1ASNA

Crystal structures of escherichia coli aspartate aminotransferase in two conformations: comparison of an unliganded open and two liganded closed forms
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structures of Escherichia coli aspartate aminotransferase in two conformations. Comparison of an unliganded open and two liganded closed forms.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1asnA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1asnA01
4BMKA 4IY7A 1QGNA 1G7XA 1WKHA 3I4JA 4W1WA 2BIAA 4JEWA 1CQ7A 2HUFA 4W5KA 4QGRA 4WXBA 1DKAA 4R8DA 2W7HA 3NUIA 4N0WA 1TOGA 2YOBA 3QPGA 3FZ6A 1ARHA 4R5ZA 3DRDA 2R0TA 1IAYA 2ZY4A 3A9XA 1AKBA 4E77A 3L8AA 5I92A 3TATA 1PMMA 1B5OA 1LK9A 1TOIA 3A8UX 3TQXA 3WCOA 3PPLA 1YIYA 3WZFA 3AEPA 4ATPA 1GD9A 3FZ7A 4EB7A 4ZSWA 2BIEA 4Y0DA 4WYAA 2QLRA 2V1PA 4WLHA 3P1TA 1AY4A 1KMKA 2X8UA 1BJNA 1W7LA 1E5FA 4XK1A 3G0TA 4ZAHA 2E7UA 2R5CA 5DB5A 4CVQA 1ARSA 2YHKA 2BI3A 1BW0A 1YJSA 4MQRA 2YRRA 3UE8A 3N5MA 5DJ9A 2VMZA 1ASAA 1G4VA 2HOXA 1Z3ZA 3GSBA 4A6RA 1V2FA 3QGUA 3WY7A 5G4IA 3RCHB 1SZKA 2E54A 2CANA 9AATA 2WKAA 1B4XA 3E2ZA 3F6TA 1V72A 2NMPA 4EB5A 4A0RA 4ITXA 4EU1A 3NNKA 3IHJA 1M0QA 2E7IA 2ZY3A 2CJHA 3ZRQA 2GSAA 2AATA 3FDBA 3HDOA 2C81A 2GB3A 2AY4A 1PG8A 3R9AA 2BKWA 1AAWA 1V2EA 4AZJA 4GE7A 2C7TA 3EI9A 4EMYA 3VAXA 3AENA 3E9KA 3B8XA 1N8PA 1CS1A 1S09A 3EIBA 4JE5D 3USFA 2BI2A 3WCNA 3ZRPA 3IF2A 3FSLA 2X3LA 5G09A 4ADEA 5E3KA 1AHFA 5DX5A 3EI8A 3OP7A 5TF5A 1SPAA 4B9BA 2VIBA 2Z1ZA 3WGCA 1AJRA 2E7JA 3BCBA 3PDBA 2FN6A 3CQ6A 3NTJA 4FFCA 2W7FA 1M32A 2D61A 3CQ5A 3B1EA 3DXWA 3GWPA 3AEJA 1AY5A 4H51A 2JISA 3DR7A 1YJYA 4WB0B 3NU7A 3P6KA 2OQXA 1YAAA 1TPLA 1J04A 2JGTA 2VMQA 1B5PA 2W8VA 1V2DA 1S07A 3FQ7A 4GSAA 3WKRA 4BQ0A 2W7LA 3GZDA 4F5MA 4K2BA 3MC6A 4IYOA 2G6WA 4JEXA 5EFSA 4OYTA 3A9YA 1W7NA 2CH2A 4LW4A 3WGBA 1J32A 3PIUA 3LV2A 4RJ0A 1TARA 3EUCA 1TOEA 3AEMA 5FT5A 4DBCA 3NYSA 2BHXA 2VMRA 4P7YA 1ZC9A 4RAEA 2JJEA 1AAMA 1MDXA 2W7JA 1C7NA 4R5FA 3GR9A 4CBRA 4RIZA 5C6UA 4I8AA 7AATA 4ISYA 4RJYA 4WP0A 3F9TA 2R5EA 2CSTA 2BI9A 2CB1A 1X28A 4RM1A 5E4ZA 1MAPA 4ZM4A 5F9SA 1PMOA 2Z9XA 1QJ5A 3WLXA 4UHMA 3B1DA 3LVMA 2PB0A 3JWBA 4IW7A 5G2QA 2W7IA 2VLHA 3DZZA 4ZM3A 1ORDA 1C0NA 1GC4A 1WYTB 3BCAA 3MC6C 4J8LA 2YCTA 1AICA 3PGYA 2CY8A 2OKJA 2BWNA 2AEUA 4OBVA 2YCNA 1OHWA 2VMXA 3LY1A 2O0RA 2F8JA 2HOZA 3EZ1A 3NDNA 1EG5A 2AY9A 4O6ZA 4GDYA 1TASA 1GC2A 2ZC0A 1LC7A 1VJOA 3VP6A 3MADA 2BI5A 4RITA 1ASCA 4N0BA 2Q7WA 1Y4IA 2VMNA 4ZDLA 1Z7DA 5F8VA 1AHEA 5J8QA 3AEOA 4ADDA 4MY5A 2BI1A 1JG8A 4WB0A 3RBLA 1UU2A 2DOUA 2VIAA 4U1TA 1JS3A 2DGMA 1WYUA 2VMUA 4WD2A 1I29A 3R4TA 1W23A 3N0LA 5M49A 2GMSA 1D7SA 1EQBA 3PD6A 1ASNA 3LVLB 5AX8A 1FG3A 3AATA 1B9IA 1S06A 2X5FA 2W8UA 4WXFA 2ZYJA 3EI5A 2FNIA 1AMAA 5LHAA 3BV0A 5FT8A 2AY8A 2WK7A 5M46A 4JE5A 2HORA 4B98A 4A00A 1RVYA 2BWOA 3E2YA 4JEZA 4CXQA 3MAFB 4M2MA 5EIGB 1D2FA 2YCPA 3ELPA 3WX9A 4DGTA 1JF9A 3A2BA 3MEBA 1BKGA 3TFTA 4WYCA 1B8GA 3OKSA 3NYUA 4ZDOA 3GETA 4WBTA 3ZZKA 1MDOA 1O61A 2BYLA 3ATHA 4WYDA 1AJSB 4MKKA 1ASDA 3HBXA 4KXKA 5K8BA 3BB8A 3FQ8A 2D7ZA 1MGVA 1LC8A 3W1HA 1TATA 3AV7A 1RVUA 1YJZA 1MAQA 2AY1A 2ZSLA 3QM2A 1GEXA 1S0AA 3FTBA 3KGXA 3M5UA 2VI9A 3CAIA 2C0RA 4JEVA 1AHYA 1X0MA 3AOVA 5G4JA 4E3QA 1DJ9A 1QISA 4XJPA 4TMRA 2VGZA 1D7RA 1AMSA 4XQ2A 3PJ0A 2DKJA 3BWNA 3KGWA 4F4EA 2AEVA 1BQDA 2D5YA 1YIZA 4LW2A 4OCAA 2CH1A 1BJOB 4Q76A 2EZ2A 2ZSMA 4PFFA 5EAAA 3MBBA 1VP4A 2ZY2A 2VMPA 3HVYA 2DR1A 2Z61A 1GEYA 1KKJA 4PFNA 4BHDA 1IBJA 3DU4A 5D95A 3TFUA 4F5HA 3HQTA 2Z9VA 3ELEA 1I48A 3LWSA 4MSOA 3CBFA 2OATA 1TOKA 4IXSA 2V0YA 4XJMA 2CJGA 2VMVA 2YRIA 3AOWA 4F5FA 3BS8A 1GC0A 1P3WA 4W1VA 3BC8A 3CQ4A 1TOJA 4U2HA 2VYCA 3ISLA 4A6TA 3W1JA 1RV3A 5BJ4A 4Q6RA 1WYVB 4ITGA 4MQPA 1AHXA 2HOYA 2YKXA 5M4DA 1M0OA 2Z67A 4WYGA 4JF1A 3TCMA 4PIWA 1LC5A 1H0CA 1X2AA 2PB2A 5LH9A 2GQNA 3N75A 4IXZA 5EIGA 3RI6A 2D65A 1C4KA 4XEWA 3ASAA 3HMUA 1SZSA 2EGYA 1CZCA 1IX6A 2W7EA 4ZWMA 1OATA 2ZJGA 1C7OA 1MLZA 3RBFA 3JZLA 3BWOA 3RCHA 1IAXA 1M0PA 3EZSA 2D63A 2BIGA 5JAYA 1AKAA 4DQ6A 2QBTA 2DGKA 1PFFA 3KE3A 3PA9A 3AEJC 4NOGA 2DKBA 2QA3A 4LNJA 3E77A 3UAKA 4EFFA 2TPLA 4W8IA 3NU8A 1YOOA 3JWAA 4MKJA 3FVXA 2JG2A 4LC3A 1ELQA 2R5CB 2FM1A 4AH3A 3LVJA 3MKJA 3T32A 3GZDC 3AELA 1G7WA 5HDMA 1H1CA 1DFOA 1M7YA 4E1OA 1D7UA 1ASFA 4RKCA 5G0AA 3MAUA 8AATA 4Y0IA 1ASEA 2EH6A 1AIBA 1KL2A 1BT4A 3B46A 1DJUA 1BJWA 1CZEA 3E2FA 3AEMC 3H7FA 2HP2A 1QIRA 3F0HA 3DXVA 2R2NA 3E2ZB 5DJ1A 4IX8A 3FD0A 2C44A 3GZCA 4WLJA 2AY6A 3FZ8A 2VMTA 2D64A 2CJDA 3JU7A 3VK3A 1XEYA 2FYFA 3NYTA 2VGWA 3ASBA 1AKCA 2QB2A 2VGTA 1ASBA 4L0OA 2AY3A 2W7DA 1UU0A 1ASMA 3NUBA 3VK2A 4ZSYA 2O7CA 4W1XA 3AENB 2W8JA 2VGUA 3EI6A 2Z20A 3JW9A 3FDDA 2OKKA 4F5LA 4Q31A 2Z1YA 1BJ4A 4PVFA 5G2PA 4GE9A 4IXOA 3FQAA 1KL1A 1AMQA 4BA5A 3A9ZA 2PO3A 4FL0A 4F5GA 1CQ8A 4OBUA 1EJIA 1LS3A 5HHYA 2YKUA 4OMAA 2AY2A 3LG0A 1BS0A 3PDBB 1OHVA 1D7VA 1N31A 1B9HA 2YKYA 5E5IA 1SFFA 3ECDA 2ZY5A 4UHNA 2EZ1A 1DJEA 2RFVA 4WYEA 2CINA 2XH1A 2QMAA 4MQQA 4ZASA 1N2TA 1W3UA 1GCKA 4J5UA 1CL1A 4AO9A 2X5DA 3I5TA 4WXGA 2O1BA 4GRXA 3D6KA 1LW4A 4LNMA 1ASLA 1CJ0A 4R2NA 4ADBA 2HP1A 3QBOA 4ZLVA 1X29A 1JS6A 2D66A 1GBNA 3K40A 4OT8A 4IYOB 3ZRRA 1DTYA 2EPJA 4KYOA 1C9CA 1WYTA 2ORDA 2VMWA 1QITA 1SF2A 3GBXA 3EI7A 1ZOBA 4TV7A 3RUYA 1IUGA 1LW5A 2AY7A 1IVRA 2VMSA 2ZUKA 3HLMA 4GE4A 3QN6A 3COGA 3RQ1A 1E5EA 1M0NA 4CXRA 1WSTA 5FT6A 1DGDA 1SZUA 4A6UA 4HVKA 1O4SA 1FC4A 3FCRA 1QJ3A 3G8MA 1AY8A 1C7GA 3HT4A 4K2IA 3WKSA 2BYJA 4F5IA 4UQVA 2Z9WA 4KAMA 2QB3A 3Q8NA 4Y0HA 3KKIA 4A0GA 2D7YA 2VMOA 2BWPA 4E3RA 1I43A 5IWQA 2OGAA 4AO4A 3ACZA 3H14A 4LNLA 5EQCA 1GDEA 4ZDPA 3DR4A 3BN1A 1ARGA 3NRAA 1I41A 1IX8A 4M2KA 3UWCA 1UKJA 1AHGA 1T3IA 2JJFA 2HZPA 2DGLA 1OHYA 1CL2A 1OXOA 2W8TA 1O69A 4XJOA 3II0A 1ECXA 3EIAA 4ADCA 5BJ3A 4W91A 3BWNC 3MAFA 5EUEA 3DC1A 1MDZA 3G7QA 1UU1A 1YNUA 4OTLA 2XBNA 3FKDA 2W7MA 1M4NA 2W8WA 1KKPA 2JJHA 2WK8A 1VEFA 3K7YA 1U08A 1AJSA 3GJUA 3NX3A 1KMJA 1WYUB 4JEYA 4UHOA 1ASGA 3PAAA 1CQ6A 1ZODA 1AIAA 1LKCA 1ARIA 1M6SA 2VI8A 3FVSA 5HXXA 2CFBA 3PD6B 1IX7A 4TN4A 2AY5A 1WKGA 3BCXA 4A72A 2W7KA 2W7GA 2EO5A 5EAVA 5D5SA 5M4BA 2FNUA 3DODA 3HL2A 3I16A 2VGSA 3JTXA 1SVVA 2ZP7A 4JF0A 3FRKA 4OC9A 4Q75A 1IJIA 4HF8A 2GMUA 3FVUA 2VMYA 3VOMA 2VLFA 4M2JA 3FFRA 1DGEA 4K2MA 1G4XA 2YKVA 1BJOA 4XJLA 1ELUA 4MGRA 3QHXA 1GEWA 5FT4A 4GEBA 4F5KA 4AOAA 3W1IA 4BA4A 2JJGA 1XI9A 3K28A 5EUNA 2VGVA 1O62A 4AZKA 4RLGA 4A0HA 1QZ9A 3DYDA 1AX4A 3E6GA 2HUIA 4WYFA 2OGEA 1OXPA 4RKDA 3QI6A 4F5JA 1BQAA 2CTZA 2FQ6A 4CBSA 4P3MA 1RV4A 3VK4A 4UOYA 1ARTA 2HUUA 1S08A 5EUDA 2Z9UA 3ZZJA 1AMRA 3FFHA 1GC3A 1W7MA 2WK9A 1WYVA 3LVKA 4XAUA 3L44A 4A0FA 4ATQA 3PDXA 1MLYA 1FG7A 4ZWVA 3B1CA
