1ASKA

Nuclear transport factor 2 (ntf2) h66a mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
b'GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQASITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Nuclear protein import is decreased by engineered mutants of nuclear transport factor 2 (NTF2) that do not bind GDP-Ran.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1askA00
3MKIA 5AIIA 4ORLA 1OHPA 5D82A 4J8TA 5CF2A 1O7WB 1O7NB 3T8NA 1BUQA 1OF5A 3OXAA 5AIFA 3KE7A 1SJWA 3LZAA 3NUVA 2BNGA 5IEPA 3RGAA 2CHCA 3H51A 3MG1A 5DREA 3SEDA 3GRDA 4WWUC 4R9LA 3OWYA 3EN1B 3F14A 3OV4A 4XBXA 3EBTA 2IMJA 1AR0A 1NWWA 4FCJA 5STDA 3A76A 4OVMA 3CNXA 4CDLA 1ZO2A 5AEUB 3D9RA 2HMNB 3E99A 2QGUA 5BXQA 4L8OA 5BVBA 2GBXB 1ASKA 3LYGA 3NM2A 1HKXA 3OX9A 3KKGA 5JPUA 2YFIB 5HGRA 1OGZA 2GEXA 3S5CA 3F8HA 3BB9A 4HM5B 1OH0A 2UX0A 4X2HA 5IG4A 8CHOA 1O7GB 4R1KA 1JKGB 3T8UA 3WMDA 5AEWB 3NBRA 4PEJA 4LMIA 4K1UA 2GXFA 3MG3A 5IG3A 3VSYA 1Q40B 3MYTA 4HM0B 4J9AA 3ER7A 2YFLB 3G16A 1UUWB 3FKAA 4U13A 1Z1SA 2HMJB 4HM7B 2PZVA 4RZMA 2XSHB 3SOYA 5KP3A 2F86B 3ROBA 2R4IA 3DMCA 2A15A 4HZ9B 5G2GA 3VGNA 2YFJB 1JKGA 1ULIB 3CNMA 3EBYA 2QIYA 2XRXB 3MG2A 1W02A 3ECFA 3FZWA 5CXOA 4X2OA 2STDA 3IPTA 1O7HB 1QMAA 3EC9A 2BMOB 1Q40A 5TGNA 1NU3A 4MJDA 1ULJB 3OWUA 3NXJA 3G8ZA 1EA2A 5FW5A 5CK6A 3UJMA 1W01A 5KP1A 3DM8A 3H3HA 1O7PB 5IERA 4HJLB 1W00A 5CLKA 3EX9A 5AI1A 4XBTA 1JB5A 3STDA 1OCVA 3EHCA 1QJGA 2I9WA 1EG9B 1W6YA 5IG0A 1UUVB 2Z76A 3B4PA 4K1VA 1Q42A 4HM3B 2INXA 3HX8A 5AIHA 4XDVA 4IIAA 2BMRB 3NV0B 6STDA 1WQLB 5IENA 4HM4B 5CF1A 4HM2B 1E3VA 2CKFB 4I4KA 1JN5B 5AIGA 2GBWB 1OGXA 3EF8A 5IEOA 3F9SA 4KVHA 4HZBB 1O7MB 3DZLA 3KZTA 3EQQB 3OWSA 4LGQA 1VZZA 1DMMA 2B1XB 3FF0A 1OPYA 4STDA 5IF6A 3KSPA 3SOAA 5IG5A 2HMMB 4H3UA 1JB4A 1E97A 3CU3A 3DXOA 1IDPA 3NHXA 4Q53A 3JUPA 3NV0A 4HVNA 2Z7AA 2BMQB 3F8XA 3F7XA 2RGQA 1OUNA 3K7CA 4HKVB 2F98A 1S5AA 5KP4A 1JN5A 4XM4A 3EN8A 3M8CA 1A2KA 3GZBA 3EJVA 3FSDA 3GZYB 3GWRA 4WP5A 3CPOA 4WYKB 1K41A 3FGYA 3RGRA 3K0ZA 1ISKA 4L8PA 2W2CA 1GYBA 3F7SA 5EVHA 3FLJA 2RCDA 5D83A 3GZXB 4HM8B 4HM1B 4GB5A 1E3RA 3G0KA 3JUQA 3HK4A 1U5OA 1ZX2A 3JUMA 2Z77A 2RFRA 3FH1A 1NDOB 4FCMA 4LEHA 7STDA 1STDA 1TP6A 3B8LA 4R9KA 1OHSA 3DUKA 1TUHA 1GY5A 2XSOB 2B24B 4WYKA 4L7KA 1JB2A 5D81A 3I0YA 3F40A 2GEYA 2XR8B 4XB5A 3GZRA 1CQSA 2HMLB 4HM6B 1OF5B 5JPPA 3FF2A 3MHEA 2HMKB 2HMOB 2OWPA 3Q90A 3JUOA 5DRVA 3MSOA 3JUNA 1GY6A 4N3VA 3B7CA 1DMQA 1C7HA 1OHOA 1GS3A 4XBYA 3B4OA 1DMNA 4XDWA 3HZPA 1GY7A 2F99A 2JQ5A 4OUQA 3BLZA 2K54A 3UNLA
chains in the Genus database with same CATH superfamily
1VQK3 4TX4A 4CJNA 3MKIA 5AIIA 2W0QA 4ORLA 1FUWA 3G4S3 4LYLB 1OHPA 4DKIA 2FXTA 1R4YA 1W6CA 1Q7Y4 2QA43 3ALAA 3BNEA 1N5PA 5D82A 4J8TA 2KRTA 5CF2A 3J7Yd 3CCL3 1O7WB 3U97A 1O7NB 4BL2A 1JZDA 3T8NA 1BUQA 1LOXA 1OF5A 1RGEA 3OXAA 5AIFA 3CCQ3 3AGNA 2HOHA 1BSDA 2W56B 3KE7A 3X41A 1IYYA 1SJWA 1STFI 3WA3A 1I0VA 1RSNA 1SPUA 1IQYA 3LZAA 3G713 3NUVA 4O3VA 1VQ63 1W5ZA 2BNGA 5IEPA 1JV2B 1EEJA 1SARA 3RGAA 3DGOA 5GSPA 3SXXA 2CHCA 3H51A 3MG1A 3X3XA 4EBGA 3HOHA 5LC6A 1BRGA 1BNEA 1UGIA 1FGRA 5DREA 3NX0A 5M18A 1D6YA 1I0XA 1DVCA 3SYUA 1BRNL 1YJW3 2UUGC 1RHLA 3SEDA 3PCSA 3GRDA 1Q9EA 4WWUC 2JDIH 4BTXA 1VQM3 1OACA 1X1YA 4R9LA 3OWYA 2CC3A 3EN1B 3F14A 3OV4A 4XBXA 4ZM8A 1VQP3 2E2TA 2FGTA 3NBJA 3CCM3 1GMRA 4CPKA 3G6E3 5AYRB 3EBTA 1M904 2IMJA 2OTL3 3CD63 1AR0A 2H0HA 3CCE3 2E2VA 1NWWA 3LT9A 5FGOA 3K5TA 4FCJA 1IVVA 2KXGA 5STDA 3FCSB 1JBSA 3A76A 1X1UA 4OVMA 3CNXA 1FGMA 1FYSA 2OCTA 1LRAA 4CDLA 3LXUX 4EC6A 1Q814 2IUJA 2FNQA 4AEQA 6GSPA 1ZO2A 4KFDA 5AEUB 2BU4A 3D9RA 1AY7A 3PYJA 3TDGA 1BNIA 4NPBA 2HMNB 1W6GA 2L1SA 3E99A 5EEOA 2QGUA 4JRFA 1VQN3 4BL3A 1A2PA 5BXQA 4L8OA 5BVBA 1UGHI 3KSED 1J2BA 2SARA 2GBXB 5AYSC 2GU1A 2W56A 1ASKA 1MOLA 2CX1A 3NM7A 3CCV3 3Q1CA 3DGNA 3LYGA 1HU9A 1RCKA 1N8QA 1BNJA 1R4CA 3S29A 5RNTA 3I563 3NM2A 1HKXA 3OX9A 3DGLA 3KKGA 5JPUA 2OTJ3 1MWSA 1ZGXA 4AKYA 2KF5A 4O2HA 1BNGA 1VQ73 2YFIB 5HGRA 1GOVA 1A90A 1V57A 1OGZA 2GEXA 3CXC2 1YHQ3 3D4AA 3CC23 2CFDA 4IT7A 3S5CA 1Y4KA 5EQLA 3CC43 4R4KA 1UUGB 3F8HA 1YJ93 3BB9A 4HM5B 3UL5A 1OH0A 2IUKA 2UX0A 4X2HA 2MF7A 3D5IA 3PGBA 5IG4A 1CH0A 4EXRA 3X3ZA 1O7GB 3WODG 4BU4A 8CHOA 1ROVA 4R1KA 1JKGB 3WOEB 3WOFB 1JJ22 3CPW2 4GSPA 3CCS3 2YX9A 3T8UA 4LZIA 1PYLA 5ELUA 3WMDA 4BTYA 