1ASCA

The structural basis for the reduced activity of the d223a(d222a) active site mutant of e. coli aspartate aminotransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFAFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for the Reduced Activity of the D223A(D222A) Active Site Mutant of E. Coli Aspartate Aminotransferase
rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 122
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ascA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ascA01
3AELA 3CBFA 4UHNA 3B1DA 5LH9A 3T32A 1WYUA 3B46A 4DBCA 2JJFA 3DC1A 4CBSA 1BJWA 2BYLA 2EZ2A 3K40A 1AHFA 1RVYA 1WKHA 1AKBA 1YJZA 2BI9A 2D65A 3FVXA 3JWBA 3NYTA 4K2BA 4WLJA 5E5IA 5C6UA 2DKJA 3AOVA 2CJGA 1GD9A 1Z3ZA 5EQCA 1CJ0A 4TV7A 3PJ0A 4ITGA 1TARA 5EIGA 4O6ZA 2ZP7A 3EI9A 2W7FA 2VMTA 5EUNA 3KE3A 4ZDPA 1SVVA 2CH1A 3FCRA 4BHDA 3UWCA 5HHYA 1W23A 5EAVA 1XI9A 1I29A 1IJIA 1WYUB 2CTZA 1V2DA 4R5FA 4OBUA 5BJ3A 4JEYA 3DODA 4JE5A 3KKIA 1N2TA 3FZ6A 3ZZKA 4A00A 4DGTA 4AOAA 1SFFA 4JEZA 4E3QA 1UU1A 3AEPA 3K28A 1GEWA 4WD2A 4E77A 4IYOA 2W7JA 4TN4A 3DU4A 3A2BA 3BN1A 3MEBA 3RBFA 1RV4A 1TOEA 3F6TA 4ZM3A 2YCTA 3F0HA 1EQBA 3ISLA 1QJ5A 3FVSA 4HVKA 1BT4A 2GMUA 4OCAA 2FN6A 4UHOA 5M49A 3B1EA 1TPLA 1D7UA 1LKCA 4UOYA 4AZKA 1O62A 1YIYA 3IF2A 3GETA 2W8WA 2VMUA 2CY8A 1SZKA 1BJOA 2ZY4A 2AEUA 4LNLA 1YOOA 4NOGA 1CS1A 1KL1A 4WBTA 1ELQA 4P3MA 1DTYA 2VMXA 1B9IA 3HT4A 4H51A 2AY4A 4A0HA 5M4DA 5M46A 2X3LA 2GMSA 3MC6C 4F5FA 1DGEA 2JGTA 3EIAA 2AY3A 1DJ9A 3LVLB 3TCMA 4M2JA 3FSLA 4WXGA 5D5SA 2ZY5A 2CJHA 4WLHA 3COGA 2W7MA 1WYVA 4PIWA 2DGKA 2QLRA 3DRDA 1D7RA 3R9AA 2GB3A 3LVKA 3DXWA 3Q8NA 4ADDA 1CZCA 3LV2A 3H7FA 3JTXA 2Z20A 3M5UA 3BCXA 2YHKA 3PAAA 1GC3A 1M7YA 2C81A 3R4TA 1N31A 4WYFA 4F5GA 3E6GA 2HOXA 4R2NA 4PVFA 1D7SA 3QBOA 1AMQA 1EJIA 2BI3A 3L8AA 3LY1A 4XQ2A 1ARSA 3QPGA 4FL0A 4W8IA 4A0GA 7AATA 1C7NA 1DKAA 3E77A 1GEXA 3PGYA 4ZM4A 1AICA 2WK9A 3G8MA 1E5FA 2DGLA 1YJYA 2BIGA 2ZY3A 2BWNA 3MBBA 1AKCA 1BQDA 3GWPA 4HF8A 5DX5A 4AO4A 2CB1A 2EPJA 4GDYA 3WGCA 4ADEA 3LVMA 5HDMA 4IW7A 1MLZA 2VGUA 4Q6RA 2YKVA 2Z1YA 1OHYA 2VMVA 3MC6A 4IYOB 1IBJA 3E2ZA 3WGBA 3TATA 2Z9UA 4EB5A 3EIBA 1S06A 2FYFA 3E2ZB 3QI6A 2AY8A 4BA5A 3OKSA 2YKUA 3LG0A 1CQ7A 4WYDA 1AKAA 2C7TA 3EZSA 2EZ1A 3DR4A 4MKJA 5BJ4A 4OT8A 4LNMA 4XJLA 1GC4A 4PFNA 1IX7A 4ZDOA 3KGWA 2O7CA 3MAFA 1V2FA 1AJSA 5EUEA 2VGWA 5E3KA 4ZSWA 1Z7DA 3NRAA 4W91A 3D6KA 3ELPA 4A6TA 3FKDA 3HL2A 3CAIA 2PB0A 4EU1A 4Q76A 1UU2A 2VLFA 3FVUA 4RKDA 2W7DA 1MAQA 1X0MA 1YIZA 1T3IA 2G6WA 3EI5A 1GCKA 1DGDA 1BS0A 2E54A 1JS3A 2PO3A 3TFUA 1AAWA 2X5FA 4LNJA 1BJNA 2W7LA 2CINA 4WB0B 1B5OA 3GZDA 5DJ1A 3TFTA 3HVYA 2JJGA 4IXOA 3GR9A 3HBXA 1X29A 5DB5A 5M4BA 4XK1A 3HDOA 4EB7A 1GBNA 2CJDA 4AH3A 4BMKA 1TOKA 2ORDA 3EUCA 4GE9A 4IXSA 4OBVA 2YOBA 5E4ZA 5TF5A 3VK2A 3HLMA 4RLGA 4CXRA 4EMYA 1ASCA 1ASMA 5FT5A 4ZLVA 2WK8A 1YNUA 2EO5A 2WKAA 3RBLA 1GDEA 2BKWA 1XEYA 1MGVA 2W7EA 3JZLA 4RJ0A 1C7GA 2W7HA 1LS3A 3QGUA 3PDBB 2Z61A 2BI2A 3TQXA 1TOJA 2W7IA 3JU7A 4BQ0A 3PIUA 4J8LA 2HOYA 1M0PA 1ASAA 1ASLA 1PG8A 2RFVA 2YCNA 3BWNC 4W5KA 1N8PA 5G2PA 1O61A 1AHEA 4OYTA 4JE5D 2E7UA 3AV7A 2VMYA 1KMKA 4U2HA 1ARHA 3LWSA 3FDDA 1ASEA 4MQPA 1E5EA 1H0CA 5G0AA 1OXOA 1VJOA 1M0NA 3A9ZA 3ECDA 1SF2A 4GRXA 4W1XA 1ZOBA 3E2YA 1VEFA 2TPLA 2OGAA 4F4EA 4RAEA 2QMAA 4CBRA 4WP0A 2YKYA 2W8VA 1ASFA 2HP1A 4ITXA 5EAAA 2BWPA 4AZJA 2GSAA 3HMUA 4JF0A 3EZ1A 4AO9A 4F5HA 1FG7A 1BQAA 1ELUA 3EI6A 2BIEA 4XJMA 1JG8A 4PFFA 3G0TA 3IHJA 4WXFA 3B8XA 2X5DA 3VP6A 1MDZA 4XJOA 1FC4A 3UAKA 1MLYA 3MAUA 2ZY2A 1LC5A 4Q75A 1SPAA 2DKBA 5F9SA 3CQ5A 1BJ4A 1AY8A 3N0LA 4JEVA 1QIRA 1S09A 2BYJA 3ZRRA 1ARIA 4GSAA 4KXKA 5AX8A 3DYDA 4ADBA 3ACZA 3E9KA 1B9HA 3FTBA 4OTLA 3VOMA 1Y4IA 3AATA 3L44A 3H14A 5G4IA 3NU7A 2D7ZA 2VMOA 3ZRPA 1C7OA 3E2FA 2QB3A 3GSBA 3NU8A 4WYCA 4ZWMA 3RUYA 3GZDC 1ZC9A 2E7IA 2W7GA 2VLHA 1KKJA 4CXQA 1GEYA 3ZZJA 1G7WA 4ADCA 3A9XA 1SZUA 1ORDA 2AY7A 4WXBA 2CANA 4DQ6A 1BJOB 2AY2A 4F5KA 1IAXA 2V0YA 3FD0A 3BC8A 1W3UA 1QGNA 1IX8A 2HUUA 2JJHA 3FDBA 4XEWA 2X8UA 1W7MA 3ZRQA 1EG5A 1I48A 1V2EA 1AMAA 4K2IA 3WZFA 4WYGA 5DJ9A 2HZPA 3PD6B 1M0QA 2C0RA 2VGTA 4ISYA 1IVRA 1AY5A 2W7KA 4M2MA 1CQ8A 5D95A 3UE8A 1AAMA 4ZWVA 3VK4A 4CVQA 1MDXA 2C44A 2CFBA 4W1VA 2R5CA 2AEVA 1C0NA 1AMRA 5F8VA 1G7XA 5FT8A 4MQRA 3USFA 2JJEA 4ZDLA 2E7JA 3WLXA 4EFFA 4JEXA 1C9CA 4A6RA 3NTJA 2ZYJA 1TOIA 4K2MA 4UQVA 2VGSA 3HQTA 1AX4A 1OHWA 2VGVA 3MADA 4E3RA 3LVJA 5G2QA 1H1CA 4LC3A 1DFOA 2VI8A 2HUFA 4I8AA 4Y0DA 1U08A 3KGXA 4A72A 2BWOA 1QZ9A 3VK3A 3JW9A 3BWOA 2BIAA 5K8BA 2AY5A 3EI7A 1AJRA 4A6UA 4B98A 3EI8A 2WK7A 1AMSA 4IXZA 3K7YA 5EUDA 2VMWA 2XBNA 1M0OA 1BKGA 1P3WA 1AY4A 3VAXA 2ZSMA 4R5ZA 3MKJA 3AENA 1WYTB 2Z9XA 2VMSA 4M2KA 2HORA 4ATPA 1OATA 3B1CA 2OGEA 4B9BA 1ARGA 2AY9A 2R5EA 4RKCA 3W1JA 1O4SA 4BA4A 1G4VA 1CZEA 1D7VA 4WB0A 3F9TA 1ARTA 3BCBA 4TMRA 1AJSB 2QBTA 1MDOA 3PDXA 1B8GA 1B5PA 1TASA 3ASBA 4MY5A 4P7YA 2AY1A 1S07A 2D63A 2Z9VA 3NYSA 1M4NA 1S08A 3RQ1A 3I5TA 1WYVB 2Z1ZA 4JF1A 2AY6A 1MAPA 2R0TA 4OC9A 2D66A 4Y0IA 1DJUA 4MGRA 3NUIA 5HXXA 4FFCA 1IAYA 3P1TA 3NNKA 2BHXA 1C4KA 1RVUA 1OXPA 1IX6A 1ASBA 3PA9A 2CSTA 3FQAA 1O69A 4A0RA 3FFHA 1AIAA 1G4XA 1M32A 3WKSA 1W7LA 4N0WA 1GC0A 1LC8A 3QN6A 3WX9A 2YRIA 1PFFA 4GE4A 1AHXA 2FM1A 4QGRA 2DR1A 2EGYA 4WYEA 1CL1A 5LHAA 1S0AA 2R2NA 3A9YA 3WCOA 5EIGB 2D7YA 2JG2A 3DR7A 3PD6A 4WYAA 1TATA 2VIBA 4OMAA 2VGZA 3QM2A 3AEMC 3AENB 1JF9A 2YRRA 3WKRA 2DOUA 3JWAA 9AATA 2CH2A 2Q7WA 1B4XA 2VMNA 3NDNA 4GE7A 3BB8A 3WY7A 3II0A 4W1WA 3BS8A 1JS6A 1PMOA 2VI9A 2AATA 1AIBA 2VYCA 3AEJA 1KMJA 1I41A 1WYTA 1D2FA 2BI5A 1V72A 4LW4A 4MSOA 2BI1A 3G7QA 3AEOA 4F5IA 2Z9WA 3P6KA 8AATA 2W8UA 1ECXA 2VMQA 3FZ8A 2NMPA 1X2AA 4Y0HA 2FQ6A 3BCAA 2D5YA 1LC7A 2OQXA 2F8JA 1GC2A 3OP7A 3N75A 1LW4A 2OKKA 3ASAA 3FRKA 1AHGA 2D64A 4MKKA 4UHMA 2R5CB 3DZZA 3FQ8A 3DXVA 3CQ4A 3GZCA 2FNUA 5FT4A 2PB2A 1CL2A 3ELEA 3W1HA 4F5LA 1SZSA 1YAAA 1ASNA 4ZAHA 3GBXA 3NX3A 2VMRA 3CQ6A 1YJSA 2DGMA 4U1TA 1M6SA 1QITA 1IUGA 3QHXA 2W8JA 4MQQA 2ZC0A 2JISA 2HUIA 2QA3A 1CQ6A 1WKGA 2YKXA 2ZUKA 1ASGA 1FG3A 4KYOA 3NUBA 2VMPA 2O0RA 3PPLA 5I92A 1WSTA 4R8DA 3PDBA 1LK9A 3ATHA 2V1PA 2VIAA 5JAYA 1DJEA 4ATQA 2OKJA 4E1OA 5IWQA 4J5UA 1RV3A 1X28A 5J8QA 4RITA 4F5JA 2GQNA 3FZ7A 3I16A 2Z67A 4ZASA 4LW2A 2VMZA 5G09A 3RCHA 3MAFB 4IX8A 1TOGA 3W1IA 1AHYA 4ZSYA 3N5MA 1J32A 4IY7A 3A8UX 4JEWA 5FT6A 3RI6A 2ZSLA 4A0FA 2HP2A 1W7NA 2O1BA 2ZJGA 4N0BA 1OHVA 1BW0A 1KKPA 4L0OA 3WCNA 2D61A 1ZODA 2QB2A 1QISA 2YCPA 4Q31A 3AOWA 3RCHB 5EFSA 3AEMA 4KAMA 3BWNA 1UKJA 3I4JA 3NYUA 3GJUA 1UU0A 4F5MA 1VP4A 4XAUA 3AEJC 2FNIA 5G4JA 4RJYA 1PMMA 4GEBA 1I43A 1ASDA 1J04A 2XH1A 1KL2A 3FFRA 4RIZA 3BV0A 2W8TA 4XJPA 2HOZA 2EH6A 4RM1A 1QJ3A 2OATA 3FQ7A 1LW5A
