1ASKA

Nuclear transport factor 2 (ntf2) h66a mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
b'GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQASITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
molecule tags Transport
source organism Rattus norvegicus
publication title Nuclear protein import is decreased by engineered mutants of nuclear transport factor 2 (NTF2) that do not bind GDP-Ran.
pubmed doi rcsb
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1askA00
3H51A 2JQ5A 2STDA 3JUOA 4L7KA 4WYKA 1O7WB 1NDOB 1DMQA 3KE7A 4OVMA 3F8HA 2XRXB 4U13A 1OUNA 2PZVA 3E99A 1JB4A 2W2CA 1GY6A 3G16A 1OHPA 1GS3A 3H3HA 3JUNA 4J9AA 6STDA 4XDWA 3NXJA 2YFJB 2BMRB 2HMMB 1GY5A 2R4IA 3F9SA 5AIIA 1O7HB 2A15A 4HM1B 3MYTA 1ULJB 1SJWA 4XBTA 1W01A 2XSHB 4HM3B 1E97A 4OUQA 5AIFA 3T8UA 3EQQB 3OXAA 4Q53A 4L8OA 1JN5B 4LMIA 4XB5A 2GEYA 4HM6B 1GY7A 1ASKA 3FLJA 3ROBA 2RGQA 2HMJB 5D83A 1W02A 7STDA 3SEDA 1OHOA 3DM8A 3BB9A 4H3UA 4K1UA 1TP6A 3OWSA 4X2OA 5CLKA 1U5OA 3OX9A 2BNGA 5AIGA 3MG1A 1OCVA 1OHSA 2Z77A 5IF6A 1NU3A 2I9WA 5CXOA 5KP3A 5TGNA 5CK6A 3DUKA 5JPPA 2XR8B 1DMNA 4L8PA 5AEWB 2QGUA 1O7MB 3SOYA 3FZWA 1Q40B 1VZZA 3EJVA 1JKGA 2UX0A 3MG2A 1EA2A 1JB2A 1K41A 3G0KA 4HM8B 3LYGA 4IIAA 5STDA 1BUQA 1CQSA 5CF2A 5IG4A 1O7GB 2F86B 3EX9A 3FF0A 1O7PB 3GZBA 3MG3A 4STDA 3JUPA 1OGZA 5EVHA 4XBXA 1C7HA 3HK4A 3F7XA 2HMKB 5HGRA 3WMDA 3EF8A 4MJDA 2QIYA 4HZBB 1QJGA 1A2KA 1TUHA 4WWUC 4X2HA 4XDVA 5CF1A 3S5CA 3GZYB 4FCMA 2YFIB 5FW5A 1OF5A 2HMNB 1QMAA 5AEUB 3B7CA 5IENA 1ISKA 3A76A 3FGYA 4HM5B 1GYBA 3NM2A 3F14A 1JN5A 3VGNA 1ULIB 3OWYA 2RFRA 5AI1A 3Q90A 3F40A 2IMJA 3GZRA 1UUVB 1S5AA 3OV4A 2RCDA 1ZO2A 1OGXA 4PEJA 2F99A 3FKAA 3K0ZA 2INXA 3STDA 3HZPA 3NV0B 4FCJA 2CHCA 3NHXA 3FF2A 3KZTA 3GZXB 3M8CA 3RGRA 2Z76A 3K7CA 3NUVA 3JUQA 4I4KA 3MHEA 3NV0A 3DXOA 8CHOA 2B1XB 5IG5A 3BLZA 1HKXA 1ZX2A 3OWUA 2OWPA 4RZMA 5BXQA 4R1KA 5IEOA 5IERA 3T8NA 3GRDA 3DZLA 3EBYA 3EHCA 2Z7AA 3CNMA 3NBRA 3EC9A 4HM0B 3KKGA 1W00A 3CU3A 5DRVA 4KVHA 4R9KA 4R9LA 1Q42A 1O7NB 3B8LA 3SOAA 1STDA 5IG0A 4XBYA 3CNXA 3HX8A 3IPTA 4WP5A 5D81A 4CDLA 1WQLB 2BMQB 1OH0A 1UUWB 3F7SA 4HM2B 1AR0A 1IDPA 5AIHA 3ECFA 2CKFB 1Z1SA 3GWRA 4LGQA 1E3VA 4XM4A 2F98A 2HMLB 3LZAA 2GEXA 4HZ9B 2K54A 5KP1A 3D9RA 3I0YA 4ORLA 3B4PA 1JB5A 1EG9B 1Q40A 5JPUA 3DMCA 3KSPA 3FSDA 1JKGB 3MKIA 4HM7B 5G2GA 3EBTA 4K1VA 3RGAA 5KP4A 2BMOB 4WYKB 3UNLA 5IG3A 3MSOA 4HM4B 4GB5A 4HJLB 4HVNA 4LEHA 5BVBA 3F8XA 2GBXB 5D82A 2XSOB 3B4OA 3EN8A 3JUMA 2GXFA 2YFLB 3ER7A 4J8TA 3FH1A 1E3RA 4N3VA 5IEPA 1DMMA 1OPYA 3CPOA 3G8ZA 5DREA 3EN1B 4HKVB 3UJMA 1NWWA 2HMOB 1W6YA 3VSYA 2B24B 1OF5B 2GBWB
chains in the Genus database with same CATH superfamily
1T2HA 4IPBA 4NREA 3NQZA 1A2PA 2ZDJA 3JUOA 1O7WB 3CCM3 1FGOA 2XRXB 1DYUA 1M9GA 3G16A 2PZVA 4AEQA 1GS3A 5JBSA 1BVIA 1HYFA 1FGTA 3NXJA 1IVVA 2HMMB 2R4IA 1B2XA 1GY5A 1RDSA 2ML5A 5BU4A 1A67A 4XBTA 1TRPA 1US1A 1BSEA 1ROAA 1RJOA 3AMOB 1W5ZA 3DGLA 4L8OA 1AQZA 1GOUA 1MOLA 2GEYA 2Y74A 2CFWA 1HZ1A 3ROBA 1STFI 1EKMA 4LSOA 7STDA 1OHOA 1B3SA 1BSAA 2FGTA 2D42A 2XGLA 4GSPA 3BNEA 1OHSA 1D6ZA 1LRAA 4N6TA 1MGRA 1N9EA 1WNHA 1O7MB 5AEWB 1FA3A 1VZZA 2UX0A 3MG2A 4N6V0 1JB2A 1K41A 1UGHI 3WOFB 6RNTA 4EV2A 3D79A 3NQYA 5STDA 1BUQA 1CQSA 2SBLA 5CF2A 1O7GB 1KWIA 2CK3H 3GZBA 1TTOA 1VQ63 2RBIA 1C7HA 1RLSA 2HMKB 4KT3B 1IYYA 1B21A 1A2VA 1G02A 1RN1A 1RNBA 2E2VA 2HMNB 4AKYA 5IENA 3B7CA 4ILFA 4O3VA 1S723 3AMOA 3A76A 3Q2PA 1N8QA 1V57A 3NM2A 1TU5A 3F14A 3CXC2 1CH0A 3OWYA 4N6OB 1YHQ3 1RGAA 1RRLA 3F40A 3FCSB 5M1AA 1RNTA 2H0HA 3G4S3 4H61A 1BGSA 1OGXA 1ZO2A 1EEJA 2AADA 3SLUA 4MMYB 4RNTA 3J7Yd 1JBTA 1AY7A 4RBNA 2CWTA 2LQVA 3CCV3 1BU4A 1VQ53 1BRGA 8CHOA 3DXOA 5IG5A 2FXTA 3BLZA 2SARA 1NNVA 1LOVA 4RZMA 3LOYA 1MWUA 5IEOA 3CCJ3 3FG4A 3T8NA 3EHCA 2Z7AA 3NBRA 4HAAA 1RSNA 3EC9A 5EQLA 3LT9A 3PZWA 1FUTA 1GMRA 1IU7A 1BANA 4KVHA 3WDGB 1BRIA 4K90B 1WMOA 3CNXA 1G0TA 4CDLA 1Y4KA 2OOVC 4LYLB 2BMQB 1TFOA 3QK9A 1SQWA 2XFTA 4HM2B 1IDPA 2L4VA 5G1KA 1D6UA 3Q3FA 1NJI4 2M7OA 2HMLB 2WGOA 2GEXA 3LZAA 4HZ9B 1B2MA 4ORLA 3B4PA 1OACA 1EG9B 1Q40A 1VQM3 1B2ZA 1JKGB 1GSPA 4HM7B 1VQO3 4K1VA 2HOHA 3RGAA 5KP4A 2BMOB 2CW9A 2CFLA 3X3ZA 4HM4B 2ML6A 4GB5A 4LEHA 3K9MC 5BVBA 4LZIA 4I5QA 3GSPA 1J2BA 1UUGB 2P0MA 3LTAA 5HOHA 2CFGA 2CIUA 1RGCA 2C4BA 1E3RA 1HU9A 1IV7A 5DREA 1MWTA 4BTXA 5M18A 