB 1Q1PA 1KZYA 1O9VA 2N7BA 5FLVA 4DOHE 4PHZA 4G6AD 1S78C 4B50A 2CHNA 4WWKA 3MBEB 4UTAA 2V2TB 3QJVB 1TNNA 5FW7A 3OXSA 3WUWA 2WNGA 2GK0B 3K6FA 3O2VL 5CZKA 2V5RA 2X3AA 1YEIH 4AEIL 4QNPF 3U2IA 4PGCB 3L3DB 4ABQA 2GBVA 1MAJA 4YSUA 5IVXF 3JVGC 2FQGA 4N0CC 1OSYA 2WWMD 1F45A 2ZG3A 3AY4C 4Q6IB 1F2QA 4L1HA 4EOWL 5CN3A 2VOTA 4H26B 5M7QA 1DE4A 2D7TL 4LE8A 3VX1A 4YC2B 2GBTA 1MQKL 4ZODA 5C9JB 3NH7L 3I84A 3DGDA 4UMGA 1OK0A 3NJHA 1HCFX 2X70A 5E6SB 4F91B 1ZV9A 4M6NL 4PLNC 4GFXA 1IBBA 1UM6H 1I8UA 3UO1L 1C08A 5I66B 3LRLA 4UT9L 2VLJB 4FCHA 5ICYA 1Z9LA 4N2LA 1QQDA 2AABL 3KNBA 5I5JA 2YRBA 2ZOTA 5F88A 4ISVB 4Y9BA 1UWGH 3G5YB 1YCSA 4XXWC 1L0XA 4KJPD 1XB6A 1FYTA 4BZ2L 1MJ7L 5EF2A 3MOAL 1GZPB 4X5QA 4HEME 4WW1A 4GS7C 1HAWA 2RFXA 4DGIL 3SGJA 5I1HL 1AZNA 3ECUA 1K9TA 1KXVA 1NC2D 1O7SA 2LLLA 3D3VD 2BNRA 3EH5B 3RWDA 1FLRL 2B9AA 3VCLB 3OHXB 1F3DH 2BFGA 3R0MA 2J25A 1PNCA 3MN8A 3UCRA 1V27A 1TMCB 3RWCA 5J7CC 3J8F7 2A9NL 1MHEA 4JRYE 3A6BL 4ZOEA 4HFWA 1OP4A 1ZPUA 5BMFH 2AEPL 2BRQA 4BZ1A 2ADYA 1NIFA 3KHOA 4AK2A 4Q97A 3D4CA 1L9OA 4V11A 4MD5B 5KVDH 1MFVA 3ABKB 1V55B 1H5BC 2Y9RT 3EUDA 2C3HA 2P8LA 2P3YA 1S7UA 1U58B 2WVVB 3QWNA 4DVBB 3RURA 3LQAH 5I18H 3L5XH 4J8QA 2DDQH 5ANMA 1JZJA 1O75A 2XICA 4JHVA 4LQ1A 5D96B 2EILB 2X9ZA 2Y25A 4N3TA 2QFRA 5F6HJ 2EIZA 2GI7A 5EHFA 1ZT1A 1KT2B 3GT6A 5CP7A 5IM7A 3O2VH 1WS8A 2CLRB 2VO5A 4FEIA 4A68A 3LKQB 4PRNB 1DVUA 3HR5B 3V52L 1MI5A 1AFVL 2FIKA 3LCYA 3QIBD 4FA8A 2B4CC 3P9LA 3OLEA 1OD9A 4GLRI 5CZXC 4LHUG 1YG9A 4EOWH 4OZ4A 4HCGA 3B7YA 3NRQA 2G2NA 4L37A 4FABL 3H85A 3NH7H 3UACA 3DPDA 4LHUD 3TOPA 3MR9B 2MSPA 4N8CH 4NO2B 2QVMA 4PAZA 1RIUL 2NY5C 4U1JB 5FGBC 4GSDL 4JQVC 3Q13A 3DOSA 4Y9CA 3H9YA 1G7MB 1K6QL 5B8CC 2B9BA 2AABH 3EFOA 4PJDA 4HG4K 1FNFA 2XFXB 5E1QA 4G8GA 2DYSB 3BKJL 4WUUE 2BNQE 3BFQG 1LE5B 4FP8L 4Y4KD 5CBAB 3HMWL 3IT8D 4BZ2H 2O5YL 2DLEA 1MJ7H 3MOAH 1KENL 2J88L 4QKTA 2XZAL 4YL4A 1P5UC 1A5FL 1WUNT 4RDQF 4MWFB 4DGIH 3CVIH 3KD4A 4G43B 1IIIA 2EDJA 5I1HH 1FCCA 1LHZA 5FYJL 2PYEB 2ZCLL 3RGHA 1CFTA 1BXAA 1JRHL 1FLRH 3P4NA 1GYWA 3PIQA 4NUJA 3VDCA 3ZDXE 4KV5E 3DSNB 5IHWA 4ZZFA 4PP2A 