1ASNA

Crystal structures of escherichia coli aspartate aminotransferase in two conformations: comparison of an unliganded open and two liganded closed forms
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structures of Escherichia coli aspartate aminotransferase in two conformations. Comparison of an unliganded open and two liganded closed forms.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1asnA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1asnA01
2VMYA 1LC7A 3IHJA 1P3WA 3WLXA 2FN6A 1ASNA 1V2FA 2W7IA 2Z9WA 3PDBA 3JW9A 3A9XA 3QPGA 4NOGA 2W8UA 1V2EA 1EG5A 1SVVA 3EI8A 1ASEA 2VI9A 3ISLA 1AY5A 1WYUB 3A9YA 1EQBA 2HUFA 2R0TA 3FVUA 5F9SA 4PFFA 4M2KA 2AEVA 1GC4A 4WBTA 2BWPA 1CS1A 2VIAA 4J5UA 4ADEA 1V72A 5FT8A 1AIAA 1ASGA 2ZY3A 4ZSWA 9AATA 3DU4A 2YRRA 3A9ZA 2W7KA 1SZUA 1TASA 2G6WA 2Z1YA 3CAIA 3TQXA 4B9BA 4KXKA 1TPLA 1IX8A 4Q75A 1AMQA 2AY3A 1OHYA 3E6GA 2QB2A 3RI6A 1S09A 4QGRA 1M4NA 3AOVA 3CBFA 4AH3A 3KGWA 5K8BA 4XJMA 1AHGA 1U08A 3AEJA 3EIBA 2CTZA 2EZ2A 2HP1A 2QLRA 7AATA 3ACZA 1N2TA 3RBLA 3I16A 4JE5A 2CSTA 1YNUA 3LWSA 2VMOA 1CQ7A 3G7QA 3NUBA 4A6TA 2W7HA 4RJ0A 3TFUA 1SPAA 1MLYA 2PB0A 4E1OA 5JAYA 2FM1A 4KYOA 4MKKA 2CB1A 3WX9A 3B8XA 2D7YA 1PFFA 1OHWA 3ZRQA 4W5KA 1W3UA 4RKDA 2W8JA 1TOEA 1YJZA 2ZP7A 5LH9A 1WSTA 2HORA 3FCRA 2OATA 3FZ7A 4IY7A 4WYCA 1DFOA 2ZY5A 3BWNC 2EO5A 1UU1A 1LW5A 3KKIA 3RUYA 2VMZA 4RITA 3NDNA 2CJGA 1AAMA 4ADDA 4JE5D 4XJLA 2Z61A 1TOKA 4FL0A 3WY7A 1JG8A 4MQQA 1W7LA 2D65A 3P6KA 3EI6A 4W1VA 4ADBA 1AMAA 1J04A 1QIRA 1ASCA 2AY9A 2JJGA 5BJ3A 4WXBA 1UU0A 1I43A 1C7NA 1D7RA 4JF0A 4A6RA 3HLMA 4OMAA 4RLGA 3K40A 2AY1A 4BQ0A 3VAXA 2X5FA 4N0WA 2W7DA 1ARHA 3ELPA 2JISA 2OKJA 2W7GA 3JTXA 2CINA 1Y4IA 5D5SA 5M49A 1TOJA 1B9HA 1IAYA 1Z3ZA 2VIBA 2W8VA 3AATA 4U1TA 4XEWA 3EI9A 4ZM4A 3RBFA 4ZWVA 1YIYA 5M4DA 2BI5A 4XQ2A 1FC4A 1I48A 1XI9A 3FD0A 1BJOB 3MAFA 4OCAA 3W1IA 2OKKA 1GC3A 1AHXA 1QITA 2AY6A 2BKWA 5FT5A 3WCOA 4ZAHA 4LW4A 1JS6A 2BI2A 3IF2A 3WZFA 3NU8A 3ZRPA 1ASAA 2VGTA 4OC9A 4F4EA 1DJ9A 2DKJA 3PPLA 1TATA 1ASLA 1ORDA 3FTBA 1B5OA 1BW0A 3ASAA 3DRDA 3TCMA 2AY7A 3FFRA 2YKYA 3II0A 1VP4A 2C44A 4WYAA 1RVUA 1AJSA 4F5LA 3EI7A 2QA3A 1FG3A 3BWNA 1C7GA 4A00A 3AEJC 3ASBA 4N0BA 3LV2A 3ELEA 4WYGA 1RV4A 3NRAA 4F5KA 1MAQA 4JEWA 5EAAA 2ZJGA 3QM2A 1YIZA 2O1BA 2VMPA 2JJHA 4ITXA 1M0OA 3BWOA 4CXRA 2E7IA 4XAUA 1AX4A 2VGSA 2DOUA 2AY2A 4E3RA 1IAXA 1D7UA 1G7XA 1CZCA 3W1HA 4DGTA 4R2NA 1ELQA 2TPLA 3FZ6A 2BIEA 3MEBA 3QHXA 1VEFA 4OYTA 2AATA 2D5YA 3A2BA 4ATPA 4BMKA 2VMNA 4I8AA 1M0QA 3BCAA 3BS8A 4WXFA 3H14A 2EPJA 4UQVA 1BT4A 8AATA 1RVYA 4MY5A 4RM1A 3DXWA 2VGZA 3E77A 3D6KA 3MKJA 4ZDLA 3VK3A 2FNIA 3FQ7A 4GRXA 2W7LA 1WKHA 2AEUA 2C81A 2YKVA 3FFHA 3OKSA 4F5GA 3FRKA 3DZZA 4R5ZA 3JU7A 1E5EA 1ECXA 1CZEA 4RJYA 2GMSA 5HHYA 3VK2A 4W8IA 1GEWA 3B1DA 1ARSA 1MGVA 3L44A 1C9CA 4ZLVA 5DX5A 1UKJA 2CH2A 3BCBA 3WCNA 1B5PA 4TN4A 3JWAA 1MDXA 2BWOA 4TV7A 3WKSA 2R5CA 2ZSLA 4PIWA 5E5IA 2HOXA 4M2JA 5E4ZA 1M0NA 4JEYA 1AKCA 1IX7A 1FG7A 3PDBB 1KL2A 3FQ8A 4PVFA 4CVQA 5EIGA 3WGBA 3E2ZA 1SF2A 4IX8A 3BC8A 2VMRA 2BIAA 1GC0A 3NYTA 4JEXA 3UE8A 1AMSA 1AKAA 4JF1A 4MKJA 2X3LA 5DJ9A 3FSLA 4H51A 4F5MA 4A6UA 5G0AA 1ZODA 2C0RA 5J8QA 1BQAA 1S08A 2W8TA 3CQ5A 3E9KA 2JJEA 5DB5A 3LVJA 4F5FA 2DKBA 5EQCA 1TOGA 1LKCA 1TOIA 2YCPA 1B4XA 4KAMA 1M0PA 1OATA 3GZDC 3HVYA 3NYUA 1KKJA 4PFNA 1LK9A 4AO4A 3I4JA 3AOWA 3MC6C 3ZZJA 1AKBA 2CJHA 3QN6A 1ZC9A 3DXVA 1MDZA 1QJ5A 1S07A 3B1CA 2CY8A 3BV0A 4UOYA 3AV7A 3PA9A 3RQ1A 1KMKA 2BWNA 2ZYJA 3FDDA 2E7JA 4LNLA 1J32A 3W1JA 2GQNA 1MAPA 2C7TA 4WYFA 4A0GA 2PB2A 3WKRA 2Z9VA 4LW2A 3TFTA 3QBOA 3NU7A 4OT8A 3K28A 1BKGA 4MQPA 3KE3A 4ZM3A 2HUIA 4O6ZA 3PAAA 1KL1A 5AX8A 4IW7A 4TMRA 3HBXA 1EJIA 2O7CA 2VMQA 4L0OA 1SFFA 4E3QA 4IYOA 2HP2A 2R5EA 4JEZA 4MSOA 3HL2A 3DR7A 1RV3A 2W8WA 3F9TA 5FT4A 3T32A 3JWBA 1YAAA 4Q76A 4RKCA 2AY8A 1O62A 2ZUKA 2ZY2A 3BB8A 2BI3A 1AMRA 3FKDA 4HF8A 2YHKA 3PIUA 2YKXA 2YCNA 1LW4A 3I5TA 2VI8A 4CBRA 2YRIA 3EI5A 2X8UA 1SZSA 2ZC0A 5TF5A 3LG0A 5EAVA 2PO3A 2WK7A 3FQAA 1ARTA 3AELA 4MGRA 4W91A 4OBUA 2D66A 4LNMA 3WGCA 1BJNA 1BJWA 2CH1A 4WB0A 4R5FA 4XJPA 4DQ6A 3GZDA 5G2QA 1ARIA 1AHFA 1YJSA 2GSAA 2CANA 3MAFB 5FT6A 5EFSA 1AAWA 1MDOA 3MC6A 3N75A 4IXOA 3L8AA 2VMTA 5EUNA 4DBCA 2WK8A 5M46A 1ARGA 1IJIA 5C6UA 4A0HA 3AENA 5G4JA 3NYSA 2F8JA 3FDBA 1AY4A 1QJ3A 2WK9A 1X28A 2VLFA 3FVSA 4EU1A 3B1EA 1AJSB 1TARA 1BQDA 1BS0A 1OXPA 2DGKA 3COGA 4ZDOA 3HMUA 2V0YA 4JEVA 2JGTA 3K7YA 4EFFA 1X2AA 4U2HA 1M32A 1IBJA 3UAKA 4Y0IA 1PMMA 1D2FA 2VLHA 4OBVA 1PG8A 4ITGA 3GBXA 3EIAA 5LHAA 1DJEA 3E2FA 2QBTA 3PDXA 4F5IA 2XBNA 3BCXA 1C7OA 1AICA 2HOZA 4F5HA 1VJOA 1DGEA 1D7VA 2Q7WA 4ZDPA 2EGYA 2W7EA 1D7SA 1O61A 4CXQA 1C4KA 3PD6A 4WXGA 4M2MA 1AHYA 1SZKA 1WYUA 3EZSA 3LVMA 3MADA 2OGEA 4EB7A 2GB3A 1H0CA 2ORDA 4UHNA 3LY1A 1C0NA 3QGUA 2ZY4A 1BJ4A 4UHMA 1AHEA 3GETA 4CBSA 1WYVA 3NUIA 3TATA 1OXOA 1I29A 2BI9A 4BHDA 4J8LA 3CQ4A 1CQ8A 3USFA 2BYLA 2VMSA 3KGXA 1X29A 4ZWMA 3NNKA 2JJFA 5EUEA 1GC2A 3PD6B 2R2NA 2Z20A 3M5UA 1E5FA 1ELUA 4BA5A 1W7NA 2R5CB 3PJ0A 2W7FA 1M7YA 2BI1A 2JG2A 1ASMA 1LC8A 3B46A 1WYVB 1KKPA 4MQRA 4GSAA 4W1WA 1S0AA 2FYFA 5EIGB 3E2ZB 1DTYA 3EZ1A 4E77A 1GEYA 4LNJA 2Z67A 2D7ZA 4GE9A 3DODA 4P3MA 1KMJA 4ADCA 1WKGA 1IUGA 2Z9XA 4LC3A 3Q8NA 4K2BA 4WLJA 2AY4A 2W7MA 1S06A 1DGDA 3JZLA 2FNUA 3P1TA 3GJUA 1N31A 3N0LA 4WD2A 4A0FA 2E54A 1QZ9A 4WLHA 2BIGA 5BJ4A 4EB5A 1UU2A 3AEPA 1GDEA 3MAUA 1T3IA 3H7FA 1B9IA 2VGWA 4P7YA 4ATQA 2XH1A 4WYEA 1ASFA 1O69A 1B8GA 1GBNA 1IVRA 2O0RA 2VGUA 1CL1A 2VMXA 3VOMA 1G7WA 3HT4A 4IXZA 1PMOA 3DR4A 2HOYA 1WYTA 3R9AA 1YJYA 4A0RA 3E2YA 3ECDA 1I41A 1JS3A 1CQ6A 5EUDA 3AEMC 1ASDA 3EUCA 2YCTA 1G4XA 4IXSA 4A72A 4F5JA 3HQTA 2VMUA 5G2PA 5HXXA 4AO9A 4GE7A 1XEYA 3DC1A 4EMYA 3PGYA 4ISYA 2CJDA 3FZ8A 1WYTB 3BN1A 1GEXA 3MBBA 2OGAA 2FQ6A 5D95A 3GR9A 4Q6RA 1LS3A 1W7MA 4AOAA 1BJOA 3LVLB 4IYOB 2CFBA 1H1CA 4FFCA 4AZJA 4BA4A 5G4IA 2AY5A 3ZRRA 3R4TA 2RFVA 1LC5A 5M4BA 1ZOBA 2ZSMA 1QISA 3A8UX 3G8MA 2YOBA 4UHOA 4ZASA 3UWCA 2DGLA 3GWPA 4OTLA 4B98A 2VGVA 5HDMA 3AEOA 4K2IA 5DJ1A 3G0TA 4K2MA 1CJ0A 5F8VA 3ZZKA 2D64A 1G4VA 2HUUA 3LVKA 3F6TA 3GSBA 3GZCA 4R8DA 2VMWA 3VK4A 1IX6A 4Q31A 1OHVA 2BYJA 2X5DA 1O4SA 2WKAA 2YKUA 4RAEA 4WB0B 2Z9UA 3RCHA 5IWQA 3DYDA 4AZKA 2E7UA 2NMPA 4HVKA 2V1PA 1DKAA 2GMUA 4RIZA 3VP6A 3OP7A 3NTJA 2DR1A 2VYCA 4XK1A 5I92A 3CQ6A 2D63A 4Y0DA 1AJRA 1YOOA 2DGMA 3AENB 1QGNA 4Y0HA 3AEMA 1JF9A 1GCKA 2W7JA 2D61A 1GD9A 1W23A 1AIBA 3RCHB 3NX3A 1MLZA 1Z7DA 2BHXA 2Z1ZA 2EH6A 2QB3A 3FVXA 3HDOA 5E3KA 4GDYA 4W1XA 1DJUA 4XJOA 1N8PA 1V2DA 3QI6A 3F0HA 1AY8A 2QMAA 2OQXA 2HZPA 4GE4A 5G09A 1CL2A 2VMVA 3ATHA 4WYDA 4WP0A 3N5MA 4ZSYA 4GEBA 1M6SA 1X0MA 1ASBA 2EZ1A