2J8XB 3UJMA 1NWWA 3N54B 4MEIA 3D4AA 2B24B 1FZUA 3TDGA 4TX4A 1Q7HA 1RCLA 1W6CA 3X42A 1IVWA 4WYKA 1M904 1NDOB 1RN7A 3KE7A 2KF6A 1BSCA 1K9M4 1I8VA 2K3DA 3E99A 1JB4A 2W2CA 3H3HA 3JUNA 1OHPA 3MPHA 4EBGA 1RRHA 6STDA 1SPUA 1TJDA 2W0QA 1N5PA 2RNTA 1YIT3 1YI23 1RKYA 1O7HB 2A15A 4HM1B 3K63A 3AHWA 3ZFZA 2CG0A 3AGNA 2WOFA 1LOYA 1W01A 4MMZB 3I563 1YGEA 2GSPA 3AGOA 3K5TA 4OUQA 1RTUA 3WODG 3S28A 3AHSA 2RSXA 1R4YA 1SIHA 1LOWA 3D3LA 3FLJA 4R4KA 2RGQA 3LTCA 3N9HA 5FGOA 1ZGXA 1SIIA 4FCZA 5CLKA 2IUKA 3OWSA 4MMXB 1QAFA 1RCKA 3OX9A 5M19A 1AVLA 1LQGC 1OCVA 1UI8A 3S29A 2Z77A 3VF1A 5IF6A 2I9WA 3O8YA 5CXOA 5KP3A 5CK6A 3DUKA 4EYCA 2QGUA 1B20A 3SOYA 3FZWA 1PYLA 1Q864 3EJVA 1LQMB 1BNRA 3NBBA 1EA2A 1GD4A 3G0KA 2JDIH 2MF7A 1X1WA 4GHOA 2FNQA 3I553 1UCJA 2E2TA 1V58A 3FF0A 4CPKA 4FMDA 1BIRA 1QALA 2KCDA 2CH9A 2W03A 3HK4A 1B2UA 1YVBI 3UL6A 3WMDA 2K0MA 3WOEB 4XDVA 4WWUC 5CF1A 3FG1A 3GZYB 1VQN3 4FCMA 1IV9A 5FW5A 1OF5A 1BNIA 2QEX3 1DVDA 1I3IA 2C10A 1JBSA 1VQ43 4HM5B 1GYBA 1MWRA 1RGFA 3CMA3 5AI1A 2RFRA 1BRNL 1UUVB 1FGRA 1GMQA 4HYZA 1IVXA 1KQS2 1VQP3 2INXA 3G713 3HZPA 4IT7A 4K61A 5G1LA 1T5YA 3NV0A 1IQ8A 1HKXA 2R41A 2CFDA 4R1KA 5IERA 1D6YA 2O9UX 1RGEA 4DKIA 4JRFA 3EBYA 4BL2A 2C11A 3G6E3 4HM0B 3CCU3 3KKGA 1AV4A 1BSBA 4EXRA 1M1K4 5DRVA 3T0UA 4R9KA 1BNFA 5IG0A 1CYUA 1RN4A 2BIRA 2XF3A 3GAXA 1UUWB 4BIRA 4AKZA 1YJW3 1AR0A 3ECFA 1BSDA 2CKFB 1E3VA 3U97A 2F98A 3LMLA 5KP1A 3LH4A 1UCIA 1IQYA 1JB5A 1I0VA 3KSPA 1IQXA 3FSDA 5IW9A 3HOHA 1LNIA 3PGBA 5AYRB 3UNLA 1JV2B 5IG3A 5AYSC 2OOVA 4N6MA 1R4CA 2XFSA 2IY2A 1FUWA 1PY3A 2W6JH 4FMAA 5LC6A 1IT8A 2GXFA 2YFLB 3ER7A 3JUMA 4J8TA 1ROVA 1Q7Y4 3LTBA 1BOXA 1DMMA 1OPYA 2WOHA 3EN1B 2HMOB 2KF4A 1BNSA 1X1UA 2ZHXB 3UB1A 3F8HA 1QAKA 1JBRA 3RNTA 3H51A 4J5GA 2OCTA 4OVMA 1GOYA 4U13A 3DY5A 3X3XA 1YNVX 2F4YA 1BRKA 4XDWA 3CC23 5AIIA 7RNTA 1I2GA 3MYTA 3CC43 3KCHA 1SJWA 2XSHB 4HM3B 1E97A 3BNCA 5AIFA 1L5GB 2MC8A 3EQQB 1GD3A 1KD14 3MWZA 4XB5A 1JN5B 3PYJA 4LMIA 1VQL3 4HM6B 1I70A 2F56A 2H0IA 2CWVA 2HMJB 2CC3A 2KAAA 4RNYA 3SEDA 3BB9A 1BUJA 1EUIC 1U5OA 1DE3A 2UUGC 3MG1A 4ZM8A 1TIJA 1NU3A 5TGNA 2P0XA 2XGNA 4N6NB 1DETA 5JPPA 2XR8B 1DMNA 2Q07A 3IJEB 6GSPA 1BAOA 1NO3A 1Q40B 4QWTA 3CCR3 1W6GA 1JKGA 1NB5I 5A0OB 4HOHA 3CCQ3 4CCVA 4IIAA 3LYGA 1BRSA 1I2EA 3BNBA 1X1XA 3KFQC 1O7PB 3JUPA 1OGZA 1BRHA 2QA43 4XBXA 3F7XA 9RNTA 1T3BA 3EF8A 4KFEA 3X3YA 1TFKA 1F8NA 2P38A 4X2HA 1A2KA 1TUHA 3CCS3 3SX1A 3NBJA 2YFIB 1QMAA 1FYSA 4RNZA 1ISKA 3HI7A 3D5IA 3EB8A 1JN5A 1ULIB 2KF3A 1UI7A 3CME3 1YJ93 3Q90A 4JF8A 2IYJA 4CJNA 2IMJA 3GZRA 2W04A 3CCE3 1I2FA 2F99A 1YJN3 1WMNA 3K0ZA 2CWUA 2ZA4A 3STDA 3NV0B 4FCJA 2P09A 2CHCA 3NHXA 1V74A 3KZTA 1QVG2 3NX0A 3RGRA 1PU4A 4J5KA 3JUQA 4I4KA 3X41A 4N6LA 2XH9A 2YX9A 3OWUA 1M1XB 2OWPA 2XEPA 1W2B2 2Z6BA 3CNMA 3CCL3 1VQ93 1N8R4 1UGIA 1G96A 1W00A 1FGMA 1Q42A 5EEOA 1FW7A 2IA7A 2GU3A 1I3FA 4XBYA 5D81A 2LYXA 1SARA 1OH0A 1UCKA 5AIHA 3S67A 3GWRA 2CX0A 3KN4A 3PCSA 4LGQA 1FGQA 4WHAA 4EW5A 2OTL3 3RDEA 2K54A 2D1WA 3D9RA 3V99A 3DGMA 3WR2A 5BIRA 1JNQA 3DMCA 3MKIA 2PNCA 3KIIA 1BRJA 2KRTA 3EBTA 1RHLA 4WYKB 3PS8A 1B27A 1AVKA 3MSOA 4HJLB 4HVNA 3EE1A 2E2UA 1CYVA 1K8A4 3HIIA 1JRQA 5D82A 2XSOB 3DH2A 4O02B 3ZG0A 4BL3A 1JZDA 3FH1A 2UGIA 3CPOA 1VQ83 3L0RA 3VSYA 4KFFA 1FUSA 4BTWA 2GBWB 3X40A 2GU1A 2JQ5A 2STDA 4L7KA 2L1SA 1DMQA 1B2SA 1LNHA 1OUNA 4J9AA 1GY6A 4R80A 1ZS7A 2YFJB 2BMRB 3F9SA 3V98A 3KSED 4BTYA 1N5HA 1ULJB 1KC84 1WMPA 2CG1A 2WGQA 1PFPA 3T8UA 3BIRA 3OXAA 4Q53A 3JVCA 1VQ73 3DGNA 1GMPA 1GY7A 1ASKA 3SVAA 5D83A 1W02A 3NM7A 3DGOA 4NPBA 3DM8A 4K1UA 1Q814 4H3UA 1TP6A 4X2OA 1N9JA 4OK0A 2BNGA 2OQEC 5AIGA 1UW1A 3D5GA 3ALAA 4L8PA 1IK3A 1JJ22 1Q9EA 1VQQA 1WTHA 1K28A 1MNLA 1YIJ3 3V92A 8RNTA 4HM8B 4O2HA 2O3OA 1A90A 5IG4A 1DVCA 2F86B 3EX9A 1T2IA 3LT8A 3MG3A 4STDA 4WFOA 1Q824 2OQEA 5EVHA 1C54A 2W56A 1BNEA 3UL5A 5HGRA 3CC73 4N6UA 1RGHA 4MJDA 2QIYA 4HZBB 1QJGA 2KXGA 2V1LA 1JZOA 3HIGA 3S5CA 3CPW2 3OW22 2F5MA 5AEUB 1VQK3 3URPA 2P05A 4O8SA 2WO0A 4FMCA 3FGYA 2ZL8A 3LXUX 3U1WA 3VGNA 1RGGA 1X1YA 2W9QA 4KFDA 3OV4A 5RNTA 1S5AA 2IUJA 2RCDA 1EQKA 4PEJA 3SYUA 3FKAA 1BNJA 2AAEA 2KF5A 2Y73A 1LVNA 5LC7A 3FF2A 1W7CA 1MGWA 1IT7A 3GZXB 3M8CA 2Z76A 1QVF2 3K7CA 3NUVA 1GOVA 3MHEA 1UCLA 2B1XB 3PCRA 1ZX2A 5BXQA 2W9PA 4EV5A 2OTJ3 3FG3A 1UDII 1U8CB 1CEWI 1BNGA 3DZLA 2BU4A 3GRDA 3WA2X 3ZG5A 1K734 3A5EA 4FR9A 3N8BA 4BU4A 1TRQA 3CU3A 3SOAA 1RGKA 4R9LA 1O7NB 2W56B 3B8LA 1RGLA 1STDA 3BU4A 4WP5A 3HX8A 3DGYA 3IPTA 1WQLB 4NHFA 1LXEA 3F7SA 3BNDA 1Z1SA 3S27A 5ELUA 2CX1A 4XM4A 4EC6A 3I0YA 3LTDA 1RMSA 5JPUA 1YGWA 4KZ1A 3Q1CA 1IVUA 3WHOA 1NB3I 5G2GA 4GL6A 5ELJA 2BHMA 2BT3A 3PXMA 1KSIA 3F8XA 2GBXB 1W2ZA 1W4NA 3B4OA 3EN8A 3IMAB 1LOXA 2BO9B 5I97A 2F5WA 2H0GA 4N3VA 4HBRA 7GSPA 5IEPA 3G8ZA 3QRDA 5GSPA 3SXXA 1I0XA 1MWSA 4HKVB 3CD63 4G1MB 1W6YA 1YVSA 3WA3A 1OF5B 2CFKA 4FMBA