4YPJA 2I26N 2C3XA 4GS7B 5F72S 1CO1A 2BDNH 3A6BH 1HH6A 2VDKL 1NUGA 3KDPB 2AEPH 2J1ZA 3HTLX 2Z91B 2WXMA 3FUIA 3RZWA 1Y1UA 1EA9C 3C6LD 1DHKA 4CDHA 2D0GA 3BO8B 1Z5LA 4JO4H 1RV6X 1SHMA 1UHVA 2QT6A 3PAZA 2YPKA 3ARFD 1UZ8A 3C08H 3CN2A 2P24B 1A6TB 4KKZA 4JAMA 2ERJC 3S36X 1XCTA 2WD0A 4ODWA 5IOPA 1IKOP 2HTLD 3MRLB 3RX8A 1XBRA 1PIGA 3FO0H 3O9WD 5DO2D 2G30A 2X4NB 4FNSA 4OLVL 3T65A 2EDTA 1PKQA 4PRDB 1PZBA 1H5BB 2VXQH 2Q8BL 1N68A 2BOBA 3LN5A 4GRWB 2OULB 1WA1X 2NY2C 5FOJA 3ZDZB 5C3IA 1SHSA 3CK0L 3EG9B 4PJHF 4YDJA 5JPNA 1U3HC 4ORGB 4HGMA 5CJXC 2YXMA 1SPDA 5H8DA 4BH8B 3FUEA 5JOPD 3V52H 4WHTA 4Z7VB 3MV11 5LBSL 3HC2A 4K73A 3EKCA 3VI4A 2FE0A 4RMTA 5HHMD 2CO6B 3ULAB 3KGUA 2QQLH 1H8LA 4NPYB 5D6DA 3BMWA 3S3JA 4M43H 2EIJB 4OB5H 2ADIB 4KQ0A 2VM9A 3VWJC 3RZCC 5F21B 1U92B 1RIUH 3HEIB 4EN3A 4GSDH 3WE6B 5I1LA 5AB9A 3HMXH 1K6QH 4Z3EA 4GW4A 3MGOB 5EA0H 4UQ2B 4OI8A 3WFCL 2OJ1A 3MPCA 3PREA 5DTFA 3TYGL 3D3VE 4FP8H 5HHPB 1M42A 4MNQA 3TNMA 4Z7QF 2KERA 3L4YA 4OCNC 5B8CB 2GG1A 2G60L 2J88H 1A5FH 2ED9A 4HKZB 4CVWA 4OZFH 2DWXA 1PDKA 2V9UA 1OLLA 4G9FE 5FYJH 2ZCLH 4BM7A 3VDBA 1BXXA 4MD4B 4X9HA 1OXYA 3FK3A 5IQOA 1ZTXL 1P5UB 1N9PA 1WF5A 1BVOA 1IAII 3NPZB 3TNNA 1NKGA 3B9VA 2WZ5A 4H5SA 2ZAHA 2HTKD 3H9SD 1DFXA 4HXBL 3QHZH 3N1PC 4X0KB 4LKCA 2IEPA 4P99A 3SHSA 2GVYA 5TDPA 1XGQA 3Q2NA 3GHEL 1HN1A 1JZ2A 2XBDA 2DYRB 4JFZH 4OLZL 3FN0L 4PJ7A 3NTCL 3CBJB 2VLMD 4UZSA 5SX4I 4FG2A 4PTUA 2F74B 2R1YA 1FL5B 1CTNA 3VXPB 5B1CA 2A77L 2W9DL 4EZLA 1HS6A 3P77B 2HLEB 1WZMA 2ERJB 5AUMA 2Q8BH 4B96A 2BPBA 3L3JA 2H45A 1E3FA 3PXJA 5A2JH 3Q05A 3PHOA 4ZZKA 3W56A 2F54A 3IXAA 3TO4A 2NX5D 3KPTA 1CD8A 1UYWL 3L17A 3S3PA 3LH2H 4IRZA 3TV3L 5LBSH 4MAUL 4NXSA 1QYGL 4XNMB 2NY2B 1AKJA 1KB9K 4OSUL 4TL5A 5KBDA 4RZCA 3GSNB 1JXKA 1M1SA 1MFCL 1TJHH 3MV9D 3QDGD 4J1UB 1U3HB 5IFAL 1NSNL 1QLFA 2X6BA 4C57C 3PQYE 1ITCA 3UJTL 4KKBC 3WKYA 2APVA 4MNHB 3FT3A 3P73A 3BGAA 3F84A 4XXDA 3QO1B 2K3TA 1YN6A 2FYYA 2V0AA 3ZHLA 4L1DA 5KYYB 2WHVA 1GYUA 3RFRA 4EUPH 1ND0A 5BVJA 1KY7A 4U33A 3VWJB 2EEFA 3WFCH 3RZCB 2NSQA 4QRRB 5GSRB 4AMWA 3O45A 5AZUA 5ABDE 2G60H 2OMTB 3BISA 2DKMA 