chains in the Genus database with same CATH superfamily
2VMYA 1LC7A 3IHJA 1P3WA 3WLXA 2FN6A 1ASNA 1V2FA 2W7IA 2Z9WA 3PDBA 3JW9A 3A9XA 3QPGA 4NOGA 2W8UA 1V2EA 1EG5A 1SVVA 3EI8A 1ASEA 2VI9A 3ISLA 1AY5A 1WYUB 3A9YA 1EQBA 2HUFA 2R0TA 3FVUA 5F9SA 4PFFA 4M2KA 2AEVA 1GC4A 4WBTA 2BWPA 1CS1A 2VIAA 4J5UA 4ADEA 1V72A 5FT8A 1AIAA 1ASGA 2ZY3A 4ZSWA 9AATA 3DU4A 2YRRA 3A9ZA 2W7KA 1SZUA 1TASA 2G6WA 2Z1YA 3CAIA 3TQXA 4B9BA 4KXKA 1TPLA 1IX8A 4Q75A 1AMQA 2AY3A 1OHYA 3E6GA 2QB2A 3RI6A 1S09A 4QGRA 1M4NA 3AOVA 3CBFA 4AH3A 3KGWA 5K8BA 4XJMA 1AHGA 1U08A 3AEJA 3EIBA 2CTZA 2EZ2A 2HP1A 2QLRA 7AATA 3ACZA 1N2TA 3RBLA 3I16A 4JE5A 2CSTA 1YNUA 3LWSA 2VMOA 1CQ7A 3G7QA 3NUBA 4A6TA 2W7HA 4RJ0A 3TFUA 1SPAA 1MLYA 2PB0A 4E1OA 5JAYA 2FM1A 4KYOA 4MKKA 2CB1A 3WX9A 3B8XA 2D7YA 1PFFA 1OHWA 3ZRQA 4W5KA 1W3UA 4RKDA 2W8JA 1TOEA 1YJZA 2ZP7A 5LH9A 1WSTA 2HORA 3FCRA 2OATA 3FZ7A 4IY7A 4WYCA 1DFOA 2ZY5A 3BWNC 2EO5A 1UU1A 1LW5A 3KKIA 3RUYA 2VMZA 4RITA 3NDNA 2CJGA 1AAMA 4ADDA 4JE5D 4XJLA 2EYQA 2Z61A 1TOKA 4FL0A 3WY7A 1JG8A 4MQQA 3N4RA 1W7LA 2D65A 3P6KA 3EI6A 4W1VA 4ADBA 1AMAA 1J04A 1QIRA 1ASCA 2AY9A 2JJGA 5BJ3A 4WXBA 1UU0A 1I43A 1C7NA 1D7RA 4JF0A 4A6RA 3HLMA 4OMAA 5KTBA 4RLGA 3K40A 2AY1A 4BQ0A 3VAXA 2X5FA 4N0WA 2W7DA 1ARHA 3ELPA 2JISA 2OKJA 2W7GA 3JTXA 2CINA 1Y4IA 5D5SA 5M49A 1TOJA 1B9HA 1IAYA 1Z3ZA 2VIBA 2W8VA 3AATA 4U1TA 4XEWA 3EI9A 4ZM4A 3RBFA 4ZWVA 1YIYA 5M4DA 2BI5A 4XQ2A 1FC4A 1I48A 1XI9A 3FD0A 1BJOB 3MAFA 4OCAA 3W1IA 2OKKA 1GC3A 1AHXA 1QITA 2AY6A 2BKWA 5FT5A 3WCOA 4ZAHA 4LW4A 1JS6A 2BI2A 3IF2A 3WZFA 3NU8A 3ZRPA 1ASAA 2VGTA 4OC9A 4F4EA 1DJ9A 2DKJA 3PPLA 1TATA 1ASLA 1ORDA 3FTBA 1B5OA 1BW0A 3ASAA 3DRDA 3TCMA 2AY7A 3FFRA 2YKYA 3II0A 1VP4A 2C44A 4WYAA 1RVUA 1AJSA 4F5LA 3EI7A 2QA3A 1FG3A 3BWNA 1C7GA 4A00A 3AEJC 3ASBA 4N0BA 3LV2A 3ELEA 4WYGA 1RV4A 3NRAA 4F5KA 1MAQA 4JEWA 5EAAA 2ZJGA 3QM2A 1YIZA 2O1BA 2VMPA 2JJHA 4ITXA 1M0OA 3BWOA 4CXRA 2E7IA 4XAUA 1AX4A 2VGSA 2DOUA 2AY2A 4E3RA 1IAXA 1D7UA 1G7XA 1CZCA 3W1HA 4DGTA 4R2NA 1ELQA 2TPLA 3FZ6A 2BIEA 3MEBA 3QHXA 1VEFA 4OYTA 2AATA 2D5YA 3A2BA 4ATPA 4BMKA 2VMNA 4I8AA 1M0QA 3BCAA 3BS8A 4WXFA 3H14A 2EPJA 4UQVA 1BT4A 8AATA 1RVYA 4MY5A 4RM1A 3DXWA 2VGZA 3E77A 3D6KA 3MKJA 4ZDLA 3VK3A 2FNIA 3FQ7A 4GRXA 2W7LA 1WKHA 2AEUA 2C81A 2YKVA 3FFHA 3OKSA 4F5GA 3FRKA 3DZZA 4R5ZA 3JU7A 1E5EA 1ECXA 1CZEA 4RJYA 2G7JA 2GMSA 5HHYA 3VK2A 4W8IA 1GEWA 3B1DA 1ARSA 1MGVA 3L44A 1C9CA 4ZLVA 5DX5A 1UKJA 2CH2A 3BCBA 3WCNA 1B5PA 4TN4A 3JWAA 1MDXA 2BWOA 4TV7A 3WKSA 2R5CA 2ZSLA 4PIWA 5E5IA 2HOXA 4M2JA 5E4ZA 1M0NA 4JEYA 1AKCA 1IX7A 1FG7A 3PDBB 1KL2A 3FQ8A 2A1VA 4PVFA 4CVQA 5EIGA 3WGBA 3E2ZA 1SF2A 4IX8A 3BC8A 2VMRA 2BIAA 1GC0A 3NYTA 4JEXA 3UE8A 1AMSA 1AKAA 4JF1A 4MKJA 2X3LA 5DJ9A 3FSLA 4H51A 4F5MA 4A6UA 5G0AA 1ZODA 2C0RA 5J8QA 1BQAA 1S08A 2W8TA 3CQ5A 3E9KA 3N7NA 2JJEA 5DB5A 3LVJA 4F5FA 2DKBA 5EQCA 1TOGA 1LKCA 1TOIA 2YCPA 1B4XA 4KAMA 1M0PA 1OATA 3GZDC 3HVYA 3NYUA 1KKJA 4PFNA 1LK9A 4AO4A 3I4JA 3AOWA 3MC6C 3ZZJA 1AKBA 2CJHA 3N4XA 3QN6A 1ZC9A 3DXVA 1MDZA 1QJ5A 1S07A 3B1CA 2CY8A 3BV0A 4UOYA 3AV7A 3PA9A 3RQ1A 1KMKA 2BWNA 2ZYJA 3FDDA 2E7JA 4LNLA 1J32A 3W1JA 2GQNA 1MAPA 2C7TA 4WYFA 4A0GA 2PB2A 3WKRA 2Z9VA 4LW2A 3TFTA 3QBOA 3NU7A 4OT8A 3K28A 2KFPA 1BKGA 4MQPA 3KE3A 4ZM3A 2HUIA 4O6ZA 3PAAA 1KL1A 5AX8A 4IW7A 4TMRA 3HBXA 1EJIA 2O7CA 2VMQA 4L0OA 1SFFA 4E3QA 4IYOA 2HP2A 2R5EA 4JEZA 4MSOA 3HL2A 3DR7A 1RV3A 2W8WA 3F9TA 5FT4A 3T32A 3JWBA 1YAAA 4Q76A 4RKCA 2AY8A 1O62A 2ZUKA 2ZY2A 3BB8A 2BI3A 1AMRA 3FKDA 4HF8A 2YHKA 3PIUA 2YKXA 2YCNA 1LW4A 3I5TA 2WB6A 2VI8A 4CBRA 2YRIA 3EI5A 2X8UA 1SZSA 2ZC0A 5TF5A 3LG0A 5EAVA 2PO3A 2WK7A 3FQAA 1ARTA 3AELA 4MGRA 4W91A 4OBUA 2D66A 4LNMA 3WGCA 1BJNA 1BJWA 2CH1A 4WB0A 4R5FA 4XJPA 4DQ6A 3GZDA 5G2QA 1ARIA 1AHFA 1YJSA 2GSAA 2CANA 3MAFB 5FT6A 5EFSA 4K05A 1AAWA 1MDOA 3MC6A 3N75A 4IXOA 3L8AA 2VMTA 5EUNA 4DBCA 2WK8A 5M46A 1ARGA 1IJIA 5C6UA 4A0HA 3AENA 5G4JA 3NYSA 2F8JA 3FDBA 1AY4A 1QJ3A 2WK9A 1X28A 2VLFA 3FVSA 4EU1A 3B1EA 1AJSB 1TARA 1BQDA 1BS0A 1OXPA 2DGKA 3COGA 4ZDOA 3HMUA 2V0YA 4JEVA 2JGTA 3K7YA 4EFFA 1X2AA 4U2HA 1M32A 1IBJA 3UAKA 4Y0IA 1PMMA 1D2FA 2VLHA 4OBVA 1PG8A 4ITGA 3GBXA 3EIAA 5LHAA 1DJEA 3E2FA 2QBTA 3PDXA 4F5IA 2XBNA 3BCXA 1C7OA 1AICA 2HOZA 4F5HA 1VJOA 1DGEA 1D7VA 2Q7WA 4ZDPA 2EGYA 2W7EA 1D7SA 1O61A 4CXQA 1C4KA 3PD6A 4WXGA 4M2MA 1AHYA 1SZKA 1WYUA 3EZSA 3LVMA 3MADA 2OGEA 4EB7A 2GB3A 3H9XA 1H0CA 2ORDA 4UHNA 3LY1A 1C0NA 3QGUA 2ZY4A 1BJ4A 4UHMA 1AHEA 3GETA 4CBSA 1WYVA 3NUIA 3TATA 1OXOA 1I29A 2BI9A 4BHDA 4J8LA 3CQ4A 1CQ8A 3USFA 2BYLA 2VMSA 3KGXA 1X29A 4ZWMA 3NNKA 2JJFA 5EUEA 1GC2A 3PD6B 2R2NA 2Z20A 3M5UA 1E5FA 1ELUA 4BA5A 1W7NA 2R5CB 3PJ0A 2W7FA 1M7YA 2BI1A 2JG2A 1ASMA 1LC8A 3B46A 1WYVB 1KKPA 4MQRA 4GSAA 4W1WA 1S0AA 2FYFA 5EIGB 3E2ZB 1DTYA 3EZ1A 4E77A 1GEYA 4LNJA 2Z67A 2D7ZA 4GE9A 3DODA 4P3MA 1KMJA 4ADCA 1WKGA 1IUGA 2Z9XA 4LC3A 3Q8NA 4K2BA 4WLJA 2AY4A 2W7MA 1S06A 1DGDA 3JZLA 2FNUA 3P1TA 3GJUA 1N31A 3N0LA 4WD2A 4A0FA 2E54A 1QZ9A 4WLHA 1KAFA 2BIGA 5BJ4A 4EB5A 1UU2A 3AEPA 2FKIA 1GDEA 3MAUA 1T3IA 3H7FA 1B9IA 2VGWA 4P7YA 4ATQA 2XH1A 4WYEA 1ASFA 1O69A 1B8GA 1GBNA 1IVRA 2O0RA 2VGUA 1CL1A 2VMXA 3VOMA 1G7WA 3HT4A 4IXZA 1PMOA 3DR4A 2HOYA 1WYTA 3R9AA 1YJYA 4A0RA 3E2YA 