chains in the Genus database with same CATH topology
4IPBA 4NREA 3NQZA 2ZDJA 3JUOA 1O7WB 3CCM3 1FGOA 2XRXB 1DYUA 1M9GA 3G16A 2PZVA 4AEQA 1GS3A 5JBSA 1FGTA 3NXJA 1IVVA 2HMMB 2R4IA 1GY5A 2ML5A 1A67A 4XBTA 1US1A 1ROAA 1RJOA 3AMOB 1W5ZA 3DGLA 4L8OA 1MOLA 2Y74A 2GEYA 2CFWA 3ROBA 1STFI 1EKMA 4LSOA 7STDA 1OHOA 2FGTA 2D42A 2XGLA 3BNEA 1OHSA 1D6ZA 4N6TA 1N9EA 1WNHA 1O7MB 5AEWB 1FA3A 1VZZA 2UX0A 3MG2A 4N6V0 1JB2A 1K41A 3WOFB 4EV2A 3NQYA 5STDA 1BUQA 1CQSA 2SBLA 5CF2A 1O7GB 1KWIA 2CK3H 3GZBA 1VQ63 1C7HA 2HMKB 1A2VA 2E2VA 2HMNB 4AKYA 5IENA 3B7CA 4O3VA 1S723 3AMOA 3A76A 3Q2PA 1N8QA 3NM2A 1TU5A 3CXC2 3F14A 3OWYA 4N6OB 1YHQ3 1RRLA 3F40A 3G4S3 3FCSB 4H61A 1ZO2A 1OGXA 3SLUA 4MMYB 3J7Yd 4RBNA 2CWTA 2LQVA 3CCV3 1VQ53 8CHOA 3DXOA 5IG5A 2FXTA 3BLZA 4RZMA 3CCJ3 3LOYA 5IEOA 3FG4A 3T8NA 3EHCA 2Z7AA 3NBRA 3EC9A 5EQLA 3LT9A 3PZWA 3WDGB 1IU7A 4KVHA 4K90B 1WMOA 3CNXA 4CDLA 1Y4KA 2OOVC 2BMQB 1TFOA 3QK9A 1SQWA 2XFTA 4HM2B 1IDPA 2L4VA 1D6UA 1NJI4 2M7OA 2HMLB 2WGOA 2GEXA 3LZAA 4HZ9B 4ORLA 3B4PA 1OACA 1EG9B 1Q40A 1VQM3 1JKGB 4HM7B 1VQO3 4K1VA 5KP4A 3RGAA 2BMOB 2CW9A 2CFLA 3X3ZA 4HM4B 2ML6A 4GB5A 4LEHA 3K9MC 5BVBA 4LZIA 1J2BA 2P0MA 3LTAA 2CFGA 2CIUA 1E3RA 1HU9A 1IV7A 5DREA 4BTXA 3UJMA 1NWWA 3N54B 4MEIA 2B24B 3TDGA 4TX4A 1W6CA 3X42A 1IVWA 4WYKA 1M904 1NDOB 1RN7A 3KE7A 1K9M4 3E99A 3H3HA 1JB4A 2W2CA 3JUNA 4EBGA 1OHPA 3MPHA 6STDA 1RRHA 1SPUA 2W0QA 1N5PA 1YIT3 1YI23 1RKYA 1O7HB 2A15A 4HM1B 3K63A 2CG0A 4MMZB 2WOFA 1W01A 3I563 1YGEA 4OUQA 3K5TA 3WODG 3S28A 2RSXA 1SIHA 3D3LA 3FLJA 5FGOA 4R4KA 2RGQA 3LTCA 3N9HA 1SIIA 4FCZA 5CLKA 2IUKA 3OWSA 4MMXB 1QAFA 3OX9A 1AVLA 1OCVA 1UI8A 3S29A 2Z77A 3VF1A 5IF6A 2I9WA 3O8YA 5CXOA 5KP3A 5CK6A 3DUKA 4EYCA 2QGUA 3SOYA 3FZWA 1Q864 3EJVA 3NBBA 1EA2A 1GD4A 3G0KA 2JDIH 2MF7A 2FNQA 3I553 2E2TA 3FF0A 4FMDA 1QALA 2KCDA 2W03A 2CH9A 3HK4A 3UL6A 1YVBI 3WMDA 2K0MA 3WOEB 4XDVA 4WWUC 5CF1A 3FG1A 3GZYB 1VQN3 4FCMA 1IV9A 5FW5A 1OF5A 2QEX3 1DVDA 2C10A 1VQ43 4HM5B 1GYBA 3CMA3 5AI1A 2RFRA 1UUVB 1FGRA 4HYZA 1IVXA 1KQS2 1VQP3 2INXA 3G713 3HZPA 4IT7A 4K61A 1T5YA 3NV0A 1IQ8A 1HKXA 2CFDA 4R1KA 5IERA 1D6YA 2O9UX 4JRFA 3EBYA 3G6E3 2C11A 4HM0B 3CCU3 3KKGA 1AV4A 1M1K4 4EXRA 5DRVA 3T0UA 4R9KA 5IG0A 1CYUA 2XF3A 3GAXA 1UUWB 1YJW3 4AKZA 1AR0A 3ECFA 2CKFB 1E3VA 3U97A 2F98A 3LMLA 5KP1A 3LH4A 1IQYA 1JB5A 3KSPA 1IQXA 3FSDA 5IW9A 3PGBA 5AYRB 3UNLA 1JV2B 5IG3A 5AYSC 2OOVA 4N6MA 1R4CA 2XFSA 1FUWA 2W6JH 4FMAA 5LC6A 1IT8A 2GXFA 2YFLB 3ER7A 3JUMA 4J8TA 1ROVA 1Q7Y4 3LTBA 1DMMA 1OPYA 2WOHA 3EN1B 2HMOB 3UB1A 3F8HA 1QAKA 3H51A 2OCTA 4OVMA 4U13A 3DY5A 3X3XA 4XDWA 3CC23 5AIIA 3MYTA 3CC43 1SJWA 2XSHB 4HM3B 1E97A 3BNCA 5AIFA 1L5GB 2MC8A 3EQQB 1GD3A 1KD14 3MWZA 4XB5A 1JN5B 3PYJA 4LMIA 1VQL3 4HM6B 2CWVA 2HMJB 2CC3A 4RNYA 3SEDA 3BB9A 1U5OA 3MG1A 4ZM8A 1TIJA 1NU3A 5TGNA 2P0XA 2XGNA 4N6NB 5JPPA 2XR8B 1DMNA 2Q07A 3IJEB 1NO3A 1Q40B 4QWTA 3CCR3 1W6GA 1JKGA 1NB5I 5A0OB 3CCQ3 4CCVA 4IIAA 3LYGA 3BNBA 3KFQC 1O7PB 3JUPA 1OGZA 2QA43 4XBXA 3F7XA 3EF8A 4KFEA 3X3YA 1TFKA 1F8NA 2P38A 4X2HA 1A2KA 1TUHA 3CCS3 3SX1A 3NBJA 2YFIB 1QMAA 4RNZA 1ISKA 3HI7A 3EB8A 1JN5A 1ULIB 1UI7A 3CME3 1YJ93 3Q90A 4JF8A 2IMJA 3GZRA 2W04A 3CCE3 2F99A 1YJN3 1WMNA 3K0ZA 2CWUA 3STDA 3NV0B 4FCJA 2P09A 2CHCA 3NHXA 1V74A 3KZTA 1QVG2 3NX0A 3RGRA 1PU4A 3JUQA 4I4KA 3X41A 4N6LA 2XH9A 2YX9A 3OWUA 1M1XB 2OWPA 2XEPA 1W2B2 2Z6BA 3CNMA 3CCL3 1VQ93 1N8R4 1G96A 1W00A 1FGMA 1Q42A 5EEOA 2IA7A 2GU3A 4XBYA 5D81A 2LYXA 1OH0A 5AIHA 3S67A 3GWRA 3KN4A 3PCSA 4LGQA 2OTL3 1FGQA 4WHAA 3RDEA 2K54A 2D1WA 3D9RA 3V99A 3DGMA 1JNQA 3DMCA 3MKIA 2PNCA 3KIIA 2KRTA 3EBTA 4WYKB 3PS8A 1AVKA 3MSOA 4HJLB 4HVNA 3EE1A 2E2UA 1CYVA 1K8A4 3HIIA 1JRQA 5D82A 2XSOB 3FH1A 3CPOA 1VQ83 3L0RA 3VSYA 4KFFA 4BTWA 2GBWB 3X40A 2GU1A 2JQ5A 2STDA 4L7KA 1DMQA 1LNHA 1OUNA 4J9AA 1GY6A 4R80A 2YFJB 2BMRB 3F9SA 