1ASKA

Nuclear transport factor 2 (ntf2) h66a mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQASITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear protein import is decreased by engineered mutants of nuclear transport factor 2 (NTF2) that do not bind GDP-Ran.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1askA00
5CF2A 3MG1A 1Q40B 3T8UA 2Z7AA 3EBYA 3KE7A 4J8TA 4Q53A 3EN8A 3CNXA 1NU3A 3DZLA 1OH0A 4U13A 2F99A 3EN1B 4WYKB 3UJMA 1GY5A 1OF5A 4K1UA 3K7CA 3OWSA 3F8XA 3GWRA 5DREA 2QIYA 1NWWA 4HM6B 3ROBA 2K54A 1EG9B 3NV0A 4HJLB 4L8PA 4OUQA 3GZYB 2RGQA 3F7SA 1DMNA 3FLJA 4H3UA 4K1VA 4HM0B 2GBWB 1O7MB 3CU3A 3FSDA 2Z77A 3EQQB 3I0YA 4X2OA 4XM4A 4LMIA 4XDWA 1OPYA 3VGNA 4CDLA 1O7GB 4GB5A 5KP4A 3LZAA 5IG4A 1ISKA 5HGRA 3SOYA 4HKVB 3K0ZA 5IG0A 3GZRA 4HZBB 4XB5A 3CNMA 5AEUB 3FGYA 3G16A 3NXJA 1OGXA 3BB9A 4HM1B 3MYTA 4LEHA 3SOAA 2UX0A 3HX8A 1NDOB 1ZX2A 3B4PA 4WYKA 5AIHA 4RZMA 3EHCA 6STDA 7STDA 5AEWB 2HMOB 1SJWA 4ORLA 2STDA 3MG2A 3JUQA 3NM2A 2Z76A 4HM5B 3NHXA 2B1XB 4HVNA 2YFIB 3JUMA 1BUQA 5AIIA 1K41A 5JPPA 1UUVB 5G2GA 4L8OA 5CK6A 2R4IA 1JN5A 2B24B 3JUNA 4OVMA 3H51A 2IMJA 3FKAA 3MHEA 2OWPA 5FW5A 4L7KA 5IG3A 4XDVA 1VZZA 3B7CA 1O7WB 3KZTA 2XRXB 3EF8A 3FZWA 3OX9A 3OWUA 1OHPA 3ECFA 1AR0A 1HKXA 1OGZA 1OF5B 3T8NA 2HMNB 5IENA 4FCMA 3FF2A 1CQSA 3MKIA 3ER7A 3NBRA 4LGQA 1Q40A 3E99A 1E3VA 4FCJA 1JKGB 5EVHA 5IF6A 2CKFB 1Q42A 5BXQA 3G8ZA 1DMQA 1S5AA 5CF1A 2BNGA 2HMKB 3B4OA 2BMOB 5D83A 1OHSA 1OUNA 1U5OA 3KKGA 4HM3B 4WWUC 3F8HA 4XBXA 1A2KA 4HM2B 3DXOA 3F40A 3JUOA 3GRDA 4HZ9B 1W00A 1E97A 1GY7A 1OHOA 4N3VA 5AIFA 1JB5A 5IEOA 5KP3A 1JKGA 3F7XA 2F98A 2QGUA 4R9KA 3G0KA 1QMAA 2PZVA 3A76A 4MJDA 3SEDA 3DM8A 1STDA 2BMQB 3LYGA 4X2HA 3EX9A 2GBXB 5IEPA 1C7HA 4XBTA 1ZO2A 3F14A 5TGNA 1QJGA 5AIGA 2YFLB 3HZPA 1GYBA 3H3HA 3FH1A 2RCDA 3FF0A 3WMDA 5DRVA 5STDA 3NUVA 3JUPA 4WP5A 1ASKA 1JN5B 2XR8B 4HM7B 3RGRA 4HM8B 3GZBA 1ULIB 3EBTA 3HK4A 1GS3A 5CLKA 2GEXA 4PEJA 2HMJB 4HM4B 1E3RA 1TUHA 3F9SA 3CPOA 4KVHA 3S5CA 1O7HB 5AI1A 3UNLA 3OWYA 3GZXB 1GY6A 1EA2A 1WQLB 3OV4A 3OXAA 3M8CA 4R1KA 5BVBA 1TP6A 1W02A 3Q90A 4R9LA 5IERA 4J9AA 3IPTA 1O7NB 2JQ5A 5IG5A 2CHCA 3DMCA 5KP1A 1OCVA 3NV0B 4IIAA 2F86B 2HMMB 8CHOA 3MG3A 3DUKA 1IDPA 1JB2A 2RFRA 2HMLB 2INXA 1W01A 3B8LA 2I9WA 5JPUA 1W6YA 2BMRB 3EC9A 4XBYA 5D82A 3BLZA 5D81A 3MSOA 3EJVA 1DMMA 2XSHB 3STDA 1ULJB 2GEYA 3RGAA 3VSYA 1JB4A 2XSOB 2GXFA 1O7PB 2YFJB 4I4KA 3D9RA 1Z1SA 4STDA 2W2CA 3KSPA 2A15A 1UUWB 5CXOA
chains in the Genus database with same CATH superfamily
1B3SA 5CF2A 3T8UA 1Q40B 3EBYA 3KE7A 4EC6A 1UW1A 1B2SA 5LC7A 1FUWA 3CNXA 3UL5A 3PYJA 1LNHA 1YGWA 4WYKB 3UJMA 2AADA 3K7CA 1FW7A 3GWRA 4HM6B 4O8SA 2FNQA 2K54A 1EG9B 4L8PA 3PGBA 3GZYB 2RGQA 3GAXA 5JBSA 1Q864 3FSDA 2Z77A 1RCLA 4X2OA 5M18A 4CDLA 3CCL3 1YJW3 1M9GA 3LTDA 4BIRA 1ISKA 3SOYA 3X3XA 1AY7A 3K0ZA 5IG0A 1NO3A 3CNMA 3CC73 3S67A 3G16A 3BB9A 3WOFB 4EXRA 2CFDA 2KAAA 4LEHA 1US1A 4KFEA 2CG0A 3HIIA 5A0OB 1N8R4 2FGTA 2WOFA 1BRIA 2W04A 5AEWB 1SJWA 1PFPA 4N6MA 2STDA 1KC84 3MWZA 2Z76A 1MWSA 2XF3A 1IQ8A 1IQYA 3JUMA 1DYUA 1IT8A 1UUVB 1BNRA 1AQZA 1A90A 4L8OA 4CJNA 2R4IA 1B2XA 3CXC2 3H51A 3MHEA 2QA43 2CW9A 1G02A 5IG3A 2K0MA 3NM7A 1B2ZA 1QAFA 1DVCA 3FZWA 3OX9A 3OWUA 4HAAA 4HYZA 3ECFA 2OOVA 3IJEB 1OGZA 5IENA 3SX1A 3CD63 3FF2A 4KFDA 1CH0A 3HOHA 3O8YA 4LGQA 4NPBA 1R4CA 1B2MA 1DMQA 3GSPA 2BNGA 2HMKB 2LQVA 3EE1A 1A2KA 1YVBI 1RLSA 2H0IA 2W9PA 1UGHI 3F40A 5I97A 4EBGA 4FMBA 1G0TA 5AIFA 1N5PA 1JB5A 4N6NB 3WA3A 5KP3A 3CCE3 1BAOA 3F7XA 2CC3A 1K9M4 1Q824 1NB5I 2BMQB 3EX9A 5IEPA 1C7HA 4XBTA 3F14A 5TGNA 1LQGC 2P0XA 3HI7A 5AIGA 3CC23 1W7CA 3BNCA 2FXTA 3FH1A 1YVSA 2RCDA 3U1WA 4EW5A 1DVDA 5STDA 3JUPA 2O3OA 2GU3A 1B27A 1JN5B 2F5WA 2P05A 4HM8B 3GZBA 4HM7B 4N6TA 2GEXA 3WDGB 4KVHA 3S5CA 1HZ1A 1NJI4 1HU9A 4G1MB 5G1KA 4MEIA 3GZXB 1WQLB 1A2PA 2CK3H 2IYJA 4AKZA 1RGGA 3X41A 3PS8A 4R9LA 1WNHA 1O7NB 3IPTA 5IG5A 2CHCA 1LVNA 2F86B 8CHOA 3A5EA 1DETA 1N9EA 4GSPA 3KIIA 2HMLB 2KF5A 2I9WA 5JPUA 1W6YA 3D3LA 3EC9A 3CC43 4LYLB 1JB4A 2XSOB 1YJ93 3DH2A 4I4KA 4RNYA 1D6YA 1RJOA 4STDA 2GSPA 2W2CA 3FCSB 3KSPA 2A15A 1I2FA 1TRQA 3MG1A 3L0RA 2E2UA 4J8TA 1TFOA 3EN8A 4KFFA 1NU3A 1FYSA 2BIRA 2F99A 1T3BA 1GY5A 1QVF2 1N8QA 3F8XA 5DREA 2QIYA 1NWWA 4N6OB 2V1LA 3NV0A 1BNFA 1IVWA 4HOHA 2P09A 3QRDA 1BIRA 3F7SA 