1ASKA

Nuclear transport factor 2 (ntf2) h66a mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
GDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQASITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Nuclear protein import is decreased by engineered mutants of nuclear transport factor 2 (NTF2) that do not bind GDP-Ran.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport
total genus 33
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1askA00
1Q42A 3M8CA 1W02A 2XSOB 1VZZA 3F7XA 3WMDA 3NV0A 2QIYA 1OHSA 4HZBB 4Q53A 1JB4A 5DRVA 1O7NB 3EC9A 4HM0B 4HM8B 5IF6A 1Q40A 3KE7A 1O7MB 4I4KA 5IENA 1IDPA 3G0KA 5IEOA 1DMQA 2GBXB 1DMNA 2RCDA 1TUHA 2YFJB 5D82A 3S5CA 3CNXA 1A2KA 4HM1B 3EBYA 4WYKA 1E97A 4XB5A 3F8HA 3G16A 4HKVB 4X2OA 5KP4A 4FCJA 3NM2A 4CDLA 1E3VA 3SEDA 3RGRA 5IG4A 4HZ9B 4LEHA 4K1UA 1NWWA 4X2HA 1QMAA 4R1KA 5AEWB 2BMRB 4L7KA 3T8UA 2QGUA 5CK6A 1C7HA 1OPYA 3NHXA 5CXOA 1ISKA 3NBRA 5AIFA 1U5OA 3K0ZA 4R9LA 3DM8A 1OGZA 3MHEA 2I9WA 3B4OA 3VGNA 1O7WB 2F99A 1GYBA 3A76A 1OF5A 3GZXB 5CF1A 3FSDA 5BVBA 4K1VA 2BNGA 3JUPA 3MG2A 3OXAA 1ZO2A 5IEPA 2IMJA 3DZLA 3UJMA 3GZYB 1JN5B 1JKGA 3JUQA 5IG5A 3HK4A 3NV0B 3DXOA 2Z7AA 4XDVA 3OV4A 3F9SA 1O7GB 1STDA 2PZVA 3JUMA 2YFLB 3KZTA 3UNLA 4XDWA 5TGNA 4XBXA 3OWYA 4HM4B 1Q40B 3KSPA 3T8NA 1OH0A 2HMJB 3FKAA 4HM6B 4LMIA 1TP6A 3JUOA 3F40A 3EX9A 2OWPA 3B4PA 4WYKB 3FGYA 3B7CA 3K7CA 3OWSA 4HM3B 5IG0A 5AEUB 1Z1SA 2STDA 1UUVB 1OUNA 2GEYA 2HMLB 7STDA 5EVHA 3GZRA 4R9KA 5AI1A 2GXFA 3HZPA 2HMKB 3MKIA 4WWUC 5D83A 2RFRA 5JPPA 3GRDA 1ULIB 1AR0A 1W00A 5JPUA 4OVMA 3GWRA 5HGRA 4ORLA 3FF2A 4STDA 4L8OA 4XBYA 3STDA 1W01A 1GY5A 4PEJA 1OHOA 1OF5B 3ROBA 5BXQA 2R4IA 2B24B 3ECFA 1CQSA 3F7SA 3LZAA 4J8TA 2RGQA 2INXA 3DUKA 1O7PB 2BMOB 4HJLB 4GB5A 3FH1A 1OGXA 1ZX2A 3MG3A 3FLJA 4RZMA 5IERA 1NU3A 3VSYA 2XR8B 3MSOA 1K41A 2HMOB 4IIAA 3D9RA 3BB9A 3JUNA 3G8ZA 2YFIB 2BMQB 3EF8A 4HM2B 8CHOA 4XBTA 3H3HA 2HMNB 4N3VA 3B8LA 3EJVA 2XRXB 1WQLB 3FF0A 2GEXA 2W2CA 3H51A 2GBWB 4L8PA 1ASKA 2XSHB 3F14A 3MYTA 3CU3A 1JB2A 1OHPA 5KP1A 4FCMA 3E99A 3EHCA 1JN5A 1W6YA 1EG9B 4MJDA 4XM4A 4LGQA 3LYGA 2F98A 3EN8A 2CKFB 2K54A 4WP5A 1JB5A 1O7HB 2HMMB 3ER7A 3HX8A 1GY6A 1NDOB 3OWUA 3SOYA 2F86B 3NUVA 2CHCA 5FW5A 5AIHA 3Q90A 5DREA 6STDA 1E3RA 4H3UA 4HM5B 2UX0A 4J9AA 1OCVA 5AIIA 3FZWA 3RGAA 1SJWA 5G2GA 1DMMA 4OUQA 5CF2A 1GY7A 2A15A 4HM7B 3NXJA 3CNMA 3DMCA 5AIGA 5KP3A 1EA2A 3F8XA 1ULJB 2Z77A 4U13A 5STDA 1GS3A 1JKGB 1BUQA 5IG3A 5CLKA 3EBTA 3EN1B 3KKGA 1UUWB 2B1XB 3OX9A 3I0YA 3SOAA 1QJGA 2Z76A 3BLZA 1HKXA 3MG1A 2JQ5A 3IPTA 4HVNA 5D81A 1S5AA 3EQQB 3CPOA 4KVHA 3GZBA
chains in the Genus database with same CATH superfamily
1Q42A 3AMOB 3X3ZA 3M8CA 1W02A 2XSOB 1VZZA 2P09A 3F7XA 3WMDA 3NV0A 2QIYA 3KN4A 1TJDA 1B2UA 1X1UA 1UI7A 1A2PA 1X1YA 4O3VA 1OHSA 3EB8A 4HZBB 1JB4A 4Q53A 5ELJA 2OOVA 4AKZA 1J2BA 3AGOA 2W9QA 2CH9A 4IT7A 5DRVA 2BT3A 2F5MA 1O7NB 3PS8A 3EC9A 3Q2PA 3D3LA 3PXMA 4MMXB 1UCLA 4NREA 1N5HA 1RSNA 3ALAA 3HIGA 1Q9EA 3DGNA 4HM0B 4HM8B 5IF6A 3N9HA 1Q40A 3KE7A 4RNTA 1FW7A 1O7MB 1YIJ3 1YJW3 4GSPA 4I4KA 4NPBA 3WOFB 4ILFA 2CFDA 4CJNA 5A0OB 5IENA 1IDPA 4GHOA 1IQYA 3G0KA 1FYSA 6GSPA 1YIT3 1NO3A 5IEOA 1D6ZA 1BNIA 1DMQA 2GBXB 1YNVX 1IV7A 1DMNA 2RCDA 1TUHA 2YFJB 3FG3A 5D82A 3S5CA 3CNXA 3CXC2 3CCE3 2K3DA 1A2KA 1BSBA 1RGKA 4HM1B 2CFGA 4FCZA 1JZOA 2AADA 4J5KA 4FR9A 4R80A 3EBYA 4N6NB 1GOVA 1UW1A 2H0HA 1BRHA 2O9UX 4WYKA 4BTYA 1E97A 3K5TA 4KT3B 4TX4A 4XB5A 2JDIH 1CYUA 1DE3A 1TFKA 3F8HA 3G16A 4HKVB 3L0RA 4X2OA 5KP4A 4FCJA 3NM2A 4CDLA 1GMRA 1FGMA 1E3VA 4HOHA 3SEDA 1M1K4 3RGRA 5IG4A 2CWTA 1VQ73 1JNQA 1JRQA 1VQQA 3LTBA 4HZ9B 1U8CB 2KF6A 4LEHA 1ZS7A 3SXXA 4K1UA 3I553 3CCJ3 1MNLA 1NWWA 5HOHA 1RRLA 3NM7A 4X2HA 3URPA 3X40A 1QMAA 2W0QA 4R1KA 1BVIA 3N54B 4KFFA 3GAXA 1SIHA 2P0XA 4KZ1A 3UB1A 2BMRB 5AEWB 4L7KA 3T8UA 3CCU3 2BIRA 1W7CA 2QGUA 5CK6A 1JBRA 2GU3A 2QEX3 1SARA 1QVF2 4LSOA 1RGEA 1FGQA 1D6YA 3V99A 1C7HA 1IT8A 1OPYA 3D5IA 3EE1A 2BU4A 3NHXA 5CXOA 1MOLA 1GOUA 3NBRA 5AIFA 1U5OA 1ISKA 3ZFZA 3K0ZA 2W9PA 1DETA 3QRDA 4R9LA 4BL2A 2C4BA 1T2HA 3DM8A 5GSPA 4EBGA 1IV9A 1OGZA 3MHEA 2I9WA 2RBIA 3B4OA 3SX1A 3VGNA 3LT8A 1RTUA 3V92A 4HBRA 2HOHA 3G6E3 2CWVA 2E2TA 1O7WB 1WTHA 1HU9A 2F99A 1G0TA 1GYBA 3NBJA 1BRJA 1W2ZA 1HZ1A 3A76A 1OF5A 2IYJA 3GZXB 1RHLA 5CF1A 1A90A 3FSDA 5BVBA 3BNCA 