3V98A 3KSED 4BTYA 1N5HA 1ULJB 1KC84 1WMPA 2CG1A 2WGQA 1PFPA 3T8UA 3OXAA 4Q53A 3JVCA 1VQ73 3DGNA 1GY7A 1ASKA 3SVAA 5D83A 1W02A 3NM7A 3DGOA 3DM8A 4K1UA 1Q814 4H3UA 1TP6A 4X2OA 1N9JA 4OK0A 2BNGA 2OQEC 5AIGA 1UW1A 3ALAA 4L8PA 1IK3A 1JJ22 1WTHA 1K28A 1MNLA 1YIJ3 3V92A 4HM8B 4O2HA 2O3OA 1A90A 5IG4A 1DVCA 2F86B 3EX9A 3LT8A 3MG3A 4STDA 4WFOA 1Q824 2OQEA 5EVHA 2W56A 3UL5A 5HGRA 3CC73 4N6UA 4MJDA 2QIYA 4HZBB 1QJGA 2KXGA 2V1LA 3HIGA 3OW22 3S5CA 3CPW2 5AEUB 1VQK3 2P05A 4O8SA 2WO0A 4FMCA 3FGYA 2ZL8A 3LXUX 3U1WA 3VGNA 2W9QA 4KFDA 3OV4A 1S5AA 2IUJA 2RCDA 1EQKA 4PEJA 3FKAA 2Y73A 1LVNA 5LC7A 3FF2A 1W7CA 1IT7A 3GZXB 3M8CA 2Z76A 1QVF2 3K7CA 3NUVA 3MHEA 2B1XB 3PCRA 1ZX2A 5BXQA 2W9PA 4EV5A 2OTJ3 3FG3A 1U8CB 1CEWI 3DZLA 3GRDA 3WA2X 1K734 4FR9A 3N8BA 3CU3A 3SOAA 4R9LA 1O7NB 2W56B 3B8LA 1STDA 4WP5A 3HX8A 3IPTA 1WQLB 4NHFA 1LXEA 3F7SA 3BNDA 1Z1SA 3S27A 5ELUA 4XM4A 4EC6A 3I0YA 3LTDA 5JPUA 4KZ1A 3Q1CA 1IVUA 1NB3I 5G2GA 4GL6A 5ELJA 2BHMA 2BT3A 3PXMA 1KSIA 3F8XA 2GBXB 1W2ZA 1W4NA 3B4OA 3EN8A 3IMAB 1LOXA 2BO9B 5I97A 4N3VA 5IEPA 4HBRA 3G8ZA 3QRDA 3SXXA 4HKVB 3CD63 4G1MB 1W6YA 4O02B 3WA3A 1OF5B 2CFKA 4FMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H51 A;  2JQ5 A;  2STD A;  3JUO A;  4L7K A;  4WYK A;  1O7W B;  1NDO B;  1DMQ A;  3KE7 A;  4OVM A;  3F8H A;  2XRX B;  4U13 A;  1OUN A;  2PZV A;  3E99 A;  1JB4 A;  2W2C A;  1GY6 A;  3G16 A;  1OHP A;  1GS3 A;  3H3H A;  3JUN A;  4J9A A;  6STD A;  4XDW A;  3NXJ A;  2YFJ B;  2BMR B;  2HMM B;  1GY5 A;  2R4I A;  3F9S A;  5AII A;  1O7H B;  2A15 A;  4HM1 B;  3MYT A;  1ULJ B;  1SJW A;  4XBT A;  1W01 A;  2XSH B;  4HM3 B;  1E97 A;  4OUQ A;  5AIF A;  3T8U A;  3EQQ B;  3OXA A;  4Q53 A;  4L8O A;  1JN5 B;  4LMI A;  4XB5 A;  2GEY A;  4HM6 B;  1GY7 A;  1ASK A;  3FLJ A;  3ROB A;  2RGQ A;  2HMJ B;  5D83 A;  1W02 A;  7STD A;  3SED A;  1OHO A;  3DM8 A;  3BB9 A;  4H3U A;  4K1U A;  1TP6 A;  3OWS A;  4X2O A;  5CLK A;  1U5O A;  3OX9 A;  2BNG A;  5AIG A;  3MG1 A;  1OCV A;  1OHS A;  2Z77 A;  5IF6 A;  1NU3 A;  2I9W A;  5CXO A;  5KP3 A;  5TGN A;  5CK6 A;  3DUK A;  5JPP A;  2XR8 B;  1DMN A;  4L8P A;  5AEW B;  2QGU A;  1O7M B;  3SOY A;  3FZW A;  1Q40 B;  1VZZ A;  3EJV A;  1JKG A;  2UX0 A;  3MG2 A;  1EA2 A;  1JB2 A;  1K41 A;  3G0K A;  4HM8 B;  3LYG A;  4IIA A;  5STD A;  1BUQ A;  1CQS A;  5CF2 A;  5IG4 A;  1O7G B;  2F86 B;  3EX9 A;  3FF0 A;  1O7P B;  3GZB A;  3MG3 A;  4STD A;  3JUP A;  1OGZ A;  5EVH A;  4XBX A;  1C7H A;  3HK4 A;  3F7X A;  2HMK B;  5HGR A;  3WMD A;  3EF8 A;  4MJD A;  2QIY A;  4HZB B;  1QJG A;  1A2K A;  1TUH A;  4WWU C;  4X2H A;  4XDV A;  5CF1 A;  3S5C A;  3GZY B;  4FCM A;  2YFI B;  5FW5 A;  1OF5 A;  2HMN B;  1QMA A;  5AEU B;  3B7C A;  5IEN A;  1ISK A;  3A76 A;  3FGY A;  4HM5 B;  1GYB A;  3NM2 A;  3F14 A;  1JN5 A;  3VGN A;  1ULI B;  3OWY A;  2RFR A;  5AI1 A;  3Q90 A;  3F40 A;  2IMJ A;  3GZR A;  1UUV B;  1S5A A;  3OV4 A;  2RCD A;  1ZO2 A;  1OGX A;  4PEJ A;  2F99 A;  3FKA A;  3K0Z A;  2INX A;  3STD A;  3HZP A;  3NV0 B;  4FCJ A;  2CHC A;  3NHX A;  3FF2 A;  3KZT A;  3GZX B;  3M8C A;  3RGR A;  2Z76 A;  3K7C A;  3NUV A;  3JUQ A;  4I4K A;  3MHE A;  3NV0 A;  3DXO A;  8CHO A;  2B1X B;  5IG5 A;  3BLZ A;  1HKX A;  1ZX2 A;  3OWU A;  2OWP A;  4RZM A;  5BXQ A;  4R1K A;  5IEO A;  5IER A;  3T8N A;  3GRD A;  3DZL A;  3EBY A;  3EHC A;  2Z7A A;  3CNM A;  3NBR A;  3EC9 A;  4HM0 B;  3KKG A;  1W00 A;  3CU3 A;  5DRV A;  4KVH A;  4R9K A;  4R9L A;  1Q42 A;  1O7N B;  3B8L A;  3SOA A;  1STD A;  5IG0 A;  4XBY A;  3CNX A;  3HX8 A;  3IPT A;  4WP5 A;  5D81 A;  4CDL A;  1WQL B;  2BMQ B;  1OH0 A;  1UUW B;  3F7S A;  4HM2 B;  1AR0 A;  1IDP A;  5AIH A;  3ECF A;  2CKF B;  1Z1S A;  3GWR A;  4LGQ A;  1E3V A;  4XM4 A;  2F98 A;  2HML B;  3LZA A;  2GEX A;  4HZ9 B;  2K54 A;  5KP1 A;  3D9R A;  3I0Y A;  4ORL A;  3B4P A;  1JB5 A;  1EG9 B;  1Q40 A;  5JPU A;  3DMC A;  3KSP A;  3FSD A;  1JKG B;  3MKI A;  4HM7 B;  5G2G A;  3EBT A;  4K1V A;  3RGA A;  5KP4 A;  2BMO B;  4WYK B;  3UNL A;  5IG3 A;  3MSO A;  4HM4 B;  4GB5 A;  4HJL B;  4HVN A;  4LEH A;  5BVB A;  3F8X A;  2GBX B;  5D82 A;  2XSO B;  3B4O A;  3EN8 A;  3JUM A;  2GXF A;  2YFL B;  3ER7 A;  4J8T A;  3FH1 A;  1E3R A;  4N3V A;  5IEP A;  1DMM A;  1OPY A;  3CPO A;  3G8Z A;  5DRE A;  3EN1 B;  4HKV B;  3UJM A;  1NWW A;  2HMO B;  1W6Y A;  3VSY A;  2B24 B;  1OF5 B;  2GBW B; 