1DMNA 4DKIA 3CPW2 4AEQA 4BU4A 4HM0B 1T2HA 1OACA 1T2IA 3I0YA 2KF6A 1GD3A 3AHSA 4LMIA 2W56A 1OPYA 2CFGA 5M1AA 1AVLA 1G96A 1K734 3LZAA 4J5KA 1LQMB 2PNCA 2OOVC 2H0HA 4HBRA 3X3YA 4R80A 3V92A 3NXJA 1OGXA 3DGLA 2ZHXB 2R41A 3DGYA 1RNTA 2UX0A 5BIRA 1PU4A 2AAEA 1VQ43 4WYKA 5AIHA 1T5YA 4RZMA 8RNTA 1Q814 2C10A 1VQL3 1GOVA 1IK3A 1Y4KA 3RNTA 3JUQA 3LTCA 4IPBA 3V98A 1I70A 1KSIA 2W9QA 6GSPA 2YFIB 3ALAA 1BUQA 1VQK3 5AIIA 1JBSA 1K41A 4O02B 3AGOA 2YX9A 1YJN3 1B20A 1VQ93 2KF3A 1UDII 1TFKA 3Q3FA 1BSEA 4OVMA 3X40A 2OWPA 2RBIA 1V57A 1SPUA 5AYRB 1UUGB 3EF8A 1ROAA 1OHPA 2ZA4A 1AR0A 1HKXA 3T8NA 1OF5B 6RNTA 1TJDA 5GSPA 1BU4A 4J5GA 2F5MA 1YI23 1EEJA 1JRQA 3E99A 4FCJA 1BNJA 2BU4A 1BRSA 3QK9A 5EVHA 1VQN3 5BXQA 5CF1A 3LXUX 2CH9A 1Q7Y4 1BVIA 1FZUA 1OHSA 3KKGA 4HM3B 2CX1A 2XH9A 4OK0A 4WWUC 3OW22 4LZIA 1FUTA 1ZS7A 3I553 2W0QA 3BIRA 3JUOA 3LT9A 9RNTA 1LXEA 1E97A 1GY7A 4N3VA 1AV4A 3U97A 5BU4A 1BSAA 1WMPA 4R9KA 4MJDA 5EQLA 4I5QA 3DM8A 2ZDJA 1RN4A 3K9MC 4TX4A 1LRAA 1SARA 1RN1A 2YFLB 1GYBA 1CYUA 2XGLA 2IUKA 1RSNA 2MC8A 3WMDA 2OTJ3 3NUVA 1AVKA 3N54B 1GS3A 1BRJA 1JZDA 1TUHA 5LC6A 3CPOA 3V99A 1W2ZA 1O7HB 3M8CA 1MWRA 1CYVA 4FMCA 1TP6A 1W02A 2KF4A 4FMDA 4R4KA 1BRGA 2JQ5A 1RCKA 3BU4A 2XEPA 5KP1A 1RRHA 2C11A 1LOXA 2IY2A 2H0GA 2IUJA 1UCKA 3MG3A 3DUKA 1IDPA 1KQS2 1JB2A 1BNGA 1BANA 1GMQA 2INXA 1GMPA 1MWTA 2JDIH 2RFRA 4MMXB 4CCVA 2E2TA 3BLZA 3NX0A 1RMSA 3D79A 3EJVA 1DMMA 3STDA 1ULJB 3AHWA 2GXFA 1X1XA 3VF1A 3TDGA 1RGHA 1UUWB 1BRNL 2Z7AA 1BNIA 1JBTA 4Q53A 3DZLA 3AMOA 3EN1B 3LT8A 2HOHA 5EEOA 3RGRA 1OF5A 1GOYA 1RHLA 1A2VA 2IA7A 1X1WA 3OWSA 1VQ53 4EV2A 2CFWA 1EKMA 4K61A 1R4YA 1HYFA 4HJLB 2D1WA 3G6E3 5M19A 3EB8A 4FR9A 5FGOA 2BT3A 1I3FA 2P38A 3EQQB 1FGTA 3VGNA 4N6LA 3ZG0A 1JV2B 5KP4A 3PXMA 4LSOA 3WA2X 3K63A 3T0UA 3GZRA 1X1YA 4HZBB 4XB5A 2LYXA 3SLUA 1BSCA 1NB3I 3SYUA 4ILFA 1X1UA 4HM1B 3MYTA 2XGNA 1M1XB 3CCS3 3HX8A 3PCSA 1NDOB 2J8XB 3IMAB 3B4PA 1J2BA 3UL6A 1BOXA 4ZM8A 6STDA 1YGEA 2SARA 7STDA 5RNTA 4ORLA 3G713 3MG2A 4HM5B 3X3ZA 1TTOA 2WGQA 3ZG5A 3BNEA 3NHXA 1F8NA 3CCU3 4HVNA 4BTXA 5JPPA 5G2GA 1GMRA 1JNQA 2RNTA 3BNDA 3DGOA 1WMOA 3Q1CA 5CK6A 2B24B 4BTWA 3CCJ3 2OCTA 2WOHA 2W56B 1L5GB 4L7KA 1RDSA 4XDVA 1VZZA 1RTUA 3CCM3 1RGAA 2XRXB 4JRFA 2L1SA 1C54A 4FCMA 3JVCA 1RGCA 3MKIA 2CFLA 1Q40A 1E3VA 1V58A 1UGIA 5IF6A 2CKFB 3D4AA 1IVUA 1S5AA 1KWIA 2CWVA 5D83A 2UUGC 1OUNA 1U5OA 4XBXA 1I0VA 1MWUA 1QAKA 2OQEC 2CX0A 1WMNA 2Y73A 1D6UA 1D6ZA 5HOHA 4HZ9B 4KT3B 1RNBA 4QWTA 1BRHA 3LMLA 1Q9EA 1IVVA 2PZVA 2W6JH 3A76A 3SEDA 1STDA 1STFI 3WODG 2QEX3 3D5IA 3HZPA 1K8A4 3H3HA 1FGRA 3UB1A 3KN4A 4WP5A 1TIJA 4WFOA 1ASKA 2MF7A 3HK4A 1ULIB 3EBTA 1BNEA 1VQ63 4MMYB 1A67A 3F9SA 1W4NA 3UNLA 1VQ83 5AI1A 3OWYA 5BVBA 1GY6A 1EA2A 3OV4A 3WOEB 3RDEA 2E2VA 1V74A 3Q90A 2XFTA 5IERA 1YIJ3 3Q2PA 1VQO3 1IYYA 1JZOA 1OCVA 2HMMB 1PY3A 3WHOA 5IW9A 2GU1A 3B8LA 1S723 1I8VA 2D42A 2KXGA 1GSPA 2ZL8A 4XBYA 4K90B 1K28A 1MOLA 2XSHB 1DE3A 1QALA 3VSYA 1IQXA 3MPHA 3PZWA 2YFJB 1O7PB 4CPKA 1VQQA 1EQKA 1Z1SA 1LOYA 2P0MA 2GEYA 4KZ1A 1YNVX 2KCDA 4BL3A 3FG1A 3CCV3 4EYCA 1OH0A 4U13A 3BNBA 4K1UA 1IU7A 1U8CB 3PCRA 3ROBA 2KRTA 3ZFZA 7RNTA 2CIUA 1JBRA 1B2UA 4OUQA 4GHOA 4EV5A 4H3UA 7GSPA 4K1VA 3FLJA 2M7OA 1WTHA 1O7MB 2GBWB 1W6GA 2WO0A 2Y74A 3CU3A 1VQP3 1I2GA 4XM4A 4XDWA 1O7GB 2O9UX 4GB5A 3WR2A 2WGOA 5IG4A 5HGRA 4HKVB 5AEUB 1RGLA 3K5TA 3FGYA 1W6CA 3N8BA 4GL6A 1I3IA 3SOAA 3SVAA 1BRKA 2L4VA 3AMOB 1ZX2A 3LOYA 2OQEA 3NBBA 2CFKA 3EHCA 4MMZB 2HMOB 4BTYA 1BSBA 3NM2A 4BL2A 1NNVA 3N9HA 2B1XB 1IV9A 1M1K4 1MGWA 4WHAA 4N6UA 1UCIA 1FGOA 1I0XA 5CXOA 3S28A 2OTL3 1JN5A 1QVG2 3JUNA 4JF8A 1KD14 2IMJA 2ML6A 3DY5A 1RN7A 3FKAA 4NREA 3AGNA 5FW5A 3B7CA 1TRPA 1O7WB 3KZTA 1W5ZA 1LNIA 1N5HA 1GOUA 1EUIC 2HMNB 1IV7A 3NBJA 3G4S3 2BHMA 1CQSA 3KSED 1IVXA 3ER7A 3NBRA 1VQ73 2F4YA 1Q7HA 2Z6BA 1JKGB 1Q42A 1LOVA 3G8ZA 5AYSC 4IT7A 3CMA3 3B4OA 3CCQ3 1RRLA 2BMOB 1GD4A 2XFSA 3J7Yd 1PYLA 2CWTA 3F8HA 1JJ22 1FGMA 2SBLA 4HM2B 1B21A 3DXOA 4RNTA 1MGRA 3D5GA 4FCZA 3GRDA 1M904 1W00A 4FMAA 1TU5A 2RSXA 1OHOA 1RKYA 4RNZA 3LTAA 5IEOA 1FA3A 1JKGA 1LOWA 2BO9B 2F98A 2QGUA 1SQWA 3G0KA 1QMAA 5ELJA 1UI8A 3LYGA 3LTBA 4X2HA 2GBXB 1FGQA 1BNSA 1ZO2A 1QJGA 2Q07A 3NQYA 4O3VA 2UGIA 3KFQC 3S27A 1BUJA 2K3DA 3FF0A 5DRVA 5G1LA 2C4BA 3URPA 2XR8B 3NQZA 3I563 2CWUA 4NHFA 5CLKA 4PEJA 2HMJB 1SIIA 1E3RA 3FG4A 1CEWI 1FUSA 1UCJA 3KCHA 4HM4B 2CG1A 4AKYA 4R1KA 3S29A 3HIGA 3OXAA 3SXXA 3CCR3 1RGEA 3FG3A 1ZGXA 3DGNA 4J9AA 1RGKA 3DMCA 4H61A 1UCLA 3NV0B 1I2EA 4IIAA 4RBNA 5ELUA 2ML5A 2F56A 4O2HA 1W01A 2W03A 1BGSA 1YHQ3 5D82A 2BMRB 1BSDA 4N6V0 1ROVA 3CME3 5D81A 3DGMA 1RGFA 1UI7A 3MSOA 1YIT3 1MNLA 3X42A 1SIHA 3RGAA 1W2B2 3D9RA 1VQM3 1IT7A 1N9JA 3LH4A