chains in the Genus database with same CATH superfamily
4BMKA 4IY7A 1QGNA 1G7XA 1WKHA 3I4JA 4W1WA 2BIAA 4JEWA 1CQ7A 2HUFA 4W5KA 4QGRA 3N7NA 4WXBA 1DKAA 4R8DA 2W7HA 3NUIA 4N0WA 1TOGA 2YOBA 3QPGA 3FZ6A 1ARHA 4R5ZA 3DRDA 2R0TA 1IAYA 2FKIA 2ZY4A 3A9XA 1AKBA 4E77A 3L8AA 5I92A 3TATA 1PMMA 1B5OA 1LK9A 1TOIA 3A8UX 3TQXA 3WCOA 3PPLA 1YIYA 3WZFA 3AEPA 4ATPA 1GD9A 3FZ7A 4EB7A 4ZSWA 2BIEA 4Y0DA 4WYAA 2QLRA 2V1PA 4WLHA 3P1TA 1AY4A 1KMKA 2X8UA 1BJNA 1W7LA 1E5FA 4XK1A 3G0TA 4ZAHA 2E7UA 2R5CA 5DB5A 4CVQA 1ARSA 2YHKA 2BI3A 2EYQA 1BW0A 1YJSA 4MQRA 2YRRA 3UE8A 3N5MA 5DJ9A 2VMZA 1ASAA 1G4VA 2HOXA 1Z3ZA 3GSBA 4A6RA 1V2FA 3QGUA 3WY7A 5G4IA 3RCHB 1SZKA 2E54A 2CANA 9AATA 2WKAA 1B4XA 3E2ZA 3F6TA 1V72A 2NMPA 4EB5A 4A0RA 4ITXA 4EU1A 2G7JA 3NNKA 3IHJA 1M0QA 2E7IA 2ZY3A 2CJHA 3ZRQA 2GSAA 2AATA 3FDBA 3HDOA 2C81A 2GB3A 2AY4A 1PG8A 3R9AA 2BKWA 1AAWA 1V2EA 4AZJA 4GE7A 2C7TA 3EI9A 4EMYA 3VAXA 3AENA 3E9KA 3B8XA 1N8PA 1CS1A 1S09A 3EIBA 4JE5D 3USFA 2BI2A 3WCNA 3ZRPA 3IF2A 3FSLA 2X3LA 5G09A 4ADEA 5E3KA 1AHFA 5DX5A 3EI8A 3OP7A 5TF5A 1SPAA 4B9BA 2VIBA 2Z1ZA 3WGCA 1AJRA 2E7JA 3BCBA 3PDBA 2FN6A 3CQ6A 3NTJA 4FFCA 2W7FA 1M32A 2D61A 3CQ5A 3B1EA 3DXWA 3GWPA 3AEJA 1AY5A 4H51A 2JISA 3DR7A 1YJYA 4WB0B 3NU7A 3P6KA 2OQXA 1YAAA 1TPLA 1J04A 2JGTA 2VMQA 1B5PA 2W8VA 1V2DA 1S07A 3FQ7A 4GSAA 3WKRA 4BQ0A 2W7LA 3GZDA 4F5MA 4K2BA 3MC6A 4IYOA 2G6WA 4JEXA 5EFSA 4OYTA 3A9YA 1W7NA 2CH2A 4LW4A 3WGBA 1J32A 3PIUA 3LV2A 4RJ0A 1TARA 3EUCA 1TOEA 3AEMA 5FT5A 4DBCA 3NYSA 2BHXA 2VMRA 4P7YA 1ZC9A 4RAEA 2JJEA 1AAMA 1MDXA 2W7JA 1C7NA 4R5FA 3GR9A 4CBRA 4RIZA 5C6UA 4I8AA 7AATA 4ISYA 4RJYA 4WP0A 3F9TA 2R5EA 2CSTA 2BI9A 2CB1A 1X28A 4RM1A 5E4ZA 1MAPA 4ZM4A 5F9SA 1PMOA 2Z9XA 1QJ5A 3WLXA 4UHMA 3B1DA 3LVMA 2PB0A 3JWBA 4IW7A 5G2QA 2W7IA 2VLHA 3DZZA 4ZM3A 1ORDA 1C0NA 1GC4A 1WYTB 3BCAA 3MC6C 4J8LA 2YCTA 1AICA 3PGYA 2CY8A 2OKJA 2BWNA 2AEUA 4OBVA 2YCNA 1OHWA 2VMXA 3LY1A 2O0RA 2F8JA 2HOZA 3EZ1A 3NDNA 1EG5A 2AY9A 4O6ZA 4H63Q 4GDYA 1TASA 1GC2A 2ZC0A 1LC7A 1VJOA 3VP6A 3MADA 2BI5A 4RITA 1ASCA 4N0BA 2Q7WA 1Y4IA 2VMNA 4ZDLA 1Z7DA 5F8VA 1AHEA 5J8QA 3AEOA 4ADDA 4MY5A 2BI1A 1JG8A 4WB0A 3RBLA 1UU2A 2DOUA 2VIAA 4U1TA 1JS3A 2DGMA 1WYUA 2VMUA 4WD2A 1I29A 3R4TA 1W23A 3N0LA 5M49A 2GMSA 1D7SA 1EQBA 3PD6A 1ASNA 3LVLB 5AX8A 1FG3A 3AATA 1B9IA 1S06A 2X5FA 2W8UA 4WXFA 2ZYJA 3EI5A 2FNIA 1AMAA 5LHAA 3BV0A 5FT8A 2AY8A 2WK7A 5M46A 4JE5A 2HORA 4B98A 4A00A 1RVYA 2BWOA 3E2YA 4JEZA 4CXQA 3MAFB 4M2MA 5EIGB 1D2FA 2YCPA 3ELPA 3WX9A 4DGTA 1JF9A 3A2BA 3MEBA 1BKGA 3TFTA 4WYCA 1B8GA 3OKSA 3NYUA 4ZDOA 3GETA 4WBTA 3ZZKA 1MDOA 1O61A 2BYLA 3ATHA 4WYDA 1AJSB 4MKKA 1ASDA 3HBXA 4KXKA 5K8BA 3BB8A 3FQ8A 2D7ZA 1MGVA 1LC8A 3W1HA 1TATA 3AV7A 1RVUA 1YJZA 1MAQA 2AY1A 2ZSLA 3QM2A 1GEXA 1S0AA 3FTBA 3KGXA 3M5UA 2VI9A 3CAIA 2C0RA 4JEVA 1AHYA 1X0MA 3AOVA 5G4JA 4E3QA 1DJ9A 1QISA 4XJPA 4TMRA 2VGZA 1D7RA 1AMSA 4XQ2A 3PJ0A 2DKJA 3BWNA 3KGWA 4F4EA 2AEVA 1BQDA 2D5YA 1YIZA 4LW2A 4OCAA 2CH1A 1BJOB 4Q76A 2EZ2A 2ZSMA 4PFFA 5EAAA 3MBBA 1VP4A 2ZY2A 2VMPA 3HVYA 2DR1A 2Z61A 1GEYA 1KKJA 4PFNA 4BHDA 1IBJA 3DU4A 5D95A 3TFUA 4F5HA 3HQTA 2Z9VA 3ELEA 1I48A 3LWSA 4MSOA 3CBFA 2OATA 1TOKA 4IXSA 2V0YA 4XJMA 2CJGA 2VMVA 2YRIA 3AOWA 4F5FA 3BS8A 1GC0A 1P3WA 4W1VA 3BC8A 3CQ4A 1TOJA 4U2HA 2VYCA 3ISLA 4A6TA 3W1JA 1RV3A 5BJ4A 4Q6RA 1WYVB 4ITGA 4MQPA 1AHXA 2HOYA 2YKXA 5M4DA 1M0OA 2Z67A 4WYGA 4JF1A 3TCMA 4PIWA 1LC5A 1H0CA 1X2AA 2PB2A 5LH9A 2GQNA 3N75A 4IXZA 5EIGA 3RI6A 2D65A 1C4KA 4XEWA 3ASAA 3HMUA 1SZSA 2EGYA 1CZCA 1IX6A 2W7EA 4ZWMA 1OATA 2ZJGA 1C7OA 1MLZA 3RBFA 3JZLA 3BWOA 3RCHA 1IAXA 1M0PA 3EZSA 2D63A 2BIGA 5JAYA 1AKAA 4DQ6A 2QBTA 2DGKA 3N4RA 1PFFA 3KE3A 3PA9A 3AEJC 4NOGA 2DKBA 2QA3A 4LNJA 3E77A 3UAKA 4EFFA 2TPLA 1KAFA 4W8IA 3NU8A 1YOOA 3JWAA 4MKJA 3FVXA 2JG2A 4LC3A 1ELQA 2R5CB 2FM1A 4AH3A 3LVJA 3MKJA 3T32A 3GZDC 3AELA 1G7WA 2QSRA 5HDMA 3H9XA 1H1CA 1DFOA 1M7YA 4E1OA 1D7UA 1ASFA 4RKCA 5G0AA 3MAUA 8AATA 4Y0IA 1ASEA 2EH6A 1AIBA 1KL2A 1BT4A 3B46A 1DJUA 1BJWA 2WB6A 1CZEA 3E2FA 3AEMC 3H7FA 2HP2A 1QIRA 3F0HA 3DXVA 2R2NA 3E2ZB 5DJ1A 4IX8A 3FD0A 2C44A 3GZCA 4WLJA 2AY6A 3FZ8A 2VMTA 2D64A 2CJDA 3JU7A 3VK3A 1XEYA 2FYFA 3NYTA 2VGWA 3ASBA 1AKCA 2QB2A 2VGTA 1ASBA 4L0OA 2AY3A 2W7DA 1UU0A 1ASMA 3NUBA 3VK2A 4ZSYA 2O7CA 4W1XA 3AENB 2W8JA 2VGUA 3EI6A 2Z20A 3JW9A 3FDDA 2OKKA 4F5LA 4Q31A 2Z1YA 1BJ4A 4PVFA 5G2PA 4GE9A 4IXOA 3FQAA 1KL1A 1AMQA 4BA5A 3A9ZA 2PO3A 4FL0A 4F5GA 1CQ8A 4OBUA 1EJIA 1LS3A 5HHYA 2YKUA 4OMAA 2AY2A 3LG0A 1BS0A 3PDBB 1OHVA 1D7VA 1N31A 1B9HA 2YKYA 5E5IA 1SFFA 3ECDA 2ZY5A 4UHNA 2EZ1A 1DJEA 2RFVA 4WYEA 2CINA 2XH1A 2QMAA 4MQQA 4ZASA 1N2TA 1W3UA 1GCKA 4J5UA 1CL1A 4AO9A 4K05A 2X5DA 3I5TA 4WXGA 2O1BA 4GRXA 3D6KA 1LW4A 4LNMA 1ASLA 1CJ0A 4R2NA 4ADBA 2HP1A 3QBOA 4ZLVA 1X29A 1JS6A 2D66A 1GBNA 3K40A 4OT8A 4IYOB 3ZRRA 1DTYA 2EPJA 4KYOA 1C9CA 1WYTA 2ORDA 2VMWA 1QITA 1SF2A 3GBXA 3EI7A 1ZOBA 4TV7A 3RUYA 3N4SA 1IUGA 1LW5A 2AY7A 1IVRA 2VMSA 2ZUKA 3HLMA 4GE4A 3QN6A 3COGA 3RQ1A 1E5EA 1M0NA 4CXRA 1WSTA 5KTBA 5FT6A 1DGDA 1SZUA 4A6UA 4HVKA 1O4SA 1FC4A 3FCRA 1QJ3A 3G8MA 1AY8A 1C7GA 3HT4A 4K2IA 3WKSA 2BYJA 4F5IA 4UQVA 2Z9WA 4KAMA 2QB3A 3Q8NA 4Y0HA 3KKIA 4A0GA 2D7YA 2VMOA 2BWPA 4E3RA 1I43A 5IWQA 2OGAA 4AO4A 3ACZA 3H14A 