1OACA 3K9MC 4KFEA 1YGWA 1I2EA 1MGWA 3Q1CA 4K1VA 2BNGA 2GSPA 3UL6A 3I563 3JUPA 2OOVC 3CCQ3 1JBTA 3MG2A 2ML5A 2Y73A 4CCVA 1I70A 1X1XA 4O8SA 1BRKA 1M1XB 3AHSA 3LTCA 3OXAA 1B20A 1AVLA 3HI7A 1PU4A 2CX0A 3CC43 2F4YA 1ZO2A 3O8YA 1C54A 1BU4A 3G713 5IEPA 1Q7HA 1IVXA 1NB5I 2IMJA 3UL5A 4EC6A 3S27A 4FMDA 3DZLA 3BIRA 3DGLA 1K734 1RDSA 1YVBI 3GZYB 1YVSA 1UUGB 2W03A 1N9JA 3UJMA 3FG1A 1N8R4 1V74A 3T0UA 1R4CA 1YJ93 1VQN3 1JN5B 1PFPA 1JKGA 3JUQA 5IG5A 1D6UA 3HK4A 3DXOA 3NV0B 1ZGXA 4IPBA 2Z7AA 1BRIA 4XDVA 3OV4A 3F9SA 1O7GB 1STDA 2KF3A 2P38A 2PZVA 2YX9A 3JUMA 4N6LA 4R4KA 3BNDA 2LQVA 2YFLB 3KZTA 3GSPA 3UNLA 1VQP3 4XDWA 5TGNA 4XBXA 1UCJA 3OWYA 4GL6A 4HM4B 1IK3A 1KQS2 3SYUA 1VQL3 1Q40B 1G02A 3KSPA 3CC73 5M1AA 1S723 3DGMA 1TU5A 3T8NA 4N6TA 1OH0A 3U1WA 1X1WA 2HMJB 2Q07A 4MEIA 1L5GB 3SLUA 1VQK3 1RRHA 3FKAA 1IVWA 2ZHXB 1AV4A 4HM6B 1LXEA 3BNEA 3KIIA 3CD63 4LMIA 1K28A 1TP6A 1IVUA 3JUOA 1UGIA 2J8XB 2OQEA 3F40A 2AAEA 3EX9A 2OWPA 3B4PA 1RGHA 4LYLB 4EV5A 4WYKB 2C11A 1CYVA 2E2UA 2PNCA 3FGYA 1IT7A 3B7CA 3TDGA 5M19A 1PYLA 1NB3I 3K7CA 3OWSA 3CCL3 4HM3B 1T2IA 1WNHA 1YI23 2MF7A 5IG0A 5AEUB 1Z1SA 2UUGC 4RNYA 1UGHI 2STDA 2IUJA 3LOYA 1UUVB 1R4YA 3PZWA 4NHFA 1OUNA 2GEYA 2HMLB 7STDA 5EVHA 4RNZA 2IA7A 3CCV3 3GZRA 4R9KA 1RN4A 5AI1A 3CME3 4EW5A 1N5PA 1LVNA 2XFSA 2IY2A 2GXFA 2GU1A 3HZPA 1FUSA 4N6MA 1VQM3 1DVDA 2WOHA 2LYXA 4EXRA 2HMKB 1AVKA 1RGLA 1VQO3 3IMAB 3MKIA 1QALA 4FMBA 4QWTA 2P0MA 4WWUC 2CFWA 2RFRA 5D83A 3G4S3 5JPPA 1B2MA 3IJEB 1EKMA 3SVAA 1BNSA 3GRDA 1JBSA 1ULIB 2XEPA 1AR0A 4KFDA 1GD3A 4N6OB 4MMZB 1N8QA 4BIRA 1W00A 1FGRA 4AEQA 1RCLA 1LOXA 5JPUA 4OVMA 5AYRB 1RGCA 1MGRA 3GWRA 3MPHA 4ORLA 5HGRA 1B21A 3FF2A 2KF5A 2FXTA 3ZG0A 2QA43 3NQYA 4STDA 4L8OA 4XBYA 1WMPA 1K9M4 3STDA 1W01A 3S28A 5LC7A 3X3XA 2FGTA 1M904 4WHAA 1GY5A 1OHOA 1OF5B 4PEJA 3ROBA 5BXQA 2CK3H 2R4IA 2B24B 4HYZA 5ELUA 3ECFA 3OW22 1CQSA 3F7SA 1RLSA 3LMLA 2V1LA 3LZAA 4J8TA 1BSAA 5I97A 1A2VA 1BAOA 2CFKA 2RGQA 3WDGB 2INXA 2CX1A 4AKYA 3DUKA 1JJ22 1HYFA 1O7PB 3RNTA 3VF1A 1VQ93 2BMOB 9RNTA 3JVCA 2H0GA 4HJLB 4GB5A 6RNTA 3FH1A 1I0XA 1OGXA 1BOXA 1ZX2A 3MG3A 2M7OA 4BL3A 2L1SA 4JRFA 3WA2X 3KSED 3FLJA 4HAAA 1DYUA 1BNJA 2KXGA 4BTXA 3CCR3 4RZMA 1I8VA 5IERA 1I2GA 1BNEA 1BNGA 1G96A 3X42A 1NU3A 3VSYA 1NNVA 1KSIA 2XR8B 3HIIA 3WODG 3MSOA 3LXUX 1RN1A 2D1WA 1K41A 4OK0A 3D5GA 1Q814 2HMOB 2CW9A 4IIAA 3X3YA 3PGBA 1VQ43 1YJN3 1I3FA 7RNTA 2C10A 2BHMA 3D9RA 3BB9A 3JUNA 7GSPA 1AY7A 3G8ZA 1STFI 1RGAA 1LNIA 2YFIB 2BMQB 5BIRA 3EF8A 1IQ8A 4HM2B 8CHOA 4XBTA 1B3SA 1US1A 3H3HA 2HMNB 1KD14 4G1MB 4N3VA 1UCIA 5G1KA 5BU4A 1BGSA 3B8LA 4J5GA 3ZG5A 1UDII 1BRNL 1B27A 2CG0A 2SBLA 3EJVA 2XRXB 1W2B2 3CPW2 1WQLB 1QVG2 3FF0A 1FUWA 2GEXA 2KF4A 5RNTA 2Z6BA 3J7Yd 1BSCA 1BSEA 4MMYB 3X41A 2ML6A 1TIJA 3DY5A 2OTL3 2W2CA 3H51A 1MWRA 2GBWB 1SQWA 1ASKA 1BANA 4L8PA 1IU7A 1ROVA 1UI8A 1LOYA 2XSHB 3F14A 2XGNA 2WO0A 3LT9A 3MYTA 3CU3A 5EEOA 1JB2A 1OHPA 5KP1A 2KCDA 4FCMA 1LOWA 2IUKA 3E99A 2XFTA 3PYJA 1VQ83 2OTJ3 3LH4A 1CH0A 5LC6A 3EHCA 3FG4A 1LNHA 1FGTA 5FGOA 2CC3A 1JN5A 1W6YA 1EG9B 3FCSB 4MJDA 8RNTA 2KAAA 1I3IA 1RGGA 4XM4A 1KWIA 3A5EA 2ZA4A 4LGQA 1LRAA 2W56A 3LYGA 3N8BA 4WFOA 2F56A 4BU4A 2F98A 3DGOA 2O3OA 2BO9B 1BNRA 1JV2B 2F5WA 4N6V0 1FUTA 1GMPA 3WHOA 3CCS3 1NJI4 1SPUA 3AMOA 1SIIA 3EN8A 1B2SA 2CKFB 2W6JH 2K54A 4WP5A 3AHWA 1JB5A 1BRGA 1T3BA 3NQZA 1IYYA 1O7HB 3D4AA 2HMMB 2Y74A 4ZM8A 4H61A 1A67A 1MWUA 1F8NA 3ER7A 1W6CA 3HX8A 1KC84 1GY6A 1VQ63 2CFLA 3Q3FA 1NDOB 1WMNA 3OWUA 4K90B 2F86B 3SOYA 2R41A 1MWSA 3NUVA 2CHCA 5FW5A 5AIHA 3Q90A 3HOHA 1GD4A 1GSPA 5DREA 1I2FA 5EQLA 1DVCA 6STDA 2WOFA 2CG1A 1TRQA 2L4VA 2W04A 1E3RA 4H3UA 4HM5B 2UX0A 1CEWI 4FMCA 4J9AA 1EQKA 3BNBA 1I0VA 1BSDA 3KCHA 1QAKA 3U97A 1OCVA 5AIIA 2RSXA 1TTOA 3FZWA 1FA3A 2D42A 2WGOA 3RGAA 1SJWA 1TFOA 5G1LA 5G2GA 2MC8A 3S29A 1DMMA 4OUQA 2XGLA 4N6UA 5CF2A 3DGYA 1UCKA 1GY7A 2A15A 4LZIA 4HM7B 1VQ53 1BNFA 1ROAA 1JZDA 3NXJA 4RBNA 3RDEA 1LQGC 1GOYA 5JBSA 3CCM3 3CNMA 3DMCA 3K63A 1TRPA 1EEJA 1EA2A 3LTDA 5AIGA 1B2XA 5AYSC 5KP3A 4CPKA 2H0IA 3F8XA 4JF8A 1ULJB 1RNBA 2Z77A 4K61A 3CC23 1GMQA 4U13A 1T5YA 1W5ZA 5STDA 5IW9A 3LTAA 2CIUA 2ZL8A 1GS3A 1JKGB 2XH9A 3AGNA 4DKIA 1IQXA 4O02B 1BUQA 1PY3A 2OQEC 4FMAA 1M9GA 3S67A 1FGOA 1FZUA 1MWTA 2CWUA 3CMA3 1BIRA 2WGQA 5IG3A 5CLKA 2FNQA 3NX0A 2OCTA 1LOVA 3EBTA 3MWZA 1Q824 1RCKA 2ZDJA 1RN7A 3EN1B 1UUWB 2B1XB 3BU4A 3KKGA 3NBBA 1K8A4 1QAFA 3OX9A 1EUIC 2E2VA 1BUJA 3I0YA 2K0MA 3SOAA 2RNTA 1QJGA 2Z76A 1IVVA 3QK9A 3KFQC 3BLZA 1RJOA 2SARA 3WR2A 1YHQ3 1AQZA 1Q7Y4 2UGIA 1HKXA 1W6GA 3MG1A 2JQ5A 1YGEA 1WMOA 1RMSA 3WA3A 3IPTA 4HVNA 4O2HA 5D81A 1S5AA 1BRSA 1N9EA 1Q864 2KRTA 4BTWA 1LQMB 2P05A 1RKYA 3WOEB 3D79A 3EQQB 3V98A 3DH2A 3CPOA 4I5QA 1W4NA 1Y4KA 2W56B 4EV2A 4KVHA 3PCRA 1RGFA 4EYCA 1RNTA 1V58A 5M18A 2XF3A 1V57A 1B2ZA 3PCSA 3GZBA