chains in the Genus database with same CATH topology
5CF2A 3T8UA 1Q40B 3EBYA 3KE7A 4EC6A 1UW1A 5LC7A 1FUWA 3CNXA 3UL5A 3PYJA 1LNHA 4WYKB 3UJMA 3K7CA 3GWRA 4HM6B 4O8SA 2FNQA 2K54A 1EG9B 4L8PA 3PGBA 3GZYB 2RGQA 3GAXA 5JBSA 1Q864 3FSDA 2Z77A 4X2OA 4CDLA 3CCL3 1YJW3 1M9GA 3LTDA 1ISKA 3SOYA 3X3XA 3K0ZA 5IG0A 1NO3A 3CNMA 3CC73 3S67A 3G16A 3BB9A 3WOFB 4EXRA 2CFDA 4LEHA 1US1A 4KFEA 2CG0A 3HIIA 5A0OB 1N8R4 2FGTA 2WOFA 2W04A 5AEWB 1SJWA 1PFPA 4N6MA 2STDA 1KC84 3MWZA 2Z76A 2XF3A 1IQ8A 1IQYA 3JUMA 1DYUA 1IT8A 1UUVB 1A90A 4L8OA 2R4IA 3CXC2 3H51A 3MHEA 2QA43 2CW9A 5IG3A 2K0MA 3NM7A 1QAFA 4HYZA 1DVCA 3FZWA 3OX9A 3OWUA 2OOVA 3ECFA 3IJEB 1OGZA 5IENA 3SX1A 3CD63 3FF2A 4KFDA 4LGQA 3O8YA 1R4CA 1DMQA 2BNGA 2HMKB 2LQVA 3EE1A 1A2KA 1YVBI 2W9PA 3F40A 5I97A 4EBGA 4FMBA 5AIFA 1N5PA 1JB5A 4N6NB 3WA3A 5KP3A 3CCE3 3F7XA 2CC3A 1K9M4 1Q824 1NB5I 2BMQB 3EX9A 5IEPA 1C7HA 4XBTA 3F14A 5TGNA 2P0XA 3HI7A 5AIGA 3CC23 1W7CA 3BNCA 2FXTA 3FH1A 2RCDA 3U1WA 1DVDA 5STDA 3JUPA 2O3OA 2GU3A 1JN5B 2P05A 4HM7B 3RGRA 4HM8B 3GZBA 4N6TA 2GEXA 3WDGB 4KVHA 3S5CA 1NJI4 1HU9A 4G1MB 4MEIA 3GZXB 1WQLB 2CK3H 4AKZA 3X41A 3PS8A 4R9LA 1WNHA 1O7NB 3IPTA 5IG5A 2CHCA 1LVNA 2F86B 8CHOA 1N9EA 3KIIA 2HMLB 2I9WA 5JPUA 1W6YA 3D3LA 3EC9A 3CC43 1JB4A 2XSOB 1YJ93 4I4KA 4RNYA 1D6YA 1RJOA 4STDA 2W2CA 3FCSB 3KSPA 2A15A 3MG1A 3L0RA 2E2UA 4J8TA 1TFOA 3EN8A 4KFFA 1NU3A 2F99A 1GY5A 1QVF2 1N8QA 3F8XA 5DREA 2QIYA 1NWWA 4N6OB 2V1LA 3NV0A 1IVWA 2P09A 3QRDA 3F7SA 1DMNA 3CPW2 4AEQA 4HM0B 1OACA 3I0YA 1GD3A 4LMIA 2W56A 1OPYA 2CFGA 1AVLA 1G96A 1K734 3LZAA 2PNCA 2OOVC 4HBRA 3X3YA 4R80A 3V92A 3NXJA 1OGXA 3DGLA 2UX0A 1PU4A 1VQ43 4WYKA 5AIHA 1T5YA 4RZMA 1Q814 1VQL3 2C10A 1Y4KA 3JUQA 3LTCA 4IPBA 3V98A 1KSIA 2W9QA 2YFIB 3ALAA 1BUQA 1VQK3 5AIIA 1K41A 4O02B 2YX9A 1YJN3 1VQ93 1TFKA 4OVMA 3X40A 2OWPA 1SPUA 5AYRB 3EF8A 1ROAA 1OHPA 1AR0A 1HKXA 3T8NA 1OF5B 1YI23 1JRQA 3E99A 4FCJA 3QK9A 5EVHA 1VQN3 5BXQA 5CF1A 3LXUX 2CH9A 1Q7Y4 1VQO3 1OHSA 3KKGA 4HM3B 4WWUC 3OW22 2XH9A 4OK0A 4LZIA 3I553 2W0QA 3JUOA 3LT9A 1LXEA 1E97A 1GY7A 4N3VA 1AV4A 3U97A 1WMPA 4R9KA 4MJDA 5EQLA 3DM8A 2ZDJA 3K9MC 4TX4A 2YFLB 1GYBA 1CYUA 2XGLA 2IUKA 2MC8A 3WMDA 2OTJ3 3NUVA 1AVKA 3N54B 1GS3A 1TUHA 5LC6A 3CPOA 3V99A 1W2ZA 1O7HB 3M8CA 1CYVA 4FMCA 1TP6A 1W02A 4FMDA 4R4KA 2JQ5A 5KP1A 2XEPA 1RRHA 2C11A 1LOXA 2IUJA 3MG3A 3DUKA 1IDPA 1KQS2 1JB2A 2RFRA 2INXA 2JDIH 4MMXB 4CCVA 2E2TA 3BLZA 3NX0A 3STDA 3EJVA 1DMMA 1ULJB 2GXFA 3VF1A 3TDGA 1UUWB 2Z7AA 4Q53A 3DZLA 3AMOA 3EN1B 3LT8A 5EEOA 1OF5A 1A2VA 2IA7A 3OWSA 1VQ53 4EV2A 2CFWA 1EKMA 4K61A 4HJLB 2D1WA 3G6E3 3EB8A 4FR9A 5FGOA 2BT3A 2P38A 3EQQB 1FGTA 3VGNA 4N6LA 1JV2B 5KP4A 3PXMA 4LSOA 3WA2X 3K63A 3T0UA 3GZRA 4HZBB 4XB5A 2LYXA 3SLUA 1NB3I 4HM1B 3MYTA 2XGNA 1M1XB 3CCS3 3HX8A 3PCSA 1NDOB 3IMAB 3B4PA 1J2BA 3UL6A 4ZM8A 6STDA 1YGEA 7STDA 4ORLA 3G713 3MG2A 4HM5B 3X3ZA 2WGQA 3CCU3 3BNEA 3NHXA 1F8NA 4HVNA 4BTXA 5JPPA 5G2GA 1JNQA 3BNDA 3DGOA 3Q1CA 1WMOA 5CK6A 4BTWA 2B24B 3CCJ3 2OCTA 2WOHA 2W56B 1L5GB 4L7KA 4XDVA 1VZZA 3CCM3 2XRXB 4JRFA 4FCMA 3JVCA 3MKIA 2CFLA 1Q40A 1E3VA 5IF6A 2CKFB 1IVUA 1S5AA 1KWIA 2CWVA 5D83A 1OUNA 1U5OA 4XBXA 1QAKA 2OQEC 1WMNA 2Y73A 1D6UA 1D6ZA 4HZ9B 4QWTA 3LMLA 1IVVA 2PZVA 2W6JH 3A76A 3SEDA 1STDA 1STFI 3WODG 2QEX3 3HZPA 1K8A4 3H3HA 1FGRA 3UB1A 3KN4A 4WP5A 1TIJA 4WFOA 1ASKA 2MF7A 3HK4A 1ULIB 3EBTA 1VQ63 4MMYB 1A67A 3F9SA 1W4NA 3UNLA 1VQ83 5AI1A 3OWYA 5BVBA 1GY6A 1EA2A 3OV4A 3WOEB 3RDEA 2E2VA 1V74A 3Q90A 2XFTA 5IERA 1YIJ3 3Q2PA 1OCVA 2HMMB 5IW9A 2GU1A 3B8LA 1S723 2D42A 2KXGA 2ZL8A 4XBYA 4K90B 1K28A 1MOLA 2XSHB 1QALA 3VSYA 1IQXA 3MPHA 3PZWA 2YFJB 1O7PB 1EQKA 1Z1SA 2P0MA 2GEYA 4KZ1A 2KCDA 3FG1A 3CCV3 4EYCA 1OH0A 4U13A 3BNBA 4K1UA 1IU7A 1U8CB 3PCRA 3ROBA 2KRTA 2CIUA 4OUQA 4EV5A 4H3UA 4K1VA 3FLJA 2M7OA 1WTHA 1O7MB 2GBWB 1W6GA 2WO0A 2Y74A 3CU3A 1VQP3 4XM4A 4XDWA 1O7GB 2O9UX 4GB5A 2WGOA 5IG4A 5HGRA 4HKVB 5AEUB 3K5TA 3FGYA 1W6CA 3N8BA 