3ECDA 1I41A 1JS3A 1CQ6A 5EUDA 3AEMC 1ASDA 3EUCA 2YCTA 1G4XA 4IXSA 4A72A 4F5JA 3HQTA 2VMUA 5G2PA 5HXXA 4AO9A 4GE7A 1XEYA 3DC1A 4EMYA 4H63Q 3PGYA 4ISYA 2CJDA 3FZ8A 1WYTB 3BN1A 1GEXA 3MBBA 2OGAA 2FQ6A 5D95A 3GR9A 4Q6RA 1LS3A 1W7MA 4AOAA 1BJOA 3LVLB 4IYOB 2CFBA 1H1CA 4FFCA 4AZJA 4BA4A 5G4IA 2AY5A 3ZRRA 3R4TA 2RFVA 1LC5A 5M4BA 1ZOBA 2ZSMA 1QISA 3A8UX 3G8MA 2YOBA 4UHOA 4ZASA 3UWCA 2DGLA 3GWPA 4OTLA 4B98A 2VGVA 5HDMA 3AEOA 4K2IA 5DJ1A 3G0TA 4K2MA 1CJ0A 5F8VA 3ZZKA 2D64A 1G4VA 2HUUA 3LVKA 3F6TA 3GSBA 3GZCA 4R8DA 2VMWA 3VK4A 1IX6A 4Q31A 1OHVA 2BYJA 2X5DA 1O4SA 2WKAA 2YKUA 4RAEA 4WB0B 2Z9UA 3RCHA 5IWQA 3DYDA 4AZKA 2E7UA 2NMPA 4HVKA 2V1PA 1DKAA 2GMUA 4RIZA 3VP6A 3OP7A 3NTJA 2DR1A 2VYCA 4XK1A 5I92A 3CQ6A 2D63A 4Y0DA 1AJRA 1YOOA 2DGMA 3AENB 1QGNA 4Y0HA 3AEMA 1JF9A 1GCKA 2W7JA 2D61A 1GD9A 1W23A 1AIBA 3RCHB 3NX3A 1MLZA 1Z7DA 2BHXA 2Z1ZA 2EH6A 2QB3A 3FVXA 3HDOA 5E3KA 4GDYA 4W1XA 1DJUA 4XJOA 1N8PA 1V2DA 3QI6A 3F0HA 1AY8A 2QMAA 2QSRA 2OQXA 2HZPA 4GE4A 5G09A 1CL2A 2VMVA 3ATHA 4WYDA 4WP0A 3N5MA 4ZSYA 3N4SA 4GEBA 1M6SA 1X0MA 1ASBA 2EZ1A
chains in the Genus database with same CATH topology
2VMYA 1LC7A 3IHJA 1P3WA 3WLXA 2FN6A 1ASNA 1V2FA 2W7IA 2Z9WA 3PDBA 3JW9A 3A9XA 3QPGA 4NOGA 2W8UA 1V2EA 1EG5A 1SVVA 3EI8A 1ASEA 2VI9A 3ISLA 1AY5A 1WYUB 3A9YA 1EQBA 2HUFA 2R0TA 3FVUA 5F9SA 4PFFA 4M2KA 2AEVA 1GC4A 4WBTA 2BWPA 1CS1A 2VIAA 4J5UA 4ADEA 1V72A 5FT8A 1AIAA 1ASGA 2ZY3A 4ZSWA 9AATA 3DU4A 2YRRA 3A9ZA 2W7KA 1SZUA 1TASA 2G6WA 2Z1YA 3CAIA 3TQXA 4B9BA 4KXKA 1TPLA 1IX8A 4Q75A 1AMQA 2AY3A 1OHYA 3E6GA 2QB2A 3RI6A 1S09A 4QGRA 1M4NA 3AOVA 3CBFA 4AH3A 3KGWA 5K8BA 4XJMA 1AHGA 1U08A 3AEJA 3EIBA 2CTZA 2EZ2A 2HP1A 2QLRA 7AATA 3ACZA 1N2TA 3RBLA 3I16A 4JE5A 2CSTA 1YNUA 3LWSA 2VMOA 1CQ7A 3G7QA 3NUBA 4A6TA 2W7HA 4RJ0A 3TFUA 1SPAA 1MLYA 2PB0A 4E1OA 5JAYA 2FM1A 4KYOA 4MKKA 2CB1A 3WX9A 3B8XA 2D7YA 1PFFA 1OHWA 3ZRQA 4W5KA 1W3UA 4RKDA 2W8JA 1TOEA 1YJZA 2ZP7A 5LH9A 1WSTA 2HORA 3FCRA 2OATA 3FZ7A 4IY7A 4WYCA 1DFOA 2ZY5A 3BWNC 2EO5A 1UU1A 1LW5A 3KKIA 3RUYA 2VMZA 4RITA 3NDNA 2CJGA 1AAMA 4ADDA 4JE5D 4XJLA 2EYQA 2Z61A 1TOKA 4FL0A 3WY7A 1JG8A 4MQQA 3N4RA 1W7LA 2D65A 3P6KA 3EI6A 4W1VA 4ADBA 1AMAA 1J04A 1QIRA 1ASCA 2AY9A 2JJGA 5BJ3A 4WXBA 1UU0A 1I43A 1C7NA 1D7RA 4JF0A 4A6RA 3HLMA 4OMAA 5KTBA 4RLGA 3K40A 2AY1A 4BQ0A 3VAXA 2X5FA 4N0WA 2W7DA 1ARHA 3ELPA 2JISA 2OKJA 2W7GA 3JTXA 2CINA 1Y4IA 5D5SA 5M49A 1TOJA 1B9HA 1IAYA 1Z3ZA 2VIBA 2W8VA 3AATA 4U1TA 4XEWA 3EI9A 4ZM4A 3RBFA 4ZWVA 1YIYA 5M4DA 2BI5A 4XQ2A 1FC4A 1I48A 1XI9A 3FD0A 1BJOB 3MAFA 4OCAA 3W1IA 2OKKA 1GC3A 1AHXA 1QITA 2AY6A 2BKWA 5FT5A 3WCOA 4ZAHA 4LW4A 1JS6A 2BI2A 3IF2A 3WZFA 3NU8A 3ZRPA 1ASAA 2VGTA 4OC9A 4F4EA 1DJ9A 2DKJA 3PPLA 1TATA 1ASLA 1ORDA 3FTBA 1B5OA 1BW0A 3ASAA 3DRDA 3TCMA 2AY7A 3FFRA 2YKYA 3II0A 1VP4A 2C44A 4WYAA 1RVUA 1AJSA 4F5LA 3EI7A 2QA3A 1FG3A 3BWNA 1C7GA 4A00A 3AEJC 3ASBA 4N0BA 3LV2A 3ELEA 4WYGA 1RV4A 3NRAA 4F5KA 1MAQA 4JEWA 5EAAA 2ZJGA 3QM2A 1YIZA 2O1BA 2VMPA 2JJHA 4ITXA 1M0OA 3BWOA 4CXRA 2E7IA 4XAUA 1AX4A 2VGSA 2DOUA 2AY2A 4E3RA 1IAXA 1D7UA 1G7XA 1CZCA 3W1HA 4DGTA 4R2NA 1ELQA 2TPLA 3FZ6A 2BIEA 3MEBA 3QHXA 1VEFA 4OYTA 2AATA 2D5YA 3A2BA 4ATPA 4BMKA 2VMNA 4I8AA 1M0QA 3BCAA 3BS8A 4WXFA 3H14A 2EPJA 4UQVA 1BT4A 8AATA 1RVYA 4MY5A 4RM1A 3DXWA 2VGZA 3E77A 3D6KA 3MKJA 4ZDLA 3VK3A 2FNIA 3FQ7A 4GRXA 2W7LA 1WKHA 2AEUA 2C81A 2YKVA 3FFHA 3OKSA 4F5GA 3FRKA 3DZZA 4R5ZA 3JU7A 1E5EA 1ECXA 1CZEA 4RJYA 2G7JA 2GMSA 5HHYA 3VK2A 4W8IA 1GEWA 3B1DA 1ARSA 1MGVA 3L44A 1C9CA 4ZLVA 5DX5A 1UKJA 2CH2A 3BCBA 3WCNA 1B5PA 4TN4A 3JWAA 1MDXA 2BWOA 4TV7A 3WKSA 2R5CA 2ZSLA 4PIWA 5E5IA 2HOXA 4M2JA 5E4ZA 1M0NA 4JEYA 1AKCA 1IX7A 1FG7A 3PDBB 1KL2A 3FQ8A 2A1VA 4PVFA 4CVQA 5EIGA 3WGBA 3E2ZA 1SF2A 4IX8A 3BC8A 2VMRA 2BIAA 1GC0A 3NYTA 4JEXA 3UE8A 1AMSA 1AKAA 4JF1A 4MKJA 2X3LA 5DJ9A 3FSLA 4H51A 4F5MA 4A6UA 5G0AA 1ZODA 2C0RA 5J8QA 1BQAA 1S08A 2W8TA 3CQ5A 3E9KA 3N7NA 2JJEA 5DB5A 3LVJA 4F5FA 2DKBA 5EQCA 1TOGA 1LKCA 1TOIA 2YCPA 1B4XA 4KAMA 1M0PA 1OATA 3GZDC 3HVYA 3NYUA 1KKJA 4PFNA 1LK9A 4AO4A 3I4JA 3AOWA 3MC6C 3ZZJA 1AKBA 2CJHA 3N4XA 3QN6A 1ZC9A 3DXVA 1MDZA 1QJ5A 1S07A 3B1CA 2CY8A 3BV0A 4UOYA 3AV7A 3PA9A 3RQ1A 1KMKA 2BWNA 2ZYJA 3FDDA 2E7JA 4LNLA 1J32A 3W1JA 2GQNA 1MAPA 2C7TA 4WYFA 4A0GA 2PB2A 3WKRA 2Z9VA 4LW2A 3TFTA 3QBOA 3NU7A 4OT8A 3K28A 2KFPA 1BKGA 4MQPA 3KE3A 4ZM3A 2HUIA 4O6ZA 3PAAA 1KL1A 5AX8A 4IW7A 4TMRA 3HBXA 1EJIA 2O7CA 2VMQA 4L0OA 1SFFA 4E3QA 4IYOA 2HP2A 2R5EA 4JEZA 4MSOA 3HL2A 3DR7A 1RV3A 2W8WA 3F9TA 5FT4A 3T32A 3JWBA 1YAAA 4Q76A 4RKCA 2AY8A 1O62A 2ZUKA 2ZY2A 3BB8A 2BI3A 1AMRA 3FKDA 4HF8A 2YHKA 3PIUA 2YKXA 2YCNA 1LW4A 3I5TA 2WB6A 2VI8A 4CBRA 2YRIA 3EI5A 2X8UA 1SZSA 2ZC0A 5TF5A 3LG0A 5EAVA 2PO3A 2WK7A 3FQAA 1ARTA 3AELA 4MGRA 4W91A 4OBUA 2D66A 4LNMA 3WGCA 1BJNA 1BJWA 2CH1A 4WB0A 4R5FA 4XJPA 4DQ6A 3GZDA 5G2QA 1ARIA 1AHFA 1YJSA 2GSAA 2CANA 3MAFB 5FT6A 5EFSA 4K05A 1AAWA 1MDOA 3MC6A 3N75A 4IXOA 3L8AA 2VMTA 5EUNA 4DBCA 2WK8A 5M46A 1ARGA 1IJIA 5C6UA 4A0HA 3AENA 5G4JA 3NYSA 2F8JA 3FDBA 1AY4A 1QJ3A 2WK9A 1X28A 2VLFA 3FVSA 4EU1A 3B1EA 1AJSB 1TARA 1BQDA 1BS0A 1OXPA 2DGKA 3COGA 4ZDOA 3HMUA 2V0YA 4JEVA 2JGTA 3K7YA 4EFFA 1X2AA 4U2HA 1M32A 1IBJA 3UAKA 4Y0IA 1PMMA 1D2FA 2VLHA 4OBVA 1PG8A 4ITGA 3GBXA 3EIAA 5LHAA 1DJEA 3E2FA 2QBTA 3PDXA 4F5IA 2XBNA 3BCXA 1C7OA 1AICA 2HOZA 4F5HA 1VJOA 1DGEA 1D7VA 2Q7WA 4ZDPA 2EGYA 2W7EA 1D7SA 1O61A 4CXQA 1C4KA 3PD6A 4WXGA 4M2MA 1AHYA 1SZKA 1WYUA 3EZSA 3LVMA 3MADA 2OGEA 4EB7A 2GB3A 3H9XA 1H0CA 2ORDA 4UHNA 3LY1A 1C0NA 3QGUA 2ZY4A 1BJ4A 4UHMA 1AHEA 3GETA 4CBSA 1WYVA 3NUIA 3TATA 1OXOA 1I29A 2BI9A 4BHDA 4J8LA 3CQ4A 1CQ8A 3USFA 2BYLA 2VMSA 3KGXA 1X29A 4ZWMA 3NNKA 2JJFA 5EUEA 1GC2A 3PD6B 2R2NA 2Z20A 3M5UA 1E5FA 1ELUA 4BA5A 1W7NA 2R5CB 3PJ0A 2W7FA 1M7YA 2BI1A 2JG2A 1ASMA 1LC8A 3B46A 1WYVB 1KKPA 4MQRA 4GSAA 4W1WA 1S0AA 2FYFA 5EIGB 3E2ZB 1DTYA 3EZ1A 4E77A 1GEYA 4LNJA 2Z67A 2D7ZA 4GE9A 3DODA 4P3MA 1KMJA 4ADCA 1WKGA 