chains in the Genus database with same CATH topology
1Q42A 3AMOB 3X3ZA 3M8CA 1W02A 2XSOB 1VZZA 2P09A 3F7XA 3WMDA 3NV0A 2QIYA 3KN4A 1UI7A 4O3VA 1OHSA 3EB8A 4HZBB 1JB4A 4Q53A 5ELJA 2OOVA 4AKZA 1J2BA 2W9QA 2CH9A 4IT7A 5DRVA 2BT3A 1O7NB 3PS8A 3EC9A 3Q2PA 3D3LA 3PXMA 4MMXB 4NREA 1N5HA 3ALAA 3HIGA 4HM0B 3DGNA 4HM8B 5IF6A 3N9HA 1Q40A 3KE7A 1O7MB 1YIJ3 1YJW3 4I4KA 3WOFB 2CFDA 5A0OB 5IENA 1IDPA 1IQYA 3G0KA 1YIT3 1NO3A 5IEOA 1D6ZA 1DMQA 2GBXB 1IV7A 1DMNA 2RCDA 1TUHA 2YFJB 3FG3A 5D82A 3S5CA 3CNXA 3CXC2 3CCE3 1A2KA 4HM1B 2CFGA 4FCZA 4R80A 4FR9A 3EBYA 4N6NB 4WYKA 1UW1A 2O9UX 4BTYA 1E97A 3K5TA 4TX4A 4XB5A 2JDIH 1CYUA 1TFKA 3F8HA 3G16A 4HKVB 3L0RA 4X2OA 5KP4A 4FCJA 3NM2A 4CDLA 1FGMA 1E3VA 3SEDA 1M1K4 3RGRA 5IG4A 2CWTA 1VQ73 1JNQA 1JRQA 3LTBA 4HZ9B 1U8CB 4LEHA 3SXXA 3I553 3CCJ3 4K1UA 1MNLA 1NWWA 1RRLA 3NM7A 4X2HA 3X40A 1QMAA 2W0QA 4R1KA 3N54B 4KFFA 3GAXA 1SIHA 2P0XA 4KZ1A 3UB1A 2BMRB 5AEWB 4L7KA 3T8UA 3CCU3 1W7CA 2QGUA 5CK6A 2GU3A 2QEX3 1QVF2 4LSOA 1FGQA 1D6YA 3V99A 1C7HA 1IT8A 1OPYA 3EE1A 3NHXA 5CXOA 1MOLA 3NBRA 5AIFA 1ISKA 1U5OA 3K0ZA 2W9PA 3QRDA 4R9LA 3DM8A 4EBGA 1IV9A 1OGZA 3MHEA 2I9WA 3B4OA 3SX1A 3VGNA 3LT8A 3V92A 3G6E3 4HBRA 2CWVA 2E2TA 1O7WB 1WTHA 1HU9A 2F99A 1GYBA 3NBJA 1W2ZA 3A76A 1OF5A 3GZXB 5CF1A 1A90A 3FSDA 5BVBA 3BNCA 1OACA 3K9MC 4KFEA 3Q1CA 3UL6A 4K1VA 2BNGA 3I563 3JUPA 2OOVC 3CCQ3 3MG2A 2ML5A 2Y73A 4CCVA 4O8SA 3LTCA 1M1XB 3OXAA 1AVLA 3HI7A 1PU4A 3CC43 1ZO2A 3O8YA 3G713 5IEPA 1IVXA 1NB5I 2IMJA 3UL5A 4EC6A 3S27A 4FMDA 3DZLA 3DGLA 1K734 1YVBI 3UJMA 3GZYB 2W03A 1N8R4 1N9JA 3FG1A 1V74A 3T0UA 1R4CA 1YJ93 1VQN3 1JN5B 1PFPA 1JKGA 3JUQA 5IG5A 1D6UA 3HK4A 3DXOA 3NV0B 4IPBA 2Z7AA 4XDVA 3OV4A 3F9SA 1O7GB 1STDA 2P38A 2PZVA 2YX9A 3JUMA 4N6LA 4R4KA 3BNDA 2LQVA 2YFLB 3KZTA 1VQP3 3UNLA 4XDWA 5TGNA 4XBXA 4GL6A 3OWYA 4HM4B 1IK3A 1KQS2 1VQL3 1Q40B 3KSPA 3CC73 1S723 3DGMA 1TU5A 3T8NA 4N6TA 1OH0A 2HMJB 2Q07A 4MEIA 1L5GB 3SLUA 1VQK3 1RRHA 3FKAA 1IVWA 1AV4A 4HM6B 1LXEA 3BNEA 3KIIA 3CD63 4LMIA 1K28A 1TP6A 1IVUA 3JUOA 2OQEA 3F40A 3EX9A 2OWPA 3B4PA 4EV5A 4WYKB 2PNCA 2C11A 1CYVA 2E2UA 3FGYA 1IT7A 3B7CA 3TDGA 1NB3I 3K7CA 3OWSA 3CCL3 4HM3B 1YI23 1WNHA 2MF7A 5IG0A 5AEUB 1Z1SA 4RNYA 2STDA 2IUJA 3LOYA 1UUVB 3PZWA 4NHFA 1OUNA 2GEYA 2HMLB 7STDA 5EVHA 4RNZA 2IA7A 3CCV3 3GZRA 4R9KA 5AI1A 3CME3 1N5PA 1LVNA 2XFSA 2GXFA 2GU1A 3HZPA 4N6MA 1VQM3 1DVDA 2WOHA 2LYXA 4EXRA 2HMKB 1AVKA 1VQO3 3IMAB 3MKIA 1QALA 4FMBA 4QWTA 2P0MA 4WWUC 2CFWA 2RFRA 5D83A 3G4S3 5JPPA 3IJEB 1EKMA 3SVAA 3GRDA 1ULIB 2XEPA 1AR0A 4KFDA 1GD3A 4N6OB 4MMZB 1N8QA 1W00A 1FGRA 4AEQA 1LOXA 5JPUA 4OVMA 5AYRB 3GWRA 5HGRA 3MPHA 4ORLA 3FF2A 2FXTA 2QA43 3NQYA 4STDA 4L8OA 4XBYA 1WMPA 1K9M4 3STDA 1W01A 3S28A 5LC7A 3X3XA 2FGTA 1M904 4WHAA 1GY5A 1OHOA 1OF5B 4PEJA 3ROBA 5BXQA 2CK3H 2R4IA 2B24B 4HYZA 5ELUA 3ECFA 3OW22 1CQSA 3F7SA 3LMLA 2V1LA 3LZAA 4J8TA 5I97A 1A2VA 2CFKA 2RGQA 3WDGB 2INXA 4AKYA 3DUKA 1JJ22 1O7PB 3VF1A 1VQ93 2BMOB 3JVCA 4HJLB 4GB5A 3FH1A 1OGXA 1ZX2A 3MG3A 2M7OA 4JRFA 3WA2X 3KSED 3FLJA 1DYUA 2KXGA 4BTXA 3CCR3 4RZMA 5IERA 1G96A 3X42A 1NU3A 3VSYA 1KSIA 2XR8B 3HIIA 3WODG 3MSOA 3LXUX 2D1WA 1K41A 4OK0A 1Q814 2HMOB 2CW9A 4IIAA 3X3YA 3PGBA 1VQ43 1YJN3 2C10A 2BHMA 3D9RA 3BB9A 3JUNA 3G8ZA 1STFI 2YFIB 2BMQB 3EF8A 1IQ8A 4HM2B 8CHOA 4XBTA 1US1A 3H3HA 2HMNB 1KD14 4G1MB 4N3VA 3B8LA 2SBLA 2CG0A 3EJVA 2XRXB 1W2B2 3CPW2 1WQLB 1QVG2 3FF0A 1FUWA 2GEXA 2Z6BA 3J7Yd 4MMYB 3X41A 2ML6A 1TIJA 3DY5A 2OTL3 2W2CA 3H51A 2GBWB 1SQWA 1ASKA 4L8PA 3U1WA 1IU7A 1ROVA 1UI8A 2XSHB 3F14A 3LT9A 2XGNA 2WO0A 3MYTA 3CU3A 5EEOA 1JB2A 1OHPA 5KP1A 2KCDA 4FCMA 2IUKA 3E99A 2XFTA 3PYJA 1VQ83 2OTJ3 3LH4A 5LC6A 3EHCA 3FG4A 1LNHA 1FGTA 5FGOA 2CC3A 1JN5A 1W6YA 1EG9B 3FCSB 4MJDA 4XM4A 1KWIA 4LGQA 2W56A 3LYGA 3N8BA 4WFOA 2F98A 3DGOA 2O3OA 2BO9B 1JV2B 4N6V0 3CCS3 1NJI4 1SPUA 3AMOA 1SIIA 