4GL6A 3SVAA 3SOAA 3LOYA 2L4VA 3AMOB 1ZX2A 2OQEA 3NBBA 2CFKA 3EHCA 4MMZB 2HMOB 4BTYA 3NM2A 3N9HA 2B1XB 1IV9A 1M1K4 4WHAA 4N6UA 1FGOA 5CXOA 3S28A 2OTL3 1JN5A 1QVG2 3JUNA 4JF8A 1KD14 2IMJA 2ML6A 3DY5A 1RN7A 3FKAA 4NREA 5FW5A 3B7CA 1O7WB 3KZTA 1W5ZA 1N5HA 2HMNB 1IV7A 3NBJA 3G4S3 2BHMA 1CQSA 3KSED 1IVXA 3ER7A 3NBRA 1VQ73 2Z6BA 1JKGB 1Q42A 3G8ZA 5AYSC 4IT7A 3CMA3 3B4OA 3CCQ3 1RRLA 2BMOB 1GD4A 2XFSA 3J7Yd 3F8HA 2CWTA 1JJ22 1FGMA 2SBLA 4HM2B 3DXOA 4FCZA 3GRDA 1M904 1W00A 4FMAA 1TU5A 2RSXA 1OHOA 1RKYA 4RNZA 3LTAA 5IEOA 1FA3A 1JKGA 2BO9B 2F98A 2QGUA 1SQWA 3G0KA 1QMAA 5ELJA 1UI8A 3LYGA 3LTBA 4X2HA 2GBXB 1FGQA 1ZO2A 1QJGA 2Q07A 3NQYA 4O3VA 3KFQC 3S27A 3FF0A 5DRVA 2XR8B 3NQZA 3I563 2CWUA 4NHFA 5CLKA 4PEJA 2HMJB 1SIIA 1E3RA 3FG4A 1CEWI 4HM4B 2CG1A 4AKYA 1IK3A 4R1KA 3S29A 3HIGA 3OXAA 3SXXA 3CCR3 3FG3A 3DGNA 4J9AA 3DMCA 4H61A 3NV0B 4IIAA 4RBNA 5ELUA 2ML5A 4O2HA 1W01A 2W03A 1YHQ3 5D82A 2BMRB 4N6V0 1ROVA 3CME3 5D81A 3DGMA 1YIT3 1UI7A 3MSOA 1MNLA 3X42A 1SIHA 3RGAA 1W2B2 3D9RA 1VQM3 1IT7A 1N9JA 3LH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CF2 A;  3MG1 A;  1Q40 B;  3T8U A;  2Z7A A;  3EBY A;  3KE7 A;  4J8T A;  4Q53 A;  3EN8 A;  3CNX A;  1NU3 A;  3DZL A;  1OH0 A;  4U13 A;  2F99 A;  3EN1 B;  4WYK B;  3UJM A;  1GY5 A;  1OF5 A;  4K1U A;  3K7C A;  3OWS A;  3F8X A;  3GWR A;  5DRE A;  2QIY A;  1NWW A;  4HM6 B;  3ROB A;  2K54 A;  1EG9 B;  3NV0 A;  4HJL B;  4L8P A;  4OUQ A;  3GZY B;  2RGQ A;  3F7S A;  1DMN A;  3FLJ A;  4H3U A;  4K1V A;  4HM0 B;  2GBW B;  1O7M B;  3CU3 A;  3FSD A;  2Z77 A;  3EQQ B;  3I0Y A;  4X2O A;  4XM4 A;  4LMI A;  4XDW A;  1OPY A;  3VGN A;  4CDL A;  1O7G B;  4GB5 A;  5KP4 A;  3LZA A;  5IG4 A;  1ISK A;  5HGR A;  3SOY A;  4HKV B;  3K0Z A;  5IG0 A;  3GZR A;  4HZB B;  4XB5 A;  3CNM A;  5AEU B;  3FGY A;  3G16 A;  3NXJ A;  1OGX A;  3BB9 A;  4HM1 B;  3MYT A;  4LEH A;  3SOA A;  2UX0 A;  3HX8 A;  1NDO B;  1ZX2 A;  3B4P A;  4WYK A;  5AIH A;  4RZM A;  3EHC A;  6STD A;  7STD A;  5AEW B;  2HMO B;  1SJW A;  4ORL A;  2STD A;  3MG2 A;  3JUQ A;  3NM2 A;  2Z76 A;  4HM5 B;  3NHX A;  2B1X B;  4HVN A;  2YFI B;  3JUM A;  1BUQ A;  5AII A;  1K41 A;  5JPP A;  1UUV B;  5G2G A;  4L8O A;  5CK6 A;  2R4I A;  1JN5 A;  2B24 B;  3JUN A;  4OVM A;  3H51 A;  2IMJ A;  3FKA A;  3MHE A;  2OWP A;  5FW5 A;  4L7K A;  5IG3 A;  4XDV A;  1VZZ A;  3B7C A;  1O7W B;  3KZT A;  2XRX B;  3EF8 A;  3FZW A;  3OX9 A;  3OWU A;  1OHP A;  3ECF A;  1AR0 A;  1HKX A;  1OGZ A;  1OF5 B;  3T8N A;  2HMN B;  5IEN A;  4FCM A;  3FF2 A;  1CQS A;  3MKI A;  3ER7 A;  3NBR A;  4LGQ A;  1Q40 A;  3E99 A;  1E3V A;  4FCJ A;  1JKG B;  5EVH A;  5IF6 A;  2CKF B;  1Q42 A;  5BXQ A;  3G8Z A;  1DMQ A;  1S5A A;  5CF1 A;  2BNG A;  2HMK B;  3B4O A;  2BMO B;  5D83 A;  1OHS A;  1OUN A;  1U5O A;  3KKG A;  4HM3 B;  4WWU C;  3F8H A;  4XBX A;  1A2K A;  4HM2 B;  3DXO A;  3F40 A;  3JUO A;  3GRD A;  4HZ9 B;  1W00 A;  1E97 A;  1GY7 A;  1OHO A;  4N3V A;  5AIF A;  1JB5 A;  5IEO A;  5KP3 A;  1JKG A;  3F7X A;  2F98 A;  2QGU A;  4R9K A;  3G0K A;  1QMA A;  2PZV A;  3A76 A;  4MJD A;  3SED A;  3DM8 A;  1STD A;  2BMQ B;  3LYG A;  4X2H A;  3EX9 A;  2GBX B;  5IEP A;  1C7H A;  4XBT A;  1ZO2 A;  3F14 A;  5TGN A;  1QJG A;  5AIG A;  2YFL B;  3HZP A;  1GYB A;  3H3H A;  3FH1 A;  2RCD A;  3FF0 A;  3WMD A;  5DRV A;  5STD A;  3NUV A;  3JUP A;  4WP5 A;  1ASK A;  1JN5 B;  2XR8 B;  4HM7 B;  3RGR A;  4HM8 B;  3GZB A;  1ULI B;  3EBT A;  3HK4 A;  1GS3 A;  5CLK A;  2GEX A;  4PEJ A;  2HMJ B;  4HM4 B;  1E3R A;  1TUH A;  3F9S A;  3CPO A;  4KVH A;  3S5C A;  1O7H B;  5AI1 A;  3UNL A;  3OWY A;  3GZX B;  1GY6 A;  1EA2 A;  1WQL B;  3OV4 A;  3OXA A;  3M8C A;  4R1K A;  5BVB A;  1TP6 A;  1W02 A;  3Q90 A;  4R9L A;  5IER A;  4J9A A;  3IPT A;  1O7N B;  2JQ5 A;  5IG5 A;  2CHC A;  3DMC A;  5KP1 A;  1OCV A;  3NV0 B;  4IIA A;  2F86 B;  2HMM B;  8CHO A;  3MG3 A;  3DUK A;  1IDP A;  1JB2 A;  2RFR A;  2HML B;  2INX A;  1W01 A;  3B8L A;  2I9W A;  5JPU A;  1W6Y A;  2BMR B;  3EC9 A;  4XBY A;  5D82 A;  3BLZ A;  5D81 A;  3MSO A;  3EJV A;  1DMM A;  2XSH B;  3STD A;  1ULJ B;  2GEY A;  3RGA A;  3VSY A;  1JB4 A;  2XSO B;  2GXF A;  1O7P B;  2YFJ B;  4I4K A;  3D9R A;  1Z1S A;  4STD A;  2W2C A;  3KSP A;  2A15 A;  1UUW B;  5CXO A; 