1IUGA 2Z9XA 4LC3A 3Q8NA 4K2BA 4WLJA 2AY4A 2W7MA 1S06A 1DGDA 3JZLA 2FNUA 3P1TA 3GJUA 1N31A 3N0LA 4WD2A 4A0FA 2E54A 1QZ9A 4WLHA 2BIGA 5BJ4A 4EB5A 1UU2A 3AEPA 2FKIA 1GDEA 3MAUA 1T3IA 3H7FA 1B9IA 2VGWA 4P7YA 4ATQA 2XH1A 4WYEA 1ASFA 1O69A 1B8GA 1GBNA 1IVRA 2O0RA 2VGUA 1CL1A 2VMXA 3VOMA 1G7WA 3HT4A 4IXZA 1PMOA 3DR4A 2HOYA 1WYTA 3R9AA 1YJYA 4A0RA 3E2YA 3ECDA 1I41A 1JS3A 1CQ6A 5EUDA 3AEMC 1ASDA 3EUCA 2YCTA 1G4XA 4IXSA 4A72A 4F5JA 3HQTA 2VMUA 5G2PA 5HXXA 4AO9A 4GE7A 1XEYA 3DC1A 4EMYA 4H63Q 3PGYA 4ISYA 2CJDA 3FZ8A 1WYTB 3BN1A 1GEXA 3MBBA 2OGAA 2FQ6A 5D95A 3GR9A 4Q6RA 1LS3A 1W7MA 4AOAA 1BJOA 3LVLB 4IYOB 2CFBA 1H1CA 4FFCA 4AZJA 4BA4A 5G4IA 2AY5A 3ZRRA 3R4TA 2RFVA 1LC5A 5M4BA 1ZOBA 2ZSMA 1QISA 3A8UX 3G8MA 2YOBA 4UHOA 4ZASA 3UWCA 2DGLA 3GWPA 4OTLA 4B98A 2VGVA 5HDMA 3AEOA 4K2IA 5DJ1A 3G0TA 4K2MA 1CJ0A 5F8VA 3ZZKA 2D64A 1G4VA 2HUUA 3LVKA 3F6TA 3GSBA 3GZCA 4R8DA 2VMWA 3VK4A 1IX6A 4Q31A 1OHVA 2BYJA 2X5DA 1O4SA 2WKAA 2YKUA 4RAEA 4WB0B 2Z9UA 3RCHA 5IWQA 3DYDA 4AZKA 2E7UA 2NMPA 4HVKA 2V1PA 1DKAA 2GMUA 4RIZA 3VP6A 3OP7A 3NTJA 2DR1A 2VYCA 4XK1A 5I92A 3CQ6A 2D63A 4Y0DA 1AJRA 1YOOA 2DGMA 3AENB 1QGNA 4Y0HA 3AEMA 1JF9A 1GCKA 2W7JA 2D61A 1GD9A 1W23A 1AIBA 3RCHB 3NX3A 1MLZA 1Z7DA 2BHXA 2Z1ZA 2EH6A 2QB3A 3FVXA 3HDOA 5E3KA 4GDYA 4W1XA 1DJUA 4XJOA 1N8PA 1V2DA 3QI6A 3F0HA 1AY8A 2QMAA 2QSRA 2OQXA 2HZPA 4GE4A 5G09A 1CL2A 2VMVA 3ATHA 4WYDA 4WP0A 3N5MA 4ZSYA 3N4SA 4GEBA 1M6SA 1X0MA 1ASBA 2EZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VMY A;  1LC7 A;  3IHJ A;  1P3W A;  3WLX A;  2FN6 A;  1ASN A;  1V2F A;  2W7I A;  2Z9W A;  3PDB A;  3JW9 A;  3A9X A;  3QPG A;  4NOG A;  2W8U A;  1V2E A;  1EG5 A;  1SVV A;  3EI8 A;  1ASE A;  2VI9 A;  3ISL A;  1AY5 A;  1WYU B;  3A9Y A;  1EQB A;  2HUF A;  2R0T A;  3FVU A;  5F9S A;  4PFF A;  4M2K A;  2AEV A;  1GC4 A;  4WBT A;  2BWP A;  1CS1 A;  2VIA A;  4J5U A;  4ADE A;  1V72 A;  5FT8 A;  1AIA A;  1ASG A;  2ZY3 A;  4ZSW A;  9AAT A;  3DU4 A;  2YRR A;  3A9Z A;  2W7K A;  1SZU A;  1TAS A;  2G6W A;  2Z1Y A;  3CAI A;  3TQX A;  4B9B A;  4KXK A;  1TPL A;  1IX8 A;  4Q75 A;  1AMQ A;  2AY3 A;  1OHY A;  3E6G A;  2QB2 A;  3RI6 A;  1S09 A;  4QGR A;  1M4N A;  3AOV A;  3CBF A;  4AH3 A;  3KGW A;  5K8B A;  4XJM A;  1AHG A;  1U08 A;  3AEJ A;  3EIB A;  2CTZ A;  2EZ2 A;  2HP1 A;  2QLR A;  7AAT A;  3ACZ A;  1N2T A;  3RBL A;  3I16 A;  4JE5 A;  2CST A;  1YNU A;  3LWS A;  2VMO A;  1CQ7 A;  3G7Q A;  3NUB A;  4A6T A;  2W7H A;  4RJ0 A;  3TFU A;  1SPA A;  1MLY A;  2PB0 A;  4E1O A;  5JAY A;  2FM1 A;  4KYO A;  4MKK A;  2CB1 A;  3WX9 A;  3B8X A;  2D7Y A;  1PFF A;  1OHW A;  3ZRQ A;  4W5K A;  1W3U A;  4RKD A;  2W8J A;  1TOE A;  1YJZ A;  2ZP7 A;  5LH9 A;  1WST A;  2HOR A;  3FCR A;  2OAT A;  3FZ7 A;  4IY7 A;  4WYC A;  1DFO A;  2ZY5 A;  3BWN C;  2EO5 A;  1UU1 A;  1LW5 A;  3KKI A;  3RUY A;  2VMZ A;  4RIT A;  3NDN A;  2CJG A;  1AAM A;  4ADD A;  4JE5 D;  4XJL A;  2Z61 A;  1TOK A;  4FL0 A;  3WY7 A;  1JG8 A;  4MQQ A;  1W7L A;  2D65 A;  3P6K A;  3EI6 A;  4W1V A;  4ADB A;  1AMA A;  1J04 A;  1QIR A;  1ASC A;  2AY9 A;  2JJG A;  5BJ3 A;  4WXB A;  1UU0 A;  1I43 A;  1C7N A;  1D7R A;  4JF0 A;  4A6R A;  3HLM A;  4OMA A;  4RLG A;  3K40 A;  2AY1 A;  4BQ0 A;  3VAX A;  2X5F A;  4N0W A;  2W7D A;  1ARH A;  3ELP A;  2JIS A;  2OKJ A;  2W7G A;  3JTX A;  2CIN A;  1Y4I A;  5D5S A;  5M49 A;  1TOJ A;  1B9H A;  1IAY A;  1Z3Z A;  2VIB A;  2W8V A;  3AAT A;  4U1T A;  4XEW A;  3EI9 A;  4ZM4 A;  3RBF A;  4ZWV A;  1YIY A;  5M4D A;  2BI5 A;  4XQ2 A;  1FC4 A;  1I48 A;  1XI9 A;  3FD0 A;  1BJO B;  3MAF A;  4OCA A;  3W1I A;  2OKK A;  1GC3 A;  1AHX A;  1QIT A;  2AY6 A;  2BKW A;  5FT5 A;  3WCO A;  4ZAH A;  4LW4 A;  1JS6 A;  2BI2 A;  3IF2 A;  3WZF A;  3NU8 A;  3ZRP A;  1ASA A;  2VGT A;  4OC9 A;  4F4E A;  1DJ9 A;  2DKJ A;  3PPL A;  1TAT A;  1ASL A;  1ORD A;  3FTB A;  1B5O A;  1BW0 A;  3ASA A;  3DRD A;  3TCM A;  2AY7 A;  3FFR A;  2YKY A;  3II0 A;  1VP4 A;  2C44 A;  4WYA A;  1RVU A;  1AJS A;  4F5L A;  3EI7 A;  2QA3 A;  1FG3 A;  3BWN A;  1C7G A;  4A00 A;  3AEJ C;  3ASB A;  4N0B A;  3LV2 A;  3ELE A;  4WYG A;  1RV4 A;  3NRA A;  4F5K A;  1MAQ A;  4JEW A;  5EAA A;  2ZJG A;  3QM2 A;  1YIZ A;  2O1B A;  2VMP A;  2JJH A;  4ITX A;  1M0O A;  3BWO A;  4CXR A;  2E7I A;  4XAU A;  1AX4 A;  2VGS A;  2DOU A;  2AY2 A;  4E3R A;  1IAX A;  1D7U A;  1G7X A;  1CZC A;  3W1H A;  4DGT A;  4R2N A;  1ELQ A;  2TPL A;  3FZ6 A;  2BIE A;  3MEB A;  3QHX A;  1VEF A;  4OYT A;  2AAT A;  2D5Y A;  3A2B A;  4ATP A;  4BMK A;  2VMN A;  4I8A A;  1M0Q A;  3BCA A;  3BS8 A;  4WXF A;  3H14 A;  2EPJ A;  4UQV A;  1BT4 A;  8AAT A;  1RVY A;  4MY5 A;  4RM1 A;  3DXW A;  2VGZ A;  3E77 A;  3D6K A;  3MKJ A;  4ZDL A;  3VK3 A;  2FNI A;  3FQ7 A;  4GRX A;  2W7L A;  1WKH A;  2AEU A;  2C81 A;  2YKV A;  3FFH A;  3OKS A;  4F5G A;  3FRK A;  3DZZ A;  4R5Z A;  3JU7 A;  1E5E A;  1ECX A;  1CZE A;  4RJY A;  2GMS A;  5HHY A;  3VK2 A;  4W8I A;  1GEW A;  3B1D A;  1ARS A;  1MGV A;  3L44 A;  1C9C A;  4ZLV A;  5DX5 A;  1UKJ A;  2CH2 A;  3BCB A;  3WCN A;  1B5P A;  4TN4 A;  3JWA A;  1MDX A;  2BWO A;  4TV7 A;  3WKS A;  2R5C A;  2ZSL A;  4PIW A;  5E5I A;  2HOX A;  4M2J A;  5E4Z A;  1M0N A;  4JEY A;  1AKC A;  1IX7 A;  1FG7 A;  3PDB B;  1KL2 A;  3FQ8 A;  4PVF A;  4CVQ A;  5EIG A;  3WGB A;  3E2Z A;  1SF2 A;  4IX8 A;  3BC8 A;  2VMR A;  2BIA A;  1GC0 A;  3NYT A;  4JEX A;  3UE8 A;  1AMS A;  1AKA A;  4JF1 A;  4MKJ A;  2X3L A;  5DJ9 A;  3FSL A;  4H51 A;  4F5M A;  4A6U A;  5G0A A;  1ZOD A;  2C0R A;  5J8Q A;  1BQA A;  1S08 A;  2W8T A;  3CQ5 A;  3E9K A;  2JJE A;  5DB5 A;  3LVJ A;  4F5F A;  2DKB A;  5EQC A;  1TOG A;  1LKC A;  1TOI A;  2YCP A;  1B4X A;  4KAM A;  1M0P A;  1OAT A;  3GZD C;  3HVY A;  3NYU A;  1KKJ A;  4PFN A;  1LK9 A;  4AO4 A;  3I4J A;  3AOW A;  3MC6 C;  3ZZJ A;  1AKB A;  2CJH A;  3QN6 A;  1ZC9 A;  3DXV A;  1MDZ A;  1QJ5 A;  1S07 A;  3B1C