#chains in the Genus database with same CATH topology
 1T2H A;  4IPB A;  4NRE A;  3NQZ A;  1A2P A;  2ZDJ A;  3JUO A;  1O7W B;  3CCM 3;  1FGO A;  2XRX B;  1DYU A;  1M9G A;  3G16 A;  2PZV A;  4AEQ A;  1GS3 A;  5JBS A;  1BVI A;  1HYF A;  1FGT A;  3NXJ A;  1IVV A;  2HMM B;  2R4I A;  1B2X A;  1GY5 A;  1RDS A;  2ML5 A;  5BU4 A;  1A67 A;  4XBT A;  1TRP A;  1US1 A;  1BSE A;  1ROA A;  1RJO A;  3AMO B;  1W5Z A;  3DGL A;  4L8O A;  1AQZ A;  1GOU A;  1MOL A;  2GEY A;  2Y74 A;  2CFW A;  1HZ1 A;  3ROB A;  1STF I;  1EKM A;  4LSO A;  7STD A;  1OHO A;  1B3S A;  1BSA A;  2FGT A;  2D42 A;  2XGL A;  4GSP A;  3BNE A;  1OHS A;  1D6Z A;  1LRA A;  4N6T A;  1MGR A;  1N9E A;  1WNH A;  1O7M B;  5AEW B;  1FA3 A;  1VZZ A;  2UX0 A;  3MG2 A;  4N6V 0;  1JB2 A;  1K41 A;  1UGH I;  3WOF B;  6RNT A;  4EV2 A;  3D79 A;  3NQY A;  5STD A;  1BUQ A;  1CQS A;  2SBL A;  5CF2 A;  1O7G B;  1KWI A;  2CK3 H;  3GZB A;  1TTO A;  1VQ6 3;  2RBI A;  1C7H A;  1RLS A;  2HMK B;  4KT3 B;  1IYY A;  1B21 A;  1A2V A;  1G02 A;  1RN1 A;  1RNB A;  2E2V A;  2HMN B;  4AKY A;  5IEN A;  3B7C A;  4ILF A;  4O3V A;  1S72 3;  3AMO A;  3A76 A;  3Q2P A;  1N8Q A;  1V57 A;  3NM2 A;  1TU5 A;  3F14 A;  3CXC 2;  1CH0 A;  3OWY A;  4N6O B;  1YHQ 3;  1RGA A;  1RRL A;  3F40 A;  3FCS B;  5M1A A;  1RNT A;  2H0H A;  3G4S 3;  4H61 A;  1BGS A;  1OGX A;  1ZO2 A;  1EEJ A;  2AAD A;  3SLU A;  4MMY B;  4RNT A;  3J7Y d;  1JBT A;  1AY7 A;  4RBN A;  2CWT A;  2LQV A;  3CCV 3;  1BU4 A;  1VQ5 3;  1BRG A;  8CHO A;  3DXO A;  5IG5 A;  2FXT A;  3BLZ A;  2SAR A;  1NNV A;  1LOV A;  4RZM A;  3LOY A;  1MWU A;  5IEO A;  3CCJ 3;  3FG4 A;  3T8N A;  3EHC A;  2Z7A A;  3NBR A;  4HAA A;  1RSN A;  3EC9 A;  5EQL A;  3LT9 A;  3PZW A;  1FUT A;  1GMR A;  1IU7 A;  1BAN A;  4KVH A;  3WDG B;  1BRI A;  4K90 B;  1WMO A;  3CNX A;  1G0T A;  4CDL A;  1Y4K A;  2OOV C;  4LYL B;  2BMQ B;  1TFO A;  3QK9 A;  1SQW A;  2XFT A;  4HM2 B;  1IDP A;  2L4V A;  5G1K A;  1D6U A;  3Q3F A;  1NJI 4;  2M7O A;  2HML B;  2WGO A;  2GEX A;  3LZA A;  4HZ9 B;  1B2M A;  4ORL A;  3B4P A;  1OAC A;  1EG9 B;  1Q40 A;  1VQM 3;  1B2Z A;  1JKG B;  1GSP A;  4HM7 B;  1VQO 3;  4K1V A;  2HOH A;  3RGA A;  5KP4 A;  2BMO B;  2CW9 A;  2CFL A;  3X3Z A;  4HM4 B;  2ML6 A;  4GB5 A;  4LEH A;  3K9M C;  5BVB A;  4LZI A;  4I5Q A;  3GSP A;  1J2B A;  1UUG B;  2P0M A;  3LTA A;  5HOH A;  2CFG A;  2CIU A;  1RGC A;  2C4B A;  1E3R A;  1HU9 A;  1IV7 A;  5DRE A;  1MWT A;  4BTX A;  5M18 A;  2J8X B;  3UJM A;  1NWW A;  3N54 B;  4MEI A;  3D4A A;  2B24 B;  1FZU A;  3TDG A;  4TX4 A;  1Q7H A;  1RCL A;  1W6C A;  3X42 A;  1IVW A;  4WYK A;  1M90 4;  1NDO B;  1RN7 A;  3KE7 A;  2KF6 A;  1BSC A;  1K9M 4;  1I8V A;  2K3D A;  3E99 A;  1JB4 A;  2W2C A;  3H3H A;  3JUN A;  1OHP A;  3MPH A;  4EBG A;  1RRH A;  6STD A;  1SPU A;  1TJD A;  2W0Q A;  1N5P A;  2RNT A;  1YIT 3;  1YI2 3;  1RKY A;  1O7H B;  2A15 A;  4HM1 B;  3K63 A;  3AHW A;  3ZFZ A;  2CG0 A;  3AGN A;  2WOF A;  1LOY A;  1W01 A;  4MMZ B;  3I56 3;  1YGE A;  2GSP A;  3AGO A;  3K5T A;  4OUQ A;  1RTU A;  3WOD G;  3S28 A;  3AHS A;  2RSX A;  1R4Y A;  1SIH A;  1LOW A;  3D3L A;  3FLJ A;  4R4K A;  2RGQ A;  3LTC A;  3N9H A;  5FGO A;  1ZGX A;  1SII A;  4FCZ A;  5CLK A;  2IUK A;  3OWS A;  4MMX B;  1QAF A;  1RCK A;  3OX9 A;  5M19 A;  1AVL A;  1LQG C;  1OCV A;  1UI8 A;  3S29 A;  2Z77 A;  3VF1 A;  5IF6 A;  2I9W A;  3O8Y A;  5CXO A;  5KP3 A;  5CK6 A;  3DUK A;  4EYC A;  2QGU A;  1B20 A;  3SOY A;  3FZW A;  1PYL A;  1Q86 4;  3EJV A;  1LQM B;  1BNR A;  3NBB A;  1EA2 A;  1GD4 A;  3G0K A;  2JDI H;  2MF7 A;  1X1W A;  4GHO A;  2FNQ A;  3I55 3;  1UCJ A;  2E2T A;  1V58 A;  3FF0 A;  4CPK A;  4FMD A;  1BIR A;  1QAL A;  2KCD A;  2CH9 A;  2W03 A;  3HK4 A;  1B2U A;  1YVB I;  3UL6 A;  3WMD A;  2K0M A;  3WOE B;  4XDV A;  4WWU C;  5CF1 A;  3FG1 A;  3GZY B;  1VQN 3;  4FCM A;  1IV9 A;  5FW5 A;  1OF5 A;  1BNI A;  2QEX 3;  1DVD A;  1I3I A;  2C10 A;  1JBS A;  1VQ4 3;  4HM5 B;  1GYB A;  1MWR A;  1RGF A;  3CMA 3;  5AI1 A;  2RFR A;  1BRN L;  1UUV B;  1FGR A;  1GMQ A;  4HYZ A;  1IVX A;  1KQS 2;  1VQP 3;  2INX A;  3G71 3;  3HZP A;  4IT7 A;  4K61 A;  5G1L A;  1T5Y A;  3NV0 A;  1IQ8 A;  1HKX A;  2R41 A;  2CFD A;  4R1K A;  5IER