#chains in the Genus database with same CATH topology
 1B3S A;  5CF2 A;  3T8U A;  1Q40 B;  3EBY A;  3KE7 A;  4EC6 A;  1UW1 A;  1B2S A;  5LC7 A;  1FUW A;  3CNX A;  3UL5 A;  3PYJ A;  1LNH A;  1YGW A;  4WYK B;  3UJM A;  2AAD A;  3K7C A;  1FW7 A;  3GWR A;  4HM6 B;  4O8S A;  2FNQ A;  2K54 A;  1EG9 B;  4L8P A;  3PGB A;  3GZY B;  2RGQ A;  3GAX A;  5JBS A;  1Q86 4;  3FSD A;  2Z77 A;  1RCL A;  4X2O A;  5M18 A;  4CDL A;  3CCL 3;  1YJW 3;  1M9G A;  3LTD A;  4BIR A;  1ISK A;  3SOY A;  3X3X A;  1AY7 A;  3K0Z A;  5IG0 A;  1NO3 A;  3CNM A;  3CC7 3;  3S67 A;  3G16 A;  3BB9 A;  3WOF B;  4EXR A;  2CFD A;  2KAA A;  4LEH A;  1US1 A;  4KFE A;  2CG0 A;  3HII A;  5A0O B;  1N8R 4;  2FGT A;  2WOF A;  1BRI A;  2W04 A;  5AEW B;  1SJW A;  1PFP A;  4N6M A;  2STD A;  1KC8 4;  3MWZ A;  2Z76 A;  1MWS A;  2XF3 A;  1IQ8 A;  1IQY A;  3JUM A;  1DYU A;  1IT8 A;  1UUV B;  1BNR A;  1AQZ A;  1A90 A;  4L8O A;  4CJN A;  2R4I A;  1B2X A;  3CXC 2;  3H51 A;  3MHE A;  2QA4 3;  2CW9 A;  1G02 A;  5IG3 A;  2K0M A;  3NM7 A;  1B2Z A;  1QAF A;  1DVC A;  3FZW A;  3OX9 A;  3OWU A;  4HAA A;  4HYZ A;  3ECF A;  2OOV A;  3IJE B;  1OGZ A;  5IEN A;  3SX1 A;  3CD6 3;  3FF2 A;  4KFD A;  1CH0 A;  3HOH A;  3O8Y A;  4LGQ A;  4NPB A;  1R4C A;  1B2M A;  1DMQ A;  3GSP A;  2BNG A;  2HMK B;  2LQV A;  3EE1 A;  1A2K A;  1YVB I;  1RLS A;  2H0I A;  2W9P A;  1UGH I;  3F40 A;  5I97 A;  4EBG A;  4FMB A;  1G0T A;  5AIF A;  1N5P A;  1JB5 A;  4N6N B;  3WA3 A;  5KP3 A;  3CCE 3;  1BAO A;  3F7X A;  2CC3 A;  1K9M 4;  1Q82 4;  1NB5 I;  2BMQ B;  3EX9 A;  5IEP A;  1C7H A;  4XBT A;  3F14 A;  5TGN A;  1LQG C;  2P0X A;  3HI7 A;  5AIG A;  3CC2 3;  1W7C A;  3BNC A;  2FXT A;  3FH1 A;  1YVS A;  2RCD A;  3U1W A;  4EW5 A;  1DVD A;  5STD A;  3JUP A;  2O3O A;  2GU3 A;  1B27 A;  1JN5 B;  2F5W A;  2P05 A;  4HM8 B;  3GZB A;  4HM7 B;  4N6T A;  2GEX A;  3WDG B;  4KVH A;  3S5C A;  1HZ1 A;  1NJI 4;  1HU9 A;  4G1M B;  5G1K A;  4MEI A;  3GZX B;  1WQL B;  1A2P A;  2CK3 H;  2IYJ A;  4AKZ A;  1RGG A;  3X41 A;  3PS8 A;  4R9L A;  1WNH A;  1O7N B;  3IPT A;  5IG5 A;  2CHC A;  1LVN A;  2F86 B;  8CHO A;  3A5E A;  1DET A;  1N9E A;  4GSP A;  3KII A;  2HML B;  2KF5 A;  2I9W A;  5JPU A;  1W6Y A;  3D3L A;  3EC9 A;  3CC4 3;  4LYL B;  1JB4 A;  2XSO B;  1YJ9 3;  3DH2 A;  4I4K A;  4RNY A;  1D6Y A;  1RJO A;  4STD A;  2GSP A;  2W2C A;  3FCS B;  3KSP A;  2A15 A;  1I2F A;  1TRQ A;  3MG1 A;  3L0R A;  2E2U A;  4J8T A;  1TFO A;  3EN8 A;  4KFF A;  1NU3 A;  1FYS A;  2BIR A;  2F99 A;  1T3B A;  1GY5 A;  1QVF 2;  1N8Q A;  3F8X A;  5DRE A;  2QIY A;  1NWW A;  4N6O B;  2V1L A;  3NV0 A;  1BNF A;  1IVW A;  4HOH A;  2P09 A;  3QRD A;  1BIR A;  3F7S A;  1DMN A;  4DKI A;  3CPW 2;  4AEQ A;  4BU4 A;  4HM0 B;  1T2H A;  1OAC A;  1T2I A;  3I0Y A;  2KF6 A;  1GD3 A;  3AHS A;  4LMI A;  2W56 A;  1OPY A;  2CFG A;  5M1A A;  1AVL A;  1G96 A;  1K73 4;  3LZA A;  4J5K A;  1LQM B;  2PNC A;  2OOV C;  2H0H A;  4HBR A;  3X3Y A;  4R80 A;  3V92 A;  3NXJ A;  1OGX A;  3DGL A;  2ZHX B;  2R41 A;  3DGY A;  1RNT A;  2UX0 A;  5BIR A;  1PU4 A;  2AAE A;  1VQ4 3;  4WYK A;  5AIH A;  1T5Y A;  4RZM A;  8RNT A;  1Q81 4;  2C10 A;  1VQL 3;  1GOV A;  1IK3 A;  1Y4K A;  3RNT A;  3JUQ A;  3LTC A;  4IPB A;  3V98 A;  1I70 A;  1KSI A;  2W9Q A;  6GSP A;  2YFI B;  3ALA A;  1BUQ A;  1VQK 3;  5AII A;  1JBS A;  1K41 A;  4O02 B;  3AGO A;  2YX9 A;  1YJN 3;  1B20 A;  1VQ9 3;  2KF3 A;  1UDI I;  1TFK A;  3Q3F A;  1BSE A;  4OVM A;  3X40 A;  2OWP A;  2RBI A;  1V57 A;  1SPU A;  5AYR B;  1UUG B;  3EF8 A;  1ROA A;  1OHP A;  2ZA4 A;  1AR0 A;  1HKX A;  3T8N A;  1OF5 B;  6RNT A;  1TJD A;  5GSP A;  1BU4 A;  4J5G A;  2F5M A;  1YI2 3;  1EEJ A;  1JRQ A;  3E99 A;  4FCJ A;  1BNJ A;  2BU4 A;  1BRS A;  3QK9 A;  5EVH A;  1VQN 3;  5BXQ A;  5CF1 A;  3LXU X;  2CH9 A;  1Q7Y 4;  1BVI A;  1FZU A;  1OHS A;  3KKG A;  4HM3 B;  2CX1 A;  2XH9 A;  4OK0 A;  4WWU C;  3OW2 2;  4LZI A;  1FUT A;  1ZS7 A;  3I55 3;  2W0Q A;  3BIR A;  3JUO A;  3LT9 A;  9RNT A;  1LXE A;  1E97 A;  1GY7 A;  4N3V A;  1AV4 A;  3U97 A;  5BU4 A;  1BSA A;  1WMP A;  4R9K A;  4MJD A;  5EQL A;  4I5Q A;  3DM8 A;  2ZDJ A;  1RN4 A;  3K9M C;  4TX4 A;  1LRA A;  1SAR A;  1RN1 A;  2YFL B;  1GYB A;  1CYU A;  2XGL A;  2IUK A;  1RSN A;  2MC8 A;  3WMD A;  2OTJ 3;  