chains in the Genus database with same CATH superfamily
3AELA 3CBFA 4UHNA 3B1DA 5LH9A 3T32A 1WYUA 3B46A 4DBCA 2JJFA 3DC1A 4CBSA 1BJWA 2BYLA 2EZ2A 3K40A 1AHFA 1RVYA 1WKHA 1AKBA 1YJZA 2BI9A 2D65A 3FVXA 3JWBA 3NYTA 4K2BA 4WLJA 5E5IA 5C6UA 2DKJA 3AOVA 2CJGA 1GD9A 1Z3ZA 5EQCA 1CJ0A 4TV7A 3PJ0A 4ITGA 1TARA 5EIGA 4O6ZA 2ZP7A 3EI9A 2W7FA 2VMTA 5EUNA 3KE3A 4ZDPA 1SVVA 2CH1A 3FCRA 4BHDA 3UWCA 5HHYA 1W23A 5EAVA 1XI9A 1I29A 1IJIA 1WYUB 2CTZA 1V2DA 4R5FA 4OBUA 5BJ3A 4JEYA 3DODA 4JE5A 3KKIA 1N2TA 3FZ6A 3ZZKA 4A00A 4DGTA 4AOAA 1SFFA 4JEZA 4E3QA 1UU1A 3AEPA 3K28A 1GEWA 4WD2A 4E77A 4IYOA 2W7JA 4TN4A 3DU4A 3A2BA 3BN1A 3MEBA 3RBFA 1RV4A 1TOEA 3F6TA 4ZM3A 2YCTA 3F0HA 1EQBA 3ISLA 1QJ5A 3FVSA 4HVKA 1BT4A 2GMUA 4OCAA 2FN6A 4UHOA 5M49A 3B1EA 1TPLA 1D7UA 1LKCA 4UOYA 4AZKA 1O62A 1YIYA 3IF2A 3GETA 2W8WA 2VMUA 2CY8A 1SZKA 1BJOA 2ZY4A 2AEUA 4LNLA 1YOOA 4NOGA 1CS1A 1KL1A 4WBTA 1ELQA 4P3MA 1DTYA 2VMXA 1B9IA 3HT4A 4H51A 2AY4A 4A0HA 5M4DA 5M46A 2X3LA 2GMSA 3MC6C 4F5FA 1DGEA 2JGTA 3EIAA 2AY3A 1DJ9A 3LVLB 3TCMA 4M2JA 3N4RA 3FSLA 4WXGA 5D5SA 2ZY5A 2CJHA 4WLHA 3COGA 2W7MA 1WYVA 4PIWA 2DGKA 2QLRA 3N7NA 3DRDA 1D7RA 3R9AA 2GB3A 3LVKA 3DXWA 3Q8NA 4ADDA 1CZCA 3LV2A 3H7FA 3JTXA 2Z20A 3M5UA 3BCXA 2YHKA 3PAAA 1GC3A 1M7YA 2C81A 3R4TA 1N31A 4WYFA 4F5GA 3E6GA 2HOXA 4R2NA 4PVFA 1D7SA 3QBOA 1AMQA 1EJIA 2BI3A 3L8AA 3LY1A 4XQ2A 1ARSA 3QPGA 4FL0A 4W8IA 4A0GA 7AATA 1C7NA 1DKAA 3E77A 1GEXA 3PGYA 3N4XA 4ZM4A 1AICA 2WK9A 3G8MA 1E5FA 2DGLA 1YJYA 2BIGA 2ZY3A 2BWNA 3MBBA 1AKCA 1BQDA 3GWPA 4HF8A 5DX5A 4AO4A 2CB1A 2EPJA 4GDYA 3WGCA 4ADEA 3LVMA 5HDMA 4IW7A 1MLZA 2VGUA 4Q6RA 2YKVA 2Z1YA 1OHYA 2VMVA 3MC6A 4IYOB 1IBJA 3E2ZA 3WGBA 3TATA 2Z9UA 4EB5A 3EIBA 1S06A 2FYFA 3E2ZB 3QI6A 2AY8A 4BA5A 3OKSA 2YKUA 3LG0A 1CQ7A 4WYDA 1AKAA 2C7TA 3EZSA 2EZ1A 3DR4A 4MKJA 5BJ4A 4OT8A 4LNMA 4XJLA 1GC4A 4PFNA 1IX7A 4ZDOA 3KGWA 2O7CA 3MAFA 1V2FA 1AJSA 5EUEA 2VGWA 5E3KA 4ZSWA 1Z7DA 3NRAA 4W91A 3D6KA 3ELPA 4A6TA 3FKDA 3HL2A 3CAIA 2PB0A 2KFPA 4EU1A 4Q76A 1UU2A 2VLFA 3FVUA 4RKDA 2W7DA 1MAQA 1X0MA 1YIZA 1T3IA 2G6WA 3EI5A 1GCKA 1DGDA 1BS0A 2E54A 1JS3A 2PO3A 3TFUA 1AAWA 2X5FA 4LNJA 1BJNA 2W7LA 2CINA 4WB0B 1B5OA 3GZDA 5DJ1A 3TFTA 3HVYA 2JJGA 4IXOA 3GR9A 3HBXA 1X29A 5DB5A 5M4BA 4XK1A 2A1VA 3HDOA 4EB7A 1GBNA 2CJDA 4AH3A 4BMKA 1TOKA 2ORDA 3EUCA 4GE9A 4IXSA 4OBVA 2YOBA 5E4ZA 5TF5A 3VK2A 3HLMA 4RLGA 4CXRA 4EMYA 1ASCA 1ASMA 5FT5A 4ZLVA 2WK8A 1YNUA 2EO5A 2WKAA 3RBLA 1GDEA 2BKWA 1XEYA 1MGVA 2W7EA 3JZLA 4RJ0A 1C7GA 2W7HA 1LS3A 3QGUA 3PDBB 2Z61A 2FKIA 2BI2A 3TQXA 1TOJA 2W7IA 3JU7A 4BQ0A 3PIUA 4J8LA 2HOYA 1M0PA 1ASAA 1ASLA 1PG8A 2RFVA 2YCNA 3BWNC 4W5KA 1N8PA 5G2PA 1O61A 1AHEA 4OYTA 4JE5D 3H9XA 2E7UA 3AV7A 3N4SA 2VMYA 1KMKA 4U2HA 1ARHA 3LWSA 3FDDA 1ASEA 4MQPA 1E5EA 1H0CA 5G0AA 1OXOA 1VJOA 1M0NA 3A9ZA 3ECDA 1SF2A 4GRXA 4W1XA 1ZOBA 3E2YA 1VEFA 2TPLA 2OGAA 4F4EA 4RAEA 2QMAA 4CBRA 4WP0A 2YKYA 2W8VA 1ASFA 2HP1A 4ITXA 5EAAA 2BWPA 4AZJA 5KTBA 2GSAA 3HMUA 4JF0A 3EZ1A 4AO9A 4F5HA 1FG7A 1BQAA 1ELUA 3EI6A 2BIEA 4XJMA 1JG8A 4PFFA 3G0TA 3IHJA 4WXFA 3B8XA 2X5DA 3VP6A 1MDZA 4XJOA 1FC4A 3UAKA 1MLYA 3MAUA 2ZY2A 1LC5A 4Q75A 1SPAA 2DKBA 5F9SA 3CQ5A 1BJ4A 1AY8A 3N0LA 4JEVA 1QIRA 1S09A 2BYJA 3ZRRA 1ARIA 4GSAA 4KXKA 5AX8A 3DYDA 4ADBA 3ACZA 3E9KA 1B9HA 3FTBA 4OTLA 3VOMA 1Y4IA 3AATA 3L44A 3H14A 5G4IA 3NU7A 2D7ZA 2VMOA 3ZRPA 1C7OA 3E2FA 2QB3A 3GSBA 3NU8A 4WYCA 4ZWMA 3RUYA 3GZDC 1ZC9A 2E7IA 2W7GA 2VLHA 1KKJA 4CXQA 1GEYA 3ZZJA 1G7WA 4ADCA 3A9XA 1SZUA 1ORDA 2AY7A 4WXBA 2CANA 4DQ6A 1BJOB 2AY2A 4F5KA 1IAXA 2V0YA 3FD0A 3BC8A 1W3UA 1QGNA 1IX8A 2HUUA 2JJHA 3FDBA 4XEWA 2X8UA 1W7MA 3ZRQA 1EG5A 1I48A 1V2EA 1AMAA 4K2IA 3WZFA 4WYGA 5DJ9A 2HZPA 3PD6B 1M0QA 2C0RA 2VGTA 4ISYA 1IVRA 1AY5A 2W7KA 4M2MA 1CQ8A 5D95A 4H63Q 3UE8A 1AAMA 4ZWVA 4K05A 3VK4A 4CVQA 1MDXA 2C44A 2CFBA 4W1VA 2R5CA 2AEVA 1C0NA 1AMRA 5F8VA 1G7XA 5FT8A 4MQRA 3USFA 2JJEA 4ZDLA 2E7JA 3WLXA 4EFFA 4JEXA 1C9CA 4A6RA 3NTJA 2ZYJA 1TOIA 4K2MA 4UQVA 2VGSA 3HQTA 1AX4A 1OHWA 2VGVA 3MADA 4E3RA 3LVJA 5G2QA 1H1CA 4LC3A 1DFOA 2VI8A 2HUFA 4I8AA 4Y0DA 1U08A 3KGXA 4A72A 2BWOA 1QZ9A 3VK3A 3JW9A 3BWOA 2BIAA 5K8BA 2AY5A 3EI7A 1AJRA 4A6UA 4B98A 3EI8A 2WK7A 1AMSA 4IXZA 3K7YA 5EUDA 2VMWA 2XBNA 1M0OA 1BKGA 1P3WA 1AY4A 3VAXA 2ZSMA 4R5ZA 3MKJA 3AENA 1WYTB 2Z9XA 2VMSA 4M2KA 2HORA 4ATPA 1OATA 3B1CA 2OGEA 4B9BA 1ARGA 2AY9A 2R5EA 4RKCA 3W1JA 1O4SA 4BA4A 1G4VA 2QSRA 1CZEA 1D7VA 4WB0A 3F9TA 1ARTA 3BCBA 4TMRA 1AJSB 2QBTA 1MDOA 3PDXA 1B8GA 1B5PA 1TASA 3ASBA 4MY5A 4P7YA 2AY1A 1S07A 2D63A 2Z9VA 3NYSA 1M4NA 1S08A 3RQ1A 3I5TA 1WYVB 2Z1ZA 4JF1A 2AY6A 1MAPA 2R0TA 4OC9A 2D66A 4Y0IA 1DJUA 4MGRA 3NUIA 5HXXA 4FFCA 1IAYA 3P1TA 3NNKA 2BHXA 1C4KA 1RVUA 1OXPA 1IX6A 1ASBA 3PA9A 2CSTA 3FQAA 1O69A 4A0RA 3FFHA 1AIAA 1G4XA 1M32A 3WKSA 1W7LA 1KAFA 4N0WA 1GC0A 1LC8A 3QN6A 3WX9A 2YRIA 1PFFA 4GE4A 1AHXA 2FM1A 4QGRA 2DR1A 2EGYA 4WYEA 1CL1A 5LHAA 1S0AA 2R2NA 3A9YA 3WCOA 5EIGB 2D7YA 2JG2A 3DR7A 3PD6A 4WYAA 1TATA 2VIBA 4OMAA 2VGZA 3QM2A 3AEMC 3AENB 1JF9A 2YRRA 3WKRA 2DOUA 3JWAA 9AATA 2CH2A 2Q7WA 1B4XA 2VMNA 3NDNA 4GE7A 3BB8A 3WY7A 3II0A 4W1WA 3BS8A 1JS6A 1PMOA 2VI9A 2AATA 1AIBA 2VYCA 3AEJA 1KMJA 1I41A 1WYTA 1D2FA 2BI5A 1V72A 4LW4A 