5AEWB 3RDEA 3QRDA 4R80A 3NBRA 4PEJA 5BIRA 2K3DA 4LMIA 4K1UA 2GXFA 1CYUA 1UCJA 7RNTA 1BOXA 1FUSA 1RN1A 3CC73 2WOHA 3LH4A 2WO0A 2GSPA 3MG3A 3CCR3 1N5HA 1TTOA 2CX0A 2Y74A 5IG3A 3VSYA 1Q40B 4QWTA 3MYTA 4HM0B 1RGFA 4J9AA 3ER7A 3V98A 1QAKA 1RNBA 2Q07A 2YFLB 3G16A 1JRQA 1UUWB 3FKAA 3IMAB 4U13A 1N9EA 3O8YA 4WHAA 1Z1SA 3EE1A 2F56A 2HMJB 2J8XB 1YI23 1Q864 4HM7B 3V99A 1YIT3 4FMBA 3AGOA 1DE3A 2PZVA 3D79A 4RZMA 1QAFA 2XSHB 3SOYA 2F86B 5KP3A 3ROBA 2PNCA 2R4IA 3DMCA 1YIJ3 2A15A 4HZ9B 5G2GA 1BAOA 3LT8A 1B2SA 1N9JA 3FG4A 4FCZA 4WFOA 5HOHA 3SLUA 1YVSA 2CW9A 2RBIA 1C54A 1MNLA 1M9GA 4N6NB 3VGNA 3ZFZA 1BRHA 1LXEA 2YFJB 2AAEA 3PZWA 5A0OB 3D3LA 1JKGA 1ULIB 2MC8A 1KC84 3CNMA 3EBYA 2QIYA 2XRXB 3MG2A 3S27A 3X3YA 1W02A 1DYUA 2CH9A 3ECFA 1RMSA 2E2UA 3FZWA 4J5KA 5CXOA 5JBSA 1GOUA 1VQQA 1IQXA 4X2OA 3UL6A 2XH9A 3JVCA 2STDA 2IYJA 1O7HB 3IPTA 1MWTA 1FGTA 3LTCA 4K61A 3N8BA 2W6JH 1QMAA 2ML6A 3EC9A 2BO9B 2BMOB 2SBLA 3BNDA 1EUIC 1Q40A 1TIJA 5TGNA 1NU3A 1MGWA 4MJDA 1B2XA 1RDSA 1ULJB 1YGEA 4HYZA 1LQGC 1TU5A 1VQL3 1YGWA 1FGQA 2CWVA 1YJN3 1BRIA 1Q7HA 1A67A 4I5QA 3WDGB 4BIRA 1UI8A 1PU4A 3OWUA 3NXJA 1T5YA 3G8ZA 1SQWA 1EA2A 1AVKA 5FW5A 5CK6A 3UJMA 1W01A 2CIUA 5KP1A 1K8A4 2R41A 3D5GA 3DM8A 3DY5A 3H3HA 1AQZA 1LOYA 1QALA 8RNTA 2C4BA 1O7PB 1RCLA 4HJLB 4FMAA 1RRHA 1RN4A 1W00A 1ZS7A 2M7OA 4H61A 5CLKA 3EX9A 2Y73A 3HIIA 5AI1A 5M19A 1B27A 2AADA 3BNBA 1JB5A 4XBTA 1M1K4 1B2UA 4NREA 1G96A 2XF3A 4FMCA 1I70A 1KD14 1GD3A 3STDA 3IJEB 1T2IA 1U8CB 1JNQA 3GSPA 1OCVA 1TFOA 2W04A 3EHCA 1QJGA 2I9WA 1EG9B 1BVIA 4EV2A 1BU4A 1IT8A 1JBTA 1W6YA 3CCU3 5IG0A 1W4NA 1HYFA 2CFGA 2O9UX 3SX1A 1UDII 3U1WA 1UUVB 3MPHA 1NJI4 5M1AA 2Z76A 3B4PA 4K1VA 5IERA 2OOVC 3LTDA 1Q42A 3LTAA 4HM3B 1S723 1DETA 3NBBA 1IU7A 1AV4A 2INXA 2D1WA 3HX8A 4HBRA 3SVAA 4OK0A 5AIHA 1D6ZA 4XDVA 3KIIA 4IIAA 1B2ZA 1D6UA 2KF3A 4G1MB 2BMRB 3NV0B 6STDA 4FMDA 1W2ZA 4EV5A 3FG3A 1NNVA 1WQLB 5G1LA 2O3OA 1UI7A 3WR2A 1IQ8A 5IENA 2P09A 1K28A 3QK9A 1FW7A 4HM4B 5CF1A 4HM2B 1EQKA 1E3VA 3KCHA 1I2GA 2CKFB 2RSXA 2ZL8A 4I4KA 1WMNA 1BRKA 1SIHA 1JN5B 5AIGA 2CWTA 4EW5A 2P0MA 4KFEA 1W2B2 2GBWB 1OGXA 2KAAA 3EF8A 3F9SA 4KT3B 5IEOA 2XEPA 4KVHA 4HZBB 1O7MB 6RNTA 2BT3A 3DZLA 3KZTA 3LOYA 1LOWA 4CCVA 9RNTA 2CK3H 2F5MA 4N6MA 3EQQB 4BTWA 3CCJ3 3OWSA 4LGQA 1IT7A 2B1XB 1DMMA 1VZZA 1X1XA 1W7CA 3FF0A 1OPYA 3CMA3 1WMOA 4JF8A 1LNHA 4STDA 2BHMA 5IF6A 2RNTA 1X1WA 1BSBA 1M1XB 2CFKA 3KSPA 1JBRA 1I3FA 3SOAA 5IG5A 5G1KA 2HMMB 4O02B 2K0MA 1LQMB 4N6LA 4H3UA 2OQEC 1JB4A 1BSAA 1E97A 3CU3A 3DGYA 1RGAA 3DXOA 2ZA4A 1B21A 2D42A 3DH2A 1IDPA 3NHXA 3WHOA 2W03A 4LSOA 4Q53A 4MEIA 1VQ53 3JUPA 1GOYA 3NV0A 4HVNA 2Z7AA 3LMLA 2BMQB 1WNHA 3F8XA 4AKZA 1IVXA 3F7XA 2RGQA 3WA2X 1OUNA 3FG1A 3RNTA 2CG1A 2CG0A 2LQVA 3K7CA 1I2EA 3URPA 2CFLA 4HKVB 1BSCA 1LNIA 1IV9A 1BSEA 1RN7A 2F98A 3BNCA 4MMXB 2P38A 1S5AA 2KF4A 2W9QA 5ELJA 3K9MC 4RNTA 5KP4A 1JN5A 1YNVX 3EN8A 3M8CA 2V1LA 4XM4A 1A2KA 1AVLA 1EKMA 3GZBA 1RKYA 3I553 1CYVA 1MGRA 3N54B 3EJVA 2F5WA 2H0GA 1FUTA 2IY2A 2UGIA 3ZG0A 1B3SA 3FSDA 4RBNA 3UB1A 5IW9A 1I8VA 3GZYB 3GWRA 1IV7A 3PCRA 3A5EA 3CPOA 1B20A 1K41A 4WP5A 4WYKB 3FGYA 3KN4A 1BRJA 2IA7A 1RNTA 1TFKA 2C10A 3RGRA 1N8R4 2C11A 2ZDJA 2ML5A 3BIRA 4N6V0 1ROAA 1BANA 1I2FA 1WMPA 3HIGA 3KFQC 4HOHA 3K0ZA 1ISKA 2XFTA 2GU3A 4L8PA 5LC7A 2W2CA 1GYBA 1NB3I 3F7SA 2L4VA 5EVHA 1BUJA 1T2HA 1RGLA 3FLJA 2RCDA 4MMYB 5D83A 1UCLA 3GZXB 4HM8B 4HM1B 4GB5A 3ZG5A 7GSPA 1K734 4K90B 1E3RA 2F4YA 2WOFA 3DGMA 3G0KA 4ILFA 2P05A 3NQYA 3JUQA 3UNLA 3HK4A 1U5OA 4RNZA 1ZX2A 3JUMA 1VQ83 2BIRA 2Z77A 4KZ1A 2RFRA 4FR9A 1BIRA 1IVUA 2W9PA 1A2VA 1B2MA 3FH1A 1NDOB 4FCMA 1GSPA 1BNRA 4N6UA 4GL6A 1RGCA 1BGSA 4LEHA 1T3BA 1PY3A 2P0XA 3T0UA 1NB5I 7STDA 1STDA 1IK3A 1UCKA 4HAAA 3OW22 1UCIA 1TP6A 3B8LA 5BU4A 1MWUA 1BNSA 2OOVA 4R9KA 1KQS2 1OHSA 3DUKA 3AHWA 1TJDA 1FGOA 3EB8A 1TUHA 3K63A 3N9HA 1GY5A 1V58A 1DVDA 2XSOB 1US1A 1G0TA 2XFSA 4NHFA 2B24B 4MMZB 1IVWA 4WYKA 1TRPA 1RLSA 3L0RA 1RRLA 3CME3 4L7KA 1JB2A 1NO3A 3AMOB 5D81A 3I0YA 1JZOA 3F40A 1TRQA 1WTHA 1MWRA 4J5GA 2CWUA 2GEYA 2XR8B 1GMPA 2H0IA 3MWZA 4XB5A 1K9M4 2XGLA 1FZUA 1YVBI 1V74A 2KF6A 3GZRA 4EYCA 2Z6BA 1UW1A 1G02A 1F8NA 1BRSA 1KWIA 1LOVA 1CQSA 1L5GB 2HMLB 4HM6B 1RJOA 1OF5B 2WGOA 2LYXA 1Q824 5JPPA 3FF2A 2KCDA 2XGNA 3MHEA 2HMKB 3BU4A 2WGQA 2CFWA 1PFPA 1VQO3 3PXMA 1RGHA 3VF1A 3Q3FA 2HMOB 3AHSA 1QVF2 1KSIA 3PS8A 4IPBA 4O8SA 2OWPA 3NQZA 1I3IA 3HI7A 3Q90A 4N6OB 3JUOA 4GHOA 5DRVA 3Q2PA 3MSOA 3JUNA 1GY6A 1BNFA 4N3VA 3B7CA 1DMQA 1C7HA 4RNYA 1CEWI 1OHOA 3V92A 2ZHXB 5I97A 3X42A 1GS3A 4XBYA 1SIIA 3B4OA 1DMNA 4XDWA 1VQ43 1GD4A 1HZ1A 1RGGA 2QEX3 1VQ93 3LTBA 1QVG2 3HZPA 4N6TA 1GY7A 2OQEA 3S28A 4KFFA 1FA3A 3X40A 3GAXA 2F99A 1LVNA 1RTUA 2JQ5A 4OUQA 3BLZA 2K54A 1RGKA 3S67A 3AMOA 1GMQA