4LNLA 5EQCA 1GDEA 4ZDPA 3DR4A 3BN1A 1ARGA 3NRAA 1I41A 1IX8A 4M2KA 3UWCA 1UKJA 1AHGA 1T3IA 2JJFA 2HZPA 2DGLA 1OHYA 1CL2A 1OXOA 2W8TA 1O69A 4XJOA 3II0A 1ECXA 3EIAA 4ADCA 5BJ3A 4W91A 3BWNC 3MAFA 5EUEA 3DC1A 1MDZA 3G7QA 1UU1A 1YNUA 4OTLA 2XBNA 3FKDA 2W7MA 1M4NA 2W8WA 1KKPA 3N4XA 2JJHA 2WK8A 1VEFA 3K7YA 1U08A 1AJSA 3GJUA 3NX3A 1KMJA 1WYUB 4JEYA 4UHOA 1ASGA 3PAAA 1CQ6A 1ZODA 1AIAA 1LKCA 1ARIA 1M6SA 2VI8A 3FVSA 5HXXA 2CFBA 3PD6B 1IX7A 4TN4A 2AY5A 1WKGA 3BCXA 4A72A 2W7KA 2W7GA 2EO5A 5EAVA 5D5SA 5M4BA 2FNUA 3DODA 3HL2A 3I16A 2VGSA 3JTXA 2KFPA 1SVVA 2ZP7A 4JF0A 3FRKA 4OC9A 4Q75A 1IJIA 4HF8A 2GMUA 3FVUA 2VMYA 3VOMA 2A1VA 2VLFA 4M2JA 3FFRA 1DGEA 4K2MA 1G4XA 2YKVA 1BJOA 4XJLA 1ELUA 4MGRA 3QHXA 1GEWA 5FT4A 4GEBA 4F5KA 4AOAA 3W1IA 4BA4A 2JJGA 1XI9A 3K28A 5EUNA 2VGVA 1O62A 4AZKA 4RLGA 4A0HA 1QZ9A 3DYDA 1AX4A 3E6GA 2HUIA 4WYFA 2OGEA 1OXPA 4RKDA 3QI6A 4F5JA 1BQAA 2CTZA 2FQ6A 4CBSA 4P3MA 1RV4A 3VK4A 4UOYA 1ARTA 2HUUA 1S08A 5EUDA 2Z9UA 3ZZJA 1AMRA 3FFHA 1GC3A 1W7MA 2WK9A 1WYVA 3LVKA 4XAUA 3L44A 4A0FA 4ATQA 3PDXA 1MLYA 1FG7A 4ZWVA 3B1CA
chains in the Genus database with same CATH topology
4BMKA 4IY7A 1QGNA 1G7XA 1WKHA 3I4JA 4W1WA 2BIAA 4JEWA 1CQ7A 2HUFA 4W5KA 4QGRA 3N7NA 4WXBA 1DKAA 4R8DA 2W7HA 3NUIA 4N0WA 1TOGA 2YOBA 3QPGA 3FZ6A 1ARHA 4R5ZA 3DRDA 2R0TA 1IAYA 2FKIA 2ZY4A 3A9XA 1AKBA 4E77A 3L8AA 5I92A 3TATA 1PMMA 1B5OA 1LK9A 1TOIA 3A8UX 3TQXA 3WCOA 3PPLA 1YIYA 3WZFA 3AEPA 4ATPA 1GD9A 3FZ7A 4EB7A 4ZSWA 2BIEA 4Y0DA 4WYAA 2QLRA 2V1PA 4WLHA 3P1TA 1AY4A 1KMKA 2X8UA 1BJNA 1W7LA 1E5FA 4XK1A 3G0TA 4ZAHA 2E7UA 2R5CA 5DB5A 4CVQA 1ARSA 2YHKA 2BI3A 2EYQA 1BW0A 1YJSA 4MQRA 2YRRA 3UE8A 3N5MA 5DJ9A 2VMZA 1ASAA 1G4VA 2HOXA 1Z3ZA 3GSBA 4A6RA 1V2FA 3QGUA 3WY7A 5G4IA 3RCHB 1SZKA 2E54A 2CANA 9AATA 2WKAA 1B4XA 3E2ZA 3F6TA 1V72A 2NMPA 4EB5A 4A0RA 4ITXA 4EU1A 2G7JA 3NNKA 3IHJA 1M0QA 2E7IA 2ZY3A 2CJHA 3ZRQA 2GSAA 2AATA 3FDBA 3HDOA 2C81A 2GB3A 2AY4A 1PG8A 3R9AA 2BKWA 1AAWA 1V2EA 4AZJA 4GE7A 2C7TA 3EI9A 4EMYA 3VAXA 3AENA 3E9KA 3B8XA 1N8PA 1CS1A 1S09A 3EIBA 4JE5D 3USFA 2BI2A 3WCNA 3ZRPA 3IF2A 3FSLA 2X3LA 5G09A 4ADEA 5E3KA 1AHFA 5DX5A 3EI8A 3OP7A 5TF5A 1SPAA 4B9BA 2VIBA 2Z1ZA 3WGCA 1AJRA 2E7JA 3BCBA 3PDBA 2FN6A 3CQ6A 3NTJA 4FFCA 2W7FA 1M32A 2D61A 3CQ5A 3B1EA 3DXWA 3GWPA 3AEJA 1AY5A 4H51A 2JISA 3DR7A 1YJYA 4WB0B 3NU7A 3P6KA 2OQXA 1YAAA 1TPLA 1J04A 2JGTA 2VMQA 1B5PA 2W8VA 1V2DA 1S07A 3FQ7A 4GSAA 3WKRA 4BQ0A 2W7LA 3GZDA 4F5MA 4K2BA 3MC6A 4IYOA 2G6WA 4JEXA 5EFSA 4OYTA 3A9YA 1W7NA 2CH2A 4LW4A 3WGBA 1J32A 3PIUA 3LV2A 4RJ0A 1TARA 3EUCA 1TOEA 3AEMA 5FT5A 4DBCA 3NYSA 2BHXA 2VMRA 4P7YA 1ZC9A 4RAEA 2JJEA 1AAMA 1MDXA 2W7JA 1C7NA 4R5FA 3GR9A 4CBRA 4RIZA 5C6UA 4I8AA 7AATA 4ISYA 4RJYA 4WP0A 3F9TA 2R5EA 2CSTA 2BI9A 2CB1A 1X28A 4RM1A 5E4ZA 1MAPA 4ZM4A 5F9SA 1PMOA 2Z9XA 1QJ5A 3WLXA 4UHMA 3B1DA 3LVMA 2PB0A 3JWBA 4IW7A 5G2QA 2W7IA 2VLHA 3DZZA 4ZM3A 1ORDA 1C0NA 1GC4A 1WYTB 3BCAA 3MC6C 4J8LA 2YCTA 1AICA 3PGYA 2CY8A 2OKJA 2BWNA 2AEUA 4OBVA 2YCNA 1OHWA 2VMXA 3LY1A 2O0RA 2F8JA 2HOZA 3EZ1A 3NDNA 1EG5A 2AY9A 4O6ZA 4H63Q 4GDYA 1TASA 1GC2A 2ZC0A 1LC7A 1VJOA 3VP6A 3MADA 2BI5A 4RITA 1ASCA 4N0BA 2Q7WA 1Y4IA 2VMNA 4ZDLA 1Z7DA 5F8VA 1AHEA 5J8QA 3AEOA 4ADDA 4MY5A 2BI1A 1JG8A 4WB0A 3RBLA 1UU2A 2DOUA 2VIAA 4U1TA 1JS3A 2DGMA 1WYUA 2VMUA 4WD2A 1I29A 3R4TA 1W23A 3N0LA 5M49A 2GMSA 1D7SA 1EQBA 3PD6A 1ASNA 3LVLB 5AX8A 1FG3A 3AATA 1B9IA 1S06A 2X5FA 2W8UA 4WXFA 2ZYJA 3EI5A 2FNIA 1AMAA 5LHAA 3BV0A 5FT8A 2AY8A 2WK7A 5M46A 4JE5A 2HORA 4B98A 4A00A 1RVYA 2BWOA 3E2YA 4JEZA 4CXQA 3MAFB 4M2MA 5EIGB 1D2FA 2YCPA 3ELPA 3WX9A 4DGTA 1JF9A 3A2BA 3MEBA 1BKGA 3TFTA 4WYCA 1B8GA 3OKSA 3NYUA 4ZDOA 3GETA 4WBTA 3ZZKA 1MDOA 1O61A 2BYLA 3ATHA 4WYDA 1AJSB 4MKKA 1ASDA 3HBXA 4KXKA 5K8BA 3BB8A 3FQ8A 2D7ZA 1MGVA 1LC8A 3W1HA 1TATA 3AV7A 1RVUA 1YJZA 1MAQA 2AY1A 2ZSLA 3QM2A 1GEXA 1S0AA 3FTBA 3KGXA 3M5UA 2VI9A 3CAIA 2C0RA 4JEVA 1AHYA 1X0MA 3AOVA 5G4JA 4E3QA 1DJ9A 1QISA 4XJPA 4TMRA 2VGZA 1D7RA 1AMSA 4XQ2A 3PJ0A 2DKJA 3BWNA 3KGWA 4F4EA 2AEVA 1BQDA 2D5YA 1YIZA 4LW2A 4OCAA 2CH1A 1BJOB 4Q76A 2EZ2A 2ZSMA 4PFFA 5EAAA 3MBBA 1VP4A 2ZY2A 2VMPA 3HVYA 2DR1A 2Z61A 1GEYA 1KKJA 4PFNA 4BHDA 1IBJA 3DU4A 5D95A 3TFUA 4F5HA 3HQTA 2Z9VA 3ELEA 1I48A 3LWSA 4MSOA 3CBFA 2OATA 1TOKA 4IXSA 2V0YA 4XJMA 2CJGA 2VMVA 2YRIA 3AOWA 4F5FA 3BS8A 1GC0A 1P3WA 4W1VA 3BC8A 3CQ4A 1TOJA 4U2HA 2VYCA 3ISLA 4A6TA 3W1JA 1RV3A 5BJ4A 4Q6RA 1WYVB 4ITGA 4MQPA 1AHXA 2HOYA 2YKXA 5M4DA 1M0OA 2Z67A 4WYGA 4JF1A 3TCMA 4PIWA 1LC5A 1H0CA 1X2AA 2PB2A 5LH9A 2GQNA 3N75A 4IXZA 5EIGA 3RI6A 2D65A 1C4KA 4XEWA 3ASAA 3HMUA 1SZSA 2EGYA 1CZCA 1IX6A 2W7EA 4ZWMA 1OATA 2ZJGA 1C7OA 1MLZA 3RBFA 3JZLA 3BWOA 3RCHA 1IAXA 1M0PA 3EZSA 2D63A 2BIGA 5JAYA 1AKAA 4DQ6A 2QBTA 2DGKA 3N4RA 1PFFA 3KE3A 3PA9A 3AEJC 4NOGA 2DKBA 2QA3A 4LNJA 3E77A 3UAKA 4EFFA 2TPLA 4W8IA 3NU8A 1YOOA 3JWAA 4MKJA 3FVXA 2JG2A 4LC3A 1ELQA 2R5CB 2FM1A 4AH3A 3LVJA 3MKJA 3T32A 3GZDC 3AELA 1G7WA 2QSRA 5HDMA 3H9XA 1H1CA 1DFOA 1M7YA 4E1OA 1D7UA 1ASFA 4RKCA 5G0AA 3MAUA 8AATA 4Y0IA 1ASEA 2EH6A 1AIBA 1KL2A 1BT4A 3B46A 1DJUA 1BJWA 2WB6A 1CZEA 3E2FA 3AEMC 3H7FA 2HP2A 1QIRA 3F0HA 3DXVA 2R2NA 3E2ZB 5DJ1A 4IX8A 3FD0A 2C44A 3GZCA 4WLJA 2AY6A 3FZ8A 2VMTA 2D64A 2CJDA 3JU7A 3VK3A 1XEYA 2FYFA 3NYTA 2VGWA 3ASBA 1AKCA 2QB2A 2VGTA 1ASBA 4L0OA 2AY3A 2W7DA 1UU0A 1ASMA 3NUBA 3VK2A 4ZSYA 2O7CA 4W1XA 3AENB 2W8JA 2VGUA 3EI6A 2Z20A 3JW9A 3FDDA 2OKKA 4F5LA 4Q31A 2Z1YA 1BJ4A 4PVFA 5G2PA 4GE9A 4IXOA 3FQAA 1KL1A 1AMQA 4BA5A 3A9ZA 2PO3A 4FL0A 4F5GA 1CQ8A 4OBUA 1EJIA 1LS3A 5HHYA 2YKUA 4OMAA 2AY2A 3LG0A 1BS0A 3PDBB 1OHVA 1D7VA 1N31A 1B9HA 2YKYA 5E5IA 1SFFA 3ECDA 2ZY5A 4UHNA 2EZ1A 1DJEA 2RFVA 4WYEA 2CINA 2XH1A 2QMAA 4MQQA 4ZASA 1N2TA 1W3UA 1GCKA 4J5UA 1CL1A 4AO9A 4K05A 2X5DA 3I5TA 4WXGA 2O1BA 4GRXA 3D6KA 1LW4A 4LNMA 1ASLA 1CJ0A 4R2NA 4ADBA 2HP1A 3QBOA 4ZLVA 1X29A 1JS6A 2D66A 1GBNA 3K40A 4OT8A 4IYOB 3ZRRA 1DTYA 2EPJA 4KYOA 1C9CA 1WYTA 2ORDA 2VMWA 1QITA 