3EN8A 2CKFB 2W6JH 2K54A 4WP5A 1JB5A 3NQZA 1O7HB 2HMMB 2Y74A 4ZM8A 4H61A 1A67A 1F8NA 3ER7A 1W6CA 3HX8A 1KC84 1GY6A 1VQ63 2CFLA 1NDOB 1WMNA 3OWUA 4K90B 2F86B 3SOYA 3NUVA 2CHCA 5FW5A 5AIHA 3Q90A 1GD4A 5DREA 5EQLA 1DVCA 6STDA 2WOFA 2CG1A 2L4VA 2W04A 1E3RA 4H3UA 4HM5B 2UX0A 1CEWI 4FMCA 4J9AA 1EQKA 3BNBA 1QAKA 3U97A 1OCVA 5AIIA 2RSXA 3FZWA 1FA3A 2D42A 2WGOA 3RGAA 1SJWA 1TFOA 5G2GA 2MC8A 3S29A 1DMMA 4OUQA 2XGLA 4N6UA 5CF2A 1GY7A 2A15A 4LZIA 4HM7B 1VQ53 1ROAA 3NXJA 4RBNA 3RDEA 5JBSA 3CCM3 3CNMA 3DMCA 3K63A 3LTDA 5AIGA 1EA2A 5KP3A 5AYSC 3F8XA 4JF8A 1ULJB 2Z77A 4K61A 3CC23 4U13A 1T5YA 1W5ZA 5STDA 5IW9A 3LTAA 2CIUA 2ZL8A 1GS3A 1JKGB 2XH9A 1IQXA 4O02B 1BUQA 2OQEC 4FMAA 1M9GA 3S67A 1FGOA 2CWUA 3CMA3 2WGQA 5IG3A 5CLKA 2FNQA 3NX0A 2OCTA 1Q824 3EBTA 3MWZA 3EN1B 2ZDJA 1RN7A 3KKGA 1UUWB 2B1XB 3NBBA 1K8A4 1QAFA 3OX9A 2E2VA 3I0YA 2K0MA 3SOAA 1QJGA 2Z76A 1IVVA 3QK9A 3KFQC 3BLZA 1RJOA 1YHQ3 1Q7Y4 1HKXA 1W6GA 3MG1A 2JQ5A 1YGEA 1WMOA 3WA3A 3IPTA 4HVNA 4O2HA 5D81A 1S5AA 1N9EA 1Q864 2KRTA 4BTWA 1RKYA 2P05A 3WOEB 3EQQB 3V98A 3CPOA 1W4NA 1Y4KA 2W56B 4EV2A 4KVHA 3PCRA 4EYCA 2XF3A 3PCSA 3GZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  3M8C A;  1W02 A;  2XSO B;  1VZZ A;  3F7X A;  3WMD A;  3NV0 A;  2QIY A;  1OHS A;  4HZB B;  4Q53 A;  1JB4 A;  5DRV A;  1O7N B;  3EC9 A;  4HM0 B;  4HM8 B;  5IF6 A;  1Q40 A;  3KE7 A;  1O7M B;  4I4K A;  5IEN A;  1IDP A;  3G0K A;  5IEO A;  1DMQ A;  2GBX B;  1DMN A;  2RCD A;  1TUH A;  2YFJ B;  5D82 A;  3S5C A;  3CNX A;  1A2K A;  4HM1 B;  3EBY A;  4WYK A;  1E97 A;  4XB5 A;  3F8H A;  3G16 A;  4HKV B;  4X2O A;  5KP4 A;  4FCJ A;  3NM2 A;  4CDL A;  1E3V A;  3SED A;  3RGR A;  5IG4 A;  4HZ9 B;  4LEH A;  4K1U A;  1NWW A;  4X2H A;  1QMA A;  4R1K A;  5AEW B;  2BMR B;  4L7K A;  3T8U A;  2QGU A;  5CK6 A;  1C7H A;  1OPY A;  3NHX A;  5CXO A;  1ISK A;  3NBR A;  5AIF A;  1U5O A;  3K0Z A;  4R9L A;  3DM8 A;  1OGZ A;  3MHE A;  2I9W A;  3B4O A;  3VGN A;  1O7W B;  2F99 A;  1GYB A;  3A76 A;  1OF5 A;  3GZX B;  5CF1 A;  3FSD A;  5BVB A;  4K1V A;  2BNG A;  3JUP A;  3MG2 A;  3OXA A;  1ZO2 A;  5IEP A;  2IMJ A;  3DZL A;  3UJM A;  3GZY B;  1JN5 B;  1JKG A;  3JUQ A;  5IG5 A;  3HK4 A;  3NV0 B;  3DXO A;  2Z7A A;  4XDV A;  3OV4 A;  3F9S A;  1O7G B;  1STD A;  2PZV A;  3JUM A;  2YFL B;  3KZT A;  3UNL A;  4XDW A;  5TGN A;  4XBX A;  3OWY A;  4HM4 B;  1Q40 B;  3KSP A;  3T8N A;  1OH0 A;  2HMJ B;  3FKA A;  4HM6 B;  4LMI A;  1TP6 A;  3JUO A;  3F40 A;  3EX9 A;  2OWP A;  3B4P A;  4WYK B;  3FGY A;  3B7C A;  3K7C A;  3OWS A;  4HM3 B;  5IG0 A;  5AEU B;  1Z1S A;  2STD A;  1UUV B;  1OUN A;  2GEY A;  2HML B;  7STD A;  5EVH A;  3GZR A;  4R9K A;  5AI1 A;  2GXF A;  3HZP A;  2HMK B;  3MKI A;  4WWU C;  5D83 A;  2RFR A;  5JPP A;  3GRD A;  1ULI B;  1AR0 A;  1W00 A;  5JPU A;  4OVM A;  3GWR A;  5HGR A;  4ORL A;  3FF2 A;  4STD A;  4L8O A;  4XBY A;  3STD A;  1W01 A;  1GY5 A;  4PEJ A;  1OHO A;  1OF5 B;  3ROB A;  5BXQ A;  2R4I A;  2B24 B;  3ECF A;  1CQS A;  3F7S A;  3LZA A;  4J8T A;  2RGQ A;  2INX A;  3DUK A;  1O7P B;  2BMO B;  4HJL B;  4GB5 A;  3FH1 A;  1OGX A;  1ZX2 A;  3MG3 A;  3FLJ A;  4RZM A;  5IER A;  1NU3 A;  3VSY A;  2XR8 B;  3MSO A;  1K41 A;  2HMO B;  4IIA A;  3D9R A;  3BB9 A;  3JUN A;  3G8Z A;  2YFI B;  2BMQ B;  3EF8 A;  4HM2 B;  8CHO A;  4XBT A;  3H3H A;  2HMN B;  4N3V A;  3B8L A;  3EJV A;  2XRX B;  1WQL B;  3FF0 A;  2GEX A;  2W2C A;  3H51 A;  2GBW B;  4L8P A;  1ASK A;  2XSH B;  3F14 A;  3MYT A;  3CU3 A;  1JB2 A;  1OHP A;  5KP1 A;  4FCM A;  3E99 A;  3EHC A;  1JN5 A;  1W6Y A;  1EG9 B;  4MJD A;  4XM4 A;  4LGQ A;  3LYG A;  2F98 A;  3EN8 A;  2CKF B;  2K54 A;  4WP5 A;  1JB5 A;  1O7H B;  2HMM B;  3ER7 A;  3HX8 A;  1GY6 A;  1NDO B;  3OWU A;  3SOY A;  2F86 B;  3NUV A;  2CHC A;  5FW5 A;  5AIH A;  3Q90 A;  5DRE A;  6STD A;  1E3R A;  4H3U A;  4HM5 B;  2UX0 A;  4J9A A;  1OCV A;  5AII A;  3FZW A;  3RGA A;  1SJW A;  5G2G A;  1DMM A;  4OUQ A;  5CF2 A;  1GY7 A;  2A15 A;  4HM7 B;  3NXJ A;  3CNM A;  3DMC A;  5AIG A;  5KP3 A;  1EA2 A;  3F8X A;  1ULJ B;  2Z77 A;  4U13 A;  5STD A;  1GS3 A;  1JKG B;  1BUQ A;  5IG3 A;  5CLK A;  3EBT A;  3EN1 B;  3KKG A;  1UUW B;  2B1X B;  3OX9 A;  3I0Y A;  3SOA A;  1QJG A;  2Z76 A;  3BLZ A;  1HKX A;  3MG1 A;  2JQ5 A;  3IPT A;  4HVN A;  5D81 A;  1S5A A;  3EQQ B;  3CPO A;  4KVH A;  3GZB A; 