4MSOA 2BI1A 3G7QA 3AEOA 4F5IA 2Z9WA 3P6KA 8AATA 2W8UA 1ECXA 2VMQA 3FZ8A 2NMPA 1X2AA 4Y0HA 2FQ6A 3BCAA 2D5YA 1LC7A 2OQXA 2F8JA 2G7JA 1GC2A 3OP7A 3N75A 1LW4A 2OKKA 3ASAA 3FRKA 1AHGA 2D64A 4MKKA 4UHMA 2R5CB 3DZZA 3FQ8A 3DXVA 3CQ4A 3GZCA 2FNUA 5FT4A 2PB2A 1CL2A 3ELEA 3W1HA 4F5LA 1SZSA 1YAAA 1ASNA 4ZAHA 3GBXA 3NX3A 2VMRA 3CQ6A 1YJSA 2DGMA 4U1TA 1M6SA 1QITA 1IUGA 3QHXA 2W8JA 4MQQA 2ZC0A 2JISA 2HUIA 2QA3A 1CQ6A 1WKGA 2YKXA 2ZUKA 1ASGA 1FG3A 4KYOA 3NUBA 2VMPA 2O0RA 3PPLA 5I92A 1WSTA 4R8DA 3PDBA 1LK9A 3ATHA 2V1PA 2VIAA 5JAYA 1DJEA 4ATQA 2OKJA 4E1OA 5IWQA 4J5UA 1RV3A 1X28A 5J8QA 4RITA 4F5JA 2GQNA 3FZ7A 3I16A 2WB6A 2Z67A 4ZASA 4LW2A 2VMZA 5G09A 3RCHA 3MAFB 4IX8A 1TOGA 3W1IA 1AHYA 4ZSYA 3N5MA 1J32A 4IY7A 3A8UX 4JEWA 5FT6A 3RI6A 2ZSLA 4A0FA 2HP2A 1W7NA 2O1BA 2ZJGA 4N0BA 1OHVA 1BW0A 1KKPA 4L0OA 3WCNA 2D61A 1ZODA 2QB2A 1QISA 2YCPA 4Q31A 3AOWA 3RCHB 5EFSA 3AEMA 4KAMA 3BWNA 1UKJA 3I4JA 3NYUA 3GJUA 2EYQA 1UU0A 4F5MA 1VP4A 4XAUA 3AEJC 2FNIA 5G4JA 4RJYA 1PMMA 4GEBA 1I43A 1ASDA 1J04A 2XH1A 1KL2A 3FFRA 4RIZA 3BV0A 2W8TA 4XJPA 2HOZA 2EH6A 4RM1A 1QJ3A 2OATA 3FQ7A 1LW5A
chains in the Genus database with same CATH topology
3AELA 3CBFA 4UHNA 3B1DA 5LH9A 3T32A 1WYUA 3B46A 4DBCA 2JJFA 3DC1A 4CBSA 1BJWA 2BYLA 2EZ2A 3K40A 1AHFA 1RVYA 1WKHA 1AKBA 1YJZA 2BI9A 2D65A 3FVXA 3JWBA 3NYTA 4K2BA 4WLJA 5E5IA 5C6UA 2DKJA 3AOVA 2CJGA 1GD9A 1Z3ZA 5EQCA 1CJ0A 4TV7A 3PJ0A 4ITGA 1TARA 5EIGA 4O6ZA 2ZP7A 3EI9A 2W7FA 2VMTA 5EUNA 3KE3A 4ZDPA 1SVVA 2CH1A 3FCRA 4BHDA 3UWCA 5HHYA 1W23A 5EAVA 1XI9A 1I29A 1IJIA 1WYUB 2CTZA 1V2DA 4R5FA 4OBUA 5BJ3A 4JEYA 3DODA 4JE5A 3KKIA 1N2TA 3FZ6A 3ZZKA 4A00A 4DGTA 4AOAA 1SFFA 4JEZA 4E3QA 1UU1A 3AEPA 3K28A 1GEWA 4WD2A 4E77A 4IYOA 2W7JA 4TN4A 3DU4A 3A2BA 3BN1A 3MEBA 3RBFA 1RV4A 1TOEA 3F6TA 4ZM3A 2YCTA 3F0HA 1EQBA 3ISLA 1QJ5A 3FVSA 4HVKA 1BT4A 2GMUA 4OCAA 2FN6A 4UHOA 5M49A 3B1EA 1TPLA 1D7UA 1LKCA 4UOYA 4AZKA 1O62A 1YIYA 3IF2A 3GETA 2W8WA 2VMUA 2CY8A 1SZKA 1BJOA 2ZY4A 2AEUA 4LNLA 1YOOA 4NOGA 1CS1A 1KL1A 4WBTA 1ELQA 4P3MA 1DTYA 2VMXA 1B9IA 3HT4A 4H51A 2AY4A 4A0HA 5M4DA 5M46A 2X3LA 2GMSA 3MC6C 4F5FA 1DGEA 2JGTA 3EIAA 2AY3A 1DJ9A 3LVLB 3TCMA 4M2JA 3N4RA 3FSLA 4WXGA 5D5SA 2ZY5A 2CJHA 4WLHA 3COGA 2W7MA 1WYVA 4PIWA 2DGKA 2QLRA 3N7NA 3DRDA 1D7RA 3R9AA 2GB3A 3LVKA 3DXWA 3Q8NA 4ADDA 1CZCA 3LV2A 3H7FA 3JTXA 2Z20A 3M5UA 3BCXA 2YHKA 3PAAA 1GC3A 1M7YA 2C81A 3R4TA 1N31A 4WYFA 4F5GA 3E6GA 2HOXA 4R2NA 4PVFA 1D7SA 3QBOA 1AMQA 1EJIA 2BI3A 3L8AA 3LY1A 4XQ2A 1ARSA 3QPGA 4FL0A 4W8IA 4A0GA 7AATA 1C7NA 1DKAA 3E77A 1GEXA 3PGYA 3N4XA 4ZM4A 1AICA 2WK9A 3G8MA 1E5FA 2DGLA 1YJYA 2BIGA 2ZY3A 2BWNA 3MBBA 1AKCA 1BQDA 3GWPA 4HF8A 5DX5A 4AO4A 2CB1A 2EPJA 4GDYA 3WGCA 4ADEA 3LVMA 5HDMA 4IW7A 1MLZA 2VGUA 4Q6RA 2YKVA 2Z1YA 1OHYA 2VMVA 3MC6A 4IYOB 1IBJA 3E2ZA 3WGBA 3TATA 2Z9UA 4EB5A 3EIBA 1S06A 2FYFA 3E2ZB 3QI6A 2AY8A 4BA5A 3OKSA 2YKUA 3LG0A 1CQ7A 4WYDA 1AKAA 2C7TA 3EZSA 2EZ1A 3DR4A 4MKJA 5BJ4A 4OT8A 4LNMA 4XJLA 1GC4A 4PFNA 1IX7A 4ZDOA 3KGWA 2O7CA 3MAFA 1V2FA 1AJSA 5EUEA 2VGWA 5E3KA 4ZSWA 1Z7DA 3NRAA 4W91A 3D6KA 3ELPA 4A6TA 3FKDA 3HL2A 3CAIA 2PB0A 2KFPA 4EU1A 4Q76A 1UU2A 2VLFA 3FVUA 4RKDA 2W7DA 1MAQA 1X0MA 1YIZA 1T3IA 2G6WA 3EI5A 1GCKA 1DGDA 1BS0A 2E54A 1JS3A 2PO3A 3TFUA 1AAWA 2X5FA 4LNJA 1BJNA 2W7LA 2CINA 4WB0B 1B5OA 3GZDA 5DJ1A 3TFTA 3HVYA 2JJGA 4IXOA 3GR9A 3HBXA 1X29A 5DB5A 5M4BA 4XK1A 2A1VA 3HDOA 4EB7A 1GBNA 2CJDA 4AH3A 4BMKA 1TOKA 2ORDA 3EUCA 4GE9A 4IXSA 4OBVA 2YOBA 5E4ZA 5TF5A 3VK2A 3HLMA 4RLGA 4CXRA 4EMYA 1ASCA 1ASMA 5FT5A 4ZLVA 2WK8A 1YNUA 2EO5A 2WKAA 3RBLA 1GDEA 2BKWA 1XEYA 1MGVA 2W7EA 3JZLA 4RJ0A 1C7GA 2W7HA 1LS3A 3QGUA 3PDBB 2Z61A 2FKIA 2BI2A 3TQXA 1TOJA 2W7IA 3JU7A 4BQ0A 3PIUA 4J8LA 2HOYA 1M0PA 1ASAA 1ASLA 1PG8A 2RFVA 2YCNA 3BWNC 4W5KA 1N8PA 5G2PA 1O61A 1AHEA 4OYTA 4JE5D 3H9XA 2E7UA 3AV7A 3N4SA 2VMYA 1KMKA 4U2HA 1ARHA 3LWSA 3FDDA 1ASEA 4MQPA 1E5EA 1H0CA 5G0AA 1OXOA 1VJOA 1M0NA 3A9ZA 3ECDA 1SF2A 4GRXA 4W1XA 1ZOBA 3E2YA 1VEFA 2TPLA 2OGAA 4F4EA 4RAEA 2QMAA 4CBRA 4WP0A 2YKYA 2W8VA 1ASFA 2HP1A 4ITXA 5EAAA 2BWPA 4AZJA 5KTBA 2GSAA 3HMUA 4JF0A 3EZ1A 4AO9A 4F5HA 1FG7A 1BQAA 1ELUA 3EI6A 2BIEA 4XJMA 1JG8A 4PFFA 3G0TA 3IHJA 4WXFA 3B8XA 2X5DA 3VP6A 1MDZA 4XJOA 1FC4A 3UAKA 1MLYA 3MAUA 2ZY2A 1LC5A 4Q75A 1SPAA 2DKBA 5F9SA 3CQ5A 1BJ4A 1AY8A 3N0LA 4JEVA 1QIRA 1S09A 2BYJA 3ZRRA 1ARIA 4GSAA 4KXKA 5AX8A 3DYDA 4ADBA 3ACZA 3E9KA 1B9HA 3FTBA 4OTLA 3VOMA 1Y4IA 3AATA 3L44A 3H14A 5G4IA 3NU7A 2D7ZA 2VMOA 3ZRPA 1C7OA 3E2FA 2QB3A 3GSBA 3NU8A 4WYCA 4ZWMA 3RUYA 3GZDC 1ZC9A 2E7IA 2W7GA 2VLHA 1KKJA 4CXQA 1GEYA 3ZZJA 1G7WA 4ADCA 3A9XA 1SZUA 1ORDA 2AY7A 4WXBA 2CANA 4DQ6A 1BJOB 2AY2A 4F5KA 1IAXA 2V0YA 3FD0A 3BC8A 1W3UA 1QGNA 1IX8A 2HUUA 2JJHA 3FDBA 4XEWA 2X8UA 1W7MA 3ZRQA 1EG5A 1I48A 1V2EA 1AMAA 4K2IA 3WZFA 4WYGA 5DJ9A 2HZPA 3PD6B 1M0QA 2C0RA 2VGTA 4ISYA 1IVRA 1AY5A 2W7KA 4M2MA 1CQ8A 5D95A 4H63Q 3UE8A 1AAMA 4ZWVA 4K05A 3VK4A 4CVQA 1MDXA 2C44A 2CFBA 4W1VA 2R5CA 2AEVA 1C0NA 1AMRA 5F8VA 1G7XA 5FT8A 4MQRA 3USFA 2JJEA 4ZDLA 2E7JA 3WLXA 4EFFA 4JEXA 1C9CA 4A6RA 3NTJA 2ZYJA 1TOIA 4K2MA 4UQVA 2VGSA 3HQTA 1AX4A 1OHWA 2VGVA 3MADA 4E3RA 3LVJA 5G2QA 1H1CA 4LC3A 1DFOA 2VI8A 2HUFA 4I8AA 4Y0DA 1U08A 3KGXA 4A72A 2BWOA 1QZ9A 3VK3A 3JW9A 3BWOA 2BIAA 5K8BA 2AY5A 3EI7A 1AJRA 4A6UA 4B98A 3EI8A 2WK7A 1AMSA 4IXZA 3K7YA 5EUDA 2VMWA 2XBNA 1M0OA 1BKGA 1P3WA 1AY4A 3VAXA 2ZSMA 4R5ZA 3MKJA 3AENA 1WYTB 2Z9XA 2VMSA 4M2KA 2HORA 4ATPA 1OATA 3B1CA 2OGEA 4B9BA 1ARGA 2AY9A 2R5EA 4RKCA 3W1JA 1O4SA 4BA4A 1G4VA 2QSRA 1CZEA 1D7VA 4WB0A 3F9TA 1ARTA 3BCBA 4TMRA 1AJSB 2QBTA 1MDOA 3PDXA 1B8GA 1B5PA 1TASA 3ASBA 4MY5A 4P7YA 2AY1A 1S07A 2D63A 2Z9VA 3NYSA 1M4NA 1S08A 3RQ1A 3I5TA 1WYVB 2Z1ZA 4JF1A 2AY6A 1MAPA 2R0TA 4OC9A 2D66A 4Y0IA 1DJUA 4MGRA 3NUIA 5HXXA 4FFCA 1IAYA 3P1TA 3NNKA 2BHXA 1C4KA 1RVUA 1OXPA 1IX6A 1ASBA 3PA9A 2CSTA 3FQAA 1O69A 4A0RA 3FFHA 1AIAA 1G4XA 1M32A 3WKSA 1W7LA 4N0WA 1GC0A 1LC8A 3QN6A 3WX9A 2YRIA 1PFFA 