3TBTA 2C1PB 3AB0C 3G5VA 5KS9B 3GBML 2F9BT 2UV3A 1U95B 1P69B 1T20B 3DOIA 4GB9A 3E8UL 4ZUVA 2H3KA 3GS4A 4A6YB 4I9XA 1ZTXH 4HKJB 3FT2B 3VFOA 5AENA 5HI4C 2CUAA 3QPQD 2DM7A 5JIQA 4PY8J 1T22A 5D5MB 4ZQKA 3IWVA 4YBQC 2DWTA 4MA1B 3B2UC 2R0KL 1ERNA 3B5HA 3VXMA 4ZYKB 4HXBH 1BJ1J 3FQTA 4O58L 1L0PA 4PJAB 1DJHA 5F89A 1ZRUA 3QC5X 3VD1A 3CSYA 5D7LA 1REIA 2EH8L 5E4IA 3BUYA 2UZXA 2QVTA 1CB4A 2H3NA 5T1KA 4OKVB 1F4WL 4CVXB 1DQJA 3CPUA 5JOPE 2Z8VC 2DQJH 4O02H 2A77H 4P5KA 2W9DH 3JV5A 3MU3A 4WV1A 4JM2D 2LLNA 1DVFD 2ENYA 3FT0A 4GG6A 2IWKA 1MW3A 3NPSC 2C3WA 5I2IA 5TQ2L 3MRDA 1OSZA 1G1KA 2DMCA 1EAOA 1Q9LA 4H8WL 4LMQE 2FJGB 5D1ZD 1X5MA 3RVWD 3V5KB 3H6AA 3ML9A 4Y19D 5F7WC 3TV3H 1BZDA 2NDGA 4ZMZA 1QYGH 4C8XA 5JW4R 3QUHA 5LBGA 3KYMB 2GAZA 1IQDA 1N8ZB 1NMAL 1TG8A 1MFCH 1TPXC 2BWIA 3SJVB 5IFAH 1NSNH 1Z6JT 1COBA 3ESMA 1JTOA 1YN7A 3UJTH 4F7TB 3JYCA 4TSBL 3S2AA 3VD2A 4ZW7A 4ZUUB 1HNFA 4P9MH 3ZKND 3PNWA 4HHAA 1S9KC 1OGPA 4AEEA 3EH1A 5C0EB 3NCXA 3P4OB 3QR0A 3UTSA 4A7TA 3I3BA 4HBCH 2AQSA 5BZZA 4P3DA 5LNDA 3IJEA 4E42B 2OCCB 4F57L 1TDQA 3NA9H 4I0PA 2DQHL 5CXPA 4AQEA 1RURL 2B8OT 2DOCA 3TU6A 4U7MA 1HHIA 2K1MA 1O9WA 3AVEA 4M4RA 5AOIA 1U8JB 1N3NA 3ULUL 2NR6D 2WUCL 1C5DA 5KZCB 4HLJA 1XGTA 4IGBC 4XR8C 2KZWA 4I3GA 4ZW5A 4N3UA 4KDTC 1JK8A 1ZGLA 2G5BA 4NQTA 3BN9D 4UDUB 1WCQA 1TZOA 2CCLA 1ETB1 1FFOB 1W0WB 2IF7A 2JCWA 2V2WA 3E8UH 3NCWA 5JTWA 1HNYA 3TO2B 1JNJA 4Y2DD 2P8PB 2JI2A 1KTLA 3CPLA 1AHWA 1LL1A 3SYPA 2VDLL 4V1DB 3AB0B 1T5KA 2QKIA 2VLME 4R26L 3UPAA 2VXQA 1CXIA 2R0KH 3ABLB 4CGTA 5HHNB 1HIML 4GUPA 1ZGLM 3W11C 5E8EB 3IJ7A 1KGCD 2Z35A 2O6PA 2BSBA 4L3CA 4P0DA 4P57A 4EIZC 3ZL4H 1IGTA 3BAXA 5F3HA 4R90H 2EH8H 1E9QB 4XGZA 2EUZA 3J07A 4HUNB 3MRBA 3BCFA 1F4WH 4QLRA 3E6FB 4XMLL 4XN7A 5GGQH 3KPOB 5B7MA 4QNPE 4GRWF 3VXNA 3QHTC 3I6LD 4PG2A 4NO3A 3F7QA 3KVQA 3NFNA 3L9YA 4GXUN 3TF7C 5DJ0B 2Q20A 3MV9E 5FEBA 2X42A 4M8RA 5B1BB 3CCHA 4DKTA 5SWQA 4H8WH 4LT7A 4TTDC 5H37G 4XP5L 4X5WA 3VUAA 3CLFL 1XZ0B 2DQGL 2NUPB 3HMXA 2WBKA 2WK2A 3ELQA 2VE6A 1FNEA 2LVCA 2ZOWA 3NPSB 3DV6B 4NQCB 2EVFA 4AJ0A 2WBJC 1NMAH 1I1FB 3HI1B 3IB4A 4ZMQA 3IK2A 