1SF2A 3GBXA 3EI7A 1ZOBA 4TV7A 3RUYA 3N4SA 1IUGA 1LW5A 2AY7A 1IVRA 2VMSA 2ZUKA 3HLMA 4GE4A 3QN6A 3COGA 3RQ1A 1E5EA 1M0NA 4CXRA 1WSTA 5KTBA 5FT6A 1DGDA 1SZUA 4A6UA 4HVKA 1O4SA 1FC4A 3FCRA 1QJ3A 3G8MA 1AY8A 1C7GA 3HT4A 4K2IA 3WKSA 2BYJA 4F5IA 4UQVA 2Z9WA 4KAMA 2QB3A 3Q8NA 4Y0HA 3KKIA 4A0GA 2D7YA 2VMOA 2BWPA 4E3RA 1I43A 5IWQA 2OGAA 4AO4A 3ACZA 3H14A 4LNLA 5EQCA 1GDEA 4ZDPA 3DR4A 3BN1A 1ARGA 3NRAA 1I41A 1IX8A 4M2KA 3UWCA 1UKJA 1AHGA 1T3IA 2JJFA 2HZPA 2DGLA 1OHYA 1CL2A 1OXOA 2W8TA 1O69A 4XJOA 3II0A 1ECXA 3EIAA 4ADCA 5BJ3A 4W91A 3BWNC 3MAFA 5EUEA 3DC1A 1MDZA 3G7QA 1UU1A 1YNUA 4OTLA 2XBNA 3FKDA 2W7MA 1M4NA 2W8WA 1KKPA 3N4XA 2JJHA 2WK8A 1VEFA 3K7YA 1U08A 1AJSA 3GJUA 3NX3A 1KMJA 1WYUB 4JEYA 4UHOA 1ASGA 3PAAA 1CQ6A 1ZODA 1AIAA 1LKCA 1ARIA 1M6SA 2VI8A 3FVSA 5HXXA 2CFBA 3PD6B 1IX7A 4TN4A 2AY5A 1WKGA 3BCXA 4A72A 2W7KA 2W7GA 2EO5A 5EAVA 5D5SA 5M4BA 2FNUA 3DODA 3HL2A 3I16A 2VGSA 3JTXA 2KFPA 1SVVA 2ZP7A 4JF0A 3FRKA 4OC9A 4Q75A 1IJIA 4HF8A 2GMUA 3FVUA 2VMYA 3VOMA 2A1VA 2VLFA 4M2JA 3FFRA 1DGEA 4K2MA 1G4XA 2YKVA 1BJOA 4XJLA 1ELUA 4MGRA 3QHXA 1GEWA 5FT4A 4GEBA 4F5KA 4AOAA 3W1IA 4BA4A 2JJGA 1XI9A 3K28A 5EUNA 2VGVA 1O62A 4AZKA 4RLGA 4A0HA 1QZ9A 3DYDA 1AX4A 3E6GA 2HUIA 4WYFA 2OGEA 1OXPA 4RKDA 3QI6A 4F5JA 1BQAA 2CTZA 2FQ6A 4CBSA 4P3MA 1RV4A 3VK4A 4UOYA 1ARTA 2HUUA 1S08A 5EUDA 2Z9UA 3ZZJA 1AMRA 3FFHA 1GC3A 1W7MA 2WK9A 1WYVA 3LVKA 4XAUA 3L44A 4A0FA 4ATQA 3PDXA 1MLYA 1FG7A 4ZWVA 3B1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BMK A;  4IY7 A;  1QGN A;  1G7X A;  1WKH A;  3I4J A;  4W1W A;  2BIA A;  4JEW A;  1CQ7 A;  2HUF A;  4W5K A;  4QGR A;  4WXB A;  1DKA A;  4R8D A;  2W7H A;  3NUI A;  4N0W A;  1TOG A;  2YOB A;  3QPG A;  3FZ6 A;  1ARH A;  4R5Z A;  3DRD A;  2R0T A;  1IAY A;  2ZY4 A;  3A9X A;  1AKB A;  4E77 A;  3L8A A;  5I92 A;  3TAT A;  1PMM A;  1B5O A;  1LK9 A;  1TOI A;  3A8U X;  3TQX A;  3WCO A;  3PPL A;  1YIY A;  3WZF A;  3AEP A;  4ATP A;  1GD9 A;  3FZ7 A;  4EB7 A;  4ZSW A;  2BIE A;  4Y0D A;  4WYA A;  2QLR A;  2V1P A;  4WLH A;  3P1T A;  1AY4 A;  1KMK A;  2X8U A;  1BJN A;  1W7L A;  1E5F A;  4XK1 A;  3G0T A;  4ZAH A;  2E7U A;  2R5C A;  5DB5 A;  4CVQ A;  1ARS A;  2YHK A;  2BI3 A;  1BW0 A;  1YJS A;  4MQR A;  2YRR A;  3UE8 A;  3N5M A;  5DJ9 A;  2VMZ A;  1ASA A;  1G4V A;  2HOX A;  1Z3Z A;  3GSB A;  4A6R A;  1V2F A;  3QGU A;  3WY7 A;  5G4I A;  3RCH B;  1SZK A;  2E54 A;  2CAN A;  9AAT A;  2WKA A;  1B4X A;  3E2Z A;  3F6T A;  1V72 A;  2NMP A;  4EB5 A;  4A0R A;  4ITX A;  4EU1 A;  3NNK A;  3IHJ A;  1M0Q A;  2E7I A;  2ZY3 A;  2CJH A;  3ZRQ A;  2GSA A;  2AAT A;  3FDB A;  3HDO A;  2C81 A;  2GB3 A;  2AY4 A;  1PG8 A;  3R9A A;  2BKW A;  1AAW A;  1V2E A;  4AZJ A;  4GE7 A;  2C7T A;  3EI9 A;  4EMY A;  3VAX A;  3AEN A;  3E9K A;  3B8X A;  1N8P A;  1CS1 A;  1S09 A;  3EIB A;  4JE5 D;  3USF A;  2BI2 A;  3WCN A;  3ZRP A;  3IF2 A;  3FSL A;  2X3L A;  5G09 A;  4ADE A;  5E3K A;  1AHF A;  5DX5 A;  3EI8 A;  3OP7 A;  5TF5 A;  1SPA A;  4B9B A;  2VIB A;  2Z1Z A;  3WGC A;  1AJR A;  2E7J A;  3BCB A;  3PDB A;  2FN6 A;  3CQ6 A;  3NTJ A;  4FFC A;  2W7F A;  1M32 A;  2D61 A;  3CQ5 A;  3B1E A;  3DXW A;  3GWP A;  3AEJ A;  1AY5 A;  4H51 A;  2JIS A;  3DR7 A;  1YJY A;  4WB0 B;  3NU7 A;  3P6K A;  2OQX A;  1YAA A;  1TPL A;  1J04 A;  2JGT A;  2VMQ A;  1B5P A;  2W8V A;  1V2D A;  1S07 A;  3FQ7 A;  4GSA A;  3WKR A;  4BQ0 A;  2W7L A;  3GZD A;  4F5M A;  4K2B A;  3MC6 A;  4IYO A;  2G6W A;  4JEX A;  5EFS A;  4OYT A;  3A9Y A;  1W7N A;  2CH2 A;  4LW4 A;  3WGB A;  1J32 A;  3PIU A;  3LV2 A;  4RJ0 A;  1TAR A;  3EUC A;  1TOE A;  3AEM A;  5FT5 A;  4DBC A;  3NYS A;  2BHX A;  2VMR A;  4P7Y A;  1ZC9 A;  4RAE A;  2JJE A;  1AAM A;  1MDX A;  2W7J A;  1C7N A;  4R5F A;  3GR9 A;  4CBR A;  4RIZ A;  5C6U A;  4I8A A;  7AAT A;  4ISY A;  4RJY A;  4WP0 A;  3F9T A;  2R5E A;  2CST A;  2BI9 A;  2CB1 A;  1X28 A;  4RM1 A;  5E4Z A;  1MAP A;  4ZM4 A;  5F9S A;  1PMO A;  2Z9X A;  1QJ5 A;  3WLX A;  4UHM A;  3B1D A;  3LVM A;  2PB0 A;  3JWB A;  4IW7 A;  5G2Q A;  2W7I A;  2VLH A;  3DZZ A;  4ZM3 A;  1ORD A;  1C0N A;  1GC4 A;  1WYT B;  3BCA A;  3MC6 C;  4J8L A;  2YCT A;  1AIC A;  3PGY A;  2CY8 A;  2OKJ A;  2BWN A;  2AEU A;  4OBV A;  2YCN A;  1OHW A;  2VMX A;  3LY1 A;  2O0R A;  2F8J A;  2HOZ A;  3EZ1 A;  3NDN A;  1EG5 A;  2AY9 A;  4O6Z A;  4GDY A;  1TAS A;  1GC2 A;  2ZC0 A;  1LC7 A;  1VJO A;  3VP6 A;  3MAD A;  2BI5 A;  4RIT A;  1ASC A;  4N0B A;  2Q7W A;  1Y4I A;  2VMN A;  4ZDL A;  1Z7D A;  5F8V A;  1AHE A;  5J8Q A;  3AEO A;  4ADD A;  4MY5 A;  2BI1 A;  1JG8 A;  4WB0 A;  3RBL A;  1UU2 A;  2DOU A;  2VIA A;  4U1T A;  1JS3 A;  2DGM A;  1WYU A;  2VMU A;  4WD2 A;  1I29 A;  3R4T A;  1W23 A;  3N0L A;  5M49 A;  2GMS A;  1D7S A;  1EQB A;  3PD6 A;  1ASN A;  3LVL B;  5AX8 A;  1FG3 A;  3AAT A;  1B9I A;  1S06 A;  2X5F A;  2W8U A;  4WXF A;  2ZYJ A;  3EI5 A;  2FNI A;  1AMA A;  5LHA A;  3BV0 A;  5FT8 A;  2AY8 A;  2WK7 A;  5M46 A;  4JE5 A;  2HOR A;  4B98 A;  4A00 A;  1RVY A;  2BWO A;  3E2Y A;  4JEZ A;  4CXQ A;  3MAF B;  4M2M A;  5EIG B;  1D2F A;  2YCP A;  3ELP A;  3WX9 A;  4DGT A;  1JF9 A;  3A2B A;  3MEB A;  1BKG A;  3TFT A;  4WYC A;  1B8G A;  3OKS A;  3NYU A;  4ZDO A;  3GET A;  4WBT A;  3ZZK A;  1MDO A;  1O61 A;  2BYL A;  3ATH A;  4WYD A;  1AJS B;  4MKK A;  1ASD A;  3HBX A;  4KXK A;  5K8B A;  3BB8 A;  3FQ8 A;  2D7Z A;  1MGV A;  1LC8 A;  3W1H A;  1TAT A;  3AV7 A;  1RVU A;  1YJZ A;  1MAQ A;  2AY1 A;  2ZSL A;  3QM2 A;  1GEX A;  1S0A A;  3FTB A;  3KGX A;  3M5U A;  2VI9 A;  3CAI A;  2C0R A;  4JEV A;  1AHY A;  1X0M A;  3AOV A;  5G4J A;  4E3Q A;  1DJ9 A;  1QIS A;  4XJP A;  4TMR A;  2VGZ A;  1D7R A;  1AMS A;  4XQ2 A;  3PJ0 A;  2DKJ A;  3BWN A;  3KGW A;  4F4E A;  2AEV A;  1BQD A;  2D5Y A;  1YIZ A;  4LW2 A;  4OCA A;  2CH1 A;  1BJO B;  4Q76 A;  2EZ2 A;  2ZSM A;  4PFF A;  5EAA A;  3MBB A;  1VP4 A;  2ZY2 A;  2VMP A;  3HVY