3NUV A;  1AVK A;  3N54 B;  1GS3 A;  1BRJ A;  1JZD A;  1TUH A;  5LC6 A;  3CPO A;  3V99 A;  1W2Z A;  1O7H B;  3M8C A;  1MWR A;  1CYV A;  4FMC A;  1TP6 A;  1W02 A;  2KF4 A;  4FMD A;  4R4K A;  1BRG A;  2JQ5 A;  1RCK A;  3BU4 A;  2XEP A;  5KP1 A;  1RRH A;  2C11 A;  1LOX A;  2IY2 A;  2H0G A;  2IUJ A;  1UCK A;  3MG3 A;  3DUK A;  1IDP A;  1KQS 2;  1JB2 A;  1BNG A;  1BAN A;  1GMQ A;  2INX A;  1GMP A;  1MWT A;  2JDI H;  2RFR A;  4MMX B;  4CCV A;  2E2T A;  3BLZ A;  3NX0 A;  1RMS A;  3D79 A;  3EJV A;  1DMM A;  3STD A;  1ULJ B;  3AHW A;  2GXF A;  1X1X A;  3VF1 A;  3TDG A;  1RGH A;  1UUW B;  1BRN L;  2Z7A A;  1BNI A;  1JBT A;  4Q53 A;  3DZL A;  3AMO A;  3EN1 B;  3LT8 A;  2HOH A;  5EEO A;  3RGR A;  1OF5 A;  1GOY A;  1RHL A;  1A2V A;  2IA7 A;  1X1W A;  3OWS A;  1VQ5 3;  4EV2 A;  2CFW A;  1EKM A;  4K61 A;  1R4Y A;  1HYF A;  4HJL B;  2D1W A;  3G6E 3;  5M19 A;  3EB8 A;  4FR9 A;  5FGO A;  2BT3 A;  1I3F A;  2P38 A;  3EQQ B;  1FGT A;  3VGN A;  4N6L A;  3ZG0 A;  1JV2 B;  5KP4 A;  3PXM A;  4LSO A;  3WA2 X;  3K63 A;  3T0U A;  3GZR A;  1X1Y A;  4HZB B;  4XB5 A;  2LYX A;  3SLU A;  1BSC A;  1NB3 I;  3SYU A;  4ILF A;  1X1U A;  4HM1 B;  3MYT A;  2XGN A;  1M1X B;  3CCS 3;  3HX8 A;  3PCS A;  1NDO B;  2J8X B;  3IMA B;  3B4P A;  1J2B A;  3UL6 A;  1BOX A;  4ZM8 A;  6STD A;  1YGE A;  2SAR A;  7STD A;  5RNT A;  4ORL A;  3G71 3;  3MG2 A;  4HM5 B;  3X3Z A;  1TTO A;  2WGQ A;  3ZG5 A;  3BNE A;  3NHX A;  1F8N A;  3CCU 3;  4HVN A;  4BTX A;  5JPP A;  5G2G A;  1GMR A;  1JNQ A;  2RNT A;  3BND A;  3DGO A;  1WMO A;  3Q1C A;  5CK6 A;  2B24 B;  4BTW A;  3CCJ 3;  2OCT A;  2WOH A;  2W56 B;  1L5G B;  4L7K A;  1RDS A;  4XDV A;  1VZZ A;  1RTU A;  3CCM 3;  1RGA A;  2XRX B;  4JRF A;  2L1S A;  1C54 A;  4FCM A;  3JVC A;  1RGC A;  3MKI A;  2CFL A;  1Q40 A;  1E3V A;  1V58 A;  1UGI A;  5IF6 A;  2CKF B;  3D4A A;  1IVU A;  1S5A A;  1KWI A;  2CWV A;  5D83 A;  2UUG C;  1OUN A;  1U5O A;  4XBX A;  1I0V A;  1MWU A;  1QAK A;  2OQE C;  2CX0 A;  1WMN A;  2Y73 A;  1D6U A;  1D6Z A;  5HOH A;  4HZ9 B;  4KT3 B;  1RNB A;  4QWT A;  1BRH A;  3LML A;  1Q9E A;  1IVV A;  2PZV A;  2W6J H;  3A76 A;  3SED A;  1STD A;  1STF I;  3WOD G;  2QEX 3;  3D5I A;  3HZP A;  1K8A 4;  3H3H A;  1FGR A;  3UB1 A;  3KN4 A;  4WP5 A;  1TIJ A;  4WFO A;  1ASK A;  2MF7 A;  3HK4 A;  1ULI B;  3EBT A;  1BNE A;  1VQ6 3;  4MMY B;  1A67 A;  3F9S A;  1W4N A;  3UNL A;  1VQ8 3;  5AI1 A;  3OWY A;  5BVB A;  1GY6 A;  1EA2 A;  3OV4 A;  3WOE B;  3RDE A;  2E2V A;  1V74 A;  3Q90 A;  2XFT A;  5IER A;  1YIJ 3;  3Q2P A;  1VQO 3;  1IYY A;  1JZO A;  1OCV A;  2HMM B;  1PY3 A;  3WHO A;  5IW9 A;  2GU1 A;  3B8L A;  1S72 3;  1I8V A;  2D42 A;  2KXG A;  1GSP A;  2ZL8 A;  4XBY A;  4K90 B;  1K28 A;  1MOL A;  2XSH B;  1DE3 A;  1QAL A;  3VSY A;  1IQX A;  3MPH A;  3PZW A;  2YFJ B;  1O7P B;  4CPK A;  1VQQ A;  1EQK A;  1Z1S A;  1LOY A;  2P0M A;  2GEY A;  4KZ1 A;  1YNV X;  2KCD A;  4BL3 A;  3FG1 A;  3CCV 3;  4EYC A;  1OH0 A;  4U13 A;  3BNB A;  4K1U A;  1IU7 A;  1U8C B;  3PCR A;  3ROB A;  2KRT A;  3ZFZ A;  7RNT A;  2CIU A;  1JBR A;  1B2U A;  4OUQ A;  4GHO A;  4EV5 A;  4H3U A;  7GSP A;  4K1V A;  3FLJ A;  2M7O A;  1WTH A;  1O7M B;  2GBW B;  1W6G A;  2WO0 A;  2Y74 A;  3CU3 A;  1VQP 3;  1I2G A;  4XM4 A;  4XDW A;  1O7G B;  2O9U X;  4GB5 A;  3WR2 A;  2WGO A;  5IG4 A;  5HGR A;  4HKV B;  5AEU B;  1RGL A;  3K5T A;  3FGY A;  1W6C A;  3N8B A;  4GL6 A;  1I3I A;  3SOA A;  3SVA A;  1BRK A;  2L4V A;  3AMO B;  1ZX2 A;  3LOY A;  2OQE A;  3NBB A;  2CFK A;  3EHC A;  4MMZ B;  2HMO B;  4BTY A;  1BSB A;  3NM2 A;  4BL2 A;  1NNV A;  3N9H A;  2B1X B;  1IV9 A;  1M1K 4;  1MGW A;  4WHA A;  4N6U A;  1UCI A;  1FGO A;  1I0X A;  5CXO A;  3S28 A;  2OTL 3;  1JN5 A;  1QVG 2;  3JUN A;  4JF8 A;  1KD1 4;  2IMJ A;  2ML6 A;  3DY5 A;  1RN7 A;  3FKA A;  4NRE A;  3AGN A;  5FW5 A;  3B7C A;  1TRP A;  1O7W B;  3KZT A;  1W5Z A;  1LNI A;  1N5H A;  1GOU A;  1EUI C;  2HMN B;  1IV7 A;  3NBJ A;  3G4S 3;  2BHM A;  1CQS A;  3KSE D;  1IVX A;  3ER7 A;  3NBR A;  1VQ7 3;  2F4Y A;  1Q7H A;  2Z6B A;  1JKG B;  1Q42 A;  1LOV A;  3G8Z A;  5AYS C;  4IT7 A;  3CMA 3;  3B4O A;  3CCQ 3;  1RRL A;  2BMO B;  1GD4 A;  2XFS A;  3J7Y d;  1PYL A;  2CWT A;  3F8H A;  1JJ2 2;  1FGM A;  2SBL A;  4HM2 B;  1B21 