chains in the Genus database with same CATH topology
1VQK3 4TX4A 3MKIA 5AIIA 2W0QA 4ORLA 1FUWA 3G4S3 1OHPA 2FXTA 1W6CA 1Q7Y4 2QA43 3ALAA 3BNEA 1N5PA 5D82A 4J8TA 2KRTA 5CF2A 3J7Yd 3CCL3 1O7WB 3U97A 1O7NB 3T8NA 1BUQA 1LOXA 1OF5A 3OXAA 5AIFA 3CCQ3 2W56B 3X41A 3KE7A 1SJWA 1STFI 3WA3A 1SPUA 1IQYA 3LZAA 3G713 3NUVA 4O3VA 1VQ63 1W5ZA 2BNGA 5IEPA 1JV2B 3RGAA 3DGOA 3SXXA 2CHCA 3H51A 3MG1A 3X3XA 4EBGA 5LC6A 5DREA 1FGRA 3NX0A 1D6YA 1DVCA 1YJW3 3SEDA 3PCSA 3GRDA 4WWUC 2JDIH 4BTXA 1VQM3 1OACA 4R9LA 1VQP3 3OWYA 2CC3A 3EN1B 3F14A 3OV4A 4XBXA 4ZM8A 2E2TA 2FGTA 3NBJA 3CCM3 3G6E3 5AYRB 3EBTA 1M904 2IMJA 2OTL3 3CD63 1AR0A 3CCE3 2E2VA 1NWWA 3LT9A 5FGOA 3K5TA 4FCJA 1IVVA 2KXGA 5STDA 3FCSB 3A76A 4OVMA 3CNXA 1FGMA 2OCTA 4CDLA 3LXUX 4EC6A 1Q814 2IUJA 2FNQA 4AEQA 1ZO2A 4KFDA 5AEUB 3D9RA 3TDGA 3PYJA 2HMNB 1W6GA 3E99A 5EEOA 2QGUA 4JRFA 1VQN3 5BXQA 4L8OA 5BVBA 3KSED 1J2BA 2GBXB 5AYSC 2GU1A 2W56A 1ASKA 1MOLA 3NM7A 3CCV3 3Q1CA 3DGNA 3LYGA 1HU9A 1N8QA 1R4CA 3S29A 3I563 3NM2A 1HKXA 3OX9A 3DGLA 3KKGA 5JPUA 2OTJ3 4AKYA 4O2HA 1VQ73 2YFIB 5HGRA 1A90A 1OGZA 2GEXA 3CXC2 1YHQ3 3CC23 2CFDA 4IT7A 3S5CA 1Y4KA 5EQLA 3CC43 4R4KA 3F8HA 1YJ93 3BB9A 4HM5B 3UL5A 1OH0A 2IUKA 2UX0A 4X2HA 2MF7A 3PGBA 5IG4A 4EXRA 3X3ZA 1O7GB 3WODG 8CHOA 1ROVA 4R1KA 1JKGB 3WOEB 3WOFB 1JJ22 3CPW2 3CCS3 2YX9A 3T8UA 4LZIA 5ELUA 3WMDA 4BTYA 5AEWB 3RDEA 3QRDA 4R80A 3NBRA 4PEJA 4LMIA 4K1UA 2GXFA 1CYUA 3CC73 2WOHA 3LH4A 2WO0A 3MG3A 3CCR3 1N5HA 5IG3A 2Y74A 3VSYA 1Q40B 4QWTA 3MYTA 4HM0B 4J9AA 3ER7A 3V98A 1QAKA 2Q07A 2YFLB 3G16A 1JRQA 1UUWB 3FKAA 3IMAB 4U13A 1N9EA 3O8YA 4WHAA 1Z1SA 3EE1A 2HMJB 1YI23 1Q864 4HM7B 3V99A 1YIT3 4FMBA 2PZVA 4RZMA 1QAFA 2XSHB 3SOYA 2F86B 5KP3A 3ROBA 2PNCA 2R4IA 3DMCA 1YIJ3 2A15A 4HZ9B 5G2GA 3LT8A 4WFOA 1N9JA 3FG4A 4FCZA 3SLUA 2CW9A 1MNLA 1M9GA 4N6NB 3VGNA 1LXEA 2YFJB 3PZWA 5A0OB 3D3LA 1JKGA 1ULIB 2MC8A 1KC84 3CNMA 3EBYA 2QIYA 2XRXB 3MG2A 3S27A 3X3YA 1W02A 1DYUA 2CH9A 3ECFA 3FZWA 2E2UA 5JBSA 5CXOA 1IQXA 4X2OA 3UL6A 2XH9A 3JVCA 2STDA 3IPTA 1O7HB 1FGTA 3LTCA 4K61A 3N8BA 2W6JH 1QMAA 2ML6A 3EC9A 2BO9B 2BMOB 2SBLA 3BNDA 1Q40A 1TIJA 5TGNA 1NU3A 4MJDA 1TU5A 1ULJB 1YGEA 4HYZA 1VQL3 2CWVA 1FGQA 1YJN3 1A67A 1PU4A 3WDGB 1UI8A 3OWUA 3NXJA 1T5YA 3G8ZA 1SQWA 1EA2A 1AVKA 5FW5A 5CK6A 3UJMA 1W01A 2CIUA 5KP1A 1K8A4 3DM8A 3DY5A 3H3HA 1QALA 1O7PB 5IERA 4HJLB 4FMAA 1RRHA 4H61A 1W00A 2M7OA 5CLKA 3EX9A 2Y73A 3HIIA 5AI1A 1M1K4 3BNBA 4XBTA 1JB5A 4NREA 1G96A 2XF3A 4FMCA 1KD14 1GD3A 3STDA 3IJEB 1U8CB 1JNQA 1OCVA 1TFOA 2W04A 3EHCA 1QJGA 2I9WA 1EG9B 4EV2A 1IT8A 1W6YA 3CCU3 5IG0A 1W4NA 2CFGA 2O9UX 3SX1A 3U1WA 1UUVB 3MPHA 1NJI4 2Z76A 3B4PA 4K1VA 2OOVC 3LTDA 1Q42A 3LTAA 4HM3B 1S723 3NBBA 1IU7A 1AV4A 2INXA 2D1WA 3HX8A 4HBRA 3SVAA 4OK0A 5AIHA 1D6ZA 4XDVA 3KIIA 4IIAA 1D6UA 4G1MB 2BMRB 3NV0B 6STDA 4FMDA 1W2ZA 4EV5A 3FG3A 1WQLB 2O3OA 1UI7A 1IQ8A 5IENA 2P09A 1K28A 3QK9A 4HM4B 5CF1A 4HM2B 1EQKA 1E3VA 2CKFB 2RSXA 2ZL8A 4I4KA 1WMNA 1SIHA 1JN5B 5AIGA 2CWTA 2P0MA 4KFEA 1W2B2 2GBWB 1OGXA 3EF8A 3F9SA 5IEOA 2XEPA 4KVHA 4HZBB 1O7MB 2BT3A 3DZLA 3KZTA 3LOYA 4CCVA 2CK3H 4N6MA 3EQQB 4BTWA 3CCJ3 3OWSA 4LGQA 1IT7A 1VZZA 1DMMA 2B1XB 3FF0A 1W7CA 1OPYA 3CMA3 1WMOA 4JF8A 1LNHA 4STDA 2BHMA 5IF6A 1M1XB 2CFKA 3KSPA 3SOAA 5IG5A 2HMMB 4O02B 2K0MA 4N6LA 4H3UA 2OQEC 1JB4A 1E97A 3CU3A 3DXOA 2D42A 1IDPA 3NHXA 2W03A 4LSOA 4Q53A 4MEIA 1VQ53 3JUPA 3NV0A 4HVNA 2Z7AA 3LMLA 2BMQB 1WNHA 3F8XA 4AKZA 1IVXA 3F7XA 2RGQA 3WA2X 1OUNA 3FG1A 2CG1A 2CG0A 2LQVA 3K7CA 2CFLA 4HKVB 1IV9A 1RN7A 3BNCA 2F98A 4MMXB 2P38A 1S5AA 2W9QA 5ELJA 3K9MC 5KP4A 1JN5A 4XM4A 3EN8A 3M8CA 2V1LA 1A2KA 1AVLA 1EKMA 3GZBA 1RKYA 3I553 1CYVA 3N54B 3EJVA 3FSDA 4RBNA 3UB1A 5IW9A 3GZYB 3GWRA 1IV7A 3PCRA 3CPOA 4WP5A 4WYKB 1K41A 3FGYA 3KN4A 2IA7A 1TFKA 2C10A 3RGRA 1N8R4 2C11A 2ZDJA 2ML5A 4N6V0 1ROAA 1WMPA 3HIGA 3KFQC 3K0ZA 1ISKA 2XFTA 2GU3A 4L8PA 5LC7A 2W2CA 1GYBA 