A;  1D6Y A;  2O9U X;  1RGE A;  4DKI A;  4JRF A;  3EBY A;  4BL2 A;  2C11 A;  3G6E 3;  4HM0 B;  3CCU 3;  3KKG A;  1AV4 A;  1BSB A;  4EXR A;  1M1K 4;  5DRV A;  3T0U A;  4R9K A;  1BNF A;  5IG0 A;  1CYU A;  1RN4 A;  2BIR A;  2XF3 A;  3GAX A;  1UUW B;  4BIR A;  4AKZ A;  1YJW 3;  1AR0 A;  3ECF A;  1BSD A;  2CKF B;  1E3V A;  3U97 A;  2F98 A;  3LML A;  5KP1 A;  3LH4 A;  1UCI A;  1IQY A;  1JB5 A;  1I0V A;  3KSP A;  1IQX A;  3FSD A;  5IW9 A;  3HOH A;  1LNI A;  3PGB A;  5AYR B;  3UNL A;  1JV2 B;  5IG3 A;  5AYS C;  2OOV A;  4N6M A;  1R4C A;  2XFS A;  2IY2 A;  1FUW A;  1PY3 A;  2W6J H;  4FMA A;  5LC6 A;  1IT8 A;  2GXF A;  2YFL B;  3ER7 A;  3JUM A;  4J8T A;  1ROV A;  1Q7Y 4;  3LTB A;  1BOX A;  1DMM A;  1OPY A;  2WOH A;  3EN1 B;  2HMO B;  2KF4 A;  1BNS A;  1X1U A;  2ZHX B;  3UB1 A;  3F8H A;  1QAK A;  1JBR A;  3RNT A;  3H51 A;  4J5G A;  2OCT A;  4OVM A;  1GOY A;  4U13 A;  3DY5 A;  3X3X A;  1YNV X;  2F4Y A;  1BRK A;  4XDW A;  3CC2 3;  5AII A;  7RNT A;  1I2G A;  3MYT A;  3CC4 3;  3KCH A;  1SJW A;  2XSH B;  4HM3 B;  1E97 A;  3BNC A;  5AIF A;  1L5G B;  2MC8 A;  3EQQ B;  1GD3 A;  1KD1 4;  3MWZ A;  4XB5 A;  1JN5 B;  3PYJ A;  4LMI A;  1VQL 3;  4HM6 B;  1I70 A;  2F56 A;  2H0I A;  2CWV A;  2HMJ B;  2CC3 A;  2KAA A;  4RNY A;  3SED A;  3BB9 A;  1BUJ A;  1EUI C;  1U5O A;  1DE3 A;  2UUG C;  3MG1 A;  4ZM8 A;  1TIJ A;  1NU3 A;  5TGN A;  2P0X A;  2XGN A;  4N6N B;  1DET A;  5JPP A;  2XR8 B;  1DMN A;  2Q07 A;  3IJE B;  6GSP A;  1BAO A;  1NO3 A;  1Q40 B;  4QWT A;  3CCR 3;  1W6G A;  1JKG A;  1NB5 I;  5A0O B;  4HOH A;  3CCQ 3;  4CCV A;  4IIA A;  3LYG A;  1BRS A;  1I2E A;  3BNB A;  1X1X A;  3KFQ C;  1O7P B;  3JUP A;  1OGZ A;  1BRH A;  2QA4 3;  4XBX A;  3F7X A;  9RNT A;  1T3B A;  3EF8 A;  4KFE A;  3X3Y A;  1TFK A;  1F8N A;  2P38 A;  4X2H A;  1A2K A;  1TUH A;  3CCS 3;  3SX1 A;  3NBJ A;  2YFI B;  1QMA A;  1FYS A;  4RNZ A;  1ISK A;  3HI7 A;  3D5I A;  3EB8 A;  1JN5 A;  1ULI B;  2KF3 A;  1UI7 A;  3CME 3;  1YJ9 3;  3Q90 A;  4JF8 A;  2IYJ A;  4CJN A;  2IMJ A;  3GZR A;  2W04 A;  3CCE 3;  1I2F A;  2F99 A;  1YJN 3;  1WMN A;  3K0Z A;  2CWU A;  2ZA4 A;  3STD A;  3NV0 B;  4FCJ A;  2P09 A;  2CHC A;  3NHX A;  1V74 A;  3KZT A;  1QVG 2;  3NX0 A;  3RGR A;  1PU4 A;  4J5K A;  3JUQ A;  4I4K A;  3X41 A;  4N6L A;  2XH9 A;  2YX9 A;  3OWU A;  1M1X B;  2OWP A;  2XEP A;  1W2B 2;  2Z6B A;  3CNM A;  3CCL 3;  1VQ9 3;  1N8R 4;  1UGI A;  1G96 A;  1W00 A;  1FGM A;  1Q42 A;  5EEO A;  1FW7 A;  2IA7 A;  2GU3 A;  1I3F A;  4XBY A;  5D81 A;  2LYX A;  1SAR A;  1OH0 A;  1UCK A;  5AIH A;  3S67 A;  3GWR A;  2CX0 A;  3KN4 A;  3PCS A;  4LGQ A;  1FGQ A;  4WHA A;  4EW5 A;  2OTL 3;  3RDE A;  2K54 A;  2D1W A;  3D9R A;  3V99 A;  3DGM A;  3WR2 A;  5BIR A;  1JNQ A;  3DMC A;  3MKI A;  2PNC A;  3KII A;  1BRJ A;  2KRT A;  3EBT A;  1RHL A;  4WYK B;  3PS8 A;  1B27 A;  1AVK A;  3MSO A;  4HJL B;  4HVN A;  3EE1 A;  2E2U A;  1CYV A;  1K8A 4;  3HII A;  1JRQ A;  5D82 A;  2XSO B;  3DH2 A;  4O02 B;  3ZG0 A;  4BL3 A;  1JZD A;  3FH1 A;  2UGI A;  3CPO A;  1VQ8 3;  3L0R A;  3VSY A;  4KFF A;  1FUS A;  4BTW A;  2GBW B;  3X40 A;  2GU1 A;  2JQ5 A;  2STD A;  4L7K A;  2L1S A;  1DMQ A;  1B2S A;  1LNH A;  1OUN A;  4J9A A;  1GY6 A;  4R80 A;  1ZS7 A;  2YFJ B;  2BMR B;  3F9S A;  3V98 A;  3KSE D;  4BTY A;  1N5H A;  1ULJ B;  1KC8 4;  1WMP A;  2CG1 A;  2WGQ A;  1PFP A;  3T8U A;  3BIR A;  3OXA A;  4Q53 A;  3JVC A;  1VQ7 3;  3DGN A;  1GMP A;  1GY7 A;  1ASK A;  3SVA A;  5D83 A;  1W02 A;  3NM7 A;  3DGO A;  4NPB A;  3DM8 A;  4K1U A;  1Q81 4;  4H3U A;  1TP6 A;  4X2O A;  1N9J A;  4OK0 A;  2BNG A;  2OQE C;  5AIG A;  1UW1 A;  3D5G A;  3ALA A;  4L8P A;  1IK3 A;  1JJ2 2;  1Q9E A;  1VQQ A;  1WTH A;  1K28 A;  1MNL A;  1YIJ 3;  3V92 A;  8RNT A;  4HM8 B;  4O2H A;  2O3O A;  1A90 A;  5IG4 A;  1DVC A;  2F86 B;  3EX9 A;  1T2I A;  3LT8 A;  3MG3 A;  4STD A;  4WFO A;  1Q82 4;  2OQE A;  5EVH A;  1C54 A;  2W56 A;  1BNE A;  3UL5 A;  5HGR A;  3CC7 3;  4N6U A;  1RGH A;  4MJD A;  2QIY A;  4HZB B;  1QJG A;  2KXG A;  2V1L A;  1JZO A;  3HIG A;  3S5C A;  3CPW 2;  3OW2 2;  2F5M A;  5AEU B;  1VQK 3;  3URP A;  2P05 A;  4O8S A;  2WO0 A;  4FMC A;  3FGY A;  2ZL8 A;  3LXU X;  3U1W A;  3VGN A;  1RGG A;  1X1Y A;  2W9Q A;  4KFD A;  3OV4 A;  5RNT A;  1S5A A;  2IUJ A;  