4GE4A 1AHXA 2FM1A 4QGRA 2DR1A 2EGYA 4WYEA 1CL1A 5LHAA 1S0AA 2R2NA 3A9YA 3WCOA 5EIGB 2D7YA 2JG2A 3DR7A 3PD6A 4WYAA 1TATA 2VIBA 4OMAA 2VGZA 3QM2A 3AEMC 3AENB 1JF9A 2YRRA 3WKRA 2DOUA 3JWAA 9AATA 2CH2A 2Q7WA 1B4XA 2VMNA 3NDNA 4GE7A 3BB8A 3WY7A 3II0A 4W1WA 3BS8A 1JS6A 1PMOA 2VI9A 2AATA 1AIBA 2VYCA 3AEJA 1KMJA 1I41A 1WYTA 1D2FA 2BI5A 1V72A 4LW4A 4MSOA 2BI1A 3G7QA 3AEOA 4F5IA 2Z9WA 3P6KA 8AATA 2W8UA 1ECXA 2VMQA 3FZ8A 2NMPA 1X2AA 4Y0HA 2FQ6A 3BCAA 2D5YA 1LC7A 2OQXA 2F8JA 2G7JA 1GC2A 3OP7A 3N75A 1LW4A 2OKKA 3ASAA 3FRKA 1AHGA 2D64A 4MKKA 4UHMA 2R5CB 3DZZA 3FQ8A 3DXVA 3CQ4A 3GZCA 2FNUA 5FT4A 2PB2A 1CL2A 3ELEA 3W1HA 4F5LA 1SZSA 1YAAA 1ASNA 4ZAHA 3GBXA 3NX3A 2VMRA 3CQ6A 1YJSA 2DGMA 4U1TA 1M6SA 1QITA 1IUGA 3QHXA 2W8JA 4MQQA 2ZC0A 2JISA 2HUIA 2QA3A 1CQ6A 1WKGA 2YKXA 2ZUKA 1ASGA 1FG3A 4KYOA 3NUBA 2VMPA 2O0RA 3PPLA 5I92A 1WSTA 4R8DA 3PDBA 1LK9A 3ATHA 2V1PA 2VIAA 5JAYA 1DJEA 4ATQA 2OKJA 4E1OA 5IWQA 4J5UA 1RV3A 1X28A 5J8QA 4RITA 4F5JA 2GQNA 3FZ7A 3I16A 2WB6A 2Z67A 4ZASA 4LW2A 2VMZA 5G09A 3RCHA 3MAFB 4IX8A 1TOGA 3W1IA 1AHYA 4ZSYA 3N5MA 1J32A 4IY7A 3A8UX 4JEWA 5FT6A 3RI6A 2ZSLA 4A0FA 2HP2A 1W7NA 2O1BA 2ZJGA 4N0BA 1OHVA 1BW0A 1KKPA 4L0OA 3WCNA 2D61A 1ZODA 2QB2A 1QISA 2YCPA 4Q31A 3AOWA 3RCHB 5EFSA 3AEMA 4KAMA 3BWNA 1UKJA 3I4JA 3NYUA 3GJUA 2EYQA 1UU0A 4F5MA 1VP4A 4XAUA 3AEJC 2FNIA 5G4JA 4RJYA 1PMMA 4GEBA 1I43A 1ASDA 1J04A 2XH1A 1KL2A 3FFRA 4RIZA 3BV0A 2W8TA 4XJPA 2HOZA 2EH6A 4RM1A 1QJ3A 2OATA 3FQ7A 1LW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEL A;  3CBF A;  4UHN A;  3B1D A;  5LH9 A;  3T32 A;  1WYU A;  3B46 A;  4DBC A;  2JJF A;  3DC1 A;  4CBS A;  1BJW A;  2BYL A;  2EZ2 A;  3K40 A;  1AHF A;  1RVY A;  1WKH A;  1AKB A;  1YJZ A;  2BI9 A;  2D65 A;  3FVX A;  3JWB A;  3NYT A;  4K2B A;  4WLJ A;  5E5I A;  5C6U A;  2DKJ A;  3AOV A;  2CJG A;  1GD9 A;  1Z3Z A;  5EQC A;  1CJ0 A;  4TV7 A;  3PJ0 A;  4ITG A;  1TAR A;  5EIG A;  4O6Z A;  2ZP7 A;  3EI9 A;  2W7F A;  2VMT A;  5EUN A;  3KE3 A;  4ZDP A;  1SVV A;  2CH1 A;  3FCR A;  4BHD A;  3UWC A;  5HHY A;  1W23 A;  5EAV A;  1XI9 A;  1I29 A;  1IJI A;  1WYU B;  2CTZ A;  1V2D A;  4R5F A;  4OBU A;  5BJ3 A;  4JEY A;  3DOD A;  4JE5 A;  3KKI A;  1N2T A;  3FZ6 A;  3ZZK A;  4A00 A;  4DGT A;  4AOA A;  1SFF A;  4JEZ A;  4E3Q A;  1UU1 A;  3AEP A;  3K28 A;  1GEW A;  4WD2 A;  4E77 A;  4IYO A;  2W7J A;  4TN4 A;  3DU4 A;  3A2B A;  3BN1 A;  3MEB A;  3RBF A;  1RV4 A;  1TOE A;  3F6T A;  4ZM3 A;  2YCT A;  3F0H A;  1EQB A;  3ISL A;  1QJ5 A;  3FVS A;  4HVK A;  1BT4 A;  2GMU A;  4OCA A;  2FN6 A;  4UHO A;  5M49 A;  3B1E A;  1TPL A;  1D7U A;  1LKC A;  4UOY A;  4AZK A;  1O62 A;  1YIY A;  3IF2 A;  3GET A;  2W8W A;  2VMU A;  2CY8 A;  1SZK A;  1BJO A;  2ZY4 A;  2AEU A;  4LNL A;  1YOO A;  4NOG A;  1CS1 A;  1KL1 A;  4WBT A;  1ELQ A;  4P3M A;  1DTY A;  2VMX A;  1B9I A;  3HT4 A;  4H51 A;  2AY4 A;  4A0H A;  5M4D A;  5M46 A;  2X3L A;  2GMS A;  3MC6 C;  4F5F A;  1DGE A;  2JGT A;  3EIA A;  2AY3 A;  1DJ9 A;  3LVL B;  3TCM A;  4M2J A;  3FSL A;  4WXG A;  5D5S A;  2ZY5 A;  2CJH A;  4WLH A;  3COG A;  2W7M A;  1WYV A;  4PIW A;  2DGK A;  2QLR A;  3DRD A;  1D7R A;  3R9A A;  2GB3 A;  3LVK A;  3DXW A;  3Q8N A;  4ADD A;  1CZC A;  3LV2 A;  3H7F A;  3JTX A;  2Z20 A;  3M5U A;  3BCX A;  2YHK A;  3PAA A;  1GC3 A;  1M7Y A;  2C81 A;  3R4T A;  1N31 A;  4WYF A;  4F5G A;  3E6G A;  2HOX A;  4R2N A;  4PVF A;  1D7S A;  3QBO A;  1AMQ A;  1EJI A;  2BI3 A;  3L8A A;  3LY1 A;  4XQ2 A;  1ARS A;  3QPG A;  4FL0 A;  4W8I A;  4A0G A;  7AAT A;  1C7N A;  1DKA A;  3E77 A;  1GEX A;  3PGY A;  4ZM4 A;  1AIC A;  2WK9 A;  3G8M A;  1E5F A;  2DGL A;  1YJY A;  2BIG A;  2ZY3 A;  2BWN A;  3MBB A;  1AKC A;  1BQD A;  3GWP A;  4HF8 A;  5DX5 A;  4AO4 A;  2CB1 A;  2EPJ A;  4GDY A;  3WGC A;  4ADE A;  3LVM A;  5HDM A;  4IW7 A;  1MLZ A;  2VGU A;  4Q6R A;  2YKV A;  2Z1Y A;  1OHY A;  2VMV A;  3MC6 A;  4IYO B;  1IBJ A;  3E2Z A;  3WGB A;  3TAT A;  2Z9U A;  4EB5 A;  3EIB A;  1S06 A;  2FYF A;  3E2Z B;  3QI6 A;  2AY8 A;  4BA5 A;  3OKS A;  2YKU A;  3LG0 A;  1CQ7 A;  4WYD A;  1AKA A;  2C7T A;  3EZS A;  2EZ1 A;  3DR4 A;  4MKJ A;  5BJ4 A;  4OT8 A;  4LNM A;  4XJL A;  1GC4 A;  4PFN A;  1IX7 A;  4ZDO A;  3KGW A;  2O7C A;  3MAF A;  1V2F A;  1AJS A;  5EUE A;  2VGW A;  5E3K A;  4ZSW A;  1Z7D A;  3NRA A;  4W91 A;  3D6K A;  3ELP A;  4A6T A;  3FKD A;  3HL2 A;  3CAI A;  2PB0 A;  4EU1 A;  4Q76 A;  1UU2 A;  2VLF A;  3FVU A;  4RKD A;  2W7D A;  1MAQ A;  1X0M A;  1YIZ A;  1T3I A;  2G6W A;  3EI5 A;  1GCK A;  1DGD A;  1BS0 A;  2E54 A;  1JS3 A;  2PO3 A;  3TFU A;  1AAW A;  2X5F A;  4LNJ A;  1BJN A;  2W7L A;  2CIN A;  4WB0 B;  1B5O A;  3GZD A;  5DJ1 A;  3TFT A;  3HVY A;  2JJG A;  4IXO A;  3GR9 A;  3HBX A;  1X29 A;  5DB5 A;  5M4B A;  4XK1 A;  3HDO A;  4EB7 A;  1GBN A;  2CJD A;  4AH3 A;  4BMK A;  1TOK A;  2ORD A;  3EUC A;  4GE9 A;  4IXS A;  4OBV A;  2YOB A;  5E4Z A;  5TF5 A;  3VK2 A;  3HLM A;  4RLG A;  4CXR A;  4EMY A;  1ASC A;  1ASM A;  5FT5 A;  4ZLV A;  2WK8 A;  1YNU A;  2EO5 A;  2WKA A;  3RBL A;  1GDE A;  2BKW A;  1XEY A;  1MGV A;  2W7E A;  3JZL A;  4RJ0 A;  1C7G A;  2W7H A;  1LS3 A;  3QGU A;  3PDB B;  2Z61 A;  2BI2 A;  3TQX A;  1TOJ A;  2W7I A;  3JU7 A;  4BQ0 A;  3PIU A;  4J8L A;  2HOY A;  1M0P A;  1ASA A;  1ASL A;  1PG8 A;  2RFV A;  2YCN A;  3BWN C;  4W5K A;  1N8P A;  5G2P A;  1O61 A;  1AHE A;  4OYT A;  4JE5 D;  2E7U A;  3AV7 A;  2VMY A;  1KMK A;  4U2H A;  1ARH A;  3LWS A;  3FDD A;  1ASE A;  4MQP A;  1E5E A;  1H0C A;  5G0A A;  1OXO A;  1VJO A;  1M0N A;  3A9Z A;  3ECD A;  1SF2 A;  4GRX A;  4W1X A;  1ZOB A;  3E2Y A;  1VEF A;  2TPL A;  2OGA A;  4F4E A;  4RAE A;  2QMA A;  4CBR A;  4WP0 A;  2YKY A;  2W8V A;  1ASF A;  2HP1 A;  4ITX A;  5EAA A;  2BWP A;  4AZJ A;  2GSA A;  3HMU A;  4JF0 A;  3EZ1 A;  4AO9 A;  4F5H A;  1FG7 A;  1BQA A;  1ELU A;  3EI6 A;  2BIE A;  4XJM A;  1JG8 A;  4PFF A;  3G0T