1NB3I 3F7SA 2L4VA 5EVHA 3FLJA 2RCDA 4MMYB 5D83A 3GZXB 4HM8B 4HM1B 4GB5A 1K734 1E3RA 2WOFA 3DGMA 3G0KA 2P05A 3NQYA 3JUQA 3UNLA 3HK4A 1U5OA 4RNZA 1ZX2A 3JUMA 1VQ83 2Z77A 4KZ1A 2RFRA 4FR9A 1IVUA 2W9PA 1A2VA 3FH1A 1NDOB 4FCMA 4N6UA 4GL6A 4LEHA 2P0XA 3T0UA 1NB5I 7STDA 1STDA 1IK3A 3OW22 1TP6A 3B8LA 2OOVA 1KQS2 4R9KA 1OHSA 3DUKA 3EB8A 1FGOA 3N9HA 1TUHA 3K63A 1DVDA 1GY5A 2XSOB 1US1A 2XFSA 4NHFA 2B24B 4MMZB 1IVWA 4WYKA 3L0RA 1RRLA 3CME3 4L7KA 1JB2A 1NO3A 3AMOB 5D81A 3I0YA 3F40A 1WTHA 2CWUA 2GEYA 2XR8B 3MWZA 4XB5A 1K9M4 2XGLA 1YVBI 4EYCA 1V74A 3GZRA 2Z6BA 1UW1A 1F8NA 1L5GB 1KWIA 1CQSA 2HMLB 4HM6B 1RJOA 1OF5B 2WGOA 2LYXA 1Q824 5JPPA 3FF2A 2KCDA 2XGNA 3MHEA 2HMKB 2WGQA 2CFWA 1PFPA 1VQO3 3PXMA 1QVF2 3VF1A 2HMOB 1KSIA 3PS8A 4IPBA 4O8SA 2OWPA 3NQZA 3HI7A 3Q90A 4N6OB 3JUOA 5DRVA 3Q2PA 3MSOA 3JUNA 1GY6A 4N3VA 3B7CA 1DMQA 1C7HA 4RNYA 1CEWI 1OHOA 3V92A 5I97A 3X42A 1GS3A 4XBYA 1SIIA 3B4OA 1DMNA 4XDWA 1VQ43 1GD4A 1VQ93 2QEX3 3LTBA 1QVG2 3HZPA 4N6TA 1GY7A 2OQEA 3S28A 4KFFA 1FA3A 3X40A 3GAXA 2F99A 1LVNA 2JQ5A 4OUQA 3BLZA 2K54A 4K90B 3S67A 3AMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKI A;  5AII A;  4ORL A;  1OHP A;  5D82 A;  4J8T A;  5CF2 A;  1O7W B;  1O7N B;  3T8N A;  1BUQ A;  1OF5 A;  3OXA A;  5AIF A;  3KE7 A;  1SJW A;  3LZA A;  3NUV A;  2BNG A;  5IEP A;  3RGA A;  2CHC A;  3H51 A;  3MG1 A;  5DRE A;  3SED A;  3GRD A;  4WWU C;  4R9L A;  3OWY A;  3EN1 B;  3F14 A;  3OV4 A;  4XBX A;  3EBT A;  2IMJ A;  1AR0 A;  1NWW A;  4FCJ A;  5STD A;  3A76 A;  4OVM A;  3CNX A;  4CDL A;  1ZO2 A;  5AEU B;  3D9R A;  2HMN B;  3E99 A;  2QGU A;  5BXQ A;  4L8O A;  5BVB A;  2GBX B;  1ASK A;  3LYG A;  3NM2 A;  1HKX A;  3OX9 A;  3KKG A;  5JPU A;  2YFI B;  5HGR A;  1OGZ A;  2GEX A;  3S5C A;  3F8H A;  3BB9 A;  4HM5 B;  1OH0 A;  2UX0 A;  4X2H A;  5IG4 A;  8CHO A;  1O7G B;  4R1K A;  1JKG B;  3T8U A;  3WMD A;  5AEW B;  3NBR A;  4PEJ A;  4LMI A;  4K1U A;  2GXF A;  3MG3 A;  5IG3 A;  3VSY A;  1Q40 B;  3MYT A;  4HM0 B;  4J9A A;  3ER7 A;  2YFL B;  3G16 A;  1UUW B;  3FKA A;  4U13 A;  1Z1S A;  2HMJ B;  4HM7 B;  2PZV A;  4RZM A;  2XSH B;  3SOY A;  5KP3 A;  2F86 B;  3ROB A;  2R4I A;  3DMC A;  2A15 A;  4HZ9 B;  5G2G A;  3VGN A;  2YFJ B;  1JKG A;  1ULI B;  3CNM A;  3EBY A;  2QIY A;  2XRX B;  3MG2 A;  1W02 A;  3ECF A;  3FZW A;  5CXO A;  4X2O A;  2STD A;  3IPT A;  1O7H B;  1QMA A;  3EC9 A;  2BMO B;  1Q40 A;  5TGN A;  1NU3 A;  4MJD A;  1ULJ B;  3OWU A;  3NXJ A;  3G8Z A;  1EA2 A;  5FW5 A;  5CK6 A;  3UJM A;  1W01 A;  5KP1 A;  3DM8 A;  3H3H A;  1O7P B;  5IER A;  4HJL B;  1W00 A;  5CLK A;  3EX9 A;  5AI1 A;  4XBT A;  1JB5 A;  3STD A;  1OCV A;  3EHC A;  1QJG A;  2I9W A;  1EG9 B;  1W6Y A;  5IG0 A;  1UUV B;  2Z76 A;  3B4P A;  4K1V A;  1Q42 A;  4HM3 B;  2INX A;  3HX8 A;  5AIH A;  4XDV A;  4IIA A;  2BMR B;  3NV0 B;  6STD A;  1WQL B;  5IEN A;  4HM4 B;  5CF1 A;  4HM2 B;  1E3V A;  2CKF B;  4I4K A;  1JN5 B;  5AIG A;  2GBW B;  1OGX A;  3EF8 A;  5IEO A;  3F9S A;  4KVH A;  4HZB B;  1O7M B;  3DZL A;  3KZT A;  3EQQ B;  3OWS A;  4LGQ A;  1VZZ A;  1DMM A;  2B1X B;  3FF0 A;  1OPY A;  4STD A;  5IF6 A;  3KSP A;  3SOA A;  5IG5 A;  2HMM B;  4H3U A;  1JB4 A;  1E97 A;  3CU3 A;  3DXO A;  1IDP A;  3NHX A;  4Q53 A;  3JUP A;  3NV0 A;  4HVN A;  2Z7A A;  2BMQ B;  3F8X A;  3F7X A;  2RGQ A;  1OUN A;  3K7C A;  4HKV B;  2F98 A;  1S5A A;  5KP4 A;  1JN5 A;  4XM4 A;  3EN8 A;  3M8C A;  1A2K A;  3GZB A;  3EJV A;  3FSD A;  3GZY B;  3GWR A;  4WP5 A;  3CPO A;  4WYK B;  1K41 A;  3FGY A;  3RGR A;  3K0Z A;  1ISK A;  4L8P A;  2W2C A;  1GYB A;  3F7S A;  5EVH A;  3FLJ A;  2RCD A;  5D83 A;  3GZX B;  4HM8 B;  4HM1 B;  4GB5 A;  1E3R A;  3G0K A;  3JUQ A;  3HK4 A;  1U5O A;  1ZX2 A;  3JUM A;  2Z77 A;  2RFR A;  3FH1 A;  1NDO B;  4FCM A;  4LEH A;  7STD A;  1STD A;  1TP6 A;  3B8L A;  4R9K A;  1OHS A;  3DUK A;  1TUH A;  1GY5 A;  2XSO B;  2B24 B;  4WYK A;  4L7K A;  1JB2 A;  5D81 A;  3I0Y A;  3F40 A;  2GEY A;  2XR8 B;  4XB5 A;  3GZR A;  1CQS A;  2HML B;  4HM6 B;  1OF5 B;  5JPP A;  3FF2 A;  3MHE A;  2HMK B;  2HMO B;  2OWP A;  3Q90 A;  3JUO A;  5DRV A;  3MSO A;  3JUN A;  1GY6 A;  4N3V A;  3B7C A;  1DMQ A;  1C7H A;  1OHO A;  1GS3 A;  4XBY A;  3B4O A;  1DMN A;  4XDW A;  3HZP A;  1GY7 A;  2F99 A;  2JQ5 A;  4OUQ A;  3BLZ A;  2K54 A;  3UNL A; 