A;  2DR1 A;  2Z61 A;  1GEY A;  1KKJ A;  4PFN A;  4BHD A;  1IBJ A;  3DU4 A;  5D95 A;  3TFU A;  4F5H A;  3HQT A;  2Z9V A;  3ELE A;  1I48 A;  3LWS A;  4MSO A;  3CBF A;  2OAT A;  1TOK A;  4IXS A;  2V0Y A;  4XJM A;  2CJG A;  2VMV A;  2YRI A;  3AOW A;  4F5F A;  3BS8 A;  1GC0 A;  1P3W A;  4W1V A;  3BC8 A;  3CQ4 A;  1TOJ A;  4U2H A;  2VYC A;  3ISL A;  4A6T A;  3W1J A;  1RV3 A;  5BJ4 A;  4Q6R A;  1WYV B;  4ITG A;  4MQP A;  1AHX A;  2HOY A;  2YKX A;  5M4D A;  1M0O A;  2Z67 A;  4WYG A;  4JF1 A;  3TCM A;  4PIW A;  1LC5 A;  1H0C A;  1X2A A;  2PB2 A;  5LH9 A;  2GQN A;  3N75 A;  4IXZ A;  5EIG A;  3RI6 A;  2D65 A;  1C4K A;  4XEW A;  3ASA A;  3HMU A;  1SZS A;  2EGY A;  1CZC A;  1IX6 A;  2W7E A;  4ZWM A;  1OAT A;  2ZJG A;  1C7O A;  1MLZ A;  3RBF A;  3JZL A;  3BWO A;  3RCH A;  1IAX A;  1M0P A;  3EZS A;  2D63 A;  2BIG A;  5JAY A;  1AKA A;  4DQ6 A;  2QBT A;  2DGK A;  1PFF A;  3KE3 A;  3PA9 A;  3AEJ C;  4NOG A;  2DKB A;  2QA3 A;  4LNJ A;  3E77 A;  3UAK A;  4EFF A;  2TPL A;  4W8I A;  3NU8 A;  1YOO A;  3JWA A;  4MKJ A;  3FVX A;  2JG2 A;  4LC3 A;  1ELQ A;  2R5C B;  2FM1 A;  4AH3 A;  3LVJ A;  3MKJ A;  3T32 A;  3GZD C;  3AEL A;  1G7W A;  5HDM A;  1H1C A;  1DFO A;  1M7Y A;  4E1O A;  1D7U A;  1ASF A;  4RKC A;  5G0A A;  3MAU A;  8AAT A;  4Y0I A;  1ASE A;  2EH6 A;  1AIB A;  1KL2 A;  1BT4 A;  3B46 A;  1DJU A;  1BJW A;  1CZE A;  3E2F A;  3AEM C;  3H7F A;  2HP2 A;  1QIR A;  3F0H A;  3DXV A;  2R2N A;  3E2Z B;  5DJ1 A;  4IX8 A;  3FD0 A;  2C44 A;  3GZC A;  4WLJ A;  2AY6 A;  3FZ8 A;  2VMT A;  2D64 A;  2CJD A;  3JU7 A;  3VK3 A;  1XEY A;  2FYF A;  3NYT A;  2VGW A;  3ASB A;  1AKC A;  2QB2 A;  2VGT A;  1ASB A;  4L0O A;  2AY3 A;  2W7D A;  1UU0 A;  1ASM A;  3NUB A;  3VK2 A;  4ZSY A;  2O7C A;  4W1X A;  3AEN B;  2W8J A;  2VGU A;  3EI6 A;  2Z20 A;  3JW9 A;  3FDD A;  2OKK A;  4F5L A;  4Q31 A;  2Z1Y A;  1BJ4 A;  4PVF A;  5G2P A;  4GE9 A;  4IXO A;  3FQA A;  1KL1 A;  1AMQ A;  4BA5 A;  3A9Z A;  2PO3 A;  4FL0 A;  4F5G A;  1CQ8 A;  4OBU A;  1EJI A;  1LS3 A;  5HHY A;  2YKU A;  4OMA A;  2AY2 A;  3LG0 A;  1BS0 A;  3PDB B;  1OHV A;  1D7V A;  1N31 A;  1B9H A;  2YKY A;  5E5I A;  1SFF A;  3ECD A;  2ZY5 A;  4UHN A;  2EZ1 A;  1DJE A;  2RFV A;  4WYE A;  2CIN A;  2XH1 A;  2QMA A;  4MQQ A;  4ZAS A;  1N2T A;  1W3U A;  1GCK A;  4J5U A;  1CL1 A;  4AO9 A;  2X5D A;  3I5T A;  4WXG A;  2O1B A;  4GRX A;  3D6K A;  1LW4 A;  4LNM A;  1ASL A;  1CJ0 A;  4R2N A;  4ADB A;  2HP1 A;  3QBO A;  4ZLV A;  1X29 A;  1JS6 A;  2D66 A;  1GBN A;  3K40 A;  4OT8 A;  4IYO B;  3ZRR A;  1DTY A;  2EPJ A;  4KYO A;  1C9C A;  1WYT A;  2ORD A;  2VMW A;  1QIT A;  1SF2 A;  3GBX A;  3EI7 A;  1ZOB A;  4TV7 A;  3RUY A;  1IUG A;  1LW5 A;  2AY7 A;  1IVR A;  2VMS A;  2ZUK A;  3HLM A;  4GE4 A;  3QN6 A;  3COG A;  3RQ1 A;  1E5E A;  1M0N A;  4CXR A;  1WST A;  5FT6 A;  1DGD A;  1SZU A;  4A6U A;  4HVK A;  1O4S A;  1FC4 A;  3FCR A;  1QJ3 A;  3G8M A;  1AY8 A;  1C7G A;  3HT4 A;  4K2I A;  3WKS A;  2BYJ A;  4F5I A;  4UQV A;  2Z9W A;  4KAM A;  2QB3 A;  3Q8N A;  4Y0H A;  3KKI A;  4A0G A;  2D7Y A;  2VMO A;  2BWP A;  4E3R A;  1I43 A;  5IWQ A;  2OGA A;  4AO4 A;  3ACZ A;  3H14 A;  4LNL A;  5EQC A;  1GDE A;  4ZDP A;  3DR4 A;  3BN1 A;  1ARG A;  3NRA A;  1I41 A;  1IX8 A;  4M2K A;  3UWC A;  1UKJ A;  1AHG A;  1T3I A;  2JJF A;  2HZP A;  2DGL A;  1OHY A;  1CL2 A;  1OXO A;  2W8T A;  1O69 A;  4XJO A;  3II0 A;  1ECX A;  3EIA A;  4ADC A;  5BJ3 A;  4W91 A;  3BWN C;  3MAF A;  5EUE A;  3DC1 A;  1MDZ A;  3G7Q A;  1UU1 A;  1YNU A;  4OTL A;  2XBN A;  3FKD A;  2W7M A;  1M4N A;  2W8W A;  1KKP A;  2JJH A;  2WK8 A;  1VEF A;  3K7Y A;  1U08 A;  1AJS A;  3GJU A;  3NX3 A;  1KMJ A;  1WYU B;  4JEY A;  4UHO A;  1ASG A;  3PAA A;  1CQ6 A;  1ZOD A;  1AIA A;  1LKC A;  1ARI A;  1M6S A;  2VI8 A;  3FVS A;  5HXX A;  2CFB A;  3PD6 B;  1IX7 A;  4TN4 A;  2AY5 A;  1WKG A;  3BCX A;  4A72 A;  2W7K A;  2W7G A;  2EO5 A;  5EAV A;  5D5S A;  5M4B A;  2FNU A;  3DOD A;  3HL2 A;  3I16 A;  2VGS A;  3JTX A;  1SVV A;  2ZP7 A;  4JF0 A;  3FRK A;  4OC9 A;  4Q75 A;  1IJI A;  4HF8 A;  2GMU A;  3FVU A;  2VMY A;  3VOM A;  2VLF A;  4M2J A;  3FFR A;  1DGE A;  4K2M A;  1G4X A;  2YKV A;  1BJO A;  4XJL A;  1ELU A;  4MGR A;  3QHX A;  1GEW A;  5FT4 A;  4GEB A;  4F5K A;  4AOA A;  3W1I A;  4BA4 A;  2JJG A;  1XI9 A;  3K28 A;  5EUN A;  2VGV A;  1O62 A;  4AZK A;  4RLG A;  4A0H A;  1QZ9 A;  3DYD A;  1AX4 A;  3E6G A;  2HUI A;  4WYF A;  2OGE A;  1OXP A;  4RKD A;  3QI6 A;  4F5J A;  1BQA A;  2CTZ A;  2FQ6 A;  4CBS A;  4P3M A;  1RV4 A;  3VK4 A;  4UOY A;  1ART A;  2HUU A;  1S08 A;  5EUD A;  2Z9U A;  3ZZJ A;  1AMR A;  3FFH A;  1GC3 A;  1W7M A;  2WK9 A;  1WYV A;  3LVK A;  4XAU A;  3L44 A;  4A0F A;  4ATQ A;  3PDX A;  1MLY A;  1FG7 A;  4ZWV A;  3B1C A; 
#chains in the Genus database with same CATH topology
 4BMK A;  4IY7 A;  1QGN A;  1G7X A;  1WKH A;  3I4J A;  4W1W A;  2BIA A;  4JEW A;  1CQ7 A;  2HUF A;  4W5K A;  4QGR A;  3N7N A;  4WXB A;  1DKA A;  4R8D A;  2W7H A;  3NUI A;  4N0W A;  1TOG A;  2YOB A;  3QPG A;  3FZ6 A;  1ARH A;  4R5Z A;  3DRD A;  2R0T A;  1IAY A;  2FKI A;  2ZY4 A;  3A9X A;  1AKB A;  4E77 A;  3L8A A;  5I92 A;  3TAT A;  1PMM A;  1B5O A;  1LK9 A;  1TOI A;  3A8U X;  3TQX A;  3WCO A;  3PPL A;  1YIY A;  3WZF A;  3AEP A;  4ATP A;  1GD9 A;  3FZ7 A;  4EB7 A;  4ZSW A;  2BIE A;  4Y0D A;  4WYA A;  2QLR A;  2V1P A;  4WLH A;  3P1T A;  1AY4 A;  1KMK A;  2X8U A;  1BJN A;  1W7L A;  1E5F A;  4XK1 A;  3G0T A;  4ZAH A;  2E7U A;  2R5C A;  5DB5 A;  4CVQ A;  1ARS A;  2YHK A;  2BI3 A;  2EYQ A;  1BW0 A;  1YJS A;  4MQR A;  2YRR A;  3UE8 A;  3N5M A;  5DJ9 A;  2VMZ A;  1ASA A;  1G4V A;  2HOX A;  1Z3Z A;  3GSB A;  4A6R A;  1V2F A;  3QGU A;  3WY7 A;  5G4I A;  3RCH B;  1SZK A;  2E54 A;  2CAN A;  9AAT A;  2WKA A;  1B4X A;  3E2Z A;  3F6T A;  1V72 A;  2NMP A;  4EB5 A;  4A0R A;  4ITX A;  4EU1 A;  2G7J A;  