A;  3IHJ A;  4WXF A;  3B8X A;  2X5D A;  3VP6 A;  1MDZ A;  4XJO A;  1FC4 A;  3UAK A;  1MLY A;  3MAU A;  2ZY2 A;  1LC5 A;  4Q75 A;  1SPA A;  2DKB A;  5F9S A;  3CQ5 A;  1BJ4 A;  1AY8 A;  3N0L A;  4JEV A;  1QIR A;  1S09 A;  2BYJ A;  3ZRR A;  1ARI A;  4GSA A;  4KXK A;  5AX8 A;  3DYD A;  4ADB A;  3ACZ A;  3E9K A;  1B9H A;  3FTB A;  4OTL A;  3VOM A;  1Y4I A;  3AAT A;  3L44 A;  3H14 A;  5G4I A;  3NU7 A;  2D7Z A;  2VMO A;  3ZRP A;  1C7O A;  3E2F A;  2QB3 A;  3GSB A;  3NU8 A;  4WYC A;  4ZWM A;  3RUY A;  3GZD C;  1ZC9 A;  2E7I A;  2W7G A;  2VLH A;  1KKJ A;  4CXQ A;  1GEY A;  3ZZJ A;  1G7W A;  4ADC A;  3A9X A;  1SZU A;  1ORD A;  2AY7 A;  4WXB A;  2CAN A;  4DQ6 A;  1BJO B;  2AY2 A;  4F5K A;  1IAX A;  2V0Y A;  3FD0 A;  3BC8 A;  1W3U A;  1QGN A;  1IX8 A;  2HUU A;  2JJH A;  3FDB A;  4XEW A;  2X8U A;  1W7M A;  3ZRQ A;  1EG5 A;  1I48 A;  1V2E A;  1AMA A;  4K2I A;  3WZF A;  4WYG A;  5DJ9 A;  2HZP A;  3PD6 B;  1M0Q A;  2C0R A;  2VGT A;  4ISY A;  1IVR A;  1AY5 A;  2W7K A;  4M2M A;  1CQ8 A;  5D95 A;  3UE8 A;  1AAM A;  4ZWV A;  3VK4 A;  4CVQ A;  1MDX A;  2C44 A;  2CFB A;  4W1V A;  2R5C A;  2AEV A;  1C0N A;  1AMR A;  5F8V A;  1G7X A;  5FT8 A;  4MQR A;  3USF A;  2JJE A;  4ZDL A;  2E7J A;  3WLX A;  4EFF A;  4JEX A;  1C9C A;  4A6R A;  3NTJ A;  2ZYJ A;  1TOI A;  4K2M A;  4UQV A;  2VGS A;  3HQT A;  1AX4 A;  1OHW A;  2VGV A;  3MAD A;  4E3R A;  3LVJ A;  5G2Q A;  1H1C A;  4LC3 A;  1DFO A;  2VI8 A;  2HUF A;  4I8A A;  4Y0D A;  1U08 A;  3KGX A;  4A72 A;  2BWO A;  1QZ9 A;  3VK3 A;  3JW9 A;  3BWO A;  2BIA A;  5K8B A;  2AY5 A;  3EI7 A;  1AJR A;  4A6U A;  4B98 A;  3EI8 A;  2WK7 A;  1AMS A;  4IXZ A;  3K7Y A;  5EUD A;  2VMW A;  2XBN A;  1M0O A;  1BKG A;  1P3W A;  1AY4 A;  3VAX A;  2ZSM A;  4R5Z A;  3MKJ A;  3AEN A;  1WYT B;  2Z9X A;  2VMS A;  4M2K A;  2HOR A;  4ATP A;  1OAT A;  3B1C A;  2OGE A;  4B9B A;  1ARG A;  2AY9 A;  2R5E A;  4RKC A;  3W1J A;  1O4S A;  4BA4 A;  1G4V A;  1CZE A;  1D7V A;  4WB0 A;  3F9T A;  1ART A;  3BCB A;  4TMR A;  1AJS B;  2QBT A;  1MDO A;  3PDX A;  1B8G A;  1B5P A;  1TAS A;  3ASB A;  4MY5 A;  4P7Y A;  2AY1 A;  1S07 A;  2D63 A;  2Z9V A;  3NYS A;  1M4N A;  1S08 A;  3RQ1 A;  3I5T A;  1WYV B;  2Z1Z A;  4JF1 A;  2AY6 A;  1MAP A;  2R0T A;  4OC9 A;  2D66 A;  4Y0I A;  1DJU A;  4MGR A;  3NUI A;  5HXX A;  4FFC A;  1IAY A;  3P1T A;  3NNK A;  2BHX A;  1C4K A;  1RVU A;  1OXP A;  1IX6 A;  1ASB A;  3PA9 A;  2CST A;  3FQA A;  1O69 A;  4A0R A;  3FFH A;  1AIA A;  1G4X A;  1M32 A;  3WKS A;  1W7L A;  4N0W A;  1GC0 A;  1LC8 A;  3QN6 A;  3WX9 A;  2YRI A;  1PFF A;  4GE4 A;  1AHX A;  2FM1 A;  4QGR A;  2DR1 A;  2EGY A;  4WYE A;  1CL1 A;  5LHA A;  1S0A A;  2R2N A;  3A9Y A;  3WCO A;  5EIG B;  2D7Y A;  2JG2 A;  3DR7 A;  3PD6 A;  4WYA A;  1TAT A;  2VIB A;  4OMA A;  2VGZ A;  3QM2 A;  3AEM C;  3AEN B;  1JF9 A;  2YRR A;  3WKR A;  2DOU A;  3JWA A;  9AAT A;  2CH2 A;  2Q7W A;  1B4X A;  2VMN A;  3NDN A;  4GE7 A;  3BB8 A;  3WY7 A;  3II0 A;  4W1W A;  3BS8 A;  1JS6 A;  1PMO A;  2VI9 A;  2AAT A;  1AIB A;  2VYC A;  3AEJ A;  1KMJ A;  1I41 A;  1WYT A;  1D2F A;  2BI5 A;  1V72 A;  4LW4 A;  4MSO A;  2BI1 A;  3G7Q A;  3AEO A;  4F5I A;  2Z9W A;  3P6K A;  8AAT A;  2W8U A;  1ECX A;  2VMQ A;  3FZ8 A;  2NMP A;  1X2A A;  4Y0H A;  2FQ6 A;  3BCA A;  2D5Y A;  1LC7 A;  2OQX A;  2F8J A;  1GC2 A;  3OP7 A;  3N75 A;  1LW4 A;  2OKK A;  3ASA A;  3FRK A;  1AHG A;  2D64 A;  4MKK A;  4UHM A;  2R5C B;  3DZZ A;  3FQ8 A;  3DXV A;  3CQ4 A;  3GZC A;  2FNU A;  5FT4 A;  2PB2 A;  1CL2 A;  3ELE A;  3W1H A;  4F5L A;  1SZS A;  1YAA A;  1ASN A;  4ZAH A;  3GBX A;  3NX3 A;  2VMR A;  3CQ6 A;  1YJS A;  2DGM A;  4U1T A;  1M6S A;  1QIT A;  1IUG A;  3QHX A;  2W8J A;  4MQQ A;  2ZC0 A;  2JIS A;  2HUI A;  2QA3 A;  1CQ6 A;  1WKG A;  2YKX A;  2ZUK A;  1ASG A;  1FG3 A;  4KYO A;  3NUB A;  2VMP A;  2O0R A;  3PPL A;  5I92 A;  1WST A;  4R8D A;  3PDB A;  1LK9 A;  3ATH A;  2V1P A;  2VIA A;  5JAY A;  1DJE A;  4ATQ A;  2OKJ A;  4E1O A;  5IWQ A;  4J5U A;  1RV3 A;  1X28 A;  5J8Q A;  4RIT A;  4F5J A;  2GQN A;  3FZ7 A;  3I16 A;  2Z67 A;  4ZAS A;  4LW2 A;  2VMZ A;  5G09 A;  3RCH A;  3MAF B;  4IX8 A;  1TOG A;  3W1I A;  1AHY A;  4ZSY A;  3N5M A;  1J32 A;  4IY7 A;  3A8U X;  4JEW A;  5FT6 A;  3RI6 A;  2ZSL A;  4A0F A;  2HP2 A;  1W7N A;  2O1B A;  2ZJG A;  4N0B A;  1OHV A;  1BW0 A;  1KKP A;  4L0O A;  3WCN A;  2D61 A;  1ZOD A;  2QB2 A;  1QIS A;  2YCP A;  4Q31 A;  3AOW A;  3RCH B;  5EFS A;  3AEM A;  4KAM A;  3BWN A;  1UKJ A;  3I4J A;  3NYU A;  3GJU A;  1UU0 A;  4F5M A;  1VP4 A;  4XAU A;  3AEJ C;  2FNI A;  5G4J A;  4RJY A;  1PMM A;  4GEB A;  1I43 A;  1ASD A;  1J04 A;  2XH1 A;  1KL2 A;  3FFR A;  4RIZ A;  3BV0 A;  2W8T A;  4XJP A;  2HOZ A;  2EH6 A;  4RM1 A;  1QJ3 A;  2OAT A;  3FQ7 A;  1LW5 A; 
#chains in the Genus database with same CATH topology
 3AEL A;  3CBF A;  4UHN A;  3B1D A;  5LH9 A;  3T32 A;  1WYU A;  3B46 A;  4DBC A;  2JJF A;  3DC1 A;  4CBS A;  1BJW A;  2BYL A;  2EZ2 A;  3K40 A;  1AHF A;  1RVY A;  1WKH A;  1AKB A;  1YJZ A;  2BI9 A;  2D65 A;  3FVX A;  3JWB A;  3NYT A;  4K2B A;  4WLJ A;  5E5I A;  5C6U A;  2DKJ A;  3AOV A;  2CJG A;  1GD9 A;  1Z3Z A;  5EQC A;  1CJ0 A;  4TV7 A;  3PJ0 A;  4ITG A;  1TAR A;  5EIG A;  4O6Z A;  2ZP7 A;  3EI9 A;  2W7F A;  2VMT A;  5EUN A;  3KE3 A;  4ZDP A;  1SVV A;  2CH1 A;  3FCR A;  4BHD A;  3UWC A;  5HHY A;  1W23 A;  5EAV A;  1XI9 A;  1I29 A;  1IJI A;  1WYU B;  2CTZ A;  1V2D A;  4R5F A;  4OBU A;  5BJ3 A;  4JEY A;  3DOD A;  4JE5 A;  3KKI A;  1N2T A;  3FZ6 A;  3ZZK A;  4A00 A;  4DGT A;  4AOA A;  1SFF A;  4JEZ A;  4E3Q A;  1UU1 A;  3AEP A;  3K28 A;  1GEW A;  4WD2 A;  4E77 A;  4IYO A;  2W7J A;  4TN4 A;  3DU4 A;  3A2B A;  3BN1 A;  3MEB A;  3RBF A;  1RV4 A;  1TOE A;  3F6T A;  4ZM3 A;  2YCT A;  3F0H A;  1EQB A;  3ISL A;  1QJ5 A;  3FVS A;  4HVK A;  1BT4 A;  2GMU A;  4OCA A;  2FN6 A;  4UHO