2RCD A;  1EQK A;  4PEJ A;  3SYU A;  3FKA A;  1BNJ A;  2AAE A;  2KF5 A;  2Y73 A;  1LVN A;  5LC7 A;  3FF2 A;  1W7C A;  1MGW A;  1IT7 A;  3GZX B;  3M8C A;  2Z76 A;  1QVF 2;  3K7C A;  3NUV A;  1GOV A;  3MHE A;  1UCL A;  2B1X B;  3PCR A;  1ZX2 A;  5BXQ A;  2W9P A;  4EV5 A;  2OTJ 3;  3FG3 A;  1UDI I;  1U8C B;  1CEW I;  1BNG A;  3DZL A;  2BU4 A;  3GRD A;  3WA2 X;  3ZG5 A;  1K73 4;  3A5E A;  4FR9 A;  3N8B A;  4BU4 A;  1TRQ A;  3CU3 A;  3SOA A;  1RGK A;  4R9L A;  1O7N B;  2W56 B;  3B8L A;  1RGL A;  1STD A;  3BU4 A;  4WP5 A;  3HX8 A;  3DGY A;  3IPT A;  1WQL B;  4NHF A;  1LXE A;  3F7S A;  3BND A;  1Z1S A;  3S27 A;  5ELU A;  2CX1 A;  4XM4 A;  4EC6 A;  3I0Y A;  3LTD A;  1RMS A;  5JPU A;  1YGW A;  4KZ1 A;  3Q1C A;  1IVU A;  3WHO A;  1NB3 I;  5G2G A;  4GL6 A;  5ELJ A;  2BHM A;  2BT3 A;  3PXM A;  1KSI A;  3F8X A;  2GBX B;  1W2Z A;  1W4N A;  3B4O A;  3EN8 A;  3IMA B;  1LOX A;  2BO9 B;  5I97 A;  2F5W A;  2H0G A;  4N3V A;  4HBR A;  7GSP A;  5IEP A;  3G8Z A;  3QRD A;  5GSP A;  3SXX A;  1I0X A;  1MWS A;  4HKV B;  3CD6 3;  4G1M B;  1W6Y A;  1YVS A;  3WA3 A;  1OF5 B;  2CFK A;  4FMB A; 
#chains in the Genus database with same CATH homology
 4IPB A;  4NRE A;  3NQZ A;  2ZDJ A;  3JUO A;  1O7W B;  3CCM 3;  1FGO A;  2XRX B;  1DYU A;  1M9G A;  3G16 A;  2PZV A;  4AEQ A;  1GS3 A;  5JBS A;  1FGT A;  3NXJ A;  1IVV A;  2HMM B;  2R4I A;  1GY5 A;  2ML5 A;  1A67 A;  4XBT A;  1US1 A;  1ROA A;  1RJO A;  3AMO B;  1W5Z A;  3DGL A;  4L8O A;  1MOL A;  2Y74 A;  2GEY A;  2CFW A;  3ROB A;  1STF I;  1EKM A;  4LSO A;  7STD A;  1OHO A;  2FGT A;  2D42 A;  2XGL A;  3BNE A;  1OHS A;  1D6Z A;  4N6T A;  1N9E A;  1WNH A;  1O7M B;  5AEW B;  1FA3 A;  1VZZ A;  2UX0 A;  3MG2 A;  4N6V 0;  1JB2 A;  1K41 A;  3WOF B;  4EV2 A;  3NQY A;  5STD A;  1BUQ A;  1CQS A;  2SBL A;  5CF2 A;  1O7G B;  1KWI A;  2CK3 H;  3GZB A;  1VQ6 3;  1C7H A;  2HMK B;  1A2V A;  2E2V A;  2HMN B;  4AKY A;  5IEN A;  3B7C A;  4O3V A;  1S72 3;  3AMO A;  3A76 A;  3Q2P A;  1N8Q A;  3NM2 A;  1TU5 A;  3CXC 2;  3F14 A;  3OWY A;  4N6O B;  1YHQ 3;  1RRL A;  3F40 A;  3G4S 3;  3FCS B;  4H61 A;  1ZO2 A;  1OGX A;  3SLU A;  4MMY B;  3J7Y d;  4RBN A;  2CWT A;  2LQV A;  3CCV 3;  1VQ5 3;  8CHO A;  3DXO A;  5IG5 A;  2FXT A;  3BLZ A;  4RZM A;  3CCJ 3;  3LOY A;  5IEO A;  3FG4 A;  3T8N A;  3EHC A;  2Z7A A;  3NBR A;  3EC9 A;  5EQL A;  3LT9 A;  3PZW A;  3WDG B;  1IU7 A;  4KVH A;  4K90 B;  1WMO A;  3CNX A;  4CDL A;  1Y4K A;  2OOV C;  2BMQ B;  1TFO A;  3QK9 A;  1SQW A;  2XFT A;  4HM2 B;  1IDP A;  2L4V A;  1D6U A;  1NJI 4;  2M7O A;  2HML B;  2WGO A;  2GEX A;  3LZA A;  4HZ9 B;  4ORL A;  3B4P A;  1OAC A;  1EG9 B;  1Q40 A;  1VQM 3;  1JKG B;  4HM7 B;  1VQO 3;  4K1V A;  5KP4 A;  3RGA A;  2BMO B;  2CW9 A;  2CFL A;  3X3Z A;  4HM4 B;  2ML6 A;  4GB5 A;  4LEH A;  3K9M C;  5BVB A;  4LZI A;  1J2B A;  2P0M A;  3LTA A;  2CFG A;  2CIU A;  1E3R A;  1HU9 A;  1IV7 A;  5DRE A;  4BTX A;  3UJM A;  1NWW A;  3N54 B;  4MEI A;  2B24 B;  3TDG A;  4TX4 A;  1W6C A;  3X42 A;  1IVW A;  4WYK A;  1M90 4;  1NDO B;  1RN7 A;  3KE7 A;  1K9M 4;  3E99 A;  3H3H A;  1JB4 A;  2W2C A;  3JUN A;  4EBG A;  1OHP A;  3MPH A;  6STD A;  1RRH A;  1SPU A;  2W0Q A;  1N5P A;  1YIT 3;  1YI2 3;  1RKY A;  1O7H B;  2A15 A;  4HM1 B;  3K63 A;  2CG0 A;  4MMZ B;  2WOF A;  1W01 A;  3I56 3;  1YGE A;  4OUQ A;  3K5T A;  3WOD G;  3S28 A;  2RSX A;  1SIH A;  3D3L A;  3FLJ A;  5FGO A;  4R4K A;  2RGQ A;  3LTC A;  3N9H A;  1SII A;  4FCZ A;  5CLK A;  2IUK A;  3OWS A;  4MMX B;  1QAF A;  3OX9 A;  1AVL A;  1OCV A;  1UI8 A;  3S29 A;  2Z77 A;  3VF1 A;  5IF6 A;  2I9W A;  3O8Y A;  5CXO A;  5KP3 A;  5CK6 A;  3DUK A;  4EYC A;  2QGU A;  3SOY A;  3FZW A;  1Q86 4;  3EJV A;  3NBB A;  1EA2 A;  1GD4 A;  3G0K A;  2JDI H;  2MF7 A;  2FNQ A;  3I55 3;  2E2T A;  3FF0 A;  4FMD A;  1QAL A;  2KCD A;  2W03 A;  2CH9 A;  3HK4 A;  3UL6 A;  1YVB I;  3WMD A;  2K0M A;  3WOE B;  4XDV A;  4WWU C;  5CF1 A;  3FG1 A;  3GZY B;  1VQN 3;  4FCM A;  1IV9 A;  5FW5 A;  1OF5 A;  2QEX 3;  1DVD A;  2C10 A;  1VQ4 3;  4HM5 B;  1GYB A;  3CMA 3;  5AI1 A;  2RFR A;  1UUV B;  1FGR A;  4HYZ A;  1IVX A;  1KQS 2;  1VQP 3;  2INX A;  3G71 3;  3HZP A;  4IT7 A;  4K61 A;  1T5Y A;  3NV0 A;  1IQ8 A;  1HKX A;  2CFD A;  4R1K A;  5IER A;  1D6Y A;  2O9U X;  