A;  2CY8 A;  3BV0 A;  4UOY A;  3AV7 A;  3PA9 A;  3RQ1 A;  1KMK A;  2BWN A;  2ZYJ A;  3FDD A;  2E7J A;  4LNL A;  1J32 A;  3W1J A;  2GQN A;  1MAP A;  2C7T A;  4WYF A;  4A0G A;  2PB2 A;  3WKR A;  2Z9V A;  4LW2 A;  3TFT A;  3QBO A;  3NU7 A;  4OT8 A;  3K28 A;  1BKG A;  4MQP A;  3KE3 A;  4ZM3 A;  2HUI A;  4O6Z A;  3PAA A;  1KL1 A;  5AX8 A;  4IW7 A;  4TMR A;  3HBX A;  1EJI A;  2O7C A;  2VMQ A;  4L0O A;  1SFF A;  4E3Q A;  4IYO A;  2HP2 A;  2R5E A;  4JEZ A;  4MSO A;  3HL2 A;  3DR7 A;  1RV3 A;  2W8W A;  3F9T A;  5FT4 A;  3T32 A;  3JWB A;  1YAA A;  4Q76 A;  4RKC A;  2AY8 A;  1O62 A;  2ZUK A;  2ZY2 A;  3BB8 A;  2BI3 A;  1AMR A;  3FKD A;  4HF8 A;  2YHK A;  3PIU A;  2YKX A;  2YCN A;  1LW4 A;  3I5T A;  2VI8 A;  4CBR A;  2YRI A;  3EI5 A;  2X8U A;  1SZS A;  2ZC0 A;  5TF5 A;  3LG0 A;  5EAV A;  2PO3 A;  2WK7 A;  3FQA A;  1ART A;  3AEL A;  4MGR A;  4W91 A;  4OBU A;  2D66 A;  4LNM A;  3WGC A;  1BJN A;  1BJW A;  2CH1 A;  4WB0 A;  4R5F A;  4XJP A;  4DQ6 A;  3GZD A;  5G2Q A;  1ARI A;  1AHF A;  1YJS A;  2GSA A;  2CAN A;  3MAF B;  5FT6 A;  5EFS A;  1AAW A;  1MDO A;  3MC6 A;  3N75 A;  4IXO A;  3L8A A;  2VMT A;  5EUN A;  4DBC A;  2WK8 A;  5M46 A;  1ARG A;  1IJI A;  5C6U A;  4A0H A;  3AEN A;  5G4J A;  3NYS A;  2F8J A;  3FDB A;  1AY4 A;  1QJ3 A;  2WK9 A;  1X28 A;  2VLF A;  3FVS A;  4EU1 A;  3B1E A;  1AJS B;  1TAR A;  1BQD A;  1BS0 A;  1OXP A;  2DGK A;  3COG A;  4ZDO A;  3HMU A;  2V0Y A;  4JEV A;  2JGT A;  3K7Y A;  4EFF A;  1X2A A;  4U2H A;  1M32 A;  1IBJ A;  3UAK A;  4Y0I A;  1PMM A;  1D2F A;  2VLH A;  4OBV A;  1PG8 A;  4ITG A;  3GBX A;  3EIA A;  5LHA A;  1DJE A;  3E2F A;  2QBT A;  3PDX A;  4F5I A;  2XBN A;  3BCX A;  1C7O A;  1AIC A;  2HOZ A;  4F5H A;  1VJO A;  1DGE A;  1D7V A;  2Q7W A;  4ZDP A;  2EGY A;  2W7E A;  1D7S A;  1O61 A;  4CXQ A;  1C4K A;  3PD6 A;  4WXG A;  4M2M A;  1AHY A;  1SZK A;  1WYU A;  3EZS A;  3LVM A;  3MAD A;  2OGE A;  4EB7 A;  2GB3 A;  1H0C A;  2ORD A;  4UHN A;  3LY1 A;  1C0N A;  3QGU A;  2ZY4 A;  1BJ4 A;  4UHM A;  1AHE A;  3GET A;  4CBS A;  1WYV A;  3NUI A;  3TAT A;  1OXO A;  1I29 A;  2BI9 A;  4BHD A;  4J8L A;  3CQ4 A;  1CQ8 A;  3USF A;  2BYL A;  2VMS A;  3KGX A;  1X29 A;  4ZWM A;  3NNK A;  2JJF A;  5EUE A;  1GC2 A;  3PD6 B;  2R2N A;  2Z20 A;  3M5U A;  1E5F A;  1ELU A;  4BA5 A;  1W7N A;  2R5C B;  3PJ0 A;  2W7F A;  1M7Y A;  2BI1 A;  2JG2 A;  1ASM A;  1LC8 A;  3B46 A;  1WYV B;  1KKP A;  4MQR A;  4GSA A;  4W1W A;  1S0A A;  2FYF A;  5EIG B;  3E2Z B;  1DTY A;  3EZ1 A;  4E77 A;  1GEY A;  4LNJ A;  2Z67 A;  2D7Z A;  4GE9 A;  3DOD A;  4P3M A;  1KMJ A;  4ADC A;  1WKG A;  1IUG A;  2Z9X A;  4LC3 A;  3Q8N A;  4K2B A;  4WLJ A;  2AY4 A;  2W7M A;  1S06 A;  1DGD A;  3JZL A;  2FNU A;  3P1T A;  3GJU A;  1N31 A;  3N0L A;  4WD2 A;  4A0F A;  2E54 A;  1QZ9 A;  4WLH A;  2BIG A;  5BJ4 A;  4EB5 A;  1UU2 A;  3AEP A;  1GDE A;  3MAU A;  1T3I A;  3H7F A;  1B9I A;  2VGW A;  4P7Y A;  4ATQ A;  2XH1 A;  4WYE A;  1ASF A;  1O69 A;  1B8G A;  1GBN A;  1IVR A;  2O0R A;  2VGU A;  1CL1 A;  2VMX A;  3VOM A;  1G7W A;  3HT4 A;  4IXZ A;  1PMO A;  3DR4 A;  2HOY A;  1WYT A;  3R9A A;  1YJY A;  4A0R A;  3E2Y A;  3ECD A;  1I41 A;  1JS3 A;  1CQ6 A;  5EUD A;  3AEM C;  1ASD A;  3EUC A;  2YCT A;  1G4X A;  4IXS A;  4A72 A;  4F5J A;  3HQT A;  2VMU A;  5G2P A;  5HXX A;  4AO9 A;  4GE7 A;  1XEY A;  3DC1 A;  4EMY A;  3PGY A;  4ISY A;  2CJD A;  3FZ8 A;  1WYT B;  3BN1 A;  1GEX A;  3MBB A;  2OGA A;  2FQ6 A;  5D95 A;  3GR9 A;  4Q6R A;  1LS3 A;  1W7M A;  4AOA A;  1BJO A;  3LVL B;  4IYO B;  2CFB A;  1H1C A;  4FFC A;  4AZJ A;  4BA4 A;  5G4I A;  2AY5 A;  3ZRR A;  3R4T A;  2RFV A;  1LC5 A;  5M4B A;  1ZOB A;  2ZSM A;  1QIS A;  3A8U X;  3G8M A;  2YOB A;  4UHO A;  4ZAS A;  3UWC A;  2DGL A;  3GWP A;  4OTL A;  4B98 A;  2VGV A;  5HDM A;  3AEO A;  4K2I A;  5DJ1 A;  3G0T A;  4K2M A;  1CJ0 A;  5F8V A;  3ZZK A;  2D64 A;  1G4V A;  2HUU A;  3LVK A;  3F6T A;  3GSB A;  3GZC A;  4R8D A;  2VMW A;  3VK4 A;  1IX6 A;  4Q31 A;  1OHV A;  2BYJ A;  2X5D A;  1O4S A;  2WKA A;  2YKU A;  4RAE A;  4WB0 B;  2Z9U A;  3RCH A;  5IWQ A;  3DYD A;  4AZK A;  2E7U A;  2NMP A;  4HVK A;  2V1P A;  1DKA A;  2GMU A;  4RIZ A;  3VP6 A;  3OP7 A;  3NTJ A;  2DR1 A;  2VYC A;  4XK1 A;  5I92 A;  3CQ6 A;  2D63 A;  4Y0D A;  1AJR A;  1YOO A;  2DGM A;  3AEN B;  1QGN A;  4Y0H A;  3AEM A;  1JF9 A;  1GCK A;  2W7J A;  2D61 A;  1GD9 A;  1W23 A;  1AIB A;  3RCH B;  3NX3 A;  1MLZ A;  1Z7D A;  2BHX A;  2Z1Z A;  2EH6 A;  2QB3 A;  3FVX A;  3HDO A;  5E3K A;  4GDY A;  4W1X A;  1DJU A;  4XJO A;  1N8P A;  1V2D A;  3QI6 A;  3F0H A;  1AY8 A;  2QMA A;  2OQX A;  2HZP A;  4GE4 A;  5G09 A;  1CL2 A;  2VMV A;  3ATH A;  4WYD A;  4WP0 A;  3N5M A;  4ZSY A;  4GEB A;  1M6S A;  1X0M A;  1ASB A;  2EZ1 A; 
#chains in the Genus database with same CATH topology
 2VMY A;  1LC7 A;  3IHJ A;  1P3W A;  3WLX A;  2FN6 A;  1ASN A;  1V2F A;  2W7I A;  2Z9W A;  3PDB A;  3JW9 A;  3A9X A;  3QPG A;  4NOG A;  2W8U A;  1V2E A;  1EG5 A;  1SVV A;  3EI8 A;  1ASE A;  2VI9 A;  3ISL A;  1AY5 A;  1WYU B;  3A9Y A;  1EQB A;  2HUF A;  2R0T A;  3FVU A;  5F9S A;  4PFF A;  4M2K A;  2AEV A;  1GC4 A;  4WBT A;  2BWP A;  1CS1 A;  2VIA A;  4J5U A;  4ADE A;  1V72 A;  5FT8 A;  1AIA A;  1ASG A;  2ZY3 A;  4ZSW A;  9AAT A;  3DU4 A;  2YRR A;  3A9Z A;  2W7K A;  1SZU A;  1TAS A;  2G6W A;  2Z1Y A;  3CAI A;  3TQX A;  4B9B A;  4KXK A;  1TPL A;  1IX8 A;  4Q75 A;  1AMQ A;  2AY3 A;  1OHY A;  3E6G A;  2QB2 A;  3RI6 A;  1S09 A;  4QGR A;  1M4N A;  3AOV A;  3CBF A;  4AH3 A;  3KGW A;  5K8B A;  4XJM A;  1AHG A;  1U08 A;  3AEJ A;  3EIB A;  2CTZ A;  2EZ2 A;  2HP1 A;  2QLR A;  7AAT A;  3ACZ A;  1N2T A;  3RBL A;  3I16 A;  4JE5 A;  2CST A;  1YNU A;  3LWS A;  2VMO A;  1CQ7 A;  3G7Q A;  3NUB A;  4A6T A;  2W7H A;  4RJ0 A;  3TFU A;  1SPA A;  1MLY A;  2PB0 A;  4E1O A;  5JAY A;  2FM1 A;  4KYO A;  4MKK A;  