5JMOC 1NEUA 5IMOA 4G1EB 1WC7B 4TSBH 4JK0D 3GHBL 1U8NB 2VERN 3QXWA 2DV6A 1IBYA 3CFUA 3I3DA 4KJQD 4QT5A 1S3RA 3MRKA 4QF1A 2GY5A 1TPXB 4HJGB 1FRGL 1KBVA 2RHEA 3LN4B 1KLUB 4Y2NA 3FHQA 2DQHH 3N40F 2ZCZA 3L3KA 4M5YL 3RA7L 3TVMD 3ZKMC 1MWAB 3L48A 4PRPA 3VXOA 4Y1AA 2NY4C 2IAMB 4YHYC 3ULUH 2COQA 1VIWA 2R29L 1T04B 3ME0A 3VTMA 1U3NA 2CLVB 3IBOA 3ES6B 1A2YA 2X4UA 4Y2OA 2XXCB 1L7TH 4XCFL 2VGLM 3GIZH 4TLTA 1BZOA 4E0RA 4YXKL 2OZ4L 4ENED 3CDZA 4MMXA 4IGBB 2XQYG 1SJHA 2XRAL 3RTQC 2RQ8A 4HSCX 5EZJA 2QSQA 1FNGA 4NQDB 5C1MB 3F2LA 3MBWA 4PWHA 3ZMRA 3CVCA 3OKKB 5T8IA 2XTSA 3TFKD 4ODTL 3BUQA 5C7ZA 3TA3A 4YDVA 1LEIB 2MRYA 3LIZA 2O61B 2IV9A 3QDMB 5F1NB 4KPHL 4XVSL 4GO9A 4I5BB 3ARWA 1DUZB 2OYLA 4HS8H 5LBSA 3DX8B 3QB7C 4Y19E 4XB8A 6PCYA 4F7PB 4FA7B 2YXVA 1ZT7A 4AG4L 3L2MA 4N8UA 2V2XB 2BP3A 2Q8AL 3VH8A 2ZOOA 3G08B 4G7RB 3O3EA 4N8PA 3ESOA 4UV4H 2QSCH 2XNAB 4NKMB 5ERWB 5HHOA 3WEXB 3Q3GA 4XP5H 3CLFH 4O2FA 3AWEA 3BP7A 3V4PB 3PRZA 5KSBB 4UILH 2ZOLA 3ULSB 3Q5OA 4XAWL 3RTLA 4XH2A 4EUPA 2N0MA 4B9KC 1S4IA 1NM4A 2Z7UA 4C56D 5JHBA 2XXFA 4MXVE 1F6FB 3QSKB 5KYWA 4E9SA 2EQDA 4YHZL 3GHBH 2HT4D 5FF6B 5DUML 1S7VA 5E4OA 4K07A 5L2JA 5AVSB 4Z78B 2BRRH 2WUBL 2XN9A 1FRGH 4PRHB 3BIKA 3G6DL 3L3IA 4R7LA 5KW9L 1T21B 1DLHB 4M5YH 4XB7A 3WFBH 5B1JC 3NSXA 1YPZF 4OZHE 4NZFA 4WO4A 3ISRA 1QKZH 3FYIB 1PYWB 3MV01 3C60C 4WWNA 4B0MB 1I1AA 5LGJB 5KS9F 3B2MA 3O6MH 1MN4A 1LILA 5KG9A 1U33A 4YEFA 4YHYB 5DD1L 2HKAA 2OZ4H 3RI5K 1KGCE 3FTWA 2BS71 3DX6B 4K5NA 1G5AA 1GS8A 1S2EA 1ZS2A 2AAAA 2NYKA 4J4PD 2BP8B 5D5MF 4U1MB 4LXFA 3ZHDA 3A24A 1T7ZA 3PGCB 4O02A 5I0VA 3KG5A 3QG6A 3AWFA 1QTPA 6CGTA 2W8CA 3P9MA 4R96B 1PSKL 4BFRA 4TUKL 4Q58C 3VU2A 3ECBB 1XH0A 1UQSA 1R3KB 3RTQB 4ODTH 1ES0A 1L9NA 2X2UA 3QZNA 2PKDA 3CDFA 3VD0A 4ZFFA 4P2OA 4XP1L 3BH9A 3TESA 4NEHB 1HZHL 1OGAB 4OF6A 3AQZA 4Z7UF 4PD4K 3AUWB 4Y9EA 3O2DA 3KPSB 3GLDA 1ZHLA 2HT3D 1FL6A 2E7HA 2FJSA 3HS9A 1QTSA 2DKUA 3IJHB 3LVTA 5KYUB 1A6PA 1SVBA 2G75B 4HV8A 1ZHBA 4K9EL 3WJLC 1WSST 4JM4L 3KYNB 4FF9A 3ZL1A 4S1SL 3EO0B 1CYXA 2WAHA 1BOGB 4PJIA 3F7RA 4P4RB 2NLJB 4Z7WF 4HUWA 3BKCL 3FU9A 4PJBF 