A;  3DXO A;  4RNT A;  1MGR A;  3D5G A;  4FCZ A;  3GRD A;  1M90 4;  1W00 A;  4FMA A;  1TU5 A;  2RSX A;  1OHO A;  1RKY A;  4RNZ A;  3LTA A;  5IEO A;  1FA3 A;  1JKG A;  1LOW A;  2BO9 B;  2F98 A;  2QGU A;  1SQW A;  3G0K A;  1QMA A;  5ELJ A;  1UI8 A;  3LYG A;  3LTB A;  4X2H A;  2GBX B;  1FGQ A;  1BNS A;  1ZO2 A;  1QJG A;  2Q07 A;  3NQY A;  4O3V A;  2UGI A;  3KFQ C;  3S27 A;  1BUJ A;  2K3D A;  3FF0 A;  5DRV A;  5G1L A;  2C4B A;  3URP A;  2XR8 B;  3NQZ A;  3I56 3;  2CWU A;  4NHF A;  5CLK A;  4PEJ A;  2HMJ B;  1SII A;  1E3R A;  3FG4 A;  1CEW I;  1FUS A;  1UCJ A;  3KCH A;  4HM4 B;  2CG1 A;  4AKY A;  4R1K A;  3S29 A;  3HIG A;  3OXA A;  3SXX A;  3CCR 3;  1RGE A;  3FG3 A;  1ZGX A;  3DGN A;  4J9A A;  1RGK A;  3DMC A;  4H61 A;  1UCL A;  3NV0 B;  1I2E A;  4IIA A;  4RBN A;  5ELU A;  2ML5 A;  2F56 A;  4O2H A;  1W01 A;  2W03 A;  1BGS A;  1YHQ 3;  5D82 A;  2BMR B;  1BSD A;  4N6V 0;  1ROV A;  3CME 3;  5D81 A;  3DGM A;  1RGF A;  1UI7 A;  3MSO A;  1YIT 3;  1MNL A;  3X42 A;  1SIH A;  3RGA A;  1W2B 2;  3D9R A;  1VQM 3;  1IT7 A;  1N9J A;  3LH4 A; 
#chains in the Genus database with same CATH homology
 5CF2 A;  3T8U A;  1Q40 B;  3EBY A;  3KE7 A;  4EC6 A;  1UW1 A;  5LC7 A;  1FUW A;  3CNX A;  3UL5 A;  3PYJ A;  1LNH A;  4WYK B;  3UJM A;  3K7C A;  3GWR A;  4HM6 B;  4O8S A;  2FNQ A;  2K54 A;  1EG9 B;  4L8P A;  3PGB A;  3GZY B;  2RGQ A;  3GAX A;  5JBS A;  1Q86 4;  3FSD A;  2Z77 A;  4X2O A;  4CDL A;  3CCL 3;  1YJW 3;  1M9G A;  3LTD A;  1ISK A;  3SOY A;  3X3X A;  3K0Z A;  5IG0 A;  1NO3 A;  3CNM A;  3CC7 3;  3S67 A;  3G16 A;  3BB9 A;  3WOF B;  4EXR A;  2CFD A;  4LEH A;  1US1 A;  4KFE A;  2CG0 A;  3HII A;  5A0O B;  1N8R 4;  2FGT A;  2WOF A;  2W04 A;  5AEW B;  1SJW A;  1PFP A;  4N6M A;  2STD A;  1KC8 4;  3MWZ A;  2Z76 A;  2XF3 A;  1IQ8 A;  1IQY A;  3JUM A;  1DYU A;  1IT8 A;  1UUV B;  1A90 A;  4L8O A;  2R4I A;  3CXC 2;  3H51 A;  3MHE A;  2QA4 3;  2CW9 A;  5IG3 A;  2K0M A;  3NM7 A;  1QAF A;  4HYZ A;  1DVC A;  3FZW A;  3OX9 A;  3OWU A;  2OOV A;  3ECF A;  3IJE B;  1OGZ A;  5IEN A;  3SX1 A;  3CD6 3;  3FF2 A;  4KFD A;  4LGQ A;  3O8Y A;  1R4C A;  1DMQ A;  2BNG A;  2HMK B;  2LQV A;  3EE1 A;  1A2K A;  1YVB I;  2W9P A;  3F40 A;  5I97 A;  4EBG A;  4FMB A;  5AIF A;  1N5P A;  1JB5 A;  4N6N B;  3WA3 A;  5KP3 A;  3CCE 3;  3F7X A;  2CC3 A;  1K9M 4;  1Q82 4;  1NB5 I;  2BMQ B;  3EX9 A;  5IEP A;  1C7H A;  4XBT A;  3F14 A;  5TGN A;  2P0X A;  3HI7 A;  5AIG A;  3CC2 3;  1W7C A;  3BNC A;  2FXT A;  3FH1 A;  2RCD A;  3U1W A;  1DVD A;  5STD A;  3JUP A;  2O3O A;  2GU3 A;  1JN5 B;  2P05 A;  4HM7 B;  3RGR A;  4HM8 B;  3GZB A;  4N6T A;  2GEX A;  3WDG B;  4KVH A;  3S5C A;  1NJI 4;  1HU9 A;  4G1M B;  4MEI A;  3GZX B;  1WQL B;  2CK3 H;  4AKZ A;  3X41 A;  3PS8 A;  4R9L A;  1WNH A;  1O7N B;  3IPT A;  5IG5 A;  2CHC A;  1LVN A;  2F86 B;  8CHO A;  1N9E A;  3KII A;  2HML B;  2I9W A;  5JPU A;  1W6Y A;  3D3L A;  3EC9 A;  3CC4 3;  1JB4 A;  2XSO B;  1YJ9 3;  4I4K A;  4RNY A;  1D6Y A;  1RJO A;  4STD A;  2W2C A;  3FCS B;  3KSP A;  2A15 A;  3MG1 A;  3L0R A;  2E2U A;  4J8T A;  1TFO A;  3EN8 A;  4KFF A;  1NU3 A;  2F99 A;  1GY5 A;  1QVF 2;  1N8Q A;  3F8X A;  5DRE A;  2QIY A;  1NWW A;  4N6O B;  2V1L A;  3NV0 A;  1IVW A;  2P09 A;  3QRD A;  3F7S A;  1DMN A;  3CPW 2;  4AEQ A;  4HM0 B;  1OAC A;  3I0Y A;  1GD3 A;  4LMI A;  2W56 A;  1OPY A;  2CFG A;  1AVL A;  1G96 A;  1K73 4;  3LZA A;  2PNC A;  2OOV C;  4HBR A;  3X3Y A;  4R80 A;  3V92 A;  3NXJ A;  1OGX A;  3DGL A;  2UX0 A;  1PU4 A;  1VQ4 3;  4WYK A;  5AIH A;  1T5Y A;  4RZM A;  1Q81 4;  1VQL 3;  2C10 A;  1Y4K A;  3JUQ A;  3LTC A;  4IPB A;  3V98 A;  1KSI A;  2W9Q A;  2YFI B;  3ALA A;  1BUQ A;  1VQK 3;  5AII A;  1K41 A;  4O02 B;  2YX9 A;  1YJN 3;  1VQ9 3;  1TFK A;  4OVM A;  3X40 A;  2OWP A;  1SPU A;  5AYR B;  3EF8 A;  1ROA A;  1OHP A;  1AR0 A;  1HKX A;  3T8N A;  1OF5 B;  1YI2 3;  1JRQ A;  3E99 A;  4FCJ A;  3QK9 A;  5EVH A;  1VQN 3;  5BXQ A;  5CF1 A;  3LXU X;  2CH9 A;  1Q7Y 4;  1VQO 3;  1OHS A;  3KKG A;  4HM3 B;  4WWU C;  3OW2 2;  2XH9 A;  4OK0 A;  4LZI A;  3I55 3;  2W0Q A;  3JUO A;  3LT9 A;  1LXE A;  1E97 A;  1GY7 A;  4N3V A;  1AV4 A;  3U97 A;  1WMP A;  4R9K A;  4MJD A;  5EQL A;  3DM8 A;  2ZDJ A;  3K9M C;  4TX4 A;  2YFL B;  1GYB