2CB1 A;  3WX9 A;  3B8X A;  2D7Y A;  1PFF A;  1OHW A;  3ZRQ A;  4W5K A;  1W3U A;  4RKD A;  2W8J A;  1TOE A;  1YJZ A;  2ZP7 A;  5LH9 A;  1WST A;  2HOR A;  3FCR A;  2OAT A;  3FZ7 A;  4IY7 A;  4WYC A;  1DFO A;  2ZY5 A;  3BWN C;  2EO5 A;  1UU1 A;  1LW5 A;  3KKI A;  3RUY A;  2VMZ A;  4RIT A;  3NDN A;  2CJG A;  1AAM A;  4ADD A;  4JE5 D;  4XJL A;  2EYQ A;  2Z61 A;  1TOK A;  4FL0 A;  3WY7 A;  1JG8 A;  4MQQ A;  3N4R A;  1W7L A;  2D65 A;  3P6K A;  3EI6 A;  4W1V A;  4ADB A;  1AMA A;  1J04 A;  1QIR A;  1ASC A;  2AY9 A;  2JJG A;  5BJ3 A;  4WXB A;  1UU0 A;  1I43 A;  1C7N A;  1D7R A;  4JF0 A;  4A6R A;  3HLM A;  4OMA A;  5KTB A;  4RLG A;  3K40 A;  2AY1 A;  4BQ0 A;  3VAX A;  2X5F A;  4N0W A;  2W7D A;  1ARH A;  3ELP A;  2JIS A;  2OKJ A;  2W7G A;  3JTX A;  2CIN A;  1Y4I A;  5D5S A;  5M49 A;  1TOJ A;  1B9H A;  1IAY A;  1Z3Z A;  2VIB A;  2W8V A;  3AAT A;  4U1T A;  4XEW A;  3EI9 A;  4ZM4 A;  3RBF A;  4ZWV A;  1YIY A;  5M4D A;  2BI5 A;  4XQ2 A;  1FC4 A;  1I48 A;  1XI9 A;  3FD0 A;  1BJO B;  3MAF A;  4OCA A;  3W1I A;  2OKK A;  1GC3 A;  1AHX A;  1QIT A;  2AY6 A;  2BKW A;  5FT5 A;  3WCO A;  4ZAH A;  4LW4 A;  1JS6 A;  2BI2 A;  3IF2 A;  3WZF A;  3NU8 A;  3ZRP A;  1ASA A;  2VGT A;  4OC9 A;  4F4E A;  1DJ9 A;  2DKJ A;  3PPL A;  1TAT A;  1ASL A;  1ORD A;  3FTB A;  1B5O A;  1BW0 A;  3ASA A;  3DRD A;  3TCM A;  2AY7 A;  3FFR A;  2YKY A;  3II0 A;  1VP4 A;  2C44 A;  4WYA A;  1RVU A;  1AJS A;  4F5L A;  3EI7 A;  2QA3 A;  1FG3 A;  3BWN A;  1C7G A;  4A00 A;  3AEJ C;  3ASB A;  4N0B A;  3LV2 A;  3ELE A;  4WYG A;  1RV4 A;  3NRA A;  4F5K A;  1MAQ A;  4JEW A;  5EAA A;  2ZJG A;  3QM2 A;  1YIZ A;  2O1B A;  2VMP A;  2JJH A;  4ITX A;  1M0O A;  3BWO A;  4CXR A;  2E7I A;  4XAU A;  1AX4 A;  2VGS A;  2DOU A;  2AY2 A;  4E3R A;  1IAX A;  1D7U A;  1G7X A;  1CZC A;  3W1H A;  4DGT A;  4R2N A;  1ELQ A;  2TPL A;  3FZ6 A;  2BIE A;  3MEB A;  3QHX A;  1VEF A;  4OYT A;  2AAT A;  2D5Y A;  3A2B A;  4ATP A;  4BMK A;  2VMN A;  4I8A A;  1M0Q A;  3BCA A;  3BS8 A;  4WXF A;  3H14 A;  2EPJ A;  4UQV A;  1BT4 A;  8AAT A;  1RVY A;  4MY5 A;  4RM1 A;  3DXW A;  2VGZ A;  3E77 A;  3D6K A;  3MKJ A;  4ZDL A;  3VK3 A;  2FNI A;  3FQ7 A;  4GRX A;  2W7L A;  1WKH A;  2AEU A;  2C81 A;  2YKV A;  3FFH A;  3OKS A;  4F5G A;  3FRK A;  3DZZ A;  4R5Z A;  3JU7 A;  1E5E A;  1ECX A;  1CZE A;  4RJY A;  2G7J A;  2GMS A;  5HHY A;  3VK2 A;  4W8I A;  1GEW A;  3B1D A;  1ARS A;  1MGV A;  3L44 A;  1C9C A;  4ZLV A;  5DX5 A;  1UKJ A;  2CH2 A;  3BCB A;  3WCN A;  1B5P A;  4TN4 A;  3JWA A;  1MDX A;  2BWO A;  4TV7 A;  3WKS A;  2R5C A;  2ZSL A;  4PIW A;  5E5I A;  2HOX A;  4M2J A;  5E4Z A;  1M0N A;  4JEY A;  1AKC A;  1IX7 A;  1FG7 A;  3PDB B;  1KL2 A;  3FQ8 A;  2A1V A;  4PVF A;  4CVQ A;  5EIG A;  3WGB A;  3E2Z A;  1SF2 A;  4IX8 A;  3BC8 A;  2VMR A;  2BIA A;  1GC0 A;  3NYT A;  4JEX A;  3UE8 A;  1AMS A;  1AKA A;  4JF1 A;  4MKJ A;  2X3L A;  5DJ9 A;  3FSL A;  4H51 A;  4F5M A;  4A6U A;  5G0A A;  1ZOD A;  2C0R A;  5J8Q A;  1BQA A;  1S08 A;  2W8T A;  3CQ5 A;  3E9K A;  3N7N A;  2JJE A;  5DB5 A;  3LVJ A;  4F5F A;  2DKB A;  5EQC A;  1TOG A;  1LKC A;  1TOI A;  2YCP A;  1B4X A;  4KAM A;  1M0P A;  1OAT A;  3GZD C;  3HVY A;  3NYU A;  1KKJ A;  4PFN A;  1LK9 A;  4AO4 A;  3I4J A;  3AOW A;  3MC6 C;  3ZZJ A;  1AKB A;  2CJH A;  3N4X A;  3QN6 A;  1ZC9 A;  3DXV A;  1MDZ A;  1QJ5 A;  1S07 A;  3B1C A;  2CY8 A;  3BV0 A;  4UOY A;  3AV7 A;  3PA9 A;  3RQ1 A;  1KMK A;  2BWN A;  2ZYJ A;  3FDD A;  2E7J A;  4LNL A;  1J32 A;  3W1J A;  2GQN A;  1MAP A;  2C7T A;  4WYF A;  4A0G A;  2PB2 A;  3WKR A;  2Z9V A;  4LW2 A;  3TFT A;  3QBO A;  3NU7 A;  4OT8 A;  3K28 A;  2KFP A;  1BKG A;  4MQP A;  3KE3 A;  4ZM3 A;  2HUI A;  4O6Z A;  3PAA A;  1KL1 A;  5AX8 A;  4IW7 A;  4TMR A;  3HBX A;  1EJI A;  2O7C A;  2VMQ A;  4L0O A;  1SFF A;  4E3Q A;  4IYO A;  2HP2 A;  2R5E A;  4JEZ A;  4MSO A;  3HL2 A;  3DR7 A;  1RV3 A;  2W8W A;  3F9T A;  5FT4 A;  3T32 A;  3JWB A;  1YAA A;  4Q76 A;  4RKC A;  2AY8 A;  1O62 A;  2ZUK A;  2ZY2 A;  3BB8 A;  2BI3 A;  1AMR A;  3FKD A;  4HF8 A;  2YHK A;  3PIU A;  2YKX A;  2YCN A;  1LW4 A;  3I5T A;  2WB6 A;  2VI8 A;  4CBR A;  2YRI A;  3EI5 A;  2X8U A;  1SZS A;  2ZC0 A;  5TF5 A;  3LG0 A;  5EAV A;  2PO3 A;  2WK7 A;  3FQA A;  1ART A;  3AEL A;  4MGR A;  4W91 A;  4OBU A;  2D66 A;  4LNM A;  3WGC A;  1BJN A;  1BJW A;  2CH1 A;  4WB0 A;  4R5F A;  4XJP A;  4DQ6 A;  3GZD A;  5G2Q A;  1ARI A;  1AHF A;  1YJS A;  2GSA A;  2CAN A;  3MAF B;  5FT6 A;  5EFS A;  4K05 A;  1AAW A;  1MDO A;  3MC6 A;  3N75 A;  4IXO A;  3L8A A;  2VMT A;  5EUN A;  4DBC A;  2WK8 A;  5M46 A;  1ARG A;  1IJI A;  5C6U A;  4A0H A;  3AEN A;  5G4J A;  3NYS A;  2F8J A;  3FDB A;  1AY4 A;  1QJ3 A;  2WK9 A;  1X28 A;  2VLF A;  3FVS A;  4EU1 A;  3B1E A;  1AJS B;  1TAR A;  1BQD A;  1BS0 A;  1OXP A;  2DGK A;  3COG A;  4ZDO A;  3HMU A;  2V0Y A;  4JEV A;  2JGT A;  3K7Y A;  4EFF A;  1X2A A;  4U2H A;  1M32 A;  1IBJ A;  3UAK A;  4Y0I A;  1PMM A;  1D2F A;  2VLH A;  4OBV A;  1PG8 A;  4ITG A;  3GBX A;  3EIA A;  5LHA A;  1DJE A;  3E2F A;  2QBT A;  3PDX A;  4F5I A;  2XBN A;  3BCX A;  1C7O A;  1AIC A;  2HOZ A;  4F5H A;  1VJO A;  1DGE A;  1D7V A;  2Q7W A;  4ZDP A;  2EGY A;  2W7E A;  1D7S A;  1O61 A;  4CXQ A;  1C4K A;  3PD6 A;  4WXG A;  4M2M A;  1AHY A;  1SZK A;  1WYU A;  3EZS A;  3LVM A;  3MAD A;  2OGE A;  4EB7 A;  2GB3 A;  3H9X A;  1H0C A;  2ORD A;  4UHN A;  3LY1 A;  1C0N A;  3QGU A;  2ZY4 A;  1BJ4 A;  4UHM A;  1AHE A;  3GET A;  4CBS A;  1WYV A;  3NUI A;  3TAT A;  1OXO A;  1I29 A;  2BI9 A;  4BHD A;  4J8L A;  3CQ4 A;  1CQ8 A;  3USF A;  2BYL A;  2VMS A;  3KGX A;  1X29 A;  4ZWM A;  3NNK A;  2JJF A;  5EUE A;  1GC2 A;  3PD6 B;  2R2N A;  2Z20 A;  3M5U A;  1E5F A;  1ELU A;  4BA5 A;  1W7N A;  2R5C B;  3PJ0 A;  2W7F A;  1M7Y A;  2BI1 A;  2JG2 A;  1ASM A;  1LC8 A;  3B46 A;  1WYV B;  1KKP A;  4MQR A;  4GSA