A;  5M49 A;  3B1E A;  1TPL A;  1D7U A;  1LKC A;  4UOY A;  4AZK A;  1O62 A;  1YIY A;  3IF2 A;  3GET A;  2W8W A;  2VMU A;  2CY8 A;  1SZK A;  1BJO A;  2ZY4 A;  2AEU A;  4LNL A;  1YOO A;  4NOG A;  1CS1 A;  1KL1 A;  4WBT A;  1ELQ A;  4P3M A;  1DTY A;  2VMX A;  1B9I A;  3HT4 A;  4H51 A;  2AY4 A;  4A0H A;  5M4D A;  5M46 A;  2X3L A;  2GMS A;  3MC6 C;  4F5F A;  1DGE A;  2JGT A;  3EIA A;  2AY3 A;  1DJ9 A;  3LVL B;  3TCM A;  4M2J A;  3N4R A;  3FSL A;  4WXG A;  5D5S A;  2ZY5 A;  2CJH A;  4WLH A;  3COG A;  2W7M A;  1WYV A;  4PIW A;  2DGK A;  2QLR A;  3N7N A;  3DRD A;  1D7R A;  3R9A A;  2GB3 A;  3LVK A;  3DXW A;  3Q8N A;  4ADD A;  1CZC A;  3LV2 A;  3H7F A;  3JTX A;  2Z20 A;  3M5U A;  3BCX A;  2YHK A;  3PAA A;  1GC3 A;  1M7Y A;  2C81 A;  3R4T A;  1N31 A;  4WYF A;  4F5G A;  3E6G A;  2HOX A;  4R2N A;  4PVF A;  1D7S A;  3QBO A;  1AMQ A;  1EJI A;  2BI3 A;  3L8A A;  3LY1 A;  4XQ2 A;  1ARS A;  3QPG A;  4FL0 A;  4W8I A;  4A0G A;  7AAT A;  1C7N A;  1DKA A;  3E77 A;  1GEX A;  3PGY A;  3N4X A;  4ZM4 A;  1AIC A;  2WK9 A;  3G8M A;  1E5F A;  2DGL A;  1YJY A;  2BIG A;  2ZY3 A;  2BWN A;  3MBB A;  1AKC A;  1BQD A;  3GWP A;  4HF8 A;  5DX5 A;  4AO4 A;  2CB1 A;  2EPJ A;  4GDY A;  3WGC A;  4ADE A;  3LVM A;  5HDM A;  4IW7 A;  1MLZ A;  2VGU A;  4Q6R A;  2YKV A;  2Z1Y A;  1OHY A;  2VMV A;  3MC6 A;  4IYO B;  1IBJ A;  3E2Z A;  3WGB A;  3TAT A;  2Z9U A;  4EB5 A;  3EIB A;  1S06 A;  2FYF A;  3E2Z B;  3QI6 A;  2AY8 A;  4BA5 A;  3OKS A;  2YKU A;  3LG0 A;  1CQ7 A;  4WYD A;  1AKA A;  2C7T A;  3EZS A;  2EZ1 A;  3DR4 A;  4MKJ A;  5BJ4 A;  4OT8 A;  4LNM A;  4XJL A;  1GC4 A;  4PFN A;  1IX7 A;  4ZDO A;  3KGW A;  2O7C A;  3MAF A;  1V2F A;  1AJS A;  5EUE A;  2VGW A;  5E3K A;  4ZSW A;  1Z7D A;  3NRA A;  4W91 A;  3D6K A;  3ELP A;  4A6T A;  3FKD A;  3HL2 A;  3CAI A;  2PB0 A;  2KFP A;  4EU1 A;  4Q76 A;  1UU2 A;  2VLF A;  3FVU A;  4RKD A;  2W7D A;  1MAQ A;  1X0M A;  1YIZ A;  1T3I A;  2G6W A;  3EI5 A;  1GCK A;  1DGD A;  1BS0 A;  2E54 A;  1JS3 A;  2PO3 A;  3TFU A;  1AAW A;  2X5F A;  4LNJ A;  1BJN A;  2W7L A;  2CIN A;  4WB0 B;  1B5O A;  3GZD A;  5DJ1 A;  3TFT A;  3HVY A;  2JJG A;  4IXO A;  3GR9 A;  3HBX A;  1X29 A;  5DB5 A;  5M4B A;  4XK1 A;  2A1V A;  3HDO A;  4EB7 A;  1GBN A;  2CJD A;  4AH3 A;  4BMK A;  1TOK A;  2ORD A;  3EUC A;  4GE9 A;  4IXS A;  4OBV A;  2YOB A;  5E4Z A;  5TF5 A;  3VK2 A;  3HLM A;  4RLG A;  4CXR A;  4EMY A;  1ASC A;  1ASM A;  5FT5 A;  4ZLV A;  2WK8 A;  1YNU A;  2EO5 A;  2WKA A;  3RBL A;  1GDE A;  2BKW A;  1XEY A;  1MGV A;  2W7E A;  3JZL A;  4RJ0 A;  1C7G A;  2W7H A;  1LS3 A;  3QGU A;  3PDB B;  2Z61 A;  2FKI A;  2BI2 A;  3TQX A;  1TOJ A;  2W7I A;  3JU7 A;  4BQ0 A;  3PIU A;  4J8L A;  2HOY A;  1M0P A;  1ASA A;  1ASL A;  1PG8 A;  2RFV A;  2YCN A;  3BWN C;  4W5K A;  1N8P A;  5G2P A;  1O61 A;  1AHE A;  4OYT A;  4JE5 D;  3H9X A;  2E7U A;  3AV7 A;  3N4S A;  2VMY A;  1KMK A;  4U2H A;  1ARH A;  3LWS A;  3FDD A;  1ASE A;  4MQP A;  1E5E A;  1H0C A;  5G0A A;  1OXO A;  1VJO A;  1M0N A;  3A9Z A;  3ECD A;  1SF2 A;  4GRX A;  4W1X A;  1ZOB A;  3E2Y A;  1VEF A;  2TPL A;  2OGA A;  4F4E A;  4RAE A;  2QMA A;  4CBR A;  4WP0 A;  2YKY A;  2W8V A;  1ASF A;  2HP1 A;  4ITX A;  5EAA A;  2BWP A;  4AZJ A;  5KTB A;  2GSA A;  3HMU A;  4JF0 A;  3EZ1 A;  4AO9 A;  4F5H A;  1FG7 A;  1BQA A;  1ELU A;  3EI6 A;  2BIE A;  4XJM A;  1JG8 A;  4PFF A;  3G0T A;  3IHJ A;  4WXF A;  3B8X A;  2X5D A;  3VP6 A;  1MDZ A;  4XJO A;  1FC4 A;  3UAK A;  1MLY A;  3MAU A;  2ZY2 A;  1LC5 A;  4Q75 A;  1SPA A;  2DKB A;  5F9S A;  3CQ5 A;  1BJ4 A;  1AY8 A;  3N0L A;  4JEV A;  1QIR A;  1S09 A;  2BYJ A;  3ZRR A;  1ARI A;  4GSA A;  4KXK A;  5AX8 A;  3DYD A;  4ADB A;  3ACZ A;  3E9K A;  1B9H A;  3FTB A;  4OTL A;  3VOM A;  1Y4I A;  3AAT A;  3L44 A;  3H14 A;  5G4I A;  3NU7 A;  2D7Z A;  2VMO A;  3ZRP A;  1C7O A;  3E2F A;  2QB3 A;  3GSB A;  3NU8 A;  4WYC A;  4ZWM A;  3RUY A;  3GZD C;  1ZC9 A;  2E7I A;  2W7G A;  2VLH A;  1KKJ A;  4CXQ A;  1GEY A;  3ZZJ A;  1G7W A;  4ADC A;  3A9X A;  1SZU A;  1ORD A;  2AY7 A;  4WXB A;  2CAN A;  4DQ6 A;  1BJO B;  2AY2 A;  4F5K A;  1IAX A;  2V0Y A;  3FD0 A;  3BC8 A;  1W3U A;  1QGN A;  1IX8 A;  2HUU A;  2JJH A;  3FDB A;  4XEW A;  2X8U A;  1W7M A;  3ZRQ A;  1EG5 A;  1I48 A;  1V2E A;  1AMA A;  4K2I A;  3WZF A;  4WYG A;  5DJ9 A;  2HZP A;  3PD6 B;  1M0Q A;  2C0R A;  2VGT A;  4ISY A;  1IVR A;  1AY5 A;  2W7K A;  4M2M A;  1CQ8 A;  5D95 A;  4H63 Q;  3UE8 A;  1AAM A;  4ZWV A;  4K05 A;  3VK4 A;  4CVQ A;  1MDX A;  2C44 A;  2CFB A;  4W1V A;  2R5C A;  2AEV A;  1C0N A;  1AMR A;  5F8V A;  1G7X A;  5FT8 A;  4MQR A;  3USF A;  2JJE A;  4ZDL A;  2E7J A;  3WLX A;  4EFF A;  4JEX A;  1C9C A;  4A6R A;  3NTJ A;  2ZYJ A;  1TOI A;  4K2M A;  4UQV A;  2VGS A;  3HQT A;  1AX4 A;  1OHW A;  2VGV A;  3MAD A;  4E3R A;  3LVJ A;  5G2Q A;  1H1C A;  4LC3 A;  1DFO A;  2VI8 A;  2HUF A;  4I8A A;  4Y0D A;  1U08 A;  3KGX A;  4A72 A;  2BWO A;  1QZ9 A;  3VK3 A;  3JW9 A;  3BWO A;  2BIA A;  5K8B A;  2AY5 A;  3EI7 A;  1AJR A;  4A6U A;  4B98 A;  3EI8 A;  2WK7 A;  1AMS A;  4IXZ A;  3K7Y A;  5EUD A;  2VMW A;  2XBN A;  1M0O A;  1BKG A;  1P3W A;  1AY4 A;  3VAX A;  2ZSM A;  4R5Z A;  3MKJ A;  3AEN A;  1WYT B;  2Z9X A;  2VMS A;  4M2K A;  2HOR A;  4ATP A;  1OAT A;  3B1C A;  2OGE A;  4B9B A;  1ARG A;  2AY9 A;  2R5E A;  4RKC A;  3W1J A;  1O4S A;  4BA4 A;  1G4V A;  2QSR A;  1CZE A;  1D7V A;  4WB0 A;  3F9T A;  1ART A;  3BCB A;  4TMR A;  1AJS B;  2QBT A;  1MDO A;  3PDX A;  1B8G A;  1B5P A;  1TAS A;  3ASB A;  4MY5 A;  4P7Y A;  2AY1 A;  1S07 A;  2D63 A;  2Z9V A;  3NYS A;  1M4N A;  1S08 A;  3RQ1 A;  3I5T A;  1WYV B;  2Z1Z A;  4JF1 A;  2AY6 A;  1MAP A;  2R0T A;  4OC9 A;  2D66 A;  4Y0I A;  1DJU A;  4MGR A;  3NUI A;  5HXX A;  4FFC A;  1IAY A;  3P1T A;  3NNK A;  2BHX A;  1C4K A;  1RVU A;  1OXP A;  1IX6 A;  1ASB A;  3PA9 A;  2CST A;  3FQA