#chains in the Genus database with same CATH topology
 1VQK 3;  4TX4 A;  4CJN A;  3MKI A;  5AII A;  2W0Q A;  4ORL A;  1FUW A;  3G4S 3;  4LYL B;  1OHP A;  4DKI A;  2FXT A;  1R4Y A;  1W6C A;  1Q7Y 4;  2QA4 3;  3ALA A;  3BNE A;  1N5P A;  5D82 A;  4J8T A;  2KRT A;  5CF2 A;  3J7Y d;  3CCL 3;  1O7W B;  3U97 A;  1O7N B;  4BL2 A;  1JZD A;  3T8N A;  1BUQ A;  1LOX A;  1OF5 A;  1RGE A;  3OXA A;  5AIF A;  3CCQ 3;  3AGN A;  2HOH A;  1BSD A;  2W56 B;  3KE7 A;  3X41 A;  1IYY A;  1SJW A;  1STF I;  3WA3 A;  1I0V A;  1RSN A;  1SPU A;  1IQY A;  3LZA A;  3G71 3;  3NUV A;  4O3V A;  1VQ6 3;  1W5Z A;  2BNG A;  5IEP A;  1JV2 B;  1EEJ A;  1SAR A;  3RGA A;  3DGO A;  5GSP A;  3SXX A;  2CHC A;  3H51 A;  3MG1 A;  3X3X A;  4EBG A;  3HOH A;  5LC6 A;  1BRG A;  1BNE A;  1UGI A;  1FGR A;  5DRE A;  3NX0 A;  5M18 A;  1D6Y A;  1I0X A;  1DVC A;  3SYU A;  1BRN L;  1YJW 3;  2UUG C;  1RHL A;  3SED A;  3PCS A;  3GRD A;  1Q9E A;  4WWU C;  2JDI H;  4BTX A;  1VQM 3;  1OAC A;  1X1Y A;  4R9L A;  3OWY A;  2CC3 A;  3EN1 B;  3F14 A;  3OV4 A;  4XBX A;  4ZM8 A;  1VQP 3;  2E2T A;  2FGT A;  3NBJ A;  3CCM 3;  1GMR A;  4CPK A;  3G6E 3;  5AYR B;  3EBT A;  1M90 4;  2IMJ A;  2OTL 3;  3CD6 3;  1AR0 A;  2H0H A;  3CCE 3;  2E2V A;  1NWW A;  3LT9 A;  5FGO A;  3K5T A;  4FCJ A;  1IVV A;  2KXG A;  5STD A;  3FCS B;  1JBS A;  3A76 A;  1X1U A;  4OVM A;  3CNX A;  1FGM A;  1FYS A;  2OCT A;  1LRA A;  4CDL A;  3LXU X;  4EC6 A;  1Q81 4;  2IUJ A;  2FNQ A;  4AEQ A;  6GSP A;  1ZO2 A;  4KFD A;  5AEU B;  2BU4 A;  3D9R A;  1AY7 A;  3PYJ A;  3TDG A;  1BNI A;  4NPB A;  2HMN B;  1W6G A;  2L1S A;  3E99 A;  5EEO A;  2QGU A;  4JRF A;  1VQN 3;  4BL3 A;  1A2P A;  5BXQ A;  4L8O A;  5BVB A;  1UGH I;  3KSE D;  1J2B A;  2SAR A;  2GBX B;  5AYS C;  2GU1 A;  2W56 A;  1ASK A;  1MOL A;  2CX1 A;  3NM7 A;  3CCV 3;  3Q1C A;  3DGN A;  3LYG A;  1HU9 A;  1RCK A;  1N8Q A;  1BNJ A;  1R4C A;  3S29 A;  5RNT A;  3I56 3;  3NM2 A;  1HKX A;  3OX9 A;  3DGL A;  3KKG A;  5JPU A;  2OTJ 3;  1MWS A;  1ZGX A;  4AKY A;  2KF5 A;  4O2H A;  1BNG A;  1VQ7 3;  2YFI B;  5HGR A;  1GOV A;  1A90 A;  1V57 A;  1OGZ A;  2GEX A;  3CXC 2;  1YHQ 3;  3D4A A;  3CC2 3;  2CFD A;  4IT7 A;  3S5C A;  1Y4K A;  5EQL A;  3CC4 3;  4R4K A;  1UUG B;  3F8H A;  1YJ9 3;  3BB9 A;  4HM5 B;  3UL5 A;  1OH0 A;  2IUK A;  2UX0 A;  4X2H A;  2MF7 A;  3D5I A;  3PGB A;  5IG4 A;  1CH0 A;  4EXR A;  3X3Z A;  1O7G B;  3WOD G;  4BU4 A;  8CHO A;  1ROV A;  4R1K A;  1JKG B;  3WOE B;  3WOF B;  1JJ2 2;  3CPW 2;  4GSP A;  3CCS 3;  2YX9 A;  3T8U A;  4LZI A;  1PYL A;  5ELU A;  3WMD A;  4BTY A;  5AEW B;  3RDE A;  3QRD A;  4R80 A;  3NBR A;  4PEJ A;  5BIR A;  2K3D A;  4LMI A;  4K1U A;  2GXF A;  1CYU A;  1UCJ A;  7RNT A;  1BOX A;  1FUS A;  1RN1 A;  3CC7 3;  2WOH A;  3LH4 A;  2WO0 A;  2GSP A;  3MG3 A;  3CCR 3;  1N5H A;  1TTO A;  2CX0 A;  2Y74 A;  5IG3 A;  3VSY A;  1Q40 B;  4QWT A;  3MYT A;  4HM0 B;  1RGF A;  4J9A A;  3ER7 A;  3V98 A;  1QAK A;  1RNB A;  2Q07 A;  2YFL B;  3G16 A;  1JRQ A;  1UUW B;  3FKA A;  3IMA B;  4U13 A;  1N9E A;  3O8Y A;  4WHA A;  1Z1S A;  3EE1 A;  2F56 A;  2HMJ B;  2J8X B;  1YI2 3;  1Q86 4;  4HM7 B;  3V99 A;  1YIT 3;  4FMB A;  3AGO A;  1DE3 A;  2PZV A;  3D79 A;  4RZM A;  1QAF A;  2XSH B;  3SOY A;  2F86 B;  5KP3 A;  3ROB A;  2PNC A;  2R4I A;  3DMC A;  1YIJ 3;  2A15 A;  4HZ9 B;  5G2G A;  1BAO A;  3LT8 A;  1B2S A;  1N9J A;  3FG4 A;  4FCZ A;  4WFO A;  5HOH A;  3SLU A;  1YVS A;  2CW9 A;  2RBI A;  1C54 A;  1MNL A;  1M9G A;  4N6N B;  3VGN A;  3ZFZ A;  1BRH A;  1LXE A;  2YFJ B;  2AAE A;  3PZW A;  5A0O B;  3D3L A;  1JKG A;  1ULI B;  2MC8 A;  1KC8 4;  3CNM A;  3EBY A;  2QIY A;  2XRX B;  3MG2 A;  3S27 A;  3X3Y A;  1W02 A;  1DYU A;  2CH9 A;  3ECF A;  1RMS A;  2E2U A;  3FZW A;  4J5K A;  5CXO A;  5JBS A;  1GOU A;  1VQQ A;  1IQX A;  4X2O A;  3UL6 A;  2XH9 A;  3JVC A;  2STD A;  2IYJ A;  1O7H B;  3IPT A;  1MWT A;  1FGT A;  3LTC A;  4K61 A;  3N8B A;  2W6J H;  1QMA A;  2ML6 A;  3EC9 A;  2BO9 B;  2BMO B;  2SBL A;  3BND A;  1EUI C;  1Q40 A;  1TIJ A;  5TGN A;  1NU3 A;  1MGW A;  4MJD A;  1B2X A;  1RDS A;  1ULJ B;  1YGE A;  4HYZ A;  1LQG C;  1TU5 A;  1VQL 3;  1YGW A;  1FGQ A;  2CWV A;  1YJN 3;  1BRI A;  1Q7H A;  1A67 A;  4I5Q A;  3WDG B;  4BIR A;  