3NNK A;  3IHJ A;  1M0Q A;  2E7I A;  2ZY3 A;  2CJH A;  3ZRQ A;  2GSA A;  2AAT A;  3FDB A;  3HDO A;  2C81 A;  2GB3 A;  2AY4 A;  1PG8 A;  3R9A A;  2BKW A;  1AAW A;  1V2E A;  4AZJ A;  4GE7 A;  2C7T A;  3EI9 A;  4EMY A;  3VAX A;  3AEN A;  3E9K A;  3B8X A;  1N8P A;  1CS1 A;  1S09 A;  3EIB A;  4JE5 D;  3USF A;  2BI2 A;  3WCN A;  3ZRP A;  3IF2 A;  3FSL A;  2X3L A;  5G09 A;  4ADE A;  5E3K A;  1AHF A;  5DX5 A;  3EI8 A;  3OP7 A;  5TF5 A;  1SPA A;  4B9B A;  2VIB A;  2Z1Z A;  3WGC A;  1AJR A;  2E7J A;  3BCB A;  3PDB A;  2FN6 A;  3CQ6 A;  3NTJ A;  4FFC A;  2W7F A;  1M32 A;  2D61 A;  3CQ5 A;  3B1E A;  3DXW A;  3GWP A;  3AEJ A;  1AY5 A;  4H51 A;  2JIS A;  3DR7 A;  1YJY A;  4WB0 B;  3NU7 A;  3P6K A;  2OQX A;  1YAA A;  1TPL A;  1J04 A;  2JGT A;  2VMQ A;  1B5P A;  2W8V A;  1V2D A;  1S07 A;  3FQ7 A;  4GSA A;  3WKR A;  4BQ0 A;  2W7L A;  3GZD A;  4F5M A;  4K2B A;  3MC6 A;  4IYO A;  2G6W A;  4JEX A;  5EFS A;  4OYT A;  3A9Y A;  1W7N A;  2CH2 A;  4LW4 A;  3WGB A;  1J32 A;  3PIU A;  3LV2 A;  4RJ0 A;  1TAR A;  3EUC A;  1TOE A;  3AEM A;  5FT5 A;  4DBC A;  3NYS A;  2BHX A;  2VMR A;  4P7Y A;  1ZC9 A;  4RAE A;  2JJE A;  1AAM A;  1MDX A;  2W7J A;  1C7N A;  4R5F A;  3GR9 A;  4CBR A;  4RIZ A;  5C6U A;  4I8A A;  7AAT A;  4ISY A;  4RJY A;  4WP0 A;  3F9T A;  2R5E A;  2CST A;  2BI9 A;  2CB1 A;  1X28 A;  4RM1 A;  5E4Z A;  1MAP A;  4ZM4 A;  5F9S A;  1PMO A;  2Z9X A;  1QJ5 A;  3WLX A;  4UHM A;  3B1D A;  3LVM A;  2PB0 A;  3JWB A;  4IW7 A;  5G2Q A;  2W7I A;  2VLH A;  3DZZ A;  4ZM3 A;  1ORD A;  1C0N A;  1GC4 A;  1WYT B;  3BCA A;  3MC6 C;  4J8L A;  2YCT A;  1AIC A;  3PGY A;  2CY8 A;  2OKJ A;  2BWN A;  2AEU A;  4OBV A;  2YCN A;  1OHW A;  2VMX A;  3LY1 A;  2O0R A;  2F8J A;  2HOZ A;  3EZ1 A;  3NDN A;  1EG5 A;  2AY9 A;  4O6Z A;  4H63 Q;  4GDY A;  1TAS A;  1GC2 A;  2ZC0 A;  1LC7 A;  1VJO A;  3VP6 A;  3MAD A;  2BI5 A;  4RIT A;  1ASC A;  4N0B A;  2Q7W A;  1Y4I A;  2VMN A;  4ZDL A;  1Z7D A;  5F8V A;  1AHE A;  5J8Q A;  3AEO A;  4ADD A;  4MY5 A;  2BI1 A;  1JG8 A;  4WB0 A;  3RBL A;  1UU2 A;  2DOU A;  2VIA A;  4U1T A;  1JS3 A;  2DGM A;  1WYU A;  2VMU A;  4WD2 A;  1I29 A;  3R4T A;  1W23 A;  3N0L A;  5M49 A;  2GMS A;  1D7S A;  1EQB A;  3PD6 A;  1ASN A;  3LVL B;  5AX8 A;  1FG3 A;  3AAT A;  1B9I A;  1S06 A;  2X5F A;  2W8U A;  4WXF A;  2ZYJ A;  3EI5 A;  2FNI A;  1AMA A;  5LHA A;  3BV0 A;  5FT8 A;  2AY8 A;  2WK7 A;  5M46 A;  4JE5 A;  2HOR A;  4B98 A;  4A00 A;  1RVY A;  2BWO A;  3E2Y A;  4JEZ A;  4CXQ A;  3MAF B;  4M2M A;  5EIG B;  1D2F A;  2YCP A;  3ELP A;  3WX9 A;  4DGT A;  1JF9 A;  3A2B A;  3MEB A;  1BKG A;  3TFT A;  4WYC A;  1B8G A;  3OKS A;  3NYU A;  4ZDO A;  3GET A;  4WBT A;  3ZZK A;  1MDO A;  1O61 A;  2BYL A;  3ATH A;  4WYD A;  1AJS B;  4MKK A;  1ASD A;  3HBX A;  4KXK A;  5K8B A;  3BB8 A;  3FQ8 A;  2D7Z A;  1MGV A;  1LC8 A;  3W1H A;  1TAT A;  3AV7 A;  1RVU A;  1YJZ A;  1MAQ A;  2AY1 A;  2ZSL A;  3QM2 A;  1GEX A;  1S0A A;  3FTB A;  3KGX A;  3M5U A;  2VI9 A;  3CAI A;  2C0R A;  4JEV A;  1AHY A;  1X0M A;  3AOV A;  5G4J A;  4E3Q A;  1DJ9 A;  1QIS A;  4XJP A;  4TMR A;  2VGZ A;  1D7R A;  1AMS A;  4XQ2 A;  3PJ0 A;  2DKJ A;  3BWN A;  3KGW A;  4F4E A;  2AEV A;  1BQD A;  2D5Y A;  1YIZ A;  4LW2 A;  4OCA A;  2CH1 A;  1BJO B;  4Q76 A;  2EZ2 A;  2ZSM A;  4PFF A;  5EAA A;  3MBB A;  1VP4 A;  2ZY2 A;  2VMP A;  3HVY A;  2DR1 A;  2Z61 A;  1GEY A;  1KKJ A;  4PFN A;  4BHD A;  1IBJ A;  3DU4 A;  5D95 A;  3TFU A;  4F5H A;  3HQT A;  2Z9V A;  3ELE A;  1I48 A;  3LWS A;  4MSO A;  3CBF A;  2OAT A;  1TOK A;  4IXS A;  2V0Y A;  4XJM A;  2CJG A;  2VMV A;  2YRI A;  3AOW A;  4F5F A;  3BS8 A;  1GC0 A;  1P3W A;  4W1V A;  3BC8 A;  3CQ4 A;  1TOJ A;  4U2H A;  2VYC A;  3ISL A;  4A6T A;  3W1J A;  1RV3 A;  5BJ4 A;  4Q6R A;  1WYV B;  4ITG A;  4MQP A;  1AHX A;  2HOY A;  2YKX A;  5M4D A;  1M0O A;  2Z67 A;  4WYG A;  4JF1 A;  3TCM A;  4PIW A;  1LC5 A;  1H0C A;  1X2A A;  2PB2 A;  5LH9 A;  2GQN A;  3N75 A;  4IXZ A;  5EIG A;  3RI6 A;  2D65 A;  1C4K A;  4XEW A;  3ASA A;  3HMU A;  1SZS A;  2EGY A;  1CZC A;  1IX6 A;  2W7E A;  4ZWM A;  1OAT A;  2ZJG A;  1C7O A;  1MLZ A;  3RBF A;  3JZL A;  3BWO A;  3RCH A;  1IAX A;  1M0P A;  3EZS A;  2D63 A;  2BIG A;  5JAY A;  1AKA A;  4DQ6 A;  2QBT A;  2DGK A;  3N4R A;  1PFF A;  3KE3 A;  3PA9 A;  3AEJ C;  4NOG A;  2DKB A;  2QA3 A;  4LNJ A;  3E77 A;  3UAK A;  4EFF A;  2TPL A;  1KAF A;  4W8I A;  3NU8 A;  1YOO A;  3JWA A;  4MKJ A;  3FVX A;  2JG2 A;  4LC3 A;  1ELQ A;  2R5C B;  2FM1 A;  4AH3 A;  3LVJ A;  3MKJ A;  3T32 A;  3GZD C;  3AEL A;  1G7W A;  2QSR A;  5HDM A;  3H9X A;  1H1C A;  1DFO A;  1M7Y A;  4E1O A;  1D7U A;  1ASF A;  4RKC A;  5G0A A;  3MAU A;  8AAT A;  4Y0I A;  1ASE A;  2EH6 A;  1AIB A;  1KL2 A;  1BT4 A;  3B46 A;  1DJU A;  1BJW A;  2WB6 A;  1CZE A;  3E2F A;  3AEM C;  3H7F A;  2HP2 A;  1QIR A;  3F0H A;  3DXV A;  2R2N A;  3E2Z B;  5DJ1 A;  4IX8 A;  3FD0 A;  2C44 A;  3GZC A;  4WLJ A;  2AY6 A;  3FZ8 A;  2VMT A;  2D64 A;  2CJD A;  3JU7 A;  3VK3 A;  1XEY A;  2FYF A;  3NYT A;  2VGW A;  3ASB A;  1AKC A;  2QB2 A;  2VGT A;  1ASB A;  4L0O A;  2AY3 A;  2W7D A;  1UU0 A;  1ASM A;  3NUB A;  3VK2 A;  4ZSY A;  2O7C A;  4W1X A;  3AEN B;  2W8J A;  2VGU A;  3EI6 A;  2Z20 A;  3JW9 A;  3FDD A;  2OKK A;  4F5L A;  4Q31 A;  2Z1Y A;  1BJ4 A;  4PVF A;  5G2P A;  4GE9 A;  4IXO A;  3FQA A;  1KL1 A;  1AMQ A;  4BA5 A;  3A9Z A;  2PO3 A;  4FL0 A;  4F5G A;  1CQ8 A;  4OBU A;  1EJI A;  1LS3 A;  5HHY A;  2YKU A;  4OMA A;  2AY2 A;  3LG0 A;  1BS0 A;  3PDB B;  1OHV A;  1D7V A;  1N31 A;  1B9H A;  2YKY A;  5E5I A;  1SFF A;  3ECD A;  2ZY5 A;  4UHN A;  2EZ1 A;  1DJE A;  2RFV A;  4WYE A;  2CIN A;  2XH1 A;  2QMA A;  4MQQ A;  4ZAS A;  1N2T A;  1W3U A;  1GCK A;  4J5U A;  1CL1 A;  4AO9 A;  4K05 A;  2X5D A;  3I5T A;  4WXG A;  2O1B A;  4GRX A;  3D6K A;  1LW4 A;  4LNM A;  1ASL A;  1CJ0 A;  4R2N A;  4ADB