5E6IC 1ACCA 1KJMA 5I1CL 4BJLA 5B39B 1IGCL 1A7RL 1HHJB 3K4ZA 4XBMA 3DVGB 1CXHA 4PYGA 4N0CD 4R0LC 1I3RA 1GCYA 1MFUA 4HIJB 5DUMH 4X7TA 2OZNA 5AD0A 2GHWB 2YOAA 1WYJA 1ORSA 1AMYA 2WUBH 4CU6A 5G55A 2QGDA 3JTSA 4PJ5B 2NSMA 4AITA 4AYMC 4DGVH 4A66A 3G6DH 4M8QB 3B2VL 4JFUA 1AY1L 2K6WA 3C8KB 4GKZB 4OF8A 1T5WA 5BO1L 2X9XA 2JXMA 2H9GA 3SO5A 3WU1A 1EHXA 4UCFA 3GI8H 3K46A 4RFEA 4UOW1 3GUFA 5CD3A 3CFTA 4L4VD 3ABMB 1AXTL 3IF1A 1I7ZA 4UM8B 1J88A 3RX5A 4LAQL 1G0XA 4FHKA 3MUGA 1AZZC 2ZT9C 1AC6A 4DERA 4WI0A 5CSZB 2X2JA 3BVVA 4L8DB 3C60B 5HVGB 1OF2A 2PUQT 2AZUA 2NY7H 2R7EA 4IBYA 1BEXA 3CFDB 5ITFA 4U3XA 1CLVA 2EXSA 3C5JB 3EOBB 3IU3B 1XX9C 2FH8A 3UAAA 1T0NB 2A74A 1JK9B 2VZ3A 3NK3A 2EYSB 3IDIB 1PSKH 1PCSA 4KVNH 4TUKH 4TUJA 1FH5L 4LBAA 4RVBA 3BP4B 3GSOA 3HJEA 1QNIA 1FZKA 1QWUA 4X5XB 4YR6B 1OOWA 1ZLVH 1J5OL 1D5XB 3CZSA 3H9HA 1HZHH 1MLCB 1LK3L 1J9QA 1NOAA 2FX7L 3DX7B 1OTSC 1QA9A 2QADC 1X4XA 1UUNA 2VISA 2CU9A 1U4FA 1EX0A 2X2YA 2NQDA 2XJKA 4PMEA 1WZKA 4FI6A 4IKLA 4Z3GA 5I76A 2IG2H 3TIEA 2BNUB 2AV1A 4K9EH 4JM4H 2VRAA 4K7PL 3UZEA 3V9EA 3MJ9L 3A6CL 4L2LA 4UOJA 4U1IB 3KXFB 2BZ7A 4GQ9L 4QXGL 3UIYA 5KAQF 3VXQB 4I2XB 2VLJE 3V5DB 2P42B 1QBMH 1K4CB 2GPZA 4AM0Q 3RRQA 5JIDA 1S9XB 3HC4L 3I9IA 3MXWL 5BUAA 3BKCH 4FFYL 3QORA 5I1CH 5F0LB 1AQKH 1E65A 3L5HA 1IGCH 1A7RH 3D25A 2IXQB 3WD5L 2EUVA 5CZXD 5F7UA 3TBSB 3G6AA 1BREA 3W9DA 1P84J 5CN2A 4LAJH 4QRSA 3N85H 5E6IB 4EZKA 1IAMA 4Y2LA 1M56B 1U8QA 1HXYA 2IIJA 4G11A 1UOKA 4IOSD 3JT0A 4R0LB 1AY1H 4GNKB 4FXGA 5GS1C 4N87A 1UOLA 2ZKMX 4R4NC 1KTDA 2CKBL 4RFOL 4FEMA 4CILA 1HSBA 4MDIA 1MCIA 1QO3A 1EEYB 3GMOA 1FORL 1E8XA 1JD9A 3L5JA 3WS3B 1GKOA 4ZFZB 4ALAC 4OZGA 4JKLA 3V8CA 4LAQH 4N28A 4ZQTA 3R18A 4POZC 1A6UH 3IMRA 5IF0A 5FK9A 4LLVB 1X9UA 2J1XA 1U3ZA 2AEOA 4JJOA 3ZYJA 3IJ9A 2GJ6D 3HCVA 5I28A 2FHBA 1UEYA 1MQ8A 2B0SL 1SJXA 1IM9A 1X5AA 1DSYA 5EZLA 4R5XA 4QLWA 4JJ5A 1WHOA 3FTGB 4XC1L 3KPRA 3H2WA 5DFVD 1ZSDB 3MV8B 1YECH 1JHLH 3RYMA 2E76C 2X4TA 3PHAA 4X6DB 3VXUA 4ONHB 4Q6YA 4JZOA 5D7KD 3ZYIA 2A9ML 1KMGA 4JO3L 1E7UA 2XT1B 4N8VA 4X6EB 5I1JL 2MCMA 1EMTL 4NKDB 4L0PB 1JZ6A 5E1HB 3SSGA 