1UI8 A;  1PU4 A;  3OWU A;  3NXJ A;  1T5Y A;  3G8Z A;  1SQW A;  1EA2 A;  1AVK A;  5FW5 A;  5CK6 A;  3UJM A;  1W01 A;  2CIU A;  5KP1 A;  1K8A 4;  2R41 A;  3D5G A;  3DM8 A;  3DY5 A;  3H3H A;  1AQZ A;  1LOY A;  1QAL A;  8RNT A;  2C4B A;  1O7P B;  1RCL A;  4HJL B;  4FMA A;  1RRH A;  1RN4 A;  1W00 A;  1ZS7 A;  2M7O A;  4H61 A;  5CLK A;  3EX9 A;  2Y73 A;  3HII A;  5AI1 A;  5M19 A;  1B27 A;  2AAD A;  3BNB A;  1JB5 A;  4XBT A;  1M1K 4;  1B2U A;  4NRE A;  1G96 A;  2XF3 A;  4FMC A;  1I70 A;  1KD1 4;  1GD3 A;  3STD A;  3IJE B;  1T2I A;  1U8C B;  1JNQ A;  3GSP A;  1OCV A;  1TFO A;  2W04 A;  3EHC A;  1QJG A;  2I9W A;  1EG9 B;  1BVI A;  4EV2 A;  1BU4 A;  1IT8 A;  1JBT A;  1W6Y A;  3CCU 3;  5IG0 A;  1W4N A;  1HYF A;  2CFG A;  2O9U X;  3SX1 A;  1UDI I;  3U1W A;  1UUV B;  3MPH A;  1NJI 4;  5M1A A;  2Z76 A;  3B4P A;  4K1V A;  5IER A;  2OOV C;  3LTD A;  1Q42 A;  3LTA A;  4HM3 B;  1S72 3;  1DET A;  3NBB A;  1IU7 A;  1AV4 A;  2INX A;  2D1W A;  3HX8 A;  4HBR A;  3SVA A;  4OK0 A;  5AIH A;  1D6Z A;  4XDV A;  3KII A;  4IIA A;  1B2Z A;  1D6U A;  2KF3 A;  4G1M B;  2BMR B;  3NV0 B;  6STD A;  4FMD A;  1W2Z A;  4EV5 A;  3FG3 A;  1NNV A;  1WQL B;  5G1L A;  2O3O A;  1UI7 A;  3WR2 A;  1IQ8 A;  5IEN A;  2P09 A;  1K28 A;  3QK9 A;  1FW7 A;  4HM4 B;  5CF1 A;  4HM2 B;  1EQK A;  1E3V A;  3KCH A;  1I2G A;  2CKF B;  2RSX A;  2ZL8 A;  4I4K A;  1WMN A;  1BRK A;  1SIH A;  1JN5 B;  5AIG A;  2CWT A;  4EW5 A;  2P0M A;  4KFE A;  1W2B 2;  2GBW B;  1OGX A;  2KAA A;  3EF8 A;  3F9S A;  4KT3 B;  5IEO A;  2XEP A;  4KVH A;  4HZB B;  1O7M B;  6RNT A;  2BT3 A;  3DZL A;  3KZT A;  3LOY A;  1LOW A;  4CCV A;  9RNT A;  2CK3 H;  2F5M A;  4N6M A;  3EQQ B;  4BTW A;  3CCJ 3;  3OWS A;  4LGQ A;  1IT7 A;  2B1X B;  1DMM A;  1VZZ A;  1X1X A;  1W7C A;  3FF0 A;  1OPY A;  3CMA 3;  1WMO A;  4JF8 A;  1LNH A;  4STD A;  2BHM A;  5IF6 A;  2RNT A;  1X1W A;  1BSB A;  1M1X B;  2CFK A;  3KSP A;  1JBR A;  1I3F A;  3SOA A;  5IG5 A;  5G1K A;  2HMM B;  4O02 B;  2K0M A;  1LQM B;  4N6L A;  4H3U A;  2OQE C;  1JB4 A;  1BSA A;  1E97 A;  3CU3 A;  3DGY A;  1RGA A;  3DXO A;  2ZA4 A;  1B21 A;  2D42 A;  3DH2 A;  1IDP A;  3NHX A;  3WHO A;  2W03 A;  4LSO A;  4Q53 A;  4MEI A;  1VQ5 3;  3JUP A;  1GOY A;  3NV0 A;  4HVN A;  2Z7A A;  3LML A;  2BMQ B;  1WNH A;  3F8X A;  4AKZ A;  1IVX A;  3F7X A;  2RGQ A;  3WA2 X;  1OUN A;  3FG1 A;  3RNT A;  2CG1 A;  2CG0 A;  2LQV A;  3K7C A;  1I2E A;  3URP A;  2CFL A;  4HKV B;  1BSC A;  1LNI A;  1IV9 A;  1BSE A;  1RN7 A;  2F98 A;  3BNC A;  4MMX B;  2P38 A;  1S5A A;  2KF4 A;  2W9Q A;  5ELJ A;  3K9M C;  4RNT A;  5KP4 A;  1JN5 A;  1YNV X;  3EN8 A;  3M8C A;  2V1L A;  4XM4 A;  1A2K A;  1AVL A;  1EKM A;  3GZB A;  1RKY A;  3I55 3;  1CYV A;  1MGR A;  3N54 B;  3EJV A;  2F5W A;  2H0G A;  1FUT A;  2IY2 A;  2UGI A;  3ZG0 A;  1B3S A;  3FSD A;  4RBN A;  3UB1 A;  5IW9 A;  1I8V A;  3GZY B;  3GWR A;  1IV7 A;  3PCR A;  3A5E A;  3CPO A;  1B20 A;  1K41 A;  4WP5 A;  4WYK B;  3FGY A;  3KN4 A;  1BRJ A;  2IA7 A;  1RNT A;  1TFK A;  2C10 A;  3RGR A;  1N8R 4;  2C11 A;  2ZDJ A;  2ML5 A;  3BIR A;  4N6V 0;  1ROA A;  1BAN A;  1I2F A;  1WMP A;  3HIG A;  3KFQ C;  4HOH A;  3K0Z A;  1ISK A;  2XFT A;  2GU3 A;  4L8P A;  5LC7 A;  2W2C A;  1GYB A;  1NB3 I;  3F7S A;  2L4V A;  5EVH A;  1BUJ A;  1T2H A;  1RGL A;  3FLJ A;  2RCD A;  4MMY B;  5D83 A;  1UCL A;  3GZX B;  4HM8 B;  4HM1 B;  4GB5 A;  3ZG5 A;  7GSP A;  1K73 4;  4K90 B;  1E3R A;  2F4Y A;  2WOF A;  3DGM A;  3G0K A;  4ILF A;  2P05 A;  3NQY A;  3JUQ A;  3UNL A;  3HK4 A;  1U5O A;  4RNZ A;  1ZX2 A;  3JUM A;  1VQ8 3;  2BIR A;  2Z77 A;  4KZ1 A;  2RFR A;  4FR9 A;  1BIR A;  1IVU A;  2W9P A;  1A2V A;  1B2M A;  3FH1 A;  1NDO B;  4FCM A;  1GSP A;  1BNR A;  4N6U A;  4GL6 A;  1RGC A;  1BGS A;  4LEH A;  1T3B A;  1PY3 A;  2P0X A;  3T0U A;  1NB5 I;  7STD A;  1STD A;  1IK3 A;  1UCK A;  4HAA A;  3OW2 2;  1UCI A;  1TP6 A;  3B8L A;  5BU4 A;  1MWU A;  1BNS A;  2OOV A;  4R9K A;  1KQS 2;  1OHS A;  3DUK A;  3AHW A;  1TJD A;  1FGO A;  3EB8 A;  1TUH A;  3K63 A;  3N9H A;  1GY5 A;  1V58 A;  1DVD A;  2XSO B;  1US1 A;  1G0T A;  2XFS A;  4NHF A;  2B24 B;  4MMZ B;  1IVW A;  4WYK A;  1TRP A;  1RLS A;  3L0R A;  1RRL A;  3CME 3;  4L7K A;  1JB2 A;  1NO3 A;  3AMO B;  5D81 A;  3I0Y