#chains in the Genus database with same CATH topology
 1Q42 A;  3AMO B;  3X3Z A;  3M8C A;  1W02 A;  2XSO B;  1VZZ A;  2P09 A;  3F7X A;  3WMD A;  3NV0 A;  2QIY A;  3KN4 A;  1TJD A;  1B2U A;  1X1U A;  1UI7 A;  1A2P A;  1X1Y A;  4O3V A;  1OHS A;  3EB8 A;  4HZB B;  1JB4 A;  4Q53 A;  5ELJ A;  2OOV A;  4AKZ A;  1J2B A;  3AGO A;  2W9Q A;  2CH9 A;  4IT7 A;  5DRV A;  2BT3 A;  2F5M A;  1O7N B;  3PS8 A;  3EC9 A;  3Q2P A;  3D3L A;  3PXM A;  4MMX B;  1UCL A;  4NRE A;  1N5H A;  1RSN A;  3ALA A;  3HIG A;  1Q9E A;  3DGN A;  4HM0 B;  4HM8 B;  5IF6 A;  3N9H A;  1Q40 A;  3KE7 A;  4RNT A;  1FW7 A;  1O7M B;  1YIJ 3;  1YJW 3;  4GSP A;  4I4K A;  4NPB A;  3WOF B;  4ILF A;  2CFD A;  4CJN A;  5A0O B;  5IEN A;  1IDP A;  4GHO A;  1IQY A;  3G0K A;  1FYS A;  6GSP A;  1YIT 3;  1NO3 A;  5IEO A;  1D6Z A;  1BNI A;  1DMQ A;  2GBX B;  1YNV X;  1IV7 A;  1DMN A;  2RCD A;  1TUH A;  2YFJ B;  3FG3 A;  5D82 A;  3S5C A;  3CNX A;  3CXC 2;  3CCE 3;  2K3D A;  1A2K A;  1BSB A;  1RGK A;  4HM1 B;  2CFG A;  4FCZ A;  1JZO A;  2AAD A;  4J5K A;  4FR9 A;  4R80 A;  3EBY A;  4N6N B;  1GOV A;  1UW1 A;  2H0H A;  1BRH A;  2O9U X;  4WYK A;  4BTY A;  1E97 A;  3K5T A;  4KT3 B;  4TX4 A;  4XB5 A;  2JDI H;  1CYU A;  1DE3 A;  1TFK A;  3F8H A;  3G16 A;  4HKV B;  3L0R A;  4X2O A;  5KP4 A;  4FCJ A;  3NM2 A;  4CDL A;  1GMR A;  1FGM A;  1E3V A;  4HOH A;  3SED A;  1M1K 4;  3RGR A;  5IG4 A;  2CWT A;  1VQ7 3;  1JNQ A;  1JRQ A;  1VQQ A;  3LTB A;  4HZ9 B;  1U8C B;  2KF6 A;  4LEH A;  1ZS7 A;  3SXX A;  4K1U A;  3I55 3;  3CCJ 3;  1MNL A;  1NWW A;  5HOH A;  1RRL A;  3NM7 A;  4X2H A;  3URP A;  3X40 A;  1QMA A;  2W0Q A;  4R1K A;  1BVI A;  3N54 B;  4KFF A;  3GAX A;  1SIH A;  2P0X A;  4KZ1 A;  3UB1 A;  2BMR B;  5AEW B;  4L7K A;  3T8U A;  3CCU 3;  2BIR A;  1W7C A;  2QGU A;  5CK6 A;  1JBR A;  2GU3 A;  2QEX 3;  1SAR A;  1QVF 2;  4LSO A;  1RGE A;  1FGQ A;  1D6Y A;  3V99 A;  1C7H A;  1IT8 A;  1OPY A;  3D5I A;  3EE1 A;  2BU4 A;  3NHX A;  5CXO A;  1MOL A;  1GOU A;  3NBR A;  5AIF A;  1U5O A;  1ISK A;  3ZFZ A;  3K0Z A;  2W9P A;  1DET A;  3QRD A;  4R9L A;  4BL2 A;  2C4B A;  1T2H A;  3DM8 A;  5GSP A;  4EBG A;  1IV9 A;  1OGZ A;  3MHE A;  2I9W A;  2RBI A;  3B4O A;  3SX1 A;  3VGN A;  3LT8 A;  1RTU A;  3V92 A;  4HBR A;  2HOH A;  3G6E 3;  2CWV A;  2E2T A;  1O7W B;  1WTH A;  1HU9 A;  2F99 A;  1G0T A;  1GYB A;  3NBJ A;  1BRJ A;  1W2Z A;  1HZ1 A;  3A76 A;  1OF5 A;  2IYJ A;  3GZX B;  1RHL A;  5CF1 A;  1A90 A;  3FSD A;  5BVB A;  3BNC A;  1OAC A;  3K9M C;  4KFE A;  1YGW A;  1I2E A;  1MGW A;  3Q1C A;  4K1V A;  2BNG A;  2GSP A;  3UL6 A;  3I56 3;  3JUP A;  2OOV C;  3CCQ 3;  1JBT A;  3MG2 A;  2ML5 A;  2Y73 A;  4CCV A;  1I70 A;  1X1X A;  4O8S A;  1BRK A;  1M1X B;  3AHS A;  3LTC A;  3OXA A;  1B20 A;  1AVL A;  3HI7 A;  1PU4 A;  2CX0 A;  3CC4 3;  2F4Y A;  1ZO2 A;  3O8Y A;  1C54 A;  1BU4 A;  3G71 3;  5IEP A;  1Q7H A;  1IVX A;  1NB5 I;  2IMJ A;  3UL5 A;  4EC6 A;  3S27 A;  4FMD A;  3DZL A;  3BIR A;  3DGL A;  1K73 4;  1RDS A;  1YVB I;  3GZY B;  1YVS A;  1UUG B;  2W03 A;  1N9J A;  3UJM A;  3FG1 A;  1N8R 4;  1V74 A;  3T0U A;  1R4C A;  1YJ9 3;  1VQN 3;  1JN5 B;  1PFP A;  1JKG A;  3JUQ A;  5IG5 A;  1D6U A;  3HK4 A;  3DXO A;  3NV0 B;  1ZGX A;  4IPB A;  2Z7A A;  1BRI A;  4XDV A;  3OV4 A;  3F9S A;  1O7G B;  1STD A;  2KF3 A;  2P38 A;  2PZV A;  2YX9 A;  3JUM A;  4N6L A;  4R4K A;  3BND A;  2LQV A;  2YFL B;  3KZT A;  3GSP A;  3UNL A;  1VQP 3;  4XDW A;  5TGN A;  4XBX A;  1UCJ A;  3OWY A;  4GL6 A;  4HM4 B;  1IK3 A;  1KQS 2;  3SYU A;  1VQL 3;  1Q40 B;  1G02 A;  3KSP A;  3CC7 3;  5M1A A;  1S72 3;  3DGM A;  1TU5 A;  3T8N A;  4N6T A;  1OH0 A;  3U1W A;  1X1W A;  2HMJ B;  2Q07 A;  4MEI A;  1L5G B;  3SLU A;  1VQK 3;  1RRH A;  3FKA A;  1IVW A;  2ZHX B;  1AV4 A;  4HM6 B;  1LXE A;  3BNE A;  3KII A;  3CD6 3;  4LMI A;  1K28 A;  1TP6 A;  1IVU A;  3JUO A;  1UGI A;  2J8X B;  2OQE A;  3F40 A;  2AAE A;  3EX9 A;  2OWP A;  3B4P A;  1RGH A;  4LYL B;  4EV5 A;  4WYK B;  2C11 A;  1CYV A;  2E2U A;  2PNC A;  3FGY A;  1IT7 A;  3B7C A;  3TDG A;  5M19 A;  1PYL A;  1NB3 I;  3K7C A;  3OWS A;  3CCL 3;  4HM3 B;  1T2I A;  1WNH A;  1YI2 3;  2MF7 A;  5IG0 A;  5AEU B;  1Z1S A;  2UUG C;  4RNY A;  1UGH I;  2STD A;  