A;  1CYU A;  2XGL A;  2IUK A;  2MC8 A;  3WMD A;  2OTJ 3;  3NUV A;  1AVK A;  3N54 B;  1GS3 A;  1TUH A;  5LC6 A;  3CPO A;  3V99 A;  1W2Z A;  1O7H B;  3M8C A;  1CYV A;  4FMC A;  1TP6 A;  1W02 A;  4FMD A;  4R4K A;  2JQ5 A;  5KP1 A;  2XEP A;  1RRH A;  2C11 A;  1LOX A;  2IUJ A;  3MG3 A;  3DUK A;  1IDP A;  1KQS 2;  1JB2 A;  2RFR A;  2INX A;  2JDI H;  4MMX B;  4CCV A;  2E2T A;  3BLZ A;  3NX0 A;  3STD A;  3EJV A;  1DMM A;  1ULJ B;  2GXF A;  3VF1 A;  3TDG A;  1UUW B;  2Z7A A;  4Q53 A;  3DZL A;  3AMO A;  3EN1 B;  3LT8 A;  5EEO A;  1OF5 A;  1A2V A;  2IA7 A;  3OWS A;  1VQ5 3;  4EV2 A;  2CFW A;  1EKM A;  4K61 A;  4HJL B;  2D1W A;  3G6E 3;  3EB8 A;  4FR9 A;  5FGO A;  2BT3 A;  2P38 A;  3EQQ B;  1FGT A;  3VGN A;  4N6L A;  1JV2 B;  5KP4 A;  3PXM A;  4LSO A;  3WA2 X;  3K63 A;  3T0U A;  3GZR A;  4HZB B;  4XB5 A;  2LYX A;  3SLU A;  1NB3 I;  4HM1 B;  3MYT A;  2XGN A;  1M1X B;  3CCS 3;  3HX8 A;  3PCS A;  1NDO B;  3IMA B;  3B4P A;  1J2B A;  3UL6 A;  4ZM8 A;  6STD A;  1YGE A;  7STD A;  4ORL A;  3G71 3;  3MG2 A;  4HM5 B;  3X3Z A;  2WGQ A;  3CCU 3;  3BNE A;  3NHX A;  1F8N A;  4HVN A;  4BTX A;  5JPP A;  5G2G A;  1JNQ A;  3BND A;  3DGO A;  3Q1C A;  1WMO A;  5CK6 A;  4BTW A;  2B24 B;  3CCJ 3;  2OCT A;  2WOH A;  2W56 B;  1L5G B;  4L7K A;  4XDV A;  1VZZ A;  3CCM 3;  2XRX B;  4JRF A;  4FCM A;  3JVC A;  3MKI A;  2CFL A;  1Q40 A;  1E3V A;  5IF6 A;  2CKF B;  1IVU A;  1S5A A;  1KWI A;  2CWV A;  5D83 A;  1OUN A;  1U5O A;  4XBX A;  1QAK A;  2OQE C;  1WMN A;  2Y73 A;  1D6U A;  1D6Z A;  4HZ9 B;  4QWT A;  3LML A;  1IVV A;  2PZV A;  2W6J H;  3A76 A;  3SED A;  1STD A;  1STF I;  3WOD G;  2QEX 3;  3HZP A;  1K8A 4;  3H3H A;  1FGR A;  3UB1 A;  3KN4 A;  4WP5 A;  1TIJ A;  4WFO A;  1ASK A;  2MF7 A;  3HK4 A;  1ULI B;  3EBT A;  1VQ6 3;  4MMY B;  1A67 A;  3F9S A;  1W4N A;  3UNL A;  1VQ8 3;  5AI1 A;  3OWY A;  5BVB A;  1GY6 A;  1EA2 A;  3OV4 A;  3WOE B;  3RDE A;  2E2V A;  1V74 A;  3Q90 A;  2XFT A;  5IER A;  1YIJ 3;  3Q2P A;  1OCV A;  2HMM B;  5IW9 A;  2GU1 A;  3B8L A;  1S72 3;  2D42 A;  2KXG A;  2ZL8 A;  4XBY A;  4K90 B;  1K28 A;  1MOL A;  2XSH B;  1QAL A;  3VSY A;  1IQX A;  3MPH A;  3PZW A;  2YFJ B;  1O7P B;  1EQK A;  1Z1S A;  2P0M A;  2GEY A;  4KZ1 A;  2KCD A;  3FG1 A;  3CCV 3;  4EYC A;  1OH0 A;  4U13 A;  3BNB A;  4K1U A;  1IU7 A;  1U8C B;  3PCR A;  3ROB A;  2KRT A;  2CIU A;  4OUQ A;  4EV5 A;  4H3U A;  4K1V A;  3FLJ A;  2M7O A;  1WTH A;  1O7M B;  2GBW B;  1W6G A;  2WO0 A;  2Y74 A;  3CU3 A;  1VQP 3;  4XM4 A;  4XDW A;  1O7G B;  2O9U X;  4GB5 A;  2WGO A;  5IG4 A;  5HGR A;  4HKV B;  5AEU B;  3K5T A;  3FGY A;  1W6C A;  3N8B A;  4GL6 A;  3SVA A;  3SOA A;  3LOY A;  2L4V A;  3AMO B;  1ZX2 A;  2OQE A;  3NBB A;  2CFK A;  3EHC A;  4MMZ B;  2HMO B;  4BTY A;  3NM2 A;  3N9H A;  2B1X B;  1IV9 A;  1M1K 4;  4WHA A;  4N6U A;  1FGO A;  5CXO A;  3S28 A;  2OTL 3;  1JN5 A;  1QVG 2;  3JUN A;  4JF8 A;  1KD1 4;  2IMJ A;  2ML6 A;  3DY5 A;  1RN7 A;  3FKA A;  4NRE A;  5FW5 A;  3B7C A;  1O7W B;  3KZT A;  1W5Z A;  1N5H A;  2HMN B;  1IV7 A;  3NBJ A;  3G4S 3;  2BHM A;  1CQS A;  3KSE D;  1IVX A;  3ER7 A;  3NBR A;  1VQ7 3;  2Z6B A;  1JKG B;  1Q42 A;  3G8Z A;  5AYS C;  4IT7 A;  3CMA 3;  3B4O A;  3CCQ 3;  1RRL A;  2BMO B;  1GD4 A;  2XFS A;  3J7Y d;  3F8H A;  2CWT A;  1JJ2 2;  1FGM A;  2SBL A;  4HM2 B;  3DXO A;  4FCZ A;  3GRD A;  1M90 4;  1W00 A;  4FMA A;  1TU5 A;  2RSX A;  1OHO A;  1RKY A;  4RNZ A;  3LTA A;  5IEO A;  1FA3 A;  1JKG A;  2BO9 B;  2F98 A;  2QGU A;  1SQW A;  3G0K A;  1QMA A;  5ELJ A;  1UI8 A;  3LYG A;  3LTB A;  4X2H A;  2GBX B;  1FGQ A;  1ZO2 A;  1QJG A;  2Q07 A;  3NQY A;  4O3V A;  3KFQ C;  3S27 A;  3FF0 A;  5DRV A;  2XR8 B;  3NQZ A;  3I56 3;  2CWU A;  4NHF A;  5CLK A;  4PEJ A;  2HMJ B;  1SII A;  1E3R A;  3FG4 A;  1CEW I;  4HM4 B;  2CG1 A;  4AKY A;  1IK3 A;  4R1K A;  3S29 A;  3HIG A;  3OXA A;  3SXX A;  3CCR 3;  3FG3 A;  3DGN A;  4J9A A;  3DMC A;  4H61 A;  3NV0 B;  4IIA A;  4RBN A;  5ELU A;  2ML5 A;  4O2H A;  1W01 A;  2W03 A;  1YHQ 3;  5D82 A;  2BMR B;  4N6V 0;  1ROV A;  3CME 3;  5D81 A;  3DGM A;  1YIT 3;  1UI7 A;  3MSO A;  1MNL A;  3X42 A;  1SIH A;  3RGA A;  1W2B 2;  3D9R A;  1VQM 3;  1IT7 A;  1N9J A;  3LH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...