A;  1O69 A;  4A0R A;  3FFH A;  1AIA A;  1G4X A;  1M32 A;  3WKS A;  1W7L A;  1KAF A;  4N0W A;  1GC0 A;  1LC8 A;  3QN6 A;  3WX9 A;  2YRI A;  1PFF A;  4GE4 A;  1AHX A;  2FM1 A;  4QGR A;  2DR1 A;  2EGY A;  4WYE A;  1CL1 A;  5LHA A;  1S0A A;  2R2N A;  3A9Y A;  3WCO A;  5EIG B;  2D7Y A;  2JG2 A;  3DR7 A;  3PD6 A;  4WYA A;  1TAT A;  2VIB A;  4OMA A;  2VGZ A;  3QM2 A;  3AEM C;  3AEN B;  1JF9 A;  2YRR A;  3WKR A;  2DOU A;  3JWA A;  9AAT A;  2CH2 A;  2Q7W A;  1B4X A;  2VMN A;  3NDN A;  4GE7 A;  3BB8 A;  3WY7 A;  3II0 A;  4W1W A;  3BS8 A;  1JS6 A;  1PMO A;  2VI9 A;  2AAT A;  1AIB A;  2VYC A;  3AEJ A;  1KMJ A;  1I41 A;  1WYT A;  1D2F A;  2BI5 A;  1V72 A;  4LW4 A;  4MSO A;  2BI1 A;  3G7Q A;  3AEO A;  4F5I A;  2Z9W A;  3P6K A;  8AAT A;  2W8U A;  1ECX A;  2VMQ A;  3FZ8 A;  2NMP A;  1X2A A;  4Y0H A;  2FQ6 A;  3BCA A;  2D5Y A;  1LC7 A;  2OQX A;  2F8J A;  2G7J A;  1GC2 A;  3OP7 A;  3N75 A;  1LW4 A;  2OKK A;  3ASA A;  3FRK A;  1AHG A;  2D64 A;  4MKK A;  4UHM A;  2R5C B;  3DZZ A;  3FQ8 A;  3DXV A;  3CQ4 A;  3GZC A;  2FNU A;  5FT4 A;  2PB2 A;  1CL2 A;  3ELE A;  3W1H A;  4F5L A;  1SZS A;  1YAA A;  1ASN A;  4ZAH A;  3GBX A;  3NX3 A;  2VMR A;  3CQ6 A;  1YJS A;  2DGM A;  4U1T A;  1M6S A;  1QIT A;  1IUG A;  3QHX A;  2W8J A;  4MQQ A;  2ZC0 A;  2JIS A;  2HUI A;  2QA3 A;  1CQ6 A;  1WKG A;  2YKX A;  2ZUK A;  1ASG A;  1FG3 A;  4KYO A;  3NUB A;  2VMP A;  2O0R A;  3PPL A;  5I92 A;  1WST A;  4R8D A;  3PDB A;  1LK9 A;  3ATH A;  2V1P A;  2VIA A;  5JAY A;  1DJE A;  4ATQ A;  2OKJ A;  4E1O A;  5IWQ A;  4J5U A;  1RV3 A;  1X28 A;  5J8Q A;  4RIT A;  4F5J A;  2GQN A;  3FZ7 A;  3I16 A;  2WB6 A;  2Z67 A;  4ZAS A;  4LW2 A;  2VMZ A;  5G09 A;  3RCH A;  3MAF B;  4IX8 A;  1TOG A;  3W1I A;  1AHY A;  4ZSY A;  3N5M A;  1J32 A;  4IY7 A;  3A8U X;  4JEW A;  5FT6 A;  3RI6 A;  2ZSL A;  4A0F A;  2HP2 A;  1W7N A;  2O1B A;  2ZJG A;  4N0B A;  1OHV A;  1BW0 A;  1KKP A;  4L0O A;  3WCN A;  2D61 A;  1ZOD A;  2QB2 A;  1QIS A;  2YCP A;  4Q31 A;  3AOW A;  3RCH B;  5EFS A;  3AEM A;  4KAM A;  3BWN A;  1UKJ A;  3I4J A;  3NYU A;  3GJU A;  2EYQ A;  1UU0 A;  4F5M A;  1VP4 A;  4XAU A;  3AEJ C;  2FNI A;  5G4J A;  4RJY A;  1PMM A;  4GEB A;  1I43 A;  1ASD A;  1J04 A;  2XH1 A;  1KL2 A;  3FFR A;  4RIZ A;  3BV0 A;  2W8T A;  4XJP A;  2HOZ A;  2EH6 A;  4RM1 A;  1QJ3 A;  2OAT A;  3FQ7 A;  1LW5 A; 
#chains in the Genus database with same CATH homology
 3AEL A;  3CBF A;  4UHN A;  3B1D A;  5LH9 A;  3T32 A;  1WYU A;  3B46 A;  4DBC A;  2JJF A;  3DC1 A;  4CBS A;  1BJW A;  2BYL A;  2EZ2 A;  3K40 A;  1AHF A;  1RVY A;  1WKH A;  1AKB A;  1YJZ A;  2BI9 A;  2D65 A;  3FVX A;  3JWB A;  3NYT A;  4K2B A;  4WLJ A;  5E5I A;  5C6U A;  2DKJ A;  3AOV A;  2CJG A;  1GD9 A;  1Z3Z A;  5EQC A;  1CJ0 A;  4TV7 A;  3PJ0 A;  4ITG A;  1TAR A;  5EIG A;  4O6Z A;  2ZP7 A;  3EI9 A;  2W7F A;  2VMT A;  5EUN A;  3KE3 A;  4ZDP A;  1SVV A;  2CH1 A;  3FCR A;  4BHD A;  3UWC A;  5HHY A;  1W23 A;  5EAV A;  1XI9 A;  1I29 A;  1IJI A;  1WYU B;  2CTZ A;  1V2D A;  4R5F A;  4OBU A;  5BJ3 A;  4JEY A;  3DOD A;  4JE5 A;  3KKI A;  1N2T A;  3FZ6 A;  3ZZK A;  4A00 A;  4DGT A;  4AOA A;  1SFF A;  4JEZ A;  4E3Q A;  1UU1 A;  3AEP A;  3K28 A;  1GEW A;  4WD2 A;  4E77 A;  4IYO A;  2W7J A;  4TN4 A;  3DU4 A;  3A2B A;  3BN1 A;  3MEB A;  3RBF A;  1RV4 A;  1TOE A;  3F6T A;  4ZM3 A;  2YCT A;  3F0H A;  1EQB A;  3ISL A;  1QJ5 A;  3FVS A;  4HVK A;  1BT4 A;  2GMU A;  4OCA A;  2FN6 A;  4UHO A;  5M49 A;  3B1E A;  1TPL A;  1D7U A;  1LKC A;  4UOY A;  4AZK A;  1O62 A;  1YIY A;  3IF2 A;  3GET A;  2W8W A;  2VMU A;  2CY8 A;  1SZK A;  1BJO A;  2ZY4 A;  2AEU A;  4LNL A;  1YOO A;  4NOG A;  1CS1 A;  1KL1 A;  4WBT A;  1ELQ A;  4P3M A;  1DTY A;  2VMX A;  1B9I A;  3HT4 A;  4H51 A;  2AY4 A;  4A0H A;  5M4D A;  5M46 A;  2X3L A;  2GMS A;  3MC6 C;  4F5F A;  1DGE A;  2JGT A;  3EIA A;  2AY3 A;  1DJ9 A;  3LVL B;  3TCM A;  4M2J A;  3N4R A;  3FSL A;  4WXG A;  5D5S A;  2ZY5 A;  2CJH A;  4WLH A;  3COG A;  2W7M A;  1WYV A;  4PIW A;  2DGK A;  2QLR A;  3N7N A;  3DRD A;  1D7R A;  3R9A A;  2GB3 A;  3LVK A;  3DXW A;  3Q8N A;  4ADD A;  1CZC A;  3LV2 A;  3H7F A;  3JTX A;  2Z20 A;  3M5U A;  3BCX A;  2YHK A;  3PAA A;  1GC3 A;  1M7Y A;  2C81 A;  3R4T A;  1N31 A;  4WYF A;  4F5G A;  3E6G A;  2HOX A;  4R2N A;  4PVF A;  1D7S A;  3QBO A;  1AMQ A;  1EJI A;  2BI3 A;  3L8A A;  3LY1 A;  4XQ2 A;  1ARS A;  3QPG A;  4FL0 A;  4W8I A;  4A0G A;  7AAT A;  1C7N A;  1DKA A;  3E77 A;  1GEX A;  3PGY A;  3N4X A;  4ZM4 A;  1AIC A;  2WK9 A;  3G8M A;  1E5F A;  2DGL A;  1YJY A;  2BIG A;  2ZY3 A;  2BWN A;  3MBB A;  1AKC A;  1BQD A;  3GWP A;  4HF8 A;  5DX5 A;  4AO4 A;  2CB1 A;  2EPJ A;  4GDY A;  3WGC A;  4ADE A;  3LVM A;  5HDM A;  4IW7 A;  1MLZ A;  2VGU A;  4Q6R A;  2YKV A;  2Z1Y A;  1OHY A;  2VMV A;  3MC6 A;  4IYO B;  1IBJ A;  3E2Z A;  3WGB A;  3TAT A;  2Z9U A;  4EB5 A;  3EIB A;  1S06 A;  2FYF A;  3E2Z B;  3QI6 A;  2AY8 A;  4BA5 A;  3OKS A;  2YKU A;  3LG0 A;  1CQ7 A;  4WYD A;  1AKA A;  2C7T A;  3EZS A;  2EZ1 A;  3DR4 A;  4MKJ A;  5BJ4 A;  4OT8 A;  4LNM A;  4XJL A;  1GC4 A;  4PFN A;  1IX7 A;  4ZDO A;  3KGW A;  2O7C A;  3MAF A;  1V2F A;  1AJS A;  5EUE A;  2VGW A;  5E3K A;  4ZSW A;  1Z7D A;  3NRA A;  4W91 A;  3D6K A;  3ELP A;  4A6T A;  3FKD A;  3HL2 A;  3CAI A;  2PB0 A;  2KFP A;  4EU1 A;  4Q76 A;  1UU2 A;  2VLF A;  3FVU A;  4RKD A;  2W7D A;  1MAQ A;  1X0M A;  1YIZ A;  1T3I A;  2G6W A;  3EI5 A;  1GCK A;  1DGD A;  1BS0 A;  2E54 A;  1JS3 A;  2PO3 A;  3TFU A;  1AAW A;  2X5F A;  4LNJ A;  1BJN A;  2W7L A;  2CIN A;  4WB0 B;  1B5O A;  3GZD A;  5DJ1 A;  3TFT A;  3HVY A;  2JJG A;  4IXO A;  3GR9 A;  3HBX A;  1X29 A;  5DB5 A;  5M4B A;  4XK1 A;  2A1V A;  3HDO A;  4EB7 A;  1GBN A;  2CJD A;  4AH3 A;  4BMK A;  1TOK A;  2ORD A;  3EUC A;  4GE9 A;  4IXS A;  4OBV A;  2YOB A;  5E4Z A;  5TF5 A;  3VK2 A;  3HLM A;  4RLG A;  4CXR