A;  2HP1 A;  3QBO A;  4ZLV A;  1X29 A;  1JS6 A;  2D66 A;  1GBN A;  3K40 A;  4OT8 A;  4IYO B;  3ZRR A;  1DTY A;  2EPJ A;  4KYO A;  1C9C A;  1WYT A;  2ORD A;  2VMW A;  1QIT A;  1SF2 A;  3GBX A;  3EI7 A;  1ZOB A;  4TV7 A;  3RUY A;  3N4S A;  1IUG A;  1LW5 A;  2AY7 A;  1IVR A;  2VMS A;  2ZUK A;  3HLM A;  4GE4 A;  3QN6 A;  3COG A;  3RQ1 A;  1E5E A;  1M0N A;  4CXR A;  1WST A;  5KTB A;  5FT6 A;  1DGD A;  1SZU A;  4A6U A;  4HVK A;  1O4S A;  1FC4 A;  3FCR A;  1QJ3 A;  3G8M A;  1AY8 A;  1C7G A;  3HT4 A;  4K2I A;  3WKS A;  2BYJ A;  4F5I A;  4UQV A;  2Z9W A;  4KAM A;  2QB3 A;  3Q8N A;  4Y0H A;  3KKI A;  4A0G A;  2D7Y A;  2VMO A;  2BWP A;  4E3R A;  1I43 A;  5IWQ A;  2OGA A;  4AO4 A;  3ACZ A;  3H14 A;  4LNL A;  5EQC A;  1GDE A;  4ZDP A;  3DR4 A;  3BN1 A;  1ARG A;  3NRA A;  1I41 A;  1IX8 A;  4M2K A;  3UWC A;  1UKJ A;  1AHG A;  1T3I A;  2JJF A;  2HZP A;  2DGL A;  1OHY A;  1CL2 A;  1OXO A;  2W8T A;  1O69 A;  4XJO A;  3II0 A;  1ECX A;  3EIA A;  4ADC A;  5BJ3 A;  4W91 A;  3BWN C;  3MAF A;  5EUE A;  3DC1 A;  1MDZ A;  3G7Q A;  1UU1 A;  1YNU A;  4OTL A;  2XBN A;  3FKD A;  2W7M A;  1M4N A;  2W8W A;  1KKP A;  3N4X A;  2JJH A;  2WK8 A;  1VEF A;  3K7Y A;  1U08 A;  1AJS A;  3GJU A;  3NX3 A;  1KMJ A;  1WYU B;  4JEY A;  4UHO A;  1ASG A;  3PAA A;  1CQ6 A;  1ZOD A;  1AIA A;  1LKC A;  1ARI A;  1M6S A;  2VI8 A;  3FVS A;  5HXX A;  2CFB A;  3PD6 B;  1IX7 A;  4TN4 A;  2AY5 A;  1WKG A;  3BCX A;  4A72 A;  2W7K A;  2W7G A;  2EO5 A;  5EAV A;  5D5S A;  5M4B A;  2FNU A;  3DOD A;  3HL2 A;  3I16 A;  2VGS A;  3JTX A;  2KFP A;  1SVV A;  2ZP7 A;  4JF0 A;  3FRK A;  4OC9 A;  4Q75 A;  1IJI A;  4HF8 A;  2GMU A;  3FVU A;  2VMY A;  3VOM A;  2A1V A;  2VLF A;  4M2J A;  3FFR A;  1DGE A;  4K2M A;  1G4X A;  2YKV A;  1BJO A;  4XJL A;  1ELU A;  4MGR A;  3QHX A;  1GEW A;  5FT4 A;  4GEB A;  4F5K A;  4AOA A;  3W1I A;  4BA4 A;  2JJG A;  1XI9 A;  3K28 A;  5EUN A;  2VGV A;  1O62 A;  4AZK A;  4RLG A;  4A0H A;  1QZ9 A;  3DYD A;  1AX4 A;  3E6G A;  2HUI A;  4WYF A;  2OGE A;  1OXP A;  4RKD A;  3QI6 A;  4F5J A;  1BQA A;  2CTZ A;  2FQ6 A;  4CBS A;  4P3M A;  1RV4 A;  3VK4 A;  4UOY A;  1ART A;  2HUU A;  1S08 A;  5EUD A;  2Z9U A;  3ZZJ A;  1AMR A;  3FFH A;  1GC3 A;  1W7M A;  2WK9 A;  1WYV A;  3LVK A;  4XAU A;  3L44 A;  4A0F A;  4ATQ A;  3PDX A;  1MLY A;  1FG7 A;  4ZWV A;  3B1C A; 
#chains in the Genus database with same CATH homology
 4BMK A;  4IY7 A;  1QGN A;  1G7X A;  1WKH A;  3I4J A;  4W1W A;  2BIA A;  4JEW A;  1CQ7 A;  2HUF A;  4W5K A;  4QGR A;  3N7N A;  4WXB A;  1DKA A;  4R8D A;  2W7H A;  3NUI A;  4N0W A;  1TOG A;  2YOB A;  3QPG A;  3FZ6 A;  1ARH A;  4R5Z A;  3DRD A;  2R0T A;  1IAY A;  2FKI A;  2ZY4 A;  3A9X A;  1AKB A;  4E77 A;  3L8A A;  5I92 A;  3TAT A;  1PMM A;  1B5O A;  1LK9 A;  1TOI A;  3A8U X;  3TQX A;  3WCO A;  3PPL A;  1YIY A;  3WZF A;  3AEP A;  4ATP A;  1GD9 A;  3FZ7 A;  4EB7 A;  4ZSW A;  2BIE A;  4Y0D A;  4WYA A;  2QLR A;  2V1P A;  4WLH A;  3P1T A;  1AY4 A;  1KMK A;  2X8U A;  1BJN A;  1W7L A;  1E5F A;  4XK1 A;  3G0T A;  4ZAH A;  2E7U A;  2R5C A;  5DB5 A;  4CVQ A;  1ARS A;  2YHK A;  2BI3 A;  2EYQ A;  1BW0 A;  1YJS A;  4MQR A;  2YRR A;  3UE8 A;  3N5M A;  5DJ9 A;  2VMZ A;  1ASA A;  1G4V A;  2HOX A;  1Z3Z A;  3GSB A;  4A6R A;  1V2F A;  3QGU A;  3WY7 A;  5G4I A;  3RCH B;  1SZK A;  2E54 A;  2CAN A;  9AAT A;  2WKA A;  1B4X A;  3E2Z A;  3F6T A;  1V72 A;  2NMP A;  4EB5 A;  4A0R A;  4ITX A;  4EU1 A;  2G7J A;  3NNK A;  3IHJ A;  1M0Q A;  2E7I A;  2ZY3 A;  2CJH A;  3ZRQ A;  2GSA A;  2AAT A;  3FDB A;  3HDO A;  2C81 A;  2GB3 A;  2AY4 A;  1PG8 A;  3R9A A;  2BKW A;  1AAW A;  1V2E A;  4AZJ A;  4GE7 A;  2C7T A;  3EI9 A;  4EMY A;  3VAX A;  3AEN A;  3E9K A;  3B8X A;  1N8P A;  1CS1 A;  1S09 A;  3EIB A;  4JE5 D;  3USF A;  2BI2 A;  3WCN A;  3ZRP A;  3IF2 A;  3FSL A;  2X3L A;  5G09 A;  4ADE A;  5E3K A;  1AHF A;  5DX5 A;  3EI8 A;  3OP7 A;  5TF5 A;  1SPA A;  4B9B A;  2VIB A;  2Z1Z A;  3WGC A;  1AJR A;  2E7J A;  3BCB A;  3PDB A;  2FN6 A;  3CQ6 A;  3NTJ A;  4FFC A;  2W7F A;  1M32 A;  2D61 A;  3CQ5 A;  3B1E A;  3DXW A;  3GWP A;  3AEJ A;  1AY5 A;  4H51 A;  2JIS A;  3DR7 A;  1YJY A;  4WB0 B;  3NU7 A;  3P6K A;  2OQX A;  1YAA A;  1TPL A;  1J04 A;  2JGT A;  2VMQ A;  1B5P A;  2W8V A;  1V2D A;  1S07 A;  3FQ7 A;  4GSA A;  3WKR A;  4BQ0 A;  2W7L A;  3GZD A;  4F5M A;  4K2B A;  3MC6 A;  4IYO A;  2G6W A;  4JEX A;  5EFS A;  4OYT A;  3A9Y A;  1W7N A;  2CH2 A;  4LW4 A;  3WGB A;  1J32 A;  3PIU A;  3LV2 A;  4RJ0 A;  1TAR A;  3EUC A;  1TOE A;  3AEM A;  5FT5 A;  4DBC A;  3NYS A;  2BHX A;  2VMR A;  4P7Y A;  1ZC9 A;  4RAE A;  2JJE A;  1AAM A;  1MDX A;  2W7J A;  1C7N A;  4R5F A;  3GR9 A;  4CBR A;  4RIZ A;  5C6U A;  4I8A A;  7AAT A;  4ISY A;  4RJY A;  4WP0 A;  3F9T A;  2R5E A;  2CST A;  2BI9 A;  2CB1 A;  1X28 A;  4RM1 A;  5E4Z A;  1MAP A;  4ZM4 A;  5F9S A;  1PMO A;  2Z9X A;  1QJ5 A;  3WLX A;  4UHM A;  3B1D A;  3LVM A;  2PB0 A;  3JWB A;  4IW7 A;  5G2Q A;  2W7I A;  2VLH A;  3DZZ A;  4ZM3 A;  1ORD A;  1C0N A;  1GC4 A;  1WYT B;  3BCA A;  3MC6 C;  4J8L A;  2YCT A;  1AIC A;  3PGY A;  2CY8 A;  2OKJ A;  2BWN A;  2AEU A;  4OBV A;  2YCN A;  1OHW A;  2VMX A;  3LY1 A;  2O0R A;  2F8J A;  2HOZ A;  3EZ1 A;  3NDN A;  1EG5 A;  2AY9 A;  4O6Z A;  4H63 Q;  4GDY A;  1TAS A;  1GC2 A;  2ZC0 A;  1LC7 A;  1VJO A;  3VP6 A;  3MAD A;  2BI5 A;  4RIT A;  1ASC A;  4N0B A;  2Q7W A;  1Y4I A;  2VMN A;  4ZDL A;  1Z7D A;  5F8V A;  1AHE A;  5J8Q A;  3AEO A;  4ADD A;  4MY5 A;  2BI1 A;  1JG8 A;  4WB0 A;  3RBL A;  1UU2 A;  2DOU A;  2VIA A;  4U1T A;  1JS3 A;  2DGM A;  1WYU A;  2VMU A;  4WD2 A;  1I29 A;  3R4T A;  1W23 A;  3N0L A;  5M49 A;  2GMS A;  1D7S A;  1EQB A;  3PD6 A;  1ASN A;  3LVL B;  5AX8 A;  1FG3 A;  3AAT A;  1B9I A;  1S06 A;  2X5F A;  2W8U A;  4WXF A;  2ZYJ A;  3EI5 A;  2FNI A;  1AMA A;  5LHA A;  3BV0 A;  5FT8 A;  2AY8 A;  