A;  4W1W A;  1S0A A;  2FYF A;  5EIG B;  3E2Z B;  1DTY A;  3EZ1 A;  4E77 A;  1GEY A;  4LNJ A;  2Z67 A;  2D7Z A;  4GE9 A;  3DOD A;  4P3M A;  1KMJ A;  4ADC A;  1WKG A;  1IUG A;  2Z9X A;  4LC3 A;  3Q8N A;  4K2B A;  4WLJ A;  2AY4 A;  2W7M A;  1S06 A;  1DGD A;  3JZL A;  2FNU A;  3P1T A;  3GJU A;  1N31 A;  3N0L A;  4WD2 A;  4A0F A;  2E54 A;  1QZ9 A;  4WLH A;  1KAF A;  2BIG A;  5BJ4 A;  4EB5 A;  1UU2 A;  3AEP A;  2FKI A;  1GDE A;  3MAU A;  1T3I A;  3H7F A;  1B9I A;  2VGW A;  4P7Y A;  4ATQ A;  2XH1 A;  4WYE A;  1ASF A;  1O69 A;  1B8G A;  1GBN A;  1IVR A;  2O0R A;  2VGU A;  1CL1 A;  2VMX A;  3VOM A;  1G7W A;  3HT4 A;  4IXZ A;  1PMO A;  3DR4 A;  2HOY A;  1WYT A;  3R9A A;  1YJY A;  4A0R A;  3E2Y A;  3ECD A;  1I41 A;  1JS3 A;  1CQ6 A;  5EUD A;  3AEM C;  1ASD A;  3EUC A;  2YCT A;  1G4X A;  4IXS A;  4A72 A;  4F5J A;  3HQT A;  2VMU A;  5G2P A;  5HXX A;  4AO9 A;  4GE7 A;  1XEY A;  3DC1 A;  4EMY A;  4H63 Q;  3PGY A;  4ISY A;  2CJD A;  3FZ8 A;  1WYT B;  3BN1 A;  1GEX A;  3MBB A;  2OGA A;  2FQ6 A;  5D95 A;  3GR9 A;  4Q6R A;  1LS3 A;  1W7M A;  4AOA A;  1BJO A;  3LVL B;  4IYO B;  2CFB A;  1H1C A;  4FFC A;  4AZJ A;  4BA4 A;  5G4I A;  2AY5 A;  3ZRR A;  3R4T A;  2RFV A;  1LC5 A;  5M4B A;  1ZOB A;  2ZSM A;  1QIS A;  3A8U X;  3G8M A;  2YOB A;  4UHO A;  4ZAS A;  3UWC A;  2DGL A;  3GWP A;  4OTL A;  4B98 A;  2VGV A;  5HDM A;  3AEO A;  4K2I A;  5DJ1 A;  3G0T A;  4K2M A;  1CJ0 A;  5F8V A;  3ZZK A;  2D64 A;  1G4V A;  2HUU A;  3LVK A;  3F6T A;  3GSB A;  3GZC A;  4R8D A;  2VMW A;  3VK4 A;  1IX6 A;  4Q31 A;  1OHV A;  2BYJ A;  2X5D A;  1O4S A;  2WKA A;  2YKU A;  4RAE A;  4WB0 B;  2Z9U A;  3RCH A;  5IWQ A;  3DYD A;  4AZK A;  2E7U A;  2NMP A;  4HVK A;  2V1P A;  1DKA A;  2GMU A;  4RIZ A;  3VP6 A;  3OP7 A;  3NTJ A;  2DR1 A;  2VYC A;  4XK1 A;  5I92 A;  3CQ6 A;  2D63 A;  4Y0D A;  1AJR A;  1YOO A;  2DGM A;  3AEN B;  1QGN A;  4Y0H A;  3AEM A;  1JF9 A;  1GCK A;  2W7J A;  2D61 A;  1GD9 A;  1W23 A;  1AIB A;  3RCH B;  3NX3 A;  1MLZ A;  1Z7D A;  2BHX A;  2Z1Z A;  2EH6 A;  2QB3 A;  3FVX A;  3HDO A;  5E3K A;  4GDY A;  4W1X A;  1DJU A;  4XJO A;  1N8P A;  1V2D A;  3QI6 A;  3F0H A;  1AY8 A;  2QMA A;  2QSR A;  2OQX A;  2HZP A;  4GE4 A;  5G09 A;  1CL2 A;  2VMV A;  3ATH A;  4WYD A;  4WP0 A;  3N5M A;  4ZSY A;  3N4S A;  4GEB A;  1M6S A;  1X0M A;  1ASB A;  2EZ1 A; 
#chains in the Genus database with same CATH homology
 2VMY A;  1LC7 A;  3IHJ A;  1P3W A;  3WLX A;  2FN6 A;  1ASN A;  1V2F A;  2W7I A;  2Z9W A;  3PDB A;  3JW9 A;  3A9X A;  3QPG A;  4NOG A;  2W8U A;  1V2E A;  1EG5 A;  1SVV A;  3EI8 A;  1ASE A;  2VI9 A;  3ISL A;  1AY5 A;  1WYU B;  3A9Y A;  1EQB A;  2HUF A;  2R0T A;  3FVU A;  5F9S A;  4PFF A;  4M2K A;  2AEV A;  1GC4 A;  4WBT A;  2BWP A;  1CS1 A;  2VIA A;  4J5U A;  4ADE A;  1V72 A;  5FT8 A;  1AIA A;  1ASG A;  2ZY3 A;  4ZSW A;  9AAT A;  3DU4 A;  2YRR A;  3A9Z A;  2W7K A;  1SZU A;  1TAS A;  2G6W A;  2Z1Y A;  3CAI A;  3TQX A;  4B9B A;  4KXK A;  1TPL A;  1IX8 A;  4Q75 A;  1AMQ A;  2AY3 A;  1OHY A;  3E6G A;  2QB2 A;  3RI6 A;  1S09 A;  4QGR A;  1M4N A;  3AOV A;  3CBF A;  4AH3 A;  3KGW A;  5K8B A;  4XJM A;  1AHG A;  1U08 A;  3AEJ A;  3EIB A;  2CTZ A;  2EZ2 A;  2HP1 A;  2QLR A;  7AAT A;  3ACZ A;  1N2T A;  3RBL A;  3I16 A;  4JE5 A;  2CST A;  1YNU A;  3LWS A;  2VMO A;  1CQ7 A;  3G7Q A;  3NUB A;  4A6T A;  2W7H A;  4RJ0 A;  3TFU A;  1SPA A;  1MLY A;  2PB0 A;  4E1O A;  5JAY A;  2FM1 A;  4KYO A;  4MKK A;  2CB1 A;  3WX9 A;  3B8X A;  2D7Y A;  1PFF A;  1OHW A;  3ZRQ A;  4W5K A;  1W3U A;  4RKD A;  2W8J A;  1TOE A;  1YJZ A;  2ZP7 A;  5LH9 A;  1WST A;  2HOR A;  3FCR A;  2OAT A;  3FZ7 A;  4IY7 A;  4WYC A;  1DFO A;  2ZY5 A;  3BWN C;  2EO5 A;  1UU1 A;  1LW5 A;  3KKI A;  3RUY A;  2VMZ A;  4RIT A;  3NDN A;  2CJG A;  1AAM A;  4ADD A;  4JE5 D;  4XJL A;  2EYQ A;  2Z61 A;  1TOK A;  4FL0 A;  3WY7 A;  1JG8 A;  4MQQ A;  3N4R A;  1W7L A;  2D65 A;  3P6K A;  3EI6 A;  4W1V A;  4ADB A;  1AMA A;  1J04 A;  1QIR A;  1ASC A;  2AY9 A;  2JJG A;  5BJ3 A;  4WXB A;  1UU0 A;  1I43 A;  1C7N A;  1D7R A;  4JF0 A;  4A6R A;  3HLM A;  4OMA A;  5KTB A;  4RLG A;  3K40 A;  2AY1 A;  4BQ0 A;  3VAX A;  2X5F A;  4N0W A;  2W7D A;  1ARH A;  3ELP A;  2JIS A;  2OKJ A;  2W7G A;  3JTX A;  2CIN A;  1Y4I A;  5D5S A;  5M49 A;  1TOJ A;  1B9H A;  1IAY A;  1Z3Z A;  2VIB A;  2W8V A;  3AAT A;  4U1T A;  4XEW A;  3EI9 A;  4ZM4 A;  3RBF A;  4ZWV A;  1YIY A;  5M4D A;  2BI5 A;  4XQ2 A;  1FC4 A;  1I48 A;  1XI9 A;  3FD0 A;  1BJO B;  3MAF A;  4OCA A;  3W1I A;  2OKK A;  1GC3 A;  1AHX A;  1QIT A;  2AY6 A;  2BKW A;  5FT5 A;  3WCO A;  4ZAH A;  4LW4 A;  1JS6 A;  2BI2 A;  3IF2 A;  3WZF A;  3NU8 A;  3ZRP A;  1ASA A;  2VGT A;  4OC9 A;  4F4E A;  1DJ9 A;  2DKJ A;  3PPL A;  1TAT A;  1ASL A;  1ORD A;  3FTB A;  1B5O A;  1BW0 A;  3ASA A;  3DRD A;  3TCM A;  2AY7 A;  3FFR A;  2YKY A;  3II0 A;  1VP4 A;  2C44 A;  4WYA A;  1RVU A;  1AJS A;  4F5L A;  3EI7 A;  2QA3 A;  1FG3 A;  3BWN A;  1C7G A;  4A00 A;  3AEJ C;  3ASB A;  4N0B A;  3LV2 A;  3ELE A;  4WYG A;  1RV4 A;  3NRA A;  4F5K A;  1MAQ A;  4JEW A;  5EAA A;  2ZJG A;  3QM2 A;  1YIZ A;  2O1B A;  2VMP A;  2JJH A;  4ITX A;  1M0O A;  3BWO A;  4CXR A;  2E7I A;  4XAU A;  1AX4 A;  2VGS A;  2DOU A;  2AY2 A;  4E3R A;  1IAX A;  1D7U A;  1G7X A;  1CZC A;  3W1H A;  4DGT A;  4R2N A;  1ELQ A;  2TPL A;  3FZ6 A;  2BIE A;  3MEB A;  3QHX A;  1VEF A;  4OYT A;  2AAT A;  2D5Y A;  3A2B A;  4ATP A;  4BMK A;  2VMN A;  4I8A A;  1M0Q A;  3BCA A;  3BS8 A;  4WXF A;  3H14 A;  2EPJ A;  4UQV A;  1BT4 A;  8AAT A;  1RVY A;  4MY5 A;  4RM1 A;  3DXW A;  2VGZ A;  3E77 A;  3D6K A;  3MKJ A;  4ZDL A;  3VK3 A;  2FNI A;  3FQ7 A;  4GRX A;  2W7L A;  1WKH A;  2AEU A;  2C81 A;  2YKV A;  3FFH A;  3OKS A;  4F5G A;  3FRK A;  3DZZ A;  4R5Z A;  3JU7 A;  1E5E A;  1ECX A;  1CZE A;  4RJY A;  2G7J A;  2GMS A;  5HHY A;  3VK2 A;  4W8I A;  