A;  4EMY A;  1ASC A;  1ASM A;  5FT5 A;  4ZLV A;  2WK8 A;  1YNU A;  2EO5 A;  2WKA A;  3RBL A;  1GDE A;  2BKW A;  1XEY A;  1MGV A;  2W7E A;  3JZL A;  4RJ0 A;  1C7G A;  2W7H A;  1LS3 A;  3QGU A;  3PDB B;  2Z61 A;  2FKI A;  2BI2 A;  3TQX A;  1TOJ A;  2W7I A;  3JU7 A;  4BQ0 A;  3PIU A;  4J8L A;  2HOY A;  1M0P A;  1ASA A;  1ASL A;  1PG8 A;  2RFV A;  2YCN A;  3BWN C;  4W5K A;  1N8P A;  5G2P A;  1O61 A;  1AHE A;  4OYT A;  4JE5 D;  3H9X A;  2E7U A;  3AV7 A;  3N4S A;  2VMY A;  1KMK A;  4U2H A;  1ARH A;  3LWS A;  3FDD A;  1ASE A;  4MQP A;  1E5E A;  1H0C A;  5G0A A;  1OXO A;  1VJO A;  1M0N A;  3A9Z A;  3ECD A;  1SF2 A;  4GRX A;  4W1X A;  1ZOB A;  3E2Y A;  1VEF A;  2TPL A;  2OGA A;  4F4E A;  4RAE A;  2QMA A;  4CBR A;  4WP0 A;  2YKY A;  2W8V A;  1ASF A;  2HP1 A;  4ITX A;  5EAA A;  2BWP A;  4AZJ A;  5KTB A;  2GSA A;  3HMU A;  4JF0 A;  3EZ1 A;  4AO9 A;  4F5H A;  1FG7 A;  1BQA A;  1ELU A;  3EI6 A;  2BIE A;  4XJM A;  1JG8 A;  4PFF A;  3G0T A;  3IHJ A;  4WXF A;  3B8X A;  2X5D A;  3VP6 A;  1MDZ A;  4XJO A;  1FC4 A;  3UAK A;  1MLY A;  3MAU A;  2ZY2 A;  1LC5 A;  4Q75 A;  1SPA A;  2DKB A;  5F9S A;  3CQ5 A;  1BJ4 A;  1AY8 A;  3N0L A;  4JEV A;  1QIR A;  1S09 A;  2BYJ A;  3ZRR A;  1ARI A;  4GSA A;  4KXK A;  5AX8 A;  3DYD A;  4ADB A;  3ACZ A;  3E9K A;  1B9H A;  3FTB A;  4OTL A;  3VOM A;  1Y4I A;  3AAT A;  3L44 A;  3H14 A;  5G4I A;  3NU7 A;  2D7Z A;  2VMO A;  3ZRP A;  1C7O A;  3E2F A;  2QB3 A;  3GSB A;  3NU8 A;  4WYC A;  4ZWM A;  3RUY A;  3GZD C;  1ZC9 A;  2E7I A;  2W7G A;  2VLH A;  1KKJ A;  4CXQ A;  1GEY A;  3ZZJ A;  1G7W A;  4ADC A;  3A9X A;  1SZU A;  1ORD A;  2AY7 A;  4WXB A;  2CAN A;  4DQ6 A;  1BJO B;  2AY2 A;  4F5K A;  1IAX A;  2V0Y A;  3FD0 A;  3BC8 A;  1W3U A;  1QGN A;  1IX8 A;  2HUU A;  2JJH A;  3FDB A;  4XEW A;  2X8U A;  1W7M A;  3ZRQ A;  1EG5 A;  1I48 A;  1V2E A;  1AMA A;  4K2I A;  3WZF A;  4WYG A;  5DJ9 A;  2HZP A;  3PD6 B;  1M0Q A;  2C0R A;  2VGT A;  4ISY A;  1IVR A;  1AY5 A;  2W7K A;  4M2M A;  1CQ8 A;  5D95 A;  4H63 Q;  3UE8 A;  1AAM A;  4ZWV A;  4K05 A;  3VK4 A;  4CVQ A;  1MDX A;  2C44 A;  2CFB A;  4W1V A;  2R5C A;  2AEV A;  1C0N A;  1AMR A;  5F8V A;  1G7X A;  5FT8 A;  4MQR A;  3USF A;  2JJE A;  4ZDL A;  2E7J A;  3WLX A;  4EFF A;  4JEX A;  1C9C A;  4A6R A;  3NTJ A;  2ZYJ A;  1TOI A;  4K2M A;  4UQV A;  2VGS A;  3HQT A;  1AX4 A;  1OHW A;  2VGV A;  3MAD A;  4E3R A;  3LVJ A;  5G2Q A;  1H1C A;  4LC3 A;  1DFO A;  2VI8 A;  2HUF A;  4I8A A;  4Y0D A;  1U08 A;  3KGX A;  4A72 A;  2BWO A;  1QZ9 A;  3VK3 A;  3JW9 A;  3BWO A;  2BIA A;  5K8B A;  2AY5 A;  3EI7 A;  1AJR A;  4A6U A;  4B98 A;  3EI8 A;  2WK7 A;  1AMS A;  4IXZ A;  3K7Y A;  5EUD A;  2VMW A;  2XBN A;  1M0O A;  1BKG A;  1P3W A;  1AY4 A;  3VAX A;  2ZSM A;  4R5Z A;  3MKJ A;  3AEN A;  1WYT B;  2Z9X A;  2VMS A;  4M2K A;  2HOR A;  4ATP A;  1OAT A;  3B1C A;  2OGE A;  4B9B A;  1ARG A;  2AY9 A;  2R5E A;  4RKC A;  3W1J A;  1O4S A;  4BA4 A;  1G4V A;  2QSR A;  1CZE A;  1D7V A;  4WB0 A;  3F9T A;  1ART A;  3BCB A;  4TMR A;  1AJS B;  2QBT A;  1MDO A;  3PDX A;  1B8G A;  1B5P A;  1TAS A;  3ASB A;  4MY5 A;  4P7Y A;  2AY1 A;  1S07 A;  2D63 A;  2Z9V A;  3NYS A;  1M4N A;  1S08 A;  3RQ1 A;  3I5T A;  1WYV B;  2Z1Z A;  4JF1 A;  2AY6 A;  1MAP A;  2R0T A;  4OC9 A;  2D66 A;  4Y0I A;  1DJU A;  4MGR A;  3NUI A;  5HXX A;  4FFC A;  1IAY A;  3P1T A;  3NNK A;  2BHX A;  1C4K A;  1RVU A;  1OXP A;  1IX6 A;  1ASB A;  3PA9 A;  2CST A;  3FQA A;  1O69 A;  4A0R A;  3FFH A;  1AIA A;  1G4X A;  1M32 A;  3WKS A;  1W7L A;  4N0W A;  1GC0 A;  1LC8 A;  3QN6 A;  3WX9 A;  2YRI A;  1PFF A;  4GE4 A;  1AHX A;  2FM1 A;  4QGR A;  2DR1 A;  2EGY A;  4WYE A;  1CL1 A;  5LHA A;  1S0A A;  2R2N A;  3A9Y A;  3WCO A;  5EIG B;  2D7Y A;  2JG2 A;  3DR7 A;  3PD6 A;  4WYA A;  1TAT A;  2VIB A;  4OMA A;  2VGZ A;  3QM2 A;  3AEM C;  3AEN B;  1JF9 A;  2YRR A;  3WKR A;  2DOU A;  3JWA A;  9AAT A;  2CH2 A;  2Q7W A;  1B4X A;  2VMN A;  3NDN A;  4GE7 A;  3BB8 A;  3WY7 A;  3II0 A;  4W1W A;  3BS8 A;  1JS6 A;  1PMO A;  2VI9 A;  2AAT A;  1AIB A;  2VYC A;  3AEJ A;  1KMJ A;  1I41 A;  1WYT A;  1D2F A;  2BI5 A;  1V72 A;  4LW4 A;  4MSO A;  2BI1 A;  3G7Q A;  3AEO A;  4F5I A;  2Z9W A;  3P6K A;  8AAT A;  2W8U A;  1ECX A;  2VMQ A;  3FZ8 A;  2NMP A;  1X2A A;  4Y0H A;  2FQ6 A;  3BCA A;  2D5Y A;  1LC7 A;  2OQX A;  2F8J A;  2G7J A;  1GC2 A;  3OP7 A;  3N75 A;  1LW4 A;  2OKK A;  3ASA A;  3FRK A;  1AHG A;  2D64 A;  4MKK A;  4UHM A;  2R5C B;  3DZZ A;  3FQ8 A;  3DXV A;  3CQ4 A;  3GZC A;  2FNU A;  5FT4 A;  2PB2 A;  1CL2 A;  3ELE A;  3W1H A;  4F5L A;  1SZS A;  1YAA A;  1ASN A;  4ZAH A;  3GBX A;  3NX3 A;  2VMR A;  3CQ6 A;  1YJS A;  2DGM A;  4U1T A;  1M6S A;  1QIT A;  1IUG A;  3QHX A;  2W8J A;  4MQQ A;  2ZC0 A;  2JIS A;  2HUI A;  2QA3 A;  1CQ6 A;  1WKG A;  2YKX A;  2ZUK A;  1ASG A;  1FG3 A;  4KYO A;  3NUB A;  2VMP A;  2O0R A;  3PPL A;  5I92 A;  1WST A;  4R8D A;  3PDB A;  1LK9 A;  3ATH A;  2V1P A;  2VIA A;  5JAY A;  1DJE A;  4ATQ A;  2OKJ A;  4E1O A;  5IWQ A;  4J5U A;  1RV3 A;  1X28 A;  5J8Q A;  4RIT A;  4F5J A;  2GQN A;  3FZ7 A;  3I16 A;  2WB6 A;  2Z67 A;  4ZAS A;  4LW2 A;  2VMZ A;  5G09 A;  3RCH A;  3MAF B;  4IX8 A;  1TOG A;  3W1I A;  1AHY A;  4ZSY A;  3N5M A;  1J32 A;  4IY7 A;  3A8U X;  4JEW A;  5FT6 A;  3RI6 A;  2ZSL A;  4A0F A;  2HP2 A;  1W7N A;  2O1B A;  2ZJG A;  4N0B A;  1OHV A;  1BW0 A;  1KKP A;  4L0O A;  3WCN A;  2D61 A;  1ZOD A;  2QB2 A;  1QIS A;  2YCP A;  4Q31 A;  3AOW A;  3RCH B;  5EFS A;  3AEM A;  4KAM A;  3BWN A;  1UKJ A;  3I4J A;  3NYU A;  3GJU A;  2EYQ A;  1UU0 A;  4F5M A;  1VP4 A;  4XAU A;  3AEJ C;  2FNI A;  5G4J A;  4RJY A;  1PMM A;  4GEB A;  1I43 A;  1ASD A;  1J04 A;  2XH1 A;  1KL2 A;  3FFR A;  4RIZ A;  3BV0 A;  2W8T A;  4XJP A;  2HOZ A;  2EH6 A;  4RM1 A;  1QJ3 A;  2OAT A;  3FQ7 A;  1LW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...