1JPTL 3S4SA 4IIQA 3FHAA 5CEXA 5A2IH 1FNLA 1J5OH 1E40A 1J1OL 4HK0A 4MQ7A 2FX7H 3W9EA 4WIQA 5E2WL 4XC3L 1S7WB 2WANA 2N01B 3KPLB 1ILUA 4PJGA 1FNSL 1T1YB 2AJUL 4QYOB 4NP4L 1KNOB 3IMSA 1QPXA 5GS0C 3GSWB 1IAOB 1AGDA 3QS2A 2EIKB 1JWUA 2D3LA 3HE6C 5IHLB 2HFFA 4LPUA 5BS0A 2JSFA 3GBNL 4K7PH 5GGSB 3A6CH 4UNUA 4LCYA 2ZQKA 2QADB 2CGRL 3SOTA 3UGEA 5KSBF 4QXGH 1QNZL 2NY2D 5MI0C 2IPKA 2X4OB 4J8RB 3OQ3B 4OF5A 4PUBH 4L3EB 2ZUWA 1QLRB 2WQXA 1U3HD 3HC4H 3MXWH 3BKML 4Z8FL 1A9VA 4FFYH 4GIOA 4EVNA 1DO6A 4AL8C 5IW6A 4GPVA 3ARGD 3PCYA 1H3PL 3WD5H 4CKVX 2F8OA 4FG6C 4OCMC 3FMGL 4ES8A 1A4JA 5DK2B 3O3BB 2K9UA 4AVJA 2DEWX 4M00A 5J11B 3VWJD 4EI5A 2PYEE 2YJLA 2KPNA 1CLCA 2WTPA 4HEPA 2DMHA 3DRQB 4QXTB 2V4LA 3BI9X 2G0KA 2E7BA 1FORH 5I6OA 5KVEE 32C2A 5B4MC 4UDTA 3D2UD 4FULA 1E6OL 4XO4A 2J2ZA 3MFGB 4OD1L 4APXB 1RUQL 5GS1B 3T0BA 4S1DC 2WZPD 2Y7LA 1BQUA 1RUKL 3VRIB 2EAEA 3DIFB 3NUKA 3GJFA 1OTUD 2B1HL 2R0LL 2B0SH 4CVUA 5CZVH 1UURA 4NN7C 4O2EB 2FSDA 4JFHD 1DBMH 4XC1H 5BZWA 5E9DA 5J56B 4PBDA 1NCBL 3QXUA 1KCSL 3BD4A 5C3TA 1FO0H 1IL1B 4J6IA 4X4ZA 5FYKD 5EUKB 2A9MH 2FZ3B 5I1JH 4UV7L 1F6AB 3ILPB 3ZDZE 1T3FB 4JZJC 2V5MA 1WUZA 3BN3B 2PW2B 1NGQL 3WS6C 4JFFB 4MQXC 4YIQB 5CD5D 2F6AA 3NJMA 1J1OH 1R5WA 4Z7VE 1NL0L 5C8JB 2CDGB 2XG5B 5E0QA 5E2WH 2ZP0T 1UJ3A 2BSSA 3DXAA 3HE7C 1JWSB 1FNSH 2AJUH 4NP4H 1OW0A 3SPVA 5LHDA 3GWJA 3OJ2C 2CBQA 3KLAB 5DZJA 1T2XA 2BO0A 1MFNA 5E9NA 4H0IA 1F86A 1NFIB 12E8L 1ZJBA 2JQZA 1H6TA 3VFTA 3H4HA 3R06A 4QCIA 3SJVD 2WAQA 4LSDA 5F7NC 4Z8FH 3MRIA 5ISZB 4HUUB 5MI0B 1SMOA 3T0DA 4GSXA 1XCQB 1L7IH 3ROLB 1H3PH 3GB7B 1NCCL 4KRPC 4MHHI 3SDAA 4ZOAA 3C87A 3AUVA 1PLAA 3FMGH 5FFLA 3HC3L 1ZT4A 4MA7H 2KQNA 3BWAA 2VLRA 3CHXA 4XWOC 3RDTC 4ACTA 3MDJA 4KKBD 3TZVC 1PZ3A 3FOMB 4J3OH 4ODBD 4ZI8A 5DJCA 2WWOA 1FI8C 2DQEL 4LCUA 1EEQA 4WSJA 3BC9A 3NIDB 4LSVL 2EICA 4HMDA 4LP5A 4AGLA 3GFUA 4B9PA 4JPWL 2ZCHH 3E9TA 3N6YA 2HXAA 4PRIB 4PVNA 3QEUA 1X4YA 1E6OH 2HYMA 2A3TA 4OD1H 4OM1L 4WWPA 3RVTC 1TEGA 1J1XL 2CR3A 1RUKH 5D7KE 4ABVA 4YHNA 5DUJA 2R0LH 5G4MA 3OG6B 1JPST 2CA4A 2CK2A 2RA1A 4V1DD 2BY3A 1YMHB 4IRSA 3IJSB 5FKPA 3LXUX 