2IUJ A;  3LOY A;  1UUV B;  1R4Y A;  3PZW A;  4NHF A;  1OUN A;  2GEY A;  2HML B;  7STD A;  5EVH A;  4RNZ A;  2IA7 A;  3CCV 3;  3GZR A;  4R9K A;  1RN4 A;  5AI1 A;  3CME 3;  4EW5 A;  1N5P A;  1LVN A;  2XFS A;  2IY2 A;  2GXF A;  2GU1 A;  3HZP A;  1FUS A;  4N6M A;  1VQM 3;  1DVD A;  2WOH A;  2LYX A;  4EXR A;  2HMK B;  1AVK A;  1RGL A;  1VQO 3;  3IMA B;  3MKI A;  1QAL A;  4FMB A;  4QWT A;  2P0M A;  4WWU C;  2CFW A;  2RFR A;  5D83 A;  3G4S 3;  5JPP A;  1B2M A;  3IJE B;  1EKM A;  3SVA A;  1BNS A;  3GRD A;  1JBS A;  1ULI B;  2XEP A;  1AR0 A;  4KFD A;  1GD3 A;  4N6O B;  4MMZ B;  1N8Q A;  4BIR A;  1W00 A;  1FGR A;  4AEQ A;  1RCL A;  1LOX A;  5JPU A;  4OVM A;  5AYR B;  1RGC A;  1MGR A;  3GWR A;  3MPH A;  4ORL A;  5HGR A;  1B21 A;  3FF2 A;  2KF5 A;  2FXT A;  3ZG0 A;  2QA4 3;  3NQY A;  4STD A;  4L8O A;  4XBY A;  1WMP A;  1K9M 4;  3STD A;  1W01 A;  3S28 A;  5LC7 A;  3X3X A;  2FGT A;  1M90 4;  4WHA A;  1GY5 A;  1OHO A;  1OF5 B;  4PEJ A;  3ROB A;  5BXQ A;  2CK3 H;  2R4I A;  2B24 B;  4HYZ A;  5ELU A;  3ECF A;  3OW2 2;  1CQS A;  3F7S A;  1RLS A;  3LML A;  2V1L A;  3LZA A;  4J8T A;  1BSA A;  5I97 A;  1A2V A;  1BAO A;  2CFK A;  2RGQ A;  3WDG B;  2INX A;  2CX1 A;  4AKY A;  3DUK A;  1JJ2 2;  1HYF A;  1O7P B;  3RNT A;  3VF1 A;  1VQ9 3;  2BMO B;  9RNT A;  3JVC A;  2H0G A;  4HJL B;  4GB5 A;  6RNT A;  3FH1 A;  1I0X A;  1OGX A;  1BOX A;  1ZX2 A;  3MG3 A;  2M7O A;  4BL3 A;  2L1S A;  4JRF A;  3WA2 X;  3KSE D;  3FLJ A;  4HAA A;  1DYU A;  1BNJ A;  2KXG A;  4BTX A;  3CCR 3;  4RZM A;  1I8V A;  5IER A;  1I2G A;  1BNE A;  1BNG A;  1G96 A;  3X42 A;  1NU3 A;  3VSY A;  1NNV A;  1KSI A;  2XR8 B;  3HII A;  3WOD G;  3MSO A;  3LXU X;  1RN1 A;  2D1W A;  1K41 A;  4OK0 A;  3D5G A;  1Q81 4;  2HMO B;  2CW9 A;  4IIA A;  3X3Y A;  3PGB A;  1VQ4 3;  1YJN 3;  1I3F A;  7RNT A;  2C10 A;  2BHM A;  3D9R A;  3BB9 A;  3JUN A;  7GSP A;  1AY7 A;  3G8Z A;  1STF I;  1RGA A;  1LNI A;  2YFI B;  2BMQ B;  5BIR A;  3EF8 A;  1IQ8 A;  4HM2 B;  8CHO A;  4XBT A;  1B3S A;  1US1 A;  3H3H A;  2HMN B;  1KD1 4;  4G1M B;  4N3V A;  1UCI A;  5G1K A;  5BU4 A;  1BGS A;  3B8L A;  4J5G A;  3ZG5 A;  1UDI I;  1BRN L;  1B27 A;  2CG0 A;  2SBL A;  3EJV A;  2XRX B;  1W2B 2;  3CPW 2;  1WQL B;  1QVG 2;  3FF0 A;  1FUW A;  2GEX A;  2KF4 A;  5RNT A;  2Z6B A;  3J7Y d;  1BSC A;  1BSE A;  4MMY B;  3X41 A;  2ML6 A;  1TIJ A;  3DY5 A;  2OTL 3;  2W2C A;  3H51 A;  1MWR A;  2GBW B;  1SQW A;  1ASK A;  1BAN A;  4L8P A;  1IU7 A;  1ROV A;  1UI8 A;  1LOY A;  2XSH B;  3F14 A;  2XGN A;  2WO0 A;  3LT9 A;  3MYT A;  3CU3 A;  5EEO A;  1JB2 A;  1OHP A;  5KP1 A;  2KCD A;  4FCM A;  1LOW A;  2IUK A;  3E99 A;  2XFT A;  3PYJ A;  1VQ8 3;  2OTJ 3;  3LH4 A;  1CH0 A;  5LC6 A;  3EHC A;  3FG4 A;  1LNH A;  1FGT A;  5FGO A;  2CC3 A;  1JN5 A;  1W6Y A;  1EG9 B;  3FCS B;  4MJD A;  8RNT A;  2KAA A;  1I3I A;  1RGG A;  4XM4 A;  1KWI A;  3A5E A;  2ZA4 A;  4LGQ A;  1LRA A;  2W56 A;  3LYG A;  3N8B A;  4WFO A;  2F56 A;  4BU4 A;  2F98 A;  3DGO A;  2O3O A;  2BO9 B;  1BNR A;  1JV2 B;  2F5W A;  4N6V 0;  1FUT A;  1GMP A;  3WHO A;  3CCS 3;  1NJI 4;  1SPU A;  3AMO A;  1SII A;  3EN8 A;  1B2S A;  2CKF B;  2W6J H;  2K54 A;  4WP5 A;  3AHW A;  1JB5 A;  1BRG A;  1T3B A;  3NQZ A;  1IYY A;  1O7H B;  3D4A A;  2HMM B;  2Y74 A;  4ZM8 A;  4H61 A;  1A67 A;  1MWU A;  1F8N A;  3ER7 A;  1W6C A;  3HX8 A;  1KC8 4;  1GY6 A;  1VQ6 3;  2CFL A;  3Q3F A;  1NDO B;  1WMN A;  3OWU A;  4K90 B;  2F86 B;  3SOY A;  2R41 A;  1MWS A;  3NUV A;  2CHC A;  5FW5 A;  5AIH A;  3Q90 A;  3HOH A;  1GD4 A;  1GSP A;  5DRE A;  1I2F A;  5EQL A;  1DVC A;  6STD A;  2WOF A;  2CG1 A;  1TRQ A;  2L4V A;  2W04 A;  1E3R A;  4H3U A;  4HM5 B;  2UX0 A;  1CEW I;  4FMC A;  4J9A A;  1EQK A;  3BNB A;  1I0V A;  1BSD A;  3KCH A;  1QAK A;  3U97 A;  1OCV A;  5AII A;  2RSX A;  1TTO A;  3FZW A;  1FA3 A;  2D42 A;  2WGO A;  3RGA A;  1SJW A;  1TFO A;  5G1L A;  5G2G A;  2MC8 A;  3S29 A;  1DMM A;  4OUQ A;  2XGL A;  4N6U A;  5CF2 A;  3DGY A;  1UCK A;  1GY7 A;  2A15 A;  4LZI A;  4HM7 B;  1VQ5 3;  1BNF A;  1ROA A;  1JZD A;  3NXJ A;  4RBN A;  3RDE A;  1LQG C;  1GOY A;  5JBS A;  3CCM 3;  3CNM A;  3DMC A;  3K63 A;  1TRP A;  1EEJ A;  1EA2 A;  3LTD A;  5AIG A;  1B2X A;  5AYS C;  5KP3 A;  4CPK A;  2H0I A;  3F8X A;  4JF8 A;  