2WK7 A;  5M46 A;  4JE5 A;  2HOR A;  4B98 A;  4A00 A;  1RVY A;  2BWO A;  3E2Y A;  4JEZ A;  4CXQ A;  3MAF B;  4M2M A;  5EIG B;  1D2F A;  2YCP A;  3ELP A;  3WX9 A;  4DGT A;  1JF9 A;  3A2B A;  3MEB A;  1BKG A;  3TFT A;  4WYC A;  1B8G A;  3OKS A;  3NYU A;  4ZDO A;  3GET A;  4WBT A;  3ZZK A;  1MDO A;  1O61 A;  2BYL A;  3ATH A;  4WYD A;  1AJS B;  4MKK A;  1ASD A;  3HBX A;  4KXK A;  5K8B A;  3BB8 A;  3FQ8 A;  2D7Z A;  1MGV A;  1LC8 A;  3W1H A;  1TAT A;  3AV7 A;  1RVU A;  1YJZ A;  1MAQ A;  2AY1 A;  2ZSL A;  3QM2 A;  1GEX A;  1S0A A;  3FTB A;  3KGX A;  3M5U A;  2VI9 A;  3CAI A;  2C0R A;  4JEV A;  1AHY A;  1X0M A;  3AOV A;  5G4J A;  4E3Q A;  1DJ9 A;  1QIS A;  4XJP A;  4TMR A;  2VGZ A;  1D7R A;  1AMS A;  4XQ2 A;  3PJ0 A;  2DKJ A;  3BWN A;  3KGW A;  4F4E A;  2AEV A;  1BQD A;  2D5Y A;  1YIZ A;  4LW2 A;  4OCA A;  2CH1 A;  1BJO B;  4Q76 A;  2EZ2 A;  2ZSM A;  4PFF A;  5EAA A;  3MBB A;  1VP4 A;  2ZY2 A;  2VMP A;  3HVY A;  2DR1 A;  2Z61 A;  1GEY A;  1KKJ A;  4PFN A;  4BHD A;  1IBJ A;  3DU4 A;  5D95 A;  3TFU A;  4F5H A;  3HQT A;  2Z9V A;  3ELE A;  1I48 A;  3LWS A;  4MSO A;  3CBF A;  2OAT A;  1TOK A;  4IXS A;  2V0Y A;  4XJM A;  2CJG A;  2VMV A;  2YRI A;  3AOW A;  4F5F A;  3BS8 A;  1GC0 A;  1P3W A;  4W1V A;  3BC8 A;  3CQ4 A;  1TOJ A;  4U2H A;  2VYC A;  3ISL A;  4A6T A;  3W1J A;  1RV3 A;  5BJ4 A;  4Q6R A;  1WYV B;  4ITG A;  4MQP A;  1AHX A;  2HOY A;  2YKX A;  5M4D A;  1M0O A;  2Z67 A;  4WYG A;  4JF1 A;  3TCM A;  4PIW A;  1LC5 A;  1H0C A;  1X2A A;  2PB2 A;  5LH9 A;  2GQN A;  3N75 A;  4IXZ A;  5EIG A;  3RI6 A;  2D65 A;  1C4K A;  4XEW A;  3ASA A;  3HMU A;  1SZS A;  2EGY A;  1CZC A;  1IX6 A;  2W7E A;  4ZWM A;  1OAT A;  2ZJG A;  1C7O A;  1MLZ A;  3RBF A;  3JZL A;  3BWO A;  3RCH A;  1IAX A;  1M0P A;  3EZS A;  2D63 A;  2BIG A;  5JAY A;  1AKA A;  4DQ6 A;  2QBT A;  2DGK A;  3N4R A;  1PFF A;  3KE3 A;  3PA9 A;  3AEJ C;  4NOG A;  2DKB A;  2QA3 A;  4LNJ A;  3E77 A;  3UAK A;  4EFF A;  2TPL A;  4W8I A;  3NU8 A;  1YOO A;  3JWA A;  4MKJ A;  3FVX A;  2JG2 A;  4LC3 A;  1ELQ A;  2R5C B;  2FM1 A;  4AH3 A;  3LVJ A;  3MKJ A;  3T32 A;  3GZD C;  3AEL A;  1G7W A;  2QSR A;  5HDM A;  3H9X A;  1H1C A;  1DFO A;  1M7Y A;  4E1O A;  1D7U A;  1ASF A;  4RKC A;  5G0A A;  3MAU A;  8AAT A;  4Y0I A;  1ASE A;  2EH6 A;  1AIB A;  1KL2 A;  1BT4 A;  3B46 A;  1DJU A;  1BJW A;  2WB6 A;  1CZE A;  3E2F A;  3AEM C;  3H7F A;  2HP2 A;  1QIR A;  3F0H A;  3DXV A;  2R2N A;  3E2Z B;  5DJ1 A;  4IX8 A;  3FD0 A;  2C44 A;  3GZC A;  4WLJ A;  2AY6 A;  3FZ8 A;  2VMT A;  2D64 A;  2CJD A;  3JU7 A;  3VK3 A;  1XEY A;  2FYF A;  3NYT A;  2VGW A;  3ASB A;  1AKC A;  2QB2 A;  2VGT A;  1ASB A;  4L0O A;  2AY3 A;  2W7D A;  1UU0 A;  1ASM A;  3NUB A;  3VK2 A;  4ZSY A;  2O7C A;  4W1X A;  3AEN B;  2W8J A;  2VGU A;  3EI6 A;  2Z20 A;  3JW9 A;  3FDD A;  2OKK A;  4F5L A;  4Q31 A;  2Z1Y A;  1BJ4 A;  4PVF A;  5G2P A;  4GE9 A;  4IXO A;  3FQA A;  1KL1 A;  1AMQ A;  4BA5 A;  3A9Z A;  2PO3 A;  4FL0 A;  4F5G A;  1CQ8 A;  4OBU A;  1EJI A;  1LS3 A;  5HHY A;  2YKU A;  4OMA A;  2AY2 A;  3LG0 A;  1BS0 A;  3PDB B;  1OHV A;  1D7V A;  1N31 A;  1B9H A;  2YKY A;  5E5I A;  1SFF A;  3ECD A;  2ZY5 A;  4UHN A;  2EZ1 A;  1DJE A;  2RFV A;  4WYE A;  2CIN A;  2XH1 A;  2QMA A;  4MQQ A;  4ZAS A;  1N2T A;  1W3U A;  1GCK A;  4J5U A;  1CL1 A;  4AO9 A;  4K05 A;  2X5D A;  3I5T A;  4WXG A;  2O1B A;  4GRX A;  3D6K A;  1LW4 A;  4LNM A;  1ASL A;  1CJ0 A;  4R2N A;  4ADB A;  2HP1 A;  3QBO A;  4ZLV A;  1X29 A;  1JS6 A;  2D66 A;  1GBN A;  3K40 A;  4OT8 A;  4IYO B;  3ZRR A;  1DTY A;  2EPJ A;  4KYO A;  1C9C A;  1WYT A;  2ORD A;  2VMW A;  1QIT A;  1SF2 A;  3GBX A;  3EI7 A;  1ZOB A;  4TV7 A;  3RUY A;  3N4S A;  1IUG A;  1LW5 A;  2AY7 A;  1IVR A;  2VMS A;  2ZUK A;  3HLM A;  4GE4 A;  3QN6 A;  3COG A;  3RQ1 A;  1E5E A;  1M0N A;  4CXR A;  1WST A;  5KTB A;  5FT6 A;  1DGD A;  1SZU A;  4A6U A;  4HVK A;  1O4S A;  1FC4 A;  3FCR A;  1QJ3 A;  3G8M A;  1AY8 A;  1C7G A;  3HT4 A;  4K2I A;  3WKS A;  2BYJ A;  4F5I A;  4UQV A;  2Z9W A;  4KAM A;  2QB3 A;  3Q8N A;  4Y0H A;  3KKI A;  4A0G A;  2D7Y A;  2VMO A;  2BWP A;  4E3R A;  1I43 A;  5IWQ A;  2OGA A;  4AO4 A;  3ACZ A;  3H14 A;  4LNL A;  5EQC A;  1GDE A;  4ZDP A;  3DR4 A;  3BN1 A;  1ARG A;  3NRA A;  1I41 A;  1IX8 A;  4M2K A;  3UWC A;  1UKJ A;  1AHG A;  1T3I A;  2JJF A;  2HZP A;  2DGL A;  1OHY A;  1CL2 A;  1OXO A;  2W8T A;  1O69 A;  4XJO A;  3II0 A;  1ECX A;  3EIA A;  4ADC A;  5BJ3 A;  4W91 A;  3BWN C;  3MAF A;  5EUE A;  3DC1 A;  1MDZ A;  3G7Q A;  1UU1 A;  1YNU A;  4OTL A;  2XBN A;  3FKD A;  2W7M A;  1M4N A;  2W8W A;  1KKP A;  3N4X A;  2JJH A;  2WK8 A;  1VEF A;  3K7Y A;  1U08 A;  1AJS A;  3GJU A;  3NX3 A;  1KMJ A;  1WYU B;  4JEY A;  4UHO A;  1ASG A;  3PAA A;  1CQ6 A;  1ZOD A;  1AIA A;  1LKC A;  1ARI A;  1M6S A;  2VI8 A;  3FVS A;  5HXX A;  2CFB A;  3PD6 B;  1IX7 A;  4TN4 A;  2AY5 A;  1WKG A;  3BCX A;  4A72 A;  2W7K A;  2W7G A;  2EO5 A;  5EAV A;  5D5S A;  5M4B A;  2FNU A;  3DOD A;  3HL2 A;  3I16 A;  2VGS A;  3JTX A;  2KFP A;  1SVV A;  2ZP7 A;  4JF0 A;  3FRK A;  4OC9 A;  4Q75 A;  1IJI A;  4HF8 A;  2GMU A;  3FVU A;  2VMY A;  3VOM A;  2A1V A;  2VLF A;  4M2J A;  3FFR A;  1DGE A;  4K2M A;  1G4X A;  2YKV A;  1BJO A;  4XJL A;  1ELU A;  4MGR A;  3QHX A;  1GEW A;  5FT4 A;  4GEB A;  4F5K A;  4AOA A;  3W1I A;  4BA4 A;  2JJG A;  1XI9 A;  3K28 A;  5EUN A;  2VGV A;  1O62 A;  4AZK A;  4RLG A;  4A0H A;  1QZ9 A;  3DYD A;  1AX4 A;  3E6G A;  2HUI A;  4WYF A;  2OGE A;  1OXP A;  4RKD A;  3QI6 A;  4F5J A;  1BQA A;  2CTZ A;  2FQ6 A;  4CBS A;  4P3M A;  1RV4 A;  3VK4 A;  4UOY A;  1ART A;  2HUU A;  1S08 A;  5EUD A;  2Z9U A;  3ZZJ A;  1AMR A;  3FFH A;  1GC3 A;  1W7M A;  2WK9 A;  1WYV A;  3LVK A;  4XAU A;  3L44 A;  4A0F A;  4ATQ A;  3PDX A;  1MLY A;  1FG7 A;  4ZWV A;  3B1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...