1NCBH 3FFCA 1IM3B 1KCSH 3EJUA 4ZNEE 2GY7B 1IGMH 1KYOJ 3UDWA 5GZOA 2J5WA 3JZ7A 1OWRM 1I3GL 3CFJB 4NN7B 3MLYL 5HI4D 4WJKB 1QFPA 4MFHA 5K1NA 4BSVA 3WHE0 4RFNC 3X3GH 4YBQD 5EEZA 1IKFH 1FG2A 4Q74A 2X3CA 2VXTH 3MRPB 2Z8RA 1Q90A 5GGUB 3ZE2B 1WS7A 1OAUH 1NL0H 4DT2A 3ZIYA 5AVZB 4U6VH 4HS3B 4JZJB 2OMWB 1D7CA 4K5LA 4JFEB 4Z5RB 4NFDA 1YC8A 3PAUA 4KY2A 3FO1B 2MIZA 3CZJA 2MH4A 5SWZA 4XOAA 4G6JH 2FWSA 2G4GA 1JF5A 3BUIA 2PCPB 3ZVVA 12E8H 5K9KA 1G4RA 4E41B 3BWSA 3MFFA 3UBXI 2E7DA 2YA2A 4OFIA 4OZIB 1R5VA 3IDGB 1SF3A 2H0FA 1UWEL 2VT0A 5T1LB 4QRRE 5I1DA 3U0PA 3PS6A 3QQ4A 5IEHA 3PDDA 1NCCH 1WO2A 5IV2B 1CFBA 2O5NA 3HC3H 5D71L 3T8VA 1MCOL 1NBZB 2O5ZL 3FAXA 1NAMB 1CGSL 2OM5A 1P7KB 4FYTA 4RBPH 4NSKA 2XJLA 2V9RA 1EVUA 3KLSA 3OXRB 4MBRA 1HESA 4J6RH 5KS9E 4F15B 3U2SB 1IBFA 1UKQA 5IB5B 3VRLE 2WO3B 4KRPB 2DQEH 3PDOA 4JG1L 2IOIA 4LSVH 1EZVX 4JRFA 4UQIM 1X6NA 3RDTB 1A1MB 3W82A 5CU5A 3DURB 4JPWH 5D5ME 3TZVB 4CMMA 3ARXA 4FZEL 3ZXAC 5C0NC 5DHVH 1TFHA 4A7GF 2QHLA 4OM1H 2UX6A 1J1XH 1LM8V 2NCEA 2HH0L 2XV0A 4PJAE 3WFZA 3IPBA 2X6VA 1DTUA 5J6HA 5IP4A 5F3BA 4IGBD 4FL4C 2DQFB 4M6ML 5EC1A 2BC4B 1AGFA 4WHYG 3TA4D 4F93B 4NDMA 1MZZA 2WXGA 3MUJA 4IHOB 2JVUA 3GUTA 4HULB 5F8QC 1T66C 2LU4A 3G5ZA 4YXHH 3D0AA 3GSVA 3TCLB 2FO1A 3P1VA 1I3GH 3ASNB 2J43A 3MLYH 3BJLA 2EYTB 2TSAA 1NEPA 5E4AA 4JG0L 4GAYB 5C6PB 4GW1B 4KH2A 4BELD 1YEFH 2XWXA 2HJLA 1TVBB 1P9MC 3FO9A 3W11D 1F18A 4UF7C 1O0VA 4LDOB 5HDQL 4UMSA 4BCXA 3IGAB 1SDDA 2A73B 3IXTA 4RFNB 1M1XB 2DBJA 3M07A 2WLMA 4OFYD 4PR5B 3SJVE 2ZXEB 4CJ1A 3DDFA 4PBVC 5ALBL 4G8IB 2A38A 3AY2A 2NCMA 1OGTB 4QRPD 4XWGL 3CVDA 2EEAA 3B7SA 1W8NA 4Y7MA 3WYRA 1G7IA 3B9KD 2A9DA 4TTDD 4K5PA 2OMVA 3GTNA 5DYFA 1UWEH 1WCBA 4AW7A 2XWBB 2P5WB 3MCKB 3EUUA 4WJ5A 1JZ7A 2UWEB 4HX1A 2EDMA 2C34A 2WBJD 3O3AB 1NFDA 1XL6A 2I9LA 3T0ED 2XC8A 1MCOH 4PRHD 1MJ8H 3FUDA 3PP4H 4ECNA 4FQIL 3BW9A 2BX5A 3WIHA 4LSPL 2VIRB 3EO9H 1N70A 2WSKA 3NIGB 5DRZA 3T0WA 1RZJH 3KLLA 1JTTA 4N2IA 3RWFB 1N12A 3GMQB 3NSCA 4Z18A 3DETC 2Y7OA 3TGXA 5I0XA 4LVEA 4NQXB 2DH3A 4JFSA 4V1DE 4FZEH 5TE6L 1ZIBA 5DDHB 1FO0A 1K5WA 2NY4D 1W72H 1A3ZA 