1ULJ B;  1RNB A;  2Z77 A;  4K61 A;  3CC2 3;  1GMQ A;  4U13 A;  1T5Y A;  1W5Z A;  5STD A;  5IW9 A;  3LTA A;  2CIU A;  2ZL8 A;  1GS3 A;  1JKG B;  2XH9 A;  3AGN A;  4DKI A;  1IQX A;  4O02 B;  1BUQ A;  1PY3 A;  2OQE C;  4FMA A;  1M9G A;  3S67 A;  1FGO A;  1FZU A;  1MWT A;  2CWU A;  3CMA 3;  1BIR A;  2WGQ A;  5IG3 A;  5CLK A;  2FNQ A;  3NX0 A;  2OCT A;  1LOV A;  3EBT A;  3MWZ A;  1Q82 4;  1RCK A;  2ZDJ A;  1RN7 A;  3EN1 B;  1UUW B;  2B1X B;  3BU4 A;  3KKG A;  3NBB A;  1K8A 4;  1QAF A;  3OX9 A;  1EUI C;  2E2V A;  1BUJ A;  3I0Y A;  2K0M A;  3SOA A;  2RNT A;  1QJG A;  2Z76 A;  1IVV A;  3QK9 A;  3KFQ C;  3BLZ A;  1RJO A;  2SAR A;  3WR2 A;  1YHQ 3;  1AQZ A;  1Q7Y 4;  2UGI A;  1HKX A;  1W6G A;  3MG1 A;  2JQ5 A;  1YGE A;  1WMO A;  1RMS A;  3WA3 A;  3IPT A;  4HVN A;  4O2H A;  5D81 A;  1S5A A;  1BRS A;  1N9E A;  1Q86 4;  2KRT A;  4BTW A;  1LQM B;  2P05 A;  1RKY A;  3WOE B;  3D79 A;  3EQQ B;  3V98 A;  3DH2 A;  3CPO A;  4I5Q A;  1W4N A;  1Y4K A;  2W56 B;  4EV2 A;  4KVH A;  3PCR A;  1RGF A;  4EYC A;  1RNT A;  1V58 A;  5M18 A;  2XF3 A;  1V57 A;  1B2Z A;  3PCS A;  3GZB A; 
#chains in the Genus database with same CATH homology
 1Q42 A;  3AMO B;  3X3Z A;  3M8C A;  1W02 A;  2XSO B;  1VZZ A;  2P09 A;  3F7X A;  3WMD A;  3NV0 A;  2QIY A;  3KN4 A;  1UI7 A;  4O3V A;  1OHS A;  3EB8 A;  4HZB B;  1JB4 A;  4Q53 A;  5ELJ A;  2OOV A;  4AKZ A;  1J2B A;  2W9Q A;  2CH9 A;  4IT7 A;  5DRV A;  2BT3 A;  1O7N B;  3PS8 A;  3EC9 A;  3Q2P A;  3D3L A;  3PXM A;  4MMX B;  4NRE A;  1N5H A;  3ALA A;  3HIG A;  4HM0 B;  3DGN A;  4HM8 B;  5IF6 A;  3N9H A;  1Q40 A;  3KE7 A;  1O7M B;  1YIJ 3;  1YJW 3;  4I4K A;  3WOF B;  2CFD A;  5A0O B;  5IEN A;  1IDP A;  1IQY A;  3G0K A;  1YIT 3;  1NO3 A;  5IEO A;  1D6Z A;  1DMQ A;  2GBX B;  1IV7 A;  1DMN A;  2RCD A;  1TUH A;  2YFJ B;  3FG3 A;  5D82 A;  3S5C A;  3CNX A;  3CXC 2;  3CCE 3;  1A2K A;  4HM1 B;  2CFG A;  4FCZ A;  4R80 A;  4FR9 A;  3EBY A;  4N6N B;  4WYK A;  1UW1 A;  2O9U X;  4BTY A;  1E97 A;  3K5T A;  4TX4 A;  4XB5 A;  2JDI H;  1CYU A;  1TFK A;  3F8H A;  3G16 A;  4HKV B;  3L0R A;  4X2O A;  5KP4 A;  4FCJ A;  3NM2 A;  4CDL A;  1FGM A;  1E3V A;  3SED A;  1M1K 4;  3RGR A;  5IG4 A;  2CWT A;  1VQ7 3;  1JNQ A;  1JRQ A;  3LTB A;  4HZ9 B;  1U8C B;  4LEH A;  3SXX A;  3I55 3;  3CCJ 3;  4K1U A;  1MNL A;  1NWW A;  1RRL A;  3NM7 A;  4X2H A;  3X40 A;  1QMA A;  2W0Q A;  4R1K A;  3N54 B;  4KFF A;  3GAX A;  1SIH A;  2P0X A;  4KZ1 A;  3UB1 A;  2BMR B;  5AEW B;  4L7K A;  3T8U A;  3CCU 3;  1W7C A;  2QGU A;  5CK6 A;  2GU3 A;  2QEX 3;  1QVF 2;  4LSO A;  1FGQ A;  1D6Y A;  3V99 A;  1C7H A;  1IT8 A;  1OPY A;  3EE1 A;  3NHX A;  5CXO A;  1MOL A;  3NBR A;  5AIF A;  1ISK A;  1U5O A;  3K0Z A;  2W9P A;  3QRD A;  4R9L A;  3DM8 A;  4EBG A;  1IV9 A;  1OGZ A;  3MHE A;  2I9W A;  3B4O A;  3SX1 A;  3VGN A;  3LT8 A;  3V92 A;  3G6E 3;  4HBR A;  2CWV A;  2E2T A;  1O7W B;  1WTH A;  1HU9 A;  2F99 A;  1GYB A;  3NBJ A;  1W2Z A;  3A76 A;  1OF5 A;  3GZX B;  5CF1 A;  1A90 A;  3FSD A;  5BVB A;  3BNC A;  1OAC A;  3K9M C;  4KFE A;  3Q1C A;  3UL6 A;  4K1V A;  2BNG A;  3I56 3;  3JUP A;  2OOV C;  3CCQ 3;  3MG2 A;  2ML5 A;  2Y73 A;  4CCV A;  4O8S A;  3LTC A;  1M1X B;  3OXA A;  1AVL A;  3HI7 A;  1PU4 A;  3CC4 3;  1ZO2 A;  3O8Y A;  3G71 3;  5IEP A;  1IVX A;  1NB5 I;  2IMJ A;  3UL5 A;  4EC6 A;  3S27 A;  4FMD A;  3DZL A;  3DGL A;  1K73 4;  1YVB I;  3UJM A;  3GZY B;  2W03 A;  1N8R 4;  1N9J A;  3FG1 A;  1V74 A;  3T0U A;  1R4C A;  1YJ9 3;  1VQN 3;  1JN5 B;  1PFP A;  1JKG A;  3JUQ A;  5IG5 A;  1D6U A;  3HK4 A;  3DXO A;  3NV0 B;  4IPB A;  2Z7A A;  4XDV A;  3OV4 A;  3F9S A;  1O7G B;  1STD A;  2P38 A;  2PZV A;  2YX9 A;  3JUM A;  4N6L A;  4R4K A;  3BND A;  2LQV A;  2YFL B;  3KZT A;  1VQP 3;  3UNL A;  4XDW A;  5TGN A;  4XBX A;  4GL6 A;  3OWY A;  4HM4 B;  1IK3 A;  1KQS 2;  1VQL 3;  1Q40 B;  3KSP A;  3CC7 3;  1S72 3;  3DGM A;  1TU5 A;  3T8N A;  4N6T A;  1OH0 A;  2HMJ B;  2Q07 A;  4MEI A;  1L5G B;  3SLU A;  1VQK 3;  1RRH A;  3FKA A;  1IVW A;  1AV4 A;  4HM6 B;  1LXE A;  3BNE A;  3KII A;  3CD6 3;  4LMI A;  1K28 A;  1TP6 A;  1IVU A;  3JUO A;  2OQE A;  3F40 A;  3EX9 A;  2OWP A;  3B4P A;  4EV5 A;  4WYK B;  2PNC A;  2C11 A;  1CYV A;  2E2U A;  3FGY A;  1IT7 A;  3B7C A;  3TDG A;  1NB3 