4JRF A;  3EBY A;  3G6E 3;  2C11 A;  4HM0 B;  3CCU 3;  3KKG A;  1AV4 A;  1M1K 4;  4EXR A;  5DRV A;  3T0U A;  4R9K A;  5IG0 A;  1CYU A;  2XF3 A;  3GAX A;  1UUW B;  1YJW 3;  4AKZ A;  1AR0 A;  3ECF A;  2CKF B;  1E3V A;  3U97 A;  2F98 A;  3LML A;  5KP1 A;  3LH4 A;  1IQY A;  1JB5 A;  3KSP A;  1IQX A;  3FSD A;  5IW9 A;  3PGB A;  5AYR B;  3UNL A;  1JV2 B;  5IG3 A;  5AYS C;  2OOV A;  4N6M A;  1R4C A;  2XFS A;  1FUW A;  2W6J H;  4FMA A;  5LC6 A;  1IT8 A;  2GXF A;  2YFL B;  3ER7 A;  3JUM A;  4J8T A;  1ROV A;  1Q7Y 4;  3LTB A;  1DMM A;  1OPY A;  2WOH A;  3EN1 B;  2HMO B;  3UB1 A;  3F8H A;  1QAK A;  3H51 A;  2OCT A;  4OVM A;  4U13 A;  3DY5 A;  3X3X A;  4XDW A;  3CC2 3;  5AII A;  3MYT A;  3CC4 3;  1SJW A;  2XSH B;  4HM3 B;  1E97 A;  3BNC A;  5AIF A;  1L5G B;  2MC8 A;  3EQQ B;  1GD3 A;  1KD1 4;  3MWZ A;  4XB5 A;  1JN5 B;  3PYJ A;  4LMI A;  1VQL 3;  4HM6 B;  2CWV A;  2HMJ B;  2CC3 A;  4RNY A;  3SED A;  3BB9 A;  1U5O A;  3MG1 A;  4ZM8 A;  1TIJ A;  1NU3 A;  5TGN A;  2P0X A;  2XGN A;  4N6N B;  5JPP A;  2XR8 B;  1DMN A;  2Q07 A;  3IJE B;  1NO3 A;  1Q40 B;  4QWT A;  3CCR 3;  1W6G A;  1JKG A;  1NB5 I;  5A0O B;  3CCQ 3;  4CCV A;  4IIA A;  3LYG A;  3BNB A;  3KFQ C;  1O7P B;  3JUP A;  1OGZ A;  2QA4 3;  4XBX A;  3F7X A;  3EF8 A;  4KFE A;  3X3Y A;  1TFK A;  1F8N A;  2P38 A;  4X2H A;  1A2K A;  1TUH A;  3CCS 3;  3SX1 A;  3NBJ A;  2YFI B;  1QMA A;  4RNZ A;  1ISK A;  3HI7 A;  3EB8 A;  1JN5 A;  1ULI B;  1UI7 A;  3CME 3;  1YJ9 3;  3Q90 A;  4JF8 A;  2IMJ A;  3GZR A;  2W04 A;  3CCE 3;  2F99 A;  1YJN 3;  1WMN A;  3K0Z A;  2CWU A;  3STD A;  3NV0 B;  4FCJ A;  2P09 A;  2CHC A;  3NHX A;  1V74 A;  3KZT A;  1QVG 2;  3NX0 A;  3RGR A;  1PU4 A;  3JUQ A;  4I4K A;  3X41 A;  4N6L A;  2XH9 A;  2YX9 A;  3OWU A;  1M1X B;  2OWP A;  2XEP A;  1W2B 2;  2Z6B A;  3CNM A;  3CCL 3;  1VQ9 3;  1N8R 4;  1G96 A;  1W00 A;  1FGM A;  1Q42 A;  5EEO A;  2IA7 A;  2GU3 A;  4XBY A;  5D81 A;  2LYX A;  1OH0 A;  5AIH A;  3S67 A;  3GWR A;  3KN4 A;  3PCS A;  4LGQ A;  2OTL 3;  1FGQ A;  4WHA A;  3RDE A;  2K54 A;  2D1W A;  3D9R A;  3V99 A;  3DGM A;  1JNQ A;  3DMC A;  3MKI A;  2PNC A;  3KII A;  2KRT A;  3EBT A;  4WYK B;  3PS8 A;  1AVK A;  3MSO A;  4HJL B;  4HVN A;  3EE1 A;  2E2U A;  1CYV A;  1K8A 4;  3HII A;  1JRQ A;  5D82 A;  2XSO B;  3FH1 A;  3CPO A;  1VQ8 3;  3L0R A;  3VSY A;  4KFF A;  4BTW A;  2GBW B;  3X40 A;  2GU1 A;  2JQ5 A;  2STD A;  4L7K A;  1DMQ A;  1LNH A;  1OUN A;  4J9A A;  1GY6 A;  4R80 A;  2YFJ B;  2BMR B;  3F9S A;  3V98 A;  3KSE D;  4BTY A;  1N5H A;  1ULJ B;  1KC8 4;  1WMP A;  2CG1 A;  2WGQ A;  1PFP A;  3T8U A;  3OXA A;  4Q53 A;  3JVC A;  1VQ7 3;  3DGN A;  1GY7 A;  1ASK A;  3SVA A;  5D83 A;  1W02 A;  3NM7 A;  3DGO A;  3DM8 A;  4K1U A;  1Q81 4;  4H3U A;  1TP6 A;  4X2O A;  1N9J A;  4OK0 A;  2BNG A;  2OQE C;  5AIG A;  1UW1 A;  3ALA A;  4L8P A;  1IK3 A;  1JJ2 2;  1WTH A;  1K28 A;  1MNL A;  1YIJ 3;  3V92 A;  4HM8 B;  4O2H A;  2O3O A;  1A90 A;  5IG4 A;  1DVC A;  2F86 B;  3EX9 A;  3LT8 A;  3MG3 A;  4STD A;  4WFO A;  1Q82 4;  2OQE A;  5EVH A;  2W56 A;  3UL5 A;  5HGR A;  3CC7 3;  4N6U A;  4MJD A;  2QIY A;  4HZB B;  1QJG A;  2KXG A;  2V1L A;  3HIG A;  3OW2 2;  3S5C A;  3CPW 2;  5AEU B;  1VQK 3;  2P05 A;  4O8S A;  2WO0 A;  4FMC A;  3FGY A;  2ZL8 A;  3LXU X;  3U1W A;  3VGN A;  2W9Q A;  4KFD A;  3OV4 A;  1S5A A;  2IUJ A;  2RCD A;  1EQK A;  4PEJ A;  3FKA A;  2Y73 A;  1LVN A;  5LC7 A;  3FF2 A;  1W7C A;  1IT7 A;  3GZX B;  3M8C A;  2Z76 A;  1QVF 2;  3K7C A;  3NUV A;  3MHE A;  2B1X B;  3PCR A;  1ZX2 A;  5BXQ A;  2W9P A;  4EV5 A;  2OTJ 3;  3FG3 A;  1U8C B;  1CEW I;  3DZL A;  3GRD A;  3WA2 X;  1K73 4;  4FR9 A;  3N8B A;  3CU3 A;  3SOA A;  4R9L A;  1O7N B;  2W56 B;  3B8L A;  1STD A;  4WP5 A;  3HX8 A;  3IPT A;  1WQL B;  4NHF A;  1LXE A;  3F7S A;  3BND A;  1Z1S A;  3S27 A;  5ELU A;  4XM4 A;  4EC6 A;  3I0Y A;  3LTD A;  5JPU A;  4KZ1 A;  3Q1C A;  1IVU A;  1NB3 I;  5G2G A;  4GL6 A;  5ELJ A;  2BHM A;  2BT3 A;  3PXM A;  1KSI A;  3F8X A;  2GBX B;  1W2Z A;  1W4N A;  3B4O A;  3EN8 A;  3IMA B;  1LOX A;  2BO9 B;  5I97 A;  4N3V A;  5IEP A;  4HBR A;  3G8Z A;  3QRD A;  3SXX A;  4HKV B;  3CD6 3;  4G1M B;  1W6Y A;  4O02 B;  3WA3 A;  1OF5 B;  2CFK A;  4FMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...