1GEW A;  3B1D A;  1ARS A;  1MGV A;  3L44 A;  1C9C A;  4ZLV A;  5DX5 A;  1UKJ A;  2CH2 A;  3BCB A;  3WCN A;  1B5P A;  4TN4 A;  3JWA A;  1MDX A;  2BWO A;  4TV7 A;  3WKS A;  2R5C A;  2ZSL A;  4PIW A;  5E5I A;  2HOX A;  4M2J A;  5E4Z A;  1M0N A;  4JEY A;  1AKC A;  1IX7 A;  1FG7 A;  3PDB B;  1KL2 A;  3FQ8 A;  2A1V A;  4PVF A;  4CVQ A;  5EIG A;  3WGB A;  3E2Z A;  1SF2 A;  4IX8 A;  3BC8 A;  2VMR A;  2BIA A;  1GC0 A;  3NYT A;  4JEX A;  3UE8 A;  1AMS A;  1AKA A;  4JF1 A;  4MKJ A;  2X3L A;  5DJ9 A;  3FSL A;  4H51 A;  4F5M A;  4A6U A;  5G0A A;  1ZOD A;  2C0R A;  5J8Q A;  1BQA A;  1S08 A;  2W8T A;  3CQ5 A;  3E9K A;  3N7N A;  2JJE A;  5DB5 A;  3LVJ A;  4F5F A;  2DKB A;  5EQC A;  1TOG A;  1LKC A;  1TOI A;  2YCP A;  1B4X A;  4KAM A;  1M0P A;  1OAT A;  3GZD C;  3HVY A;  3NYU A;  1KKJ A;  4PFN A;  1LK9 A;  4AO4 A;  3I4J A;  3AOW A;  3MC6 C;  3ZZJ A;  1AKB A;  2CJH A;  3N4X A;  3QN6 A;  1ZC9 A;  3DXV A;  1MDZ A;  1QJ5 A;  1S07 A;  3B1C A;  2CY8 A;  3BV0 A;  4UOY A;  3AV7 A;  3PA9 A;  3RQ1 A;  1KMK A;  2BWN A;  2ZYJ A;  3FDD A;  2E7J A;  4LNL A;  1J32 A;  3W1J A;  2GQN A;  1MAP A;  2C7T A;  4WYF A;  4A0G A;  2PB2 A;  3WKR A;  2Z9V A;  4LW2 A;  3TFT A;  3QBO A;  3NU7 A;  4OT8 A;  3K28 A;  2KFP A;  1BKG A;  4MQP A;  3KE3 A;  4ZM3 A;  2HUI A;  4O6Z A;  3PAA A;  1KL1 A;  5AX8 A;  4IW7 A;  4TMR A;  3HBX A;  1EJI A;  2O7C A;  2VMQ A;  4L0O A;  1SFF A;  4E3Q A;  4IYO A;  2HP2 A;  2R5E A;  4JEZ A;  4MSO A;  3HL2 A;  3DR7 A;  1RV3 A;  2W8W A;  3F9T A;  5FT4 A;  3T32 A;  3JWB A;  1YAA A;  4Q76 A;  4RKC A;  2AY8 A;  1O62 A;  2ZUK A;  2ZY2 A;  3BB8 A;  2BI3 A;  1AMR A;  3FKD A;  4HF8 A;  2YHK A;  3PIU A;  2YKX A;  2YCN A;  1LW4 A;  3I5T A;  2WB6 A;  2VI8 A;  4CBR A;  2YRI A;  3EI5 A;  2X8U A;  1SZS A;  2ZC0 A;  5TF5 A;  3LG0 A;  5EAV A;  2PO3 A;  2WK7 A;  3FQA A;  1ART A;  3AEL A;  4MGR A;  4W91 A;  4OBU A;  2D66 A;  4LNM A;  3WGC A;  1BJN A;  1BJW A;  2CH1 A;  4WB0 A;  4R5F A;  4XJP A;  4DQ6 A;  3GZD A;  5G2Q A;  1ARI A;  1AHF A;  1YJS A;  2GSA A;  2CAN A;  3MAF B;  5FT6 A;  5EFS A;  4K05 A;  1AAW A;  1MDO A;  3MC6 A;  3N75 A;  4IXO A;  3L8A A;  2VMT A;  5EUN A;  4DBC A;  2WK8 A;  5M46 A;  1ARG A;  1IJI A;  5C6U A;  4A0H A;  3AEN A;  5G4J A;  3NYS A;  2F8J A;  3FDB A;  1AY4 A;  1QJ3 A;  2WK9 A;  1X28 A;  2VLF A;  3FVS A;  4EU1 A;  3B1E A;  1AJS B;  1TAR A;  1BQD A;  1BS0 A;  1OXP A;  2DGK A;  3COG A;  4ZDO A;  3HMU A;  2V0Y A;  4JEV A;  2JGT A;  3K7Y A;  4EFF A;  1X2A A;  4U2H A;  1M32 A;  1IBJ A;  3UAK A;  4Y0I A;  1PMM A;  1D2F A;  2VLH A;  4OBV A;  1PG8 A;  4ITG A;  3GBX A;  3EIA A;  5LHA A;  1DJE A;  3E2F A;  2QBT A;  3PDX A;  4F5I A;  2XBN A;  3BCX A;  1C7O A;  1AIC A;  2HOZ A;  4F5H A;  1VJO A;  1DGE A;  1D7V A;  2Q7W A;  4ZDP A;  2EGY A;  2W7E A;  1D7S A;  1O61 A;  4CXQ A;  1C4K A;  3PD6 A;  4WXG A;  4M2M A;  1AHY A;  1SZK A;  1WYU A;  3EZS A;  3LVM A;  3MAD A;  2OGE A;  4EB7 A;  2GB3 A;  3H9X A;  1H0C A;  2ORD A;  4UHN A;  3LY1 A;  1C0N A;  3QGU A;  2ZY4 A;  1BJ4 A;  4UHM A;  1AHE A;  3GET A;  4CBS A;  1WYV A;  3NUI A;  3TAT A;  1OXO A;  1I29 A;  2BI9 A;  4BHD A;  4J8L A;  3CQ4 A;  1CQ8 A;  3USF A;  2BYL A;  2VMS A;  3KGX A;  1X29 A;  4ZWM A;  3NNK A;  2JJF A;  5EUE A;  1GC2 A;  3PD6 B;  2R2N A;  2Z20 A;  3M5U A;  1E5F A;  1ELU A;  4BA5 A;  1W7N A;  2R5C B;  3PJ0 A;  2W7F A;  1M7Y A;  2BI1 A;  2JG2 A;  1ASM A;  1LC8 A;  3B46 A;  1WYV B;  1KKP A;  4MQR A;  4GSA A;  4W1W A;  1S0A A;  2FYF A;  5EIG B;  3E2Z B;  1DTY A;  3EZ1 A;  4E77 A;  1GEY A;  4LNJ A;  2Z67 A;  2D7Z A;  4GE9 A;  3DOD A;  4P3M A;  1KMJ A;  4ADC A;  1WKG A;  1IUG A;  2Z9X A;  4LC3 A;  3Q8N A;  4K2B A;  4WLJ A;  2AY4 A;  2W7M A;  1S06 A;  1DGD A;  3JZL A;  2FNU A;  3P1T A;  3GJU A;  1N31 A;  3N0L A;  4WD2 A;  4A0F A;  2E54 A;  1QZ9 A;  4WLH A;  2BIG A;  5BJ4 A;  4EB5 A;  1UU2 A;  3AEP A;  2FKI A;  1GDE A;  3MAU A;  1T3I A;  3H7F A;  1B9I A;  2VGW A;  4P7Y A;  4ATQ A;  2XH1 A;  4WYE A;  1ASF A;  1O69 A;  1B8G A;  1GBN A;  1IVR A;  2O0R A;  2VGU A;  1CL1 A;  2VMX A;  3VOM A;  1G7W A;  3HT4 A;  4IXZ A;  1PMO A;  3DR4 A;  2HOY A;  1WYT A;  3R9A A;  1YJY A;  4A0R A;  3E2Y A;  3ECD A;  1I41 A;  1JS3 A;  1CQ6 A;  5EUD A;  3AEM C;  1ASD A;  3EUC A;  2YCT A;  1G4X A;  4IXS A;  4A72 A;  4F5J A;  3HQT A;  2VMU A;  5G2P A;  5HXX A;  4AO9 A;  4GE7 A;  1XEY A;  3DC1 A;  4EMY A;  4H63 Q;  3PGY A;  4ISY A;  2CJD A;  3FZ8 A;  1WYT B;  3BN1 A;  1GEX A;  3MBB A;  2OGA A;  2FQ6 A;  5D95 A;  3GR9 A;  4Q6R A;  1LS3 A;  1W7M A;  4AOA A;  1BJO A;  3LVL B;  4IYO B;  2CFB A;  1H1C A;  4FFC A;  4AZJ A;  4BA4 A;  5G4I A;  2AY5 A;  3ZRR A;  3R4T A;  2RFV A;  1LC5 A;  5M4B A;  1ZOB A;  2ZSM A;  1QIS A;  3A8U X;  3G8M A;  2YOB A;  4UHO A;  4ZAS A;  3UWC A;  2DGL A;  3GWP A;  4OTL A;  4B98 A;  2VGV A;  5HDM A;  3AEO A;  4K2I A;  5DJ1 A;  3G0T A;  4K2M A;  1CJ0 A;  5F8V A;  3ZZK A;  2D64 A;  1G4V A;  2HUU A;  3LVK A;  3F6T A;  3GSB A;  3GZC A;  4R8D A;  2VMW A;  3VK4 A;  1IX6 A;  4Q31 A;  1OHV A;  2BYJ A;  2X5D A;  1O4S A;  2WKA A;  2YKU A;  4RAE A;  4WB0 B;  2Z9U A;  3RCH A;  5IWQ A;  3DYD A;  4AZK A;  2E7U A;  2NMP A;  4HVK A;  2V1P A;  1DKA A;  2GMU A;  4RIZ A;  3VP6 A;  3OP7 A;  3NTJ A;  2DR1 A;  2VYC A;  4XK1 A;  5I92 A;  3CQ6 A;  2D63 A;  4Y0D A;  1AJR A;  1YOO A;  2DGM A;  3AEN B;  1QGN A;  4Y0H A;  3AEM A;  1JF9 A;  1GCK A;  2W7J A;  2D61 A;  1GD9 A;  1W23 A;  1AIB A;  3RCH B;  3NX3 A;  1MLZ A;  1Z7D A;  2BHX A;  2Z1Z A;  2EH6 A;  2QB3 A;  3FVX A;  3HDO A;  5E3K A;  4GDY A;  4W1X A;  1DJU A;  4XJO A;  1N8P A;  1V2D A;  3QI6 A;  3F0H A;  1AY8 A;  2QMA A;  2QSR A;  2OQX A;  2HZP A;  4GE4 A;  5G09 A;  1CL2 A;  2VMV A;  3ATH A;  4WYD A;  4WP0 A;  3N5M A;  4ZSY A;  3N4S A;  4GEB A;  1M6S A;  1X0M A;  1ASB A;  2EZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...