I;  3K7C A;  3OWS A;  3CCL 3;  4HM3 B;  1YI2 3;  1WNH A;  2MF7 A;  5IG0 A;  5AEU B;  1Z1S A;  4RNY A;  2STD A;  2IUJ A;  3LOY A;  1UUV B;  3PZW A;  4NHF A;  1OUN A;  2GEY A;  2HML B;  7STD A;  5EVH A;  4RNZ A;  2IA7 A;  3CCV 3;  3GZR A;  4R9K A;  5AI1 A;  3CME 3;  1N5P A;  1LVN A;  2XFS A;  2GXF A;  2GU1 A;  3HZP A;  4N6M A;  1VQM 3;  1DVD A;  2WOH A;  2LYX A;  4EXR A;  2HMK B;  1AVK A;  1VQO 3;  3IMA B;  3MKI A;  1QAL A;  4FMB A;  4QWT A;  2P0M A;  4WWU C;  2CFW A;  2RFR A;  5D83 A;  3G4S 3;  5JPP A;  3IJE B;  1EKM A;  3SVA A;  3GRD A;  1ULI B;  2XEP A;  1AR0 A;  4KFD A;  1GD3 A;  4N6O B;  4MMZ B;  1N8Q A;  1W00 A;  1FGR A;  4AEQ A;  1LOX A;  5JPU A;  4OVM A;  5AYR B;  3GWR A;  5HGR A;  3MPH A;  4ORL A;  3FF2 A;  2FXT A;  2QA4 3;  3NQY A;  4STD A;  4L8O A;  4XBY A;  1WMP A;  1K9M 4;  3STD A;  1W01 A;  3S28 A;  5LC7 A;  3X3X A;  2FGT A;  1M90 4;  4WHA A;  1GY5 A;  1OHO A;  1OF5 B;  4PEJ A;  3ROB A;  5BXQ A;  2CK3 H;  2R4I A;  2B24 B;  4HYZ A;  5ELU A;  3ECF A;  3OW2 2;  1CQS A;  3F7S A;  3LML A;  2V1L A;  3LZA A;  4J8T A;  5I97 A;  1A2V A;  2CFK A;  2RGQ A;  3WDG B;  2INX A;  4AKY A;  3DUK A;  1JJ2 2;  1O7P B;  3VF1 A;  1VQ9 3;  2BMO B;  3JVC A;  4HJL B;  4GB5 A;  3FH1 A;  1OGX A;  1ZX2 A;  3MG3 A;  2M7O A;  4JRF A;  3WA2 X;  3KSE D;  3FLJ A;  1DYU A;  2KXG A;  4BTX A;  3CCR 3;  4RZM A;  5IER A;  1G96 A;  3X42 A;  1NU3 A;  3VSY A;  1KSI A;  2XR8 B;  3HII A;  3WOD G;  3MSO A;  3LXU X;  2D1W A;  1K41 A;  4OK0 A;  1Q81 4;  2HMO B;  2CW9 A;  4IIA A;  3X3Y A;  3PGB A;  1VQ4 3;  1YJN 3;  2C10 A;  2BHM A;  3D9R A;  3BB9 A;  3JUN A;  3G8Z A;  1STF I;  2YFI B;  2BMQ B;  3EF8 A;  1IQ8 A;  4HM2 B;  8CHO A;  4XBT A;  1US1 A;  3H3H A;  2HMN B;  1KD1 4;  4G1M B;  4N3V A;  3B8L A;  2SBL A;  2CG0 A;  3EJV A;  2XRX B;  1W2B 2;  3CPW 2;  1WQL B;  1QVG 2;  3FF0 A;  1FUW A;  2GEX A;  2Z6B A;  3J7Y d;  4MMY B;  3X41 A;  2ML6 A;  1TIJ A;  3DY5 A;  2OTL 3;  2W2C A;  3H51 A;  2GBW B;  1SQW A;  1ASK A;  4L8P A;  3U1W A;  1IU7 A;  1ROV A;  1UI8 A;  2XSH B;  3F14 A;  3LT9 A;  2XGN A;  2WO0 A;  3MYT A;  3CU3 A;  5EEO A;  1JB2 A;  1OHP A;  5KP1 A;  2KCD A;  4FCM A;  2IUK A;  3E99 A;  2XFT A;  3PYJ A;  1VQ8 3;  2OTJ 3;  3LH4 A;  5LC6 A;  3EHC A;  3FG4 A;  1LNH A;  1FGT A;  5FGO A;  2CC3 A;  1JN5 A;  1W6Y A;  1EG9 B;  3FCS B;  4MJD A;  4XM4 A;  1KWI A;  4LGQ A;  2W56 A;  3LYG A;  3N8B A;  4WFO A;  2F98 A;  3DGO A;  2O3O A;  2BO9 B;  1JV2 B;  4N6V 0;  3CCS 3;  1NJI 4;  1SPU A;  3AMO A;  1SII A;  3EN8 A;  2CKF B;  2W6J H;  2K54 A;  4WP5 A;  1JB5 A;  3NQZ A;  1O7H B;  2HMM B;  2Y74 A;  4ZM8 A;  4H61 A;  1A67 A;  1F8N A;  3ER7 A;  1W6C A;  3HX8 A;  1KC8 4;  1GY6 A;  1VQ6 3;  2CFL A;  1NDO B;  1WMN A;  3OWU A;  4K90 B;  2F86 B;  3SOY A;  3NUV A;  2CHC A;  5FW5 A;  5AIH A;  3Q90 A;  1GD4 A;  5DRE A;  5EQL A;  1DVC A;  6STD A;  2WOF A;  2CG1 A;  2L4V A;  2W04 A;  1E3R A;  4H3U A;  4HM5 B;  2UX0 A;  1CEW I;  4FMC A;  4J9A A;  1EQK A;  3BNB A;  1QAK A;  3U97 A;  1OCV A;  5AII A;  2RSX A;  3FZW A;  1FA3 A;  2D42 A;  2WGO A;  3RGA A;  1SJW A;  1TFO A;  5G2G A;  2MC8 A;  3S29 A;  1DMM A;  4OUQ A;  2XGL A;  4N6U A;  5CF2 A;  1GY7 A;  2A15 A;  4LZI A;  4HM7 B;  1VQ5 3;  1ROA A;  3NXJ A;  4RBN A;  3RDE A;  5JBS A;  3CCM 3;  3CNM A;  3DMC A;  3K63 A;  3LTD A;  5AIG A;  1EA2 A;  5KP3 A;  5AYS C;  3F8X A;  4JF8 A;  1ULJ B;  2Z77 A;  4K61 A;  3CC2 3;  4U13 A;  1T5Y A;  1W5Z A;  5STD A;  5IW9 A;  3LTA A;  2CIU A;  2ZL8 A;  1GS3 A;  1JKG B;  2XH9 A;  1IQX A;  4O02 B;  1BUQ A;  2OQE C;  4FMA A;  1M9G A;  3S67 A;  1FGO A;  2CWU A;  3CMA 3;  2WGQ A;  5IG3 A;  5CLK A;  2FNQ A;  3NX0 A;  2OCT A;  1Q82 4;  3EBT A;  3MWZ A;  3EN1 B;  2ZDJ A;  1RN7 A;  3KKG A;  1UUW B;  2B1X B;  3NBB A;  1K8A 4;  1QAF A;  3OX9 A;  2E2V A;  3I0Y A;  2K0M A;  3SOA A;  1QJG A;  2Z76 A;  1IVV A;  3QK9 A;  3KFQ C;  3BLZ A;  1RJO A;  1YHQ 3;  1Q7Y 4;  1HKX A;  1W6G A;  3MG1 A;  2JQ5 A;  1YGE A;  1WMO A;  3WA3 A;  3IPT A;  4HVN A;  4O2H A;  5D81 A;  1S5A A;  1N9E A;  1Q86 4;  2KRT A;  4BTW A;  1RKY A;  2P05 A;  3WOE B;  3EQQ B;  3V98 A;  3CPO A;  1W4N A;  1Y4K A;  2W56 B;  4EV2 A;  4KVH A;  3PCR A;  4EYC A;  2XF3 A;  3PCS A;  3GZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...