A;  1JZO A;  3F40 A;  1TRQ A;  1WTH A;  1MWR A;  4J5G A;  2CWU A;  2GEY A;  2XR8 B;  1GMP A;  2H0I A;  3MWZ A;  4XB5 A;  1K9M 4;  2XGL A;  1FZU A;  1YVB I;  1V74 A;  2KF6 A;  3GZR A;  4EYC A;  2Z6B A;  1UW1 A;  1G02 A;  1F8N A;  1BRS A;  1KWI A;  1LOV A;  1CQS A;  1L5G B;  2HML B;  4HM6 B;  1RJO A;  1OF5 B;  2WGO A;  2LYX A;  1Q82 4;  5JPP A;  3FF2 A;  2KCD A;  2XGN A;  3MHE A;  2HMK B;  3BU4 A;  2WGQ A;  2CFW A;  1PFP A;  1VQO 3;  3PXM A;  1RGH A;  3VF1 A;  3Q3F A;  2HMO B;  3AHS A;  1QVF 2;  1KSI A;  3PS8 A;  4IPB A;  4O8S A;  2OWP A;  3NQZ A;  1I3I A;  3HI7 A;  3Q90 A;  4N6O B;  3JUO A;  4GHO A;  5DRV A;  3Q2P A;  3MSO A;  3JUN A;  1GY6 A;  1BNF A;  4N3V A;  3B7C A;  1DMQ A;  1C7H A;  4RNY A;  1CEW I;  1OHO A;  3V92 A;  2ZHX B;  5I97 A;  3X42 A;  1GS3 A;  4XBY A;  1SII A;  3B4O A;  1DMN A;  4XDW A;  1VQ4 3;  1GD4 A;  1HZ1 A;  1RGG A;  2QEX 3;  1VQ9 3;  3LTB A;  1QVG 2;  3HZP A;  4N6T A;  1GY7 A;  2OQE A;  3S28 A;  4KFF A;  1FA3 A;  3X40 A;  3GAX A;  2F99 A;  1LVN A;  1RTU A;  2JQ5 A;  4OUQ A;  3BLZ A;  2K54 A;  1RGK A;  3S67 A;  3AMO A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 1VQK 3;  4TX4 A;  3MKI A;  5AII A;  2W0Q A;  4ORL A;  1FUW A;  3G4S 3;  1OHP A;  2FXT A;  1W6C A;  1Q7Y 4;  2QA4 3;  3ALA A;  3BNE A;  1N5P A;  5D82 A;  4J8T A;  2KRT A;  5CF2 A;  3J7Y d;  3CCL 3;  1O7W B;  3U97 A;  1O7N B;  3T8N A;  1BUQ A;  1LOX A;  1OF5 A;  3OXA A;  5AIF A;  3CCQ 3;  2W56 B;  3X41 A;  3KE7 A;  1SJW A;  1STF I;  3WA3 A;  1SPU A;  1IQY A;  3LZA A;  3G71 3;  3NUV A;  4O3V A;  1VQ6 3;  1W5Z A;  2BNG A;  5IEP A;  1JV2 B;  3RGA A;  3DGO A;  3SXX A;  2CHC A;  3H51 A;  3MG1 A;  3X3X A;  4EBG A;  5LC6 A;  5DRE A;  1FGR A;  3NX0 A;  1D6Y A;  1DVC A;  1YJW 3;  3SED A;  3PCS A;  3GRD A;  4WWU C;  2JDI H;  4BTX A;  1VQM 3;  1OAC A;  4R9L A;  1VQP 3;  3OWY A;  2CC3 A;  3EN1 B;  3F14 A;  3OV4 A;  4XBX A;  4ZM8 A;  2E2T A;  2FGT A;  3NBJ A;  3CCM 3;  3G6E 3;  5AYR B;  3EBT A;  1M90 4;  2IMJ A;  2OTL 3;  3CD6 3;  1AR0 A;  3CCE 3;  2E2V A;  1NWW A;  3LT9 A;  5FGO A;  3K5T A;  4FCJ A;  1IVV A;  2KXG A;  5STD A;  3FCS B;  3A76 A;  4OVM A;  3CNX A;  1FGM A;  2OCT A;  4CDL A;  3LXU X;  4EC6 A;  1Q81 4;  2IUJ A;  2FNQ A;  4AEQ A;  1ZO2 A;  4KFD A;  5AEU B;  3D9R A;  3TDG A;  3PYJ A;  2HMN B;  1W6G A;  3E99 A;  5EEO A;  2QGU A;  4JRF A;  1VQN 3;  5BXQ A;  4L8O A;  5BVB A;  3KSE D;  1J2B A;  2GBX B;  5AYS C;  2GU1 A;  2W56 A;  1ASK A;  1MOL A;  3NM7 A;  3CCV 3;  3Q1C A;  3DGN A;  3LYG A;  1HU9 A;  1N8Q A;  1R4C A;  3S29 A;  3I56 3;  3NM2 A;  1HKX A;  3OX9 A;  3DGL A;  3KKG A;  5JPU A;  2OTJ 3;  4AKY A;  4O2H A;  1VQ7 3;  2YFI B;  5HGR A;  1A90 A;  1OGZ A;  2GEX A;  3CXC 2;  1YHQ 3;  3CC2 3;  2CFD A;  4IT7 A;  3S5C A;  1Y4K A;  5EQL A;  3CC4 3;  4R4K A;  3F8H A;  1YJ9 3;  3BB9 A;  4HM5 B;  3UL5 A;  1OH0 A;  2IUK A;  2UX0 A;  4X2H A;  2MF7 A;  3PGB A;  5IG4 A;  4EXR A;  3X3Z A;  1O7G B;  3WOD G;  8CHO A;  1ROV A;  4R1K A;  1JKG B;  3WOE B;  3WOF B;  1JJ2 2;  3CPW 2;  3CCS 3;  2YX9 A;  3T8U A;  4LZI A;  5ELU A;  3WMD A;  4BTY A;  5AEW B;  3RDE A;  3QRD A;  4R80 A;  3NBR A;  4PEJ A;  4LMI A;  4K1U A;  2GXF A;  1CYU A;  3CC7 3;  2WOH A;  3LH4 A;  2WO0 A;  3MG3 A;  3CCR 3;  1N5H A;  5IG3 A;  2Y74 A;  3VSY A;  1Q40 B;  4QWT A;  3MYT A;  4HM0 B;  4J9A A;  3ER7 A;  3V98 A;  1QAK A;  2Q07 A;  2YFL B;  3G16 A;  1JRQ A;  1UUW B;  3FKA A;  3IMA B;  4U13 A;  1N9E A;  3O8Y A;  4WHA A;  1Z1S A;  3EE1 A;  2HMJ B;  1YI2 3;  1Q86 4;  4HM7 B;  3V99 A;  1YIT 3;  4FMB A;  2PZV A;  4RZM A;  1QAF A;  2XSH B;  3SOY A;  2F86 B;  5KP3 A;  3ROB A;  2PNC A;  2R4I A;  3DMC A;  1YIJ 3;  2A15 A;  4HZ9 B;  5G2G A;  3LT8 A;  4WFO A;  1N9J A;  3FG4 A;  4FCZ A;  3SLU A;  2CW9 A;  1MNL A;  1M9G A;  4N6N B;  3VGN A;  1LXE A;  2YFJ B;  3PZW A;  5A0O B;  3D3L A;  1JKG A;  1ULI B;  2MC8 A;  1KC8 4;  3CNM A;  3EBY A;  2QIY A;  2XRX B;  3MG2 A;  3S27 A;  3X3Y A;  1W02 A;  1DYU A;  2CH9 A;  3ECF A;  3FZW A;  2E2U A;  5JBS A;  5CXO A;  1IQX A;  4X2O A;  3UL6 A;  2XH9 A;  3JVC A;  2STD A;  3IPT A;  1O7H B;  1FGT A;  3LTC A;  4K61 A;  3N8B A;  2W6J H;  1QMA A;  2ML6 A;  3EC9 A;  2BO9 B;  2BMO B;  2SBL A;  3BND A;  1Q40 A;  1TIJ A;  5TGN A;  1NU3 A;  4MJD