2QBWA 2EUXA 4BKSC 5K69A 2HH0H 1WWAX 4XPHL 1J0JA 2NMSA 5JA8B 3HI6L 4M6MH 4AM0B 5DHYA 2WLJA 3UJIL 4YLBA 1MCNA 1QSEB 3QUYA 4JZNB 2Z0UA 4FI8A 5EO9A 3D0LB 3SE9H 3SGKC 3WGUB 4C54A 2XZCL 5T1MB 4EIBA 1HYSC 1RULL 4ESKA 1E4XI 4FL4B 4MJ2A 4R3SA 2GT9A 5EIIA 4R5VA 2X4PB 4P46A 2H32A 5K9QI 1N59B 5K1VA 1MZYA 2CO7A 3DOHA 1GJIA 4LCCC 3MO1B 4YBHA 3WN5A 1OGAD 5D1XC 2Q76A 2OTWA 3ARQA 3TT3L 1Q0YL 3KPSD 4NQCE 4OUUA 4XNAA 3VU1A 1QBLL 5IEKB 2JLPA 1U42A 5GS2D 4PWFA 4RH4A 4PSPA 4L23A 5ALBH 4NO5B 3MODL 4KXZI 2WCSA 3GLAA 5CMAA 3RL2A 5T3XD 3T77B 2EE0A 1FGNL 1N0LA 5B39G 2A6DB 3ARDA 5DC4B 3SOBL 3STLB 5LGYA 3P3TA 4AV4A 1J9CT 4X7EC 3D12B 1YEWA 3O4LB 2IWEA 1MFDL 2BY0A 3U9PL 4WQOA 4WY7L 2AJ3B 4DP0X 3QIWD 1OB1A 1J8KA 2WNWA 4XP9H 3U6XA 2XVKA 4AQ1B 2VDOL 1NUNB 1HKLL 3WHXA 5C0GA 2AJXL 4JRYA 4HU8A 4P2CG 2BXYA 1MRFH 1K2DA 4XNZC 2N56A 4XPTL 3VG0L 2EEDA 1JG9A 3N91A 4LSPH 4M7KH 4QI3A 5KTEL 3T6VA 3NIDF 1I1RA 1KY6A 4I3RL 5CJOL 5K39B 4JMNA 3FCSA 4XPAH 1OZTG 1QP1A 2EDEA 2G3ZA 2VXVH 3DIVA 4RZKA 1HVXA 5GISH 1FL3B 2XACC 2QDWA 3HAEA 2IANB 5TE6H 1VB9A 4NQDE 3ZU8A 1T4KB 5FS5A 3ENEA 5I6KA 2CBTA 3QEQB 3DX0A 3MGTA 4JLRA 4TSAL 4XPHH 4HGKC 1PBYA 3QH3A 4JHAL 4D2NA 4GUCA 4Y16A 5F7FA 1TTAA 3HI6H 3CU7A 1THAA 3QDME 1AIFA 1A8ZA 3V4UL 3MJWA 1P5VA 1XT5A 2DQUL 1KPUA 1F2XK 3FH8A 4MYPA 1FSKC 5DMIL 2XZCH 4D9QD 1HYRC 4PB0L 1RULH 1D7FA 1KDIA 1U30A 4KK9C 3D39B 5HJ3B 5IIEA 3TT1L 3GIVB 2W80C 1U2YA 5DJDA 2R9HD 1AO7B 3OSVA 4G6KL 3ZE2F 2AGJL 4GSQA 1YEEL 4LHQB 4KKCC 4QTHB 4JKNA 3TT3H 1D5ZB 1SXCA 2QPSA 3HG4A 3KEHA 5KSBE 2BIHA 1X5YA 2AJYL 1Q0YH 4IDJL 1JNHB 4NNPH 1EDYA 1JGVL 1QRNB 1UA7A 3FHEA 3LNDA 4XMXA 5FLUA 5GZNA 1T89C 5IW1B 1AS7A 3U1SH 5JO5A 4LCCB 4LNRA 5H94A 1YY8B 3FYEB 3GM0A 5D1XB 1E8ZA 1I9IH 3DMMC 3NN8A 3MODH 1KG0A 2BNQA 1L0QA 3KXFD 4BA0A 2ZTBA 4FQHA 4ERSL 3CFBB 4XVOA 4IRJD 4F8LA 4GP4B 1KYUA 1RZIA 4X80L 3HLAB 3ISYA 8FABB 4PRHE 1FJ1B 2J8UB 3SOBH 3X13A 1UT1A 3D69B 1GSKA 3FU8A 5ITBL 1ADQA 2W0LA 1JPEA 3U9PH 3WNIA 4U6YB 5D2NC 1YUKB 4WY7H 4BK5A 4YHML 4GG8A 5HBBA 2I9TB 2ZONA 3S98A 2KLTA 5HI5C 2BS8A 4XN5A 3NCJL 2VDOH 5DHVA 5E6ID 5AAMC 5I6NA 3CFEB