A;  1TU5 A;  1ULJ B;  1YGE A;  4HYZ A;  1VQL 3;  2CWV A;  1FGQ A;  1YJN 3;  1A67 A;  1PU4 A;  3WDG B;  1UI8 A;  3OWU A;  3NXJ A;  1T5Y A;  3G8Z A;  1SQW A;  1EA2 A;  1AVK A;  5FW5 A;  5CK6 A;  3UJM A;  1W01 A;  2CIU A;  5KP1 A;  1K8A 4;  3DM8 A;  3DY5 A;  3H3H A;  1QAL A;  1O7P B;  5IER A;  4HJL B;  4FMA A;  1RRH A;  4H61 A;  1W00 A;  2M7O A;  5CLK A;  3EX9 A;  2Y73 A;  3HII A;  5AI1 A;  1M1K 4;  3BNB A;  4XBT A;  1JB5 A;  4NRE A;  1G96 A;  2XF3 A;  4FMC A;  1KD1 4;  1GD3 A;  3STD A;  3IJE B;  1U8C B;  1JNQ A;  1OCV A;  1TFO A;  2W04 A;  3EHC A;  1QJG A;  2I9W A;  1EG9 B;  4EV2 A;  1IT8 A;  1W6Y A;  3CCU 3;  5IG0 A;  1W4N A;  2CFG A;  2O9U X;  3SX1 A;  3U1W A;  1UUV B;  3MPH A;  1NJI 4;  2Z76 A;  3B4P A;  4K1V A;  2OOV C;  3LTD A;  1Q42 A;  3LTA A;  4HM3 B;  1S72 3;  3NBB A;  1IU7 A;  1AV4 A;  2INX A;  2D1W A;  3HX8 A;  4HBR A;  3SVA A;  4OK0 A;  5AIH A;  1D6Z A;  4XDV A;  3KII A;  4IIA A;  1D6U A;  4G1M B;  2BMR B;  3NV0 B;  6STD A;  4FMD A;  1W2Z A;  4EV5 A;  3FG3 A;  1WQL B;  2O3O A;  1UI7 A;  1IQ8 A;  5IEN A;  2P09 A;  1K28 A;  3QK9 A;  4HM4 B;  5CF1 A;  4HM2 B;  1EQK A;  1E3V A;  2CKF B;  2RSX A;  2ZL8 A;  4I4K A;  1WMN A;  1SIH A;  1JN5 B;  5AIG A;  2CWT A;  2P0M A;  4KFE A;  1W2B 2;  2GBW B;  1OGX A;  3EF8 A;  3F9S A;  5IEO A;  2XEP A;  4KVH A;  4HZB B;  1O7M B;  2BT3 A;  3DZL A;  3KZT A;  3LOY A;  4CCV A;  2CK3 H;  4N6M A;  3EQQ B;  4BTW A;  3CCJ 3;  3OWS A;  4LGQ A;  1IT7 A;  1VZZ A;  1DMM A;  2B1X B;  3FF0 A;  1W7C A;  1OPY A;  3CMA 3;  1WMO A;  4JF8 A;  1LNH A;  4STD A;  2BHM A;  5IF6 A;  1M1X B;  2CFK A;  3KSP A;  3SOA A;  5IG5 A;  2HMM B;  4O02 B;  2K0M A;  4N6L A;  4H3U A;  2OQE C;  1JB4 A;  1E97 A;  3CU3 A;  3DXO A;  2D42 A;  1IDP A;  3NHX A;  2W03 A;  4LSO A;  4Q53 A;  4MEI A;  1VQ5 3;  3JUP A;  3NV0 A;  4HVN A;  2Z7A A;  3LML A;  2BMQ B;  1WNH A;  3F8X A;  4AKZ A;  1IVX A;  3F7X A;  2RGQ A;  3WA2 X;  1OUN A;  3FG1 A;  2CG1 A;  2CG0 A;  2LQV A;  3K7C A;  2CFL A;  4HKV B;  1IV9 A;  1RN7 A;  3BNC A;  2F98 A;  4MMX B;  2P38 A;  1S5A A;  2W9Q A;  5ELJ A;  3K9M C;  5KP4 A;  1JN5 A;  4XM4 A;  3EN8 A;  3M8C A;  2V1L A;  1A2K A;  1AVL A;  1EKM A;  3GZB A;  1RKY A;  3I55 3;  1CYV A;  3N54 B;  3EJV A;  3FSD A;  4RBN A;  3UB1 A;  5IW9 A;  3GZY B;  3GWR A;  1IV7 A;  3PCR A;  3CPO A;  4WP5 A;  4WYK B;  1K41 A;  3FGY A;  3KN4 A;  2IA7 A;  1TFK A;  2C10 A;  3RGR A;  1N8R 4;  2C11 A;  2ZDJ A;  2ML5 A;  4N6V 0;  1ROA A;  1WMP A;  3HIG A;  3KFQ C;  3K0Z A;  1ISK A;  2XFT A;  2GU3 A;  4L8P A;  5LC7 A;  2W2C A;  1GYB A;  1NB3 I;  3F7S A;  2L4V A;  5EVH A;  3FLJ A;  2RCD A;  4MMY B;  5D83 A;  3GZX B;  4HM8 B;  4HM1 B;  4GB5 A;  1K73 4;  1E3R A;  2WOF A;  3DGM A;  3G0K A;  2P05 A;  3NQY A;  3JUQ A;  3UNL A;  3HK4 A;  1U5O A;  4RNZ A;  1ZX2 A;  3JUM A;  1VQ8 3;  2Z77 A;  4KZ1 A;  2RFR A;  4FR9 A;  1IVU A;  2W9P A;  1A2V A;  3FH1 A;  1NDO B;  4FCM A;  4N6U A;  4GL6 A;  4LEH A;  2P0X A;  3T0U A;  1NB5 I;  7STD A;  1STD A;  1IK3 A;  3OW2 2;  1TP6 A;  3B8L A;  2OOV A;  1KQS 2;  4R9K A;  1OHS A;  3DUK A;  3EB8 A;  1FGO A;  3N9H A;  1TUH A;  3K63 A;  1DVD A;  1GY5 A;  2XSO B;  1US1 A;  2XFS A;  4NHF A;  2B24 B;  4MMZ B;  1IVW A;  4WYK A;  3L0R A;  1RRL A;  3CME 3;  4L7K A;  1JB2 A;  1NO3 A;  3AMO B;  5D81 A;  3I0Y A;  3F40 A;  1WTH A;  2CWU A;  2GEY A;  2XR8 B;  3MWZ A;  4XB5 A;  1K9M 4;  2XGL A;  1YVB I;  4EYC A;  1V74 A;  3GZR A;  2Z6B A;  1UW1 A;  1F8N A;  1L5G B;  1KWI A;  1CQS A;  2HML B;  4HM6 B;  1RJO A;  1OF5 B;  2WGO A;  2LYX A;  1Q82 4;  5JPP A;  3FF2 A;  2KCD A;  2XGN A;  3MHE A;  2HMK B;  2WGQ A;  2CFW A;  1PFP A;  1VQO 3;  3PXM A;  1QVF 2;  3VF1 A;  2HMO B;  1KSI A;  3PS8 A;  4IPB A;  4O8S A;  2OWP A;  3NQZ A;  3HI7 A;  3Q90 A;  4N6O B;  3JUO A;  5DRV A;  3Q2P A;  3MSO A;  3JUN A;  1GY6 A;  4N3V A;  3B7C A;  1DMQ A;  1C7H A;  4RNY A;  1CEW I;  1OHO A;  3V92 A;  5I97 A;  3X42 A;  1GS3 A;  4XBY A;  1SII A;  3B4O A;  1DMN A;  4XDW A;  1VQ4 3;  1GD4 A;  1VQ9 3;  2QEX 3;  3LTB A;  1QVG 2;  3HZP A;  4N6T A;  1GY7 A;  2OQE A;  3S28 A;  4KFF A;  1FA3 A;  3X40 A;  3GAX A;  2F99 A;  1LVN A;  2JQ